BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS097A10

Length=490
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KCW89755.1|  hypothetical protein EUGRSUZ_A02017                   71.2    8e-17   Eucalyptus grandis [rose gum]
ref|XP_010053830.1|  PREDICTED: protein VACUOLELESS1                  71.2    8e-17   Eucalyptus grandis [rose gum]
ref|XP_009133226.1|  PREDICTED: protein VACUOLELESS1                  64.7    6e-15   Brassica rapa
ref|XP_009625096.1|  PREDICTED: protein VACUOLELESS1                  77.0    4e-13   Nicotiana tomentosiformis
ref|XP_006348963.1|  PREDICTED: vacuolar protein sorting-associat...  77.0    4e-13   
ref|XP_004243213.1|  PREDICTED: protein VACUOLELESS1                  75.5    2e-12   Solanum lycopersicum
ref|XP_009790374.1|  PREDICTED: protein VACUOLELESS1                  74.7    3e-12   Nicotiana sylvestris
ref|XP_010681470.1|  PREDICTED: protein VACUOLELESS1                  73.2    8e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004144632.1|  PREDICTED: vacuolar protein sorting-associat...  73.2    9e-12   Cucumis sativus [cucumbers]
ref|XP_008465445.1|  PREDICTED: protein VACUOLELESS1                  72.8    1e-11   Cucumis melo [Oriental melon]
gb|KDP24238.1|  hypothetical protein JCGZ_26643                       72.8    1e-11   Jatropha curcas
gb|KJB10620.1|  hypothetical protein B456_001G211500                  71.2    4e-11   Gossypium raimondii
gb|KJB10616.1|  hypothetical protein B456_001G211500                  71.2    4e-11   Gossypium raimondii
gb|KJB10618.1|  hypothetical protein B456_001G211500                  71.2    4e-11   Gossypium raimondii
gb|KJB10617.1|  hypothetical protein B456_001G211500                  70.9    4e-11   Gossypium raimondii
gb|EPS58563.1|  hypothetical protein M569_16250                       68.6    4e-11   Genlisea aurea
gb|KHG27227.1|  Vacuolar sorting-associated protein 16                70.9    5e-11   Gossypium arboreum [tree cotton]
gb|KJB10619.1|  hypothetical protein B456_001G211500                  70.5    5e-11   Gossypium raimondii
ref|XP_002302135.2|  MANGLED family protein                           68.9    2e-10   
ref|XP_011026232.1|  PREDICTED: protein VACUOLELESS1-like isoform X1  68.9    2e-10   Populus euphratica
ref|XP_010557595.1|  PREDICTED: protein VACUOLELESS1                  68.6    3e-10   Tarenaya hassleriana [spider flower]
gb|KDO51890.1|  hypothetical protein CISIN_1g003205mg                 68.2    3e-10   Citrus sinensis [apfelsine]
gb|KDO51887.1|  hypothetical protein CISIN_1g003205mg                 68.2    4e-10   Citrus sinensis [apfelsine]
ref|XP_007048987.1|  Vacuoleless1 (VCL1) isoform 3                    68.2    4e-10   
ref|XP_006437140.1|  hypothetical protein CICLE_v10030701mg           68.2    4e-10   Citrus clementina [clementine]
ref|XP_007048986.1|  Vacuoleless1 (VCL1) isoform 2                    68.2    4e-10   
ref|XP_007048985.1|  Vacuoleless1 (VCL1) isoform 1                    67.8    5e-10   
ref|XP_002526647.1|  vacuolar protein sorting vps16, putative         67.4    6e-10   Ricinus communis
ref|XP_011044765.1|  PREDICTED: protein VACUOLELESS1-like             67.4    7e-10   Populus euphratica
ref|XP_002283428.1|  PREDICTED: protein VACUOLELESS1                  67.4    7e-10   Vitis vinifera
ref|XP_002306748.1|  MANGLED family protein                           66.6    1e-09   
ref|XP_011082899.1|  PREDICTED: protein VACUOLELESS1                  66.2    1e-09   Sesamum indicum [beniseed]
ref|XP_002881559.1|  hypothetical protein ARALYDRAFT_321506           66.2    2e-09   Arabidopsis lyrata subsp. lyrata
dbj|BAJ33734.1|  unnamed protein product                              65.9    2e-09   Eutrema halophilum
ref|XP_006411003.1|  hypothetical protein EUTSA_v10016232mg           65.9    2e-09   Eutrema salsugineum [saltwater cress]
ref|XP_010087860.1|  Vacuolar protein sorting-associated protein ...  65.9    2e-09   Morus notabilis
ref|XP_006296131.1|  hypothetical protein CARUB_v10025283mg           65.5    3e-09   Capsella rubella
ref|NP_565879.1|  vacuoleless1                                        65.1    4e-09   Arabidopsis thaliana [mouse-ear cress]
emb|CDY07756.1|  BnaA03g17550D                                        64.7    5e-09   Brassica napus [oilseed rape]
emb|CDY14496.1|  BnaC03g20990D                                        64.7    5e-09   Brassica napus [oilseed rape]
ref|NP_001078020.1|  vacuoleless1                                     64.7    5e-09   Arabidopsis thaliana [mouse-ear cress]
gb|EYU33990.1|  hypothetical protein MIMGU_mgv1a001320mg              64.7    5e-09   Erythranthe guttata [common monkey flower]
ref|XP_010505412.1|  PREDICTED: protein VACUOLELESS1-like             64.7    6e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010509236.1|  PREDICTED: protein VACUOLELESS1                  64.3    6e-09   Camelina sativa [gold-of-pleasure]
ref|XP_004303883.1|  PREDICTED: protein VACUOLELESS1 isoform X2       62.8    2e-08   Fragaria vesca subsp. vesca
emb|CDP06151.1|  unnamed protein product                              62.8    2e-08   Coffea canephora [robusta coffee]
ref|XP_010918871.1|  PREDICTED: protein VACUOLELESS1                  55.8    2e-08   Elaeis guineensis
gb|AES70033.2|  vacuolar protein sorting-associated-like protein      62.8    2e-08   Medicago truncatula
ref|XP_003599782.1|  Vacuolar protein sorting-associated protein-...  62.8    2e-08   
gb|KEH16900.1|  vacuolar protein sorting-associated-like protein      62.8    2e-08   Medicago truncatula
ref|XP_004499978.1|  PREDICTED: vacuolar protein sorting-associat...  62.8    2e-08   Cicer arietinum [garbanzo]
ref|XP_008811095.1|  PREDICTED: protein VACUOLELESS1                  62.4    3e-08   Phoenix dactylifera
ref|XP_010517084.1|  PREDICTED: protein VACUOLELESS1-like             62.4    3e-08   Camelina sativa [gold-of-pleasure]
ref|XP_011467591.1|  PREDICTED: protein VACUOLELESS1 isoform X1       62.4    3e-08   Fragaria vesca subsp. vesca
ref|XP_010271338.1|  PREDICTED: protein VACUOLELESS1 isoform X2       62.0    4e-08   
ref|XP_010271337.1|  PREDICTED: protein VACUOLELESS1 isoform X1       62.0    4e-08   Nelumbo nucifera [Indian lotus]
ref|XP_008229565.1|  PREDICTED: protein VACUOLELESS1                  61.6    5e-08   Prunus mume [ume]
ref|XP_003551927.1|  PREDICTED: vacuolar protein sorting-associat...  61.2    7e-08   
ref|XP_008342344.1|  PREDICTED: protein VACUOLELESS1                  60.1    1e-07   Malus domestica [apple tree]
ref|XP_007214933.1|  hypothetical protein PRUPE_ppa001364mg           60.1    2e-07   Prunus persica
gb|ABF69968.1|  vacuolar protein sorting 16 (VPS16) family protein    58.2    3e-07   Musa acuminata [banana]
ref|XP_007146219.1|  hypothetical protein PHAVU_006G022400g           58.9    4e-07   Phaseolus vulgaris [French bean]
ref|XP_003532091.1|  PREDICTED: vacuolar protein sorting-associat...  58.9    4e-07   Glycine max [soybeans]
ref|XP_006854657.1|  hypothetical protein AMTR_s00030p00200210        51.6    6e-07   Amborella trichopoda
ref|XP_009416537.1|  PREDICTED: protein VACUOLELESS1                  57.0    1e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009377216.1|  PREDICTED: LOW QUALITY PROTEIN: protein VACU...  53.5    2e-05   Pyrus x bretschneideri [bai li]



>gb|KCW89755.1| hypothetical protein EUGRSUZ_A02017 [Eucalyptus grandis]
Length=742

 Score = 71.2 bits (173),  Expect(2) = 8e-17, Method: Composition-based stats.
 Identities = 39/93 (42%), Positives = 50/93 (54%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQLY A +         +  + IA+TVW++P  RL GM WTDDQTLI          
Sbjct  54   SKIVQLY-AESALRKLRIFNSAGVLIAETVWKHPGGRLIGMSWTDDQTLICLVQDGTVFR  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                A+ L     +GK+C   +VVDCVFW  G+
Sbjct  113  YNIHAELLEPNISMGKECFEQNVVDCVFWGNGL  145


 Score = 42.0 bits (97),  Expect(2) = 8e-17, Method: Composition-based stats.
 Identities = 18/26 (69%), Positives = 19/26 (73%), Gaps = 4/26 (15%)
 Frame = +3

Query  48   WLLNGRLLYKRHYRKPELYNMHWKHV  125
            WLL    LY R+YRKPELY M WKHV
Sbjct  10   WLL----LYNRYYRKPELYPMRWKHV  31



>ref|XP_010053830.1| PREDICTED: protein VACUOLELESS1 [Eucalyptus grandis]
Length=843

 Score = 71.2 bits (173),  Expect(2) = 8e-17, Method: Composition-based stats.
 Identities = 39/93 (42%), Positives = 50/93 (54%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQLY A +         +  + IA+TVW++P  RL GM WTDDQTLI          
Sbjct  54   SKIVQLY-AESALRKLRIFNSAGVLIAETVWKHPGGRLIGMSWTDDQTLICLVQDGTVFR  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                A+ L     +GK+C   +VVDCVFW  G+
Sbjct  113  YNIHAELLEPNISMGKECFEQNVVDCVFWGNGL  145


 Score = 42.0 bits (97),  Expect(2) = 8e-17, Method: Composition-based stats.
 Identities = 18/26 (69%), Positives = 19/26 (73%), Gaps = 4/26 (15%)
 Frame = +3

Query  48   WLLNGRLLYKRHYRKPELYNMHWKHV  125
            WLL    LY R+YRKPELY M WKHV
Sbjct  10   WLL----LYNRYYRKPELYPMRWKHV  31



>ref|XP_009133226.1| PREDICTED: protein VACUOLELESS1 [Brassica rapa]
Length=858

 Score = 64.7 bits (156),  Expect(2) = 6e-15, Method: Composition-based stats.
 Identities = 35/93 (38%), Positives = 50/93 (54%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQLY A +         +  + +++TVW++P  RL GM W+DDQTLI          
Sbjct  54   SKIVQLY-AESALRKLRIFNSAGVLLSETVWKHPGGRLIGMSWSDDQTLISIVQDGTIYC  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                A+ +     +GK+C   +VV+CVFW  GV
Sbjct  113  YNIHAELIQPNVTMGKECFEQNVVECVFWGNGV  145


 Score = 42.4 bits (98),  Expect(2) = 6e-15, Method: Composition-based stats.
 Identities = 15/21 (71%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = +3

Query  63   RLLYKRHYRKPELYNMHWKHV  125
            +LLY R+YRKPE+Y M WKHV
Sbjct  11   QLLYNRYYRKPEIYQMRWKHV  31



>ref|XP_009625096.1| PREDICTED: protein VACUOLELESS1 [Nicotiana tomentosiformis]
Length=843

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 41/100 (41%), Positives = 56/100 (56%), Gaps = 13/100 (13%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLI-------LHY  352
            +KIVQLY A +         +  + I++TVW+NP  RL GM WTDDQTL+       ++ 
Sbjct  54   AKIVQLY-AESALRKLRIFNSAGVQISETVWKNPGGRLIGMSWTDDQTLVCITQDGTIYR  112

Query  353  SGRHRLPVLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
               H  P+  ++Q       LG DC THSVV+C+FW  GV
Sbjct  113  YNIHAEPIEPNSQLT-----LGADCFTHSVVECIFWGNGV  147


 Score = 49.7 bits (117),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 37/112 (33%), Positives = 52/112 (46%), Gaps = 16/112 (14%)
 Frame = +3

Query  63   RLLYKRHYRKPELYNMHWKHVRPNAQQGRLIPLEAAP*TI--SATTPKSYSSTA--QVRP  230
            +LL+ R+YRKPELY M WKHV     +    P       I   A   + Y+ +A  ++R 
Sbjct  11   QLLHNRYYRKPELYQMQWKHVDLTRNKVACAPFGGPIAVIRDDAKIVQLYAESALRKLRI  70

Query  231  SEAPNLQLRRRFTSH---KLSGETLTADSTACSGPTTRR*YCITQDGTDYRY  377
              +  +Q+      +   +L G + T D T           CITQDGT YRY
Sbjct  71   FNSAGVQISETVWKNPGGRLIGMSWTDDQTLV---------CITQDGTIYRY  113



>ref|XP_006348963.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Solanum tuberosum]
Length=844

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 42/100 (42%), Positives = 56/100 (56%), Gaps = 13/100 (13%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLI-------LHY  352
            +KIVQLY A +         +T + I++TVW+NP  RL GM WTDDQ L+       ++ 
Sbjct  54   AKIVQLY-AESALRKLRIFNSTGVQISETVWKNPGGRLIGMSWTDDQILVCITQDGTVYR  112

Query  353  SGRHRLPVLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
               H  P+  ++Q       LG DC THSVV+CVFW  GV
Sbjct  113  YNIHAEPIEPNSQLT-----LGADCFTHSVVECVFWGNGV  147



>ref|XP_004243213.1| PREDICTED: protein VACUOLELESS1 [Solanum lycopersicum]
Length=843

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 41/100 (41%), Positives = 55/100 (55%), Gaps = 13/100 (13%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLI-------LHY  352
            +KIVQLY A +         +  + I++TVW+NP  RL GM WTDDQ L+       ++ 
Sbjct  54   AKIVQLY-AESALRKLRIFNSAGVQISETVWKNPGGRLIGMSWTDDQILVCITQDGTVYR  112

Query  353  SGRHRLPVLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
               H  P+  ++Q       LG DC THSVV+CVFW  GV
Sbjct  113  YNIHAEPIEPNSQLT-----LGADCFTHSVVECVFWGNGV  147



>ref|XP_009790374.1| PREDICTED: protein VACUOLELESS1 [Nicotiana sylvestris]
Length=843

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 40/100 (40%), Positives = 55/100 (55%), Gaps = 13/100 (13%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLI-------LHY  352
            +KIVQLY A +         +  + I++TVW+NP  RL GM WTDDQ L+       ++ 
Sbjct  54   AKIVQLY-AESALRKLRIFNSAGVQISETVWKNPGGRLIGMSWTDDQILVCITQDGTVYR  112

Query  353  SGRHRLPVLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
               H  P+  ++Q       LG DC THSVV+C+FW  GV
Sbjct  113  YNIHAEPIEPNSQLT-----LGADCFTHSVVECIFWGNGV  147



>ref|XP_010681470.1| PREDICTED: protein VACUOLELESS1 [Beta vulgaris subsp. vulgaris]
Length=844

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 42/93 (45%), Positives = 49/93 (53%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQLY A +         +    IA+TVWRNP  RL GM WTD+QTLI          
Sbjct  55   SKIVQLY-AESALRKLRIFNSAGNQIAETVWRNPGGRLIGMSWTDEQTLICIVQDGTVYR  113

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                AQ +     LGK+C   SVV+CVFW  GV
Sbjct  114  YDIHAQVIEPSLSLGKECFEQSVVECVFWGNGV  146


 Score = 48.5 bits (114),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 36/113 (32%), Positives = 51/113 (45%), Gaps = 18/113 (16%)
 Frame = +3

Query  63   RLLYKRHYRKPELYNMHWKHVRPNAQQGRLIPLEAAP*TISATTPK-----SYSSTAQVR  227
            +LLY R+YRKPELY+M WKH+  N  +    P    P  +     K     + S+  ++R
Sbjct  12   QLLYNRYYRKPELYSMRWKHIDLNRNKVACAPF-GGPIAVIRDDSKIVQLYAESALRKLR  70

Query  228  PSEAPNLQLRR---RFTSHKLSGETLTADSTACSGPTTRR*YCITQDGTDYRY  377
               +   Q+     R    +L G + T + T           CI QDGT YRY
Sbjct  71   IFNSAGNQIAETVWRNPGGRLIGMSWTDEQTLI---------CIVQDGTVYRY  114



>ref|XP_004144632.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Cucumis sativus]
 ref|XP_004166595.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Cucumis sativus]
 gb|KGN54934.1| hypothetical protein Csa_4G608100 [Cucumis sativus]
Length=844

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 40/93 (43%), Positives = 49/93 (53%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQLY A +            I +A+TVWRNP  RL GM WTDDQTL+          
Sbjct  54   SKIVQLY-AESALRKLRIFNCAGIQLAETVWRNPGGRLIGMAWTDDQTLVCVVQDGTVYR  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                A+ L     +GK+C   +VV+CVFW  GV
Sbjct  113  YNIHAELLEPNFSMGKECFEQNVVECVFWGNGV  145



>ref|XP_008465445.1| PREDICTED: protein VACUOLELESS1 [Cucumis melo]
 ref|XP_008465446.1| PREDICTED: protein VACUOLELESS1 [Cucumis melo]
Length=844

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 40/93 (43%), Positives = 49/93 (53%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQLY A +            I +A+TVWRNP  RL GM WTDDQTL+          
Sbjct  54   SKIVQLY-AESALRKLRIFNCAGIQLAETVWRNPGGRLIGMAWTDDQTLVCVVQDGTVYR  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                A+ L     +GK+C   +VV+CVFW  GV
Sbjct  113  YNIHAELLEPNFSMGKECFEQNVVECVFWGNGV  145



>gb|KDP24238.1| hypothetical protein JCGZ_26643 [Jatropha curcas]
Length=847

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 40/93 (43%), Positives = 51/93 (55%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQLYS S          +  I +++TVW++P  RL GM WTDDQTLI          
Sbjct  54   SKIVQLYSESA-LRKLRIFNSAGILVSETVWKHPGGRLIGMSWTDDQTLICIVQDGTIYR  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
               +A+ L     +GK+C   +VVDCVFW  GV
Sbjct  113  YNINAECLEPNFSMGKECFEQNVVDCVFWGNGV  145



>gb|KJB10620.1| hypothetical protein B456_001G211500 [Gossypium raimondii]
Length=680

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 39/93 (42%), Positives = 51/93 (55%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQLYS S         T++ + I+ TVW+NP  RL GM WT+DQTLI          
Sbjct  54   SKIVQLYSESA-LRKLRIFTSSGVLISDTVWKNPGGRLIGMSWTEDQTLICIVQDGTVYR  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                A+ +     LGK+C   +VV+C+FW  GV
Sbjct  113  YNIHAELIEPNVTLGKECFEQNVVECIFWGNGV  145



>gb|KJB10616.1| hypothetical protein B456_001G211500 [Gossypium raimondii]
Length=888

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 39/93 (42%), Positives = 51/93 (55%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQLYS S         T++ + I+ TVW+NP  RL GM WT+DQTLI          
Sbjct  54   SKIVQLYSESA-LRKLRIFTSSGVLISDTVWKNPGGRLIGMSWTEDQTLICIVQDGTVYR  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                A+ +     LGK+C   +VV+C+FW  GV
Sbjct  113  YNIHAELIEPNVTLGKECFEQNVVECIFWGNGV  145



>gb|KJB10618.1| hypothetical protein B456_001G211500 [Gossypium raimondii]
Length=844

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 39/93 (42%), Positives = 51/93 (55%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQLYS S         T++ + I+ TVW+NP  RL GM WT+DQTLI          
Sbjct  54   SKIVQLYSESA-LRKLRIFTSSGVLISDTVWKNPGGRLIGMSWTEDQTLICIVQDGTVYR  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                A+ +     LGK+C   +VV+C+FW  GV
Sbjct  113  YNIHAELIEPNVTLGKECFEQNVVECIFWGNGV  145



>gb|KJB10617.1| hypothetical protein B456_001G211500 [Gossypium raimondii]
Length=795

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 39/93 (42%), Positives = 51/93 (55%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQLYS S         T++ + I+ TVW+NP  RL GM WT+DQTLI          
Sbjct  54   SKIVQLYSESA-LRKLRIFTSSGVLISDTVWKNPGGRLIGMSWTEDQTLICIVQDGTVYR  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                A+ +     LGK+C   +VV+C+FW  GV
Sbjct  113  YNIHAELIEPNVTLGKECFEQNVVECIFWGNGV  145



>gb|EPS58563.1| hypothetical protein M569_16250, partial [Genlisea aurea]
Length=258

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 54/100 (54%), Gaps = 16/100 (16%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLI-------LHY  352
            +KIVQLY A +        T++   I++T+WRNP  RL GM WTDD  L+       +++
Sbjct  54   AKIVQLY-AESAIRKLRLFTSSGCLISETIWRNPGGRLIGMSWTDDLMLVCITQDGTIYF  112

Query  353  SGRHRLPVLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
               H          L N   LGK+C  +SVV+CVFW +GV
Sbjct  113  YNIH--------AELVNTFSLGKECFENSVVECVFWGSGV  144



>gb|KHG27227.1| Vacuolar sorting-associated protein 16 [Gossypium arboreum]
Length=789

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 39/93 (42%), Positives = 51/93 (55%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQLYS S         T++ + I+ TVW+NP  RL GM WT+DQTLI          
Sbjct  54   SKIVQLYSESA-LRKLRIFTSSGVLISDTVWKNPGGRLIGMSWTEDQTLICIVQDGTVYR  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                A+ +     LGK+C   +VV+C+FW  GV
Sbjct  113  YNIHAELIEPNVTLGKECFEQNVVECIFWGNGV  145



>gb|KJB10619.1| hypothetical protein B456_001G211500 [Gossypium raimondii]
Length=772

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 39/93 (42%), Positives = 51/93 (55%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQLYS S         T++ + I+ TVW+NP  RL GM WT+DQTLI          
Sbjct  54   SKIVQLYSESA-LRKLRIFTSSGVLISDTVWKNPGGRLIGMSWTEDQTLICIVQDGTVYR  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                A+ +     LGK+C   +VV+C+FW  GV
Sbjct  113  YNIHAELIEPNVTLGKECFEQNVVECIFWGNGV  145



>ref|XP_002302135.2| MANGLED family protein [Populus trichocarpa]
 gb|EEE81408.2| MANGLED family protein [Populus trichocarpa]
Length=844

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 37/93 (40%), Positives = 49/93 (53%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQLY A +         +  + +++TVW++P  RL GM WT+DQTLI          
Sbjct  54   SKIVQLY-AESALRKLRIFNSAGVLLSETVWKHPGGRLIGMSWTEDQTLICIVQDGTIYR  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                 + L     +GKDC   +VVDCVFW  GV
Sbjct  113  YNVHGECLEPNFSMGKDCFEQNVVDCVFWGNGV  145



>ref|XP_011026232.1| PREDICTED: protein VACUOLELESS1-like isoform X1 [Populus euphratica]
Length=844

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 37/93 (40%), Positives = 49/93 (53%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQLY A +         +  + +++TVW++P  RL GM WT+DQTLI          
Sbjct  54   SKIVQLY-AESALRKLRIFNSAGVLLSETVWKHPGGRLIGMSWTEDQTLICIVQDGTIYR  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                 + L     +GKDC   +VVDCVFW  GV
Sbjct  113  YNVHGECLEPNFSMGKDCFEQNVVDCVFWGNGV  145



>ref|XP_010557595.1| PREDICTED: protein VACUOLELESS1 [Tarenaya hassleriana]
Length=861

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 37/93 (40%), Positives = 50/93 (54%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQLY A +         +  I I++TVW+NP  RL GM W+DDQTLI          
Sbjct  54   SKIVQLY-AESALRKLRIFNSAGILISETVWKNPGGRLVGMSWSDDQTLICIVQDGTVYR  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                ++ +     +GK+C   +VV+CVFW  GV
Sbjct  113  YNIHSEPIEPNFSMGKECFEQNVVECVFWGNGV  145



>gb|KDO51890.1| hypothetical protein CISIN_1g003205mg [Citrus sinensis]
Length=691

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 36/93 (39%), Positives = 51/93 (55%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQLY A +         +  + I++TVW+NP  RL GM W++DQTLI          
Sbjct  54   SKIVQLY-AESALRKLRIFNSAGVLISETVWKNPGGRLIGMSWSEDQTLICVVQDGTVYR  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                A+ +   + +GK+C   +VV+CVFW  GV
Sbjct  113  YNIHAELIEPNASMGKECFEENVVECVFWGNGV  145



>gb|KDO51887.1| hypothetical protein CISIN_1g003205mg [Citrus sinensis]
Length=839

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 36/93 (39%), Positives = 51/93 (55%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQLY A +         +  + I++TVW+NP  RL GM W++DQTLI          
Sbjct  54   SKIVQLY-AESALRKLRIFNSAGVLISETVWKNPGGRLIGMSWSEDQTLICVVQDGTVYR  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                A+ +   + +GK+C   +VV+CVFW  GV
Sbjct  113  YNIHAELIEPNASMGKECFEENVVECVFWGNGV  145



>ref|XP_007048987.1| Vacuoleless1 (VCL1) isoform 3 [Theobroma cacao]
 gb|EOX93144.1| Vacuoleless1 (VCL1) isoform 3 [Theobroma cacao]
Length=809

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 38/93 (41%), Positives = 51/93 (55%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQLYS S         T++   I++TVW++P  RL GM WT+DQTLI          
Sbjct  54   SKIVQLYSESA-LRKLRIFTSSGALISETVWKHPGGRLIGMSWTEDQTLICIVQDGTVYR  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                A+ +     LGK+C   +VV+C+FW  GV
Sbjct  113  YNVHAELIEPNVSLGKECFEQNVVECMFWGNGV  145



>ref|XP_006437140.1| hypothetical protein CICLE_v10030701mg [Citrus clementina]
 ref|XP_006484899.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Citrus sinensis]
 gb|ESR50380.1| hypothetical protein CICLE_v10030701mg [Citrus clementina]
Length=839

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 36/93 (39%), Positives = 51/93 (55%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQLY A +         +  + I++TVW+NP  RL GM W++DQTLI          
Sbjct  54   SKIVQLY-AESALRKLRIFNSAGVLISETVWKNPGGRLIGMSWSEDQTLICVVQDGTVYR  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                A+ +   + +GK+C   +VV+CVFW  GV
Sbjct  113  YNIHAELIEPNASMGKECFEENVVECVFWGNGV  145



>ref|XP_007048986.1| Vacuoleless1 (VCL1) isoform 2 [Theobroma cacao]
 gb|EOX93143.1| Vacuoleless1 (VCL1) isoform 2 [Theobroma cacao]
Length=844

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 38/93 (41%), Positives = 51/93 (55%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQLYS S         T++   I++TVW++P  RL GM WT+DQTLI          
Sbjct  54   SKIVQLYSESA-LRKLRIFTSSGALISETVWKHPGGRLIGMSWTEDQTLICIVQDGTVYR  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                A+ +     LGK+C   +VV+C+FW  GV
Sbjct  113  YNVHAELIEPNVSLGKECFEQNVVECMFWGNGV  145



>ref|XP_007048985.1| Vacuoleless1 (VCL1) isoform 1 [Theobroma cacao]
 gb|EOX93142.1| Vacuoleless1 (VCL1) isoform 1 [Theobroma cacao]
Length=874

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 38/93 (41%), Positives = 51/93 (55%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQLYS S         T++   I++TVW++P  RL GM WT+DQTLI          
Sbjct  54   SKIVQLYSESA-LRKLRIFTSSGALISETVWKHPGGRLIGMSWTEDQTLICIVQDGTVYR  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                A+ +     LGK+C   +VV+C+FW  GV
Sbjct  113  YNVHAELIEPNVSLGKECFEQNVVECMFWGNGV  145



>ref|XP_002526647.1| vacuolar protein sorting vps16, putative [Ricinus communis]
 gb|EEF35735.1| vacuolar protein sorting vps16, putative [Ricinus communis]
Length=851

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 38/93 (41%), Positives = 50/93 (54%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQLYS S          +  I I++TVW++P  RL GM WT+DQTLI          
Sbjct  54   SKIVQLYSESA-LRKLRIFNSAGILISETVWKHPGGRLIGMSWTEDQTLICIVQDGTIYR  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                A+ +     +GK+C   +VV+CVFW  GV
Sbjct  113  YNIHAEIIEPNYSMGKECFEQNVVECVFWGNGV  145



>ref|XP_011044765.1| PREDICTED: protein VACUOLELESS1-like [Populus euphratica]
Length=844

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 37/93 (40%), Positives = 49/93 (53%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQLY A +         +  I +++TVW++P  RL GM WT+DQTLI          
Sbjct  54   SKIVQLY-AESALRKLRIFNSAGILLSETVWKHPGGRLIGMSWTEDQTLICIVQDGTIYR  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                 + L     +GK+C   +VVDCVFW  GV
Sbjct  113  YNVHCEVLEPNFSMGKECFEQNVVDCVFWGNGV  145



>ref|XP_002283428.1| PREDICTED: protein VACUOLELESS1 [Vitis vinifera]
 emb|CBI22093.3| unnamed protein product [Vitis vinifera]
Length=838

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 36/93 (39%), Positives = 49/93 (53%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQLY A +         +  + I++TVW++P  RL GM WTDDQTLI          
Sbjct  54   SKIVQLY-AESALRKLRIFNSAGVQISETVWKHPGGRLVGMAWTDDQTLICVVQDGTVFR  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                A+       +GK+C   +VV+CVFW  G+
Sbjct  113  YNVHAELQEPNISMGKECFEQNVVECVFWGNGM  145



>ref|XP_002306748.1| MANGLED family protein [Populus trichocarpa]
 gb|EEE93744.1| MANGLED family protein [Populus trichocarpa]
Length=844

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 37/93 (40%), Positives = 48/93 (52%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQLY A +         +  I  ++TVW++P  RL GM WT+DQTLI          
Sbjct  54   SKIVQLY-AESALRKLRIFNSAGILFSETVWKHPGGRLIGMSWTEDQTLICIVQDGTIYR  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                 + L     +GK+C   +VVDCVFW  GV
Sbjct  113  YNVHCEVLEPNFSMGKECFEQNVVDCVFWGNGV  145



>ref|XP_011082899.1| PREDICTED: protein VACUOLELESS1 [Sesamum indicum]
Length=840

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 40/93 (43%), Positives = 52/93 (56%), Gaps = 2/93 (2%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            +KIVQLY A +        T++   I++TVW+NP  RL GM WTDD TLI          
Sbjct  54   AKIVQLY-AESALRKLRIFTSSGRLISETVWKNPGGRLIGMSWTDDLTLICITQDGTVYS  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                A+ L +   LGK+C  +SVV+CVFW  GV
Sbjct  113  YNIHAE-LISTFSLGKECFDNSVVECVFWGNGV  144



>ref|XP_002881559.1| hypothetical protein ARALYDRAFT_321506 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57818.1| hypothetical protein ARALYDRAFT_321506 [Arabidopsis lyrata subsp. 
lyrata]
Length=858

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 36/93 (39%), Positives = 50/93 (54%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQLY A +         +  I +++TVW++P  RL GM W+DDQTLI          
Sbjct  54   SKIVQLY-AESALRKLRIFNSAGILLSETVWKHPGGRLIGMSWSDDQTLICIVQDGTIYR  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                A+ +     +GK+C   +VV+CVFW  GV
Sbjct  113  YNIHAELIEPNMSMGKECFEQNVVECVFWGNGV  145



>dbj|BAJ33734.1| unnamed protein product [Thellungiella halophila]
Length=833

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 36/93 (39%), Positives = 50/93 (54%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQLY A +         +  I +++TVW++P  RL GM W+DDQTLI          
Sbjct  29   SKIVQLY-AESALRKLRIFNSAGILLSETVWKHPGGRLIGMSWSDDQTLICIVQDGTIYR  87

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                A+ +     +GK+C   +VV+CVFW  GV
Sbjct  88   YNIHAELIEPNMTMGKECFEQNVVECVFWGNGV  120



>ref|XP_006411003.1| hypothetical protein EUTSA_v10016232mg [Eutrema salsugineum]
 gb|ESQ52456.1| hypothetical protein EUTSA_v10016232mg [Eutrema salsugineum]
Length=858

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 36/93 (39%), Positives = 50/93 (54%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQLY A +         +  I +++TVW++P  RL GM W+DDQTLI          
Sbjct  54   SKIVQLY-AESALRKLRIFNSAGILLSETVWKHPGGRLIGMSWSDDQTLICIVQDGTIYR  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                A+ +     +GK+C   +VV+CVFW  GV
Sbjct  113  YNIHAELIEPNMTMGKECFEQNVVECVFWGNGV  145



>ref|XP_010087860.1| Vacuolar protein sorting-associated protein 16-like protein [Morus 
notabilis]
 gb|EXB30296.1| Vacuolar protein sorting-associated protein 16-like protein [Morus 
notabilis]
Length=842

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 38/95 (40%), Positives = 53/95 (56%), Gaps = 5/95 (5%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTL--ILHYSGRHR  367
            SKIVQL+S S          +  + +++TVW+NP  RL  M WTDDQTL  ++     +R
Sbjct  54   SKIVQLHSESA-LRKLRIFNSAGVLLSETVWKNPGGRLVAMSWTDDQTLACVVQDGTVYR  112

Query  368  LPVLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
              V   A+ L     +GK+C   +VVDCVFW  G+
Sbjct  113  YNVY--AKLLEPNISMGKECFEQNVVDCVFWGNGL  145



>ref|XP_006296131.1| hypothetical protein CARUB_v10025283mg [Capsella rubella]
 gb|EOA29029.1| hypothetical protein CARUB_v10025283mg [Capsella rubella]
Length=858

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 35/93 (38%), Positives = 50/93 (54%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQLY A +         +  I +++T+W++P  RL GM W+DDQTLI          
Sbjct  54   SKIVQLY-AESALRKLRIFNSAGILLSETIWKHPGGRLIGMSWSDDQTLICIVQDGTIYR  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                A+ +     +GK+C   +VV+CVFW  GV
Sbjct  113  YNIHAELIEPNMSMGKECFEQNVVECVFWGNGV  145



>ref|NP_565879.1| vacuoleless1 [Arabidopsis thaliana]
 sp|Q93VQ0.1|VCL1_ARATH RecName: Full=Protein VACUOLELESS1; AltName: Full=Vacuolar protein 
sorting-associated protein 16 homolog [Arabidopsis thaliana]
 gb|AAK43713.1|AF359240_1 VCL1 [Arabidopsis thaliana]
 gb|AAK82510.1| At2g38020/T8P21.7 [Arabidopsis thaliana]
 gb|AAM98105.1| At2g38020/T8P21.7 [Arabidopsis thaliana]
 gb|AEC09479.1| vacuoleless1 [Arabidopsis thaliana]
Length=858

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 35/93 (38%), Positives = 50/93 (54%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQLY A +         +  I +++TVW++P  RL GM W+DDQTLI          
Sbjct  54   SKIVQLY-AESALRKLRIFNSAGILLSETVWKHPGGRLIGMSWSDDQTLICIVQDGTIYR  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                A+ +     +G++C   +VV+CVFW  GV
Sbjct  113  YNIHAELIEPNMSMGQECFEQNVVECVFWGNGV  145



>emb|CDY07756.1| BnaA03g17550D [Brassica napus]
Length=858

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 35/93 (38%), Positives = 50/93 (54%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQLY A +         +  + +++TVW++P  RL GM W+DDQTLI          
Sbjct  54   SKIVQLY-AESALRKLRIFNSAGVLLSETVWKHPGGRLIGMSWSDDQTLISIVQDGTIYR  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                A+ +     +GK+C   +VV+CVFW  GV
Sbjct  113  YNIHAELIQPNVTMGKECFEQNVVECVFWGNGV  145



>emb|CDY14496.1| BnaC03g20990D [Brassica napus]
Length=858

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 35/93 (38%), Positives = 50/93 (54%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQLY A +         +  + +++TVW++P  RL GM W+DDQTLI          
Sbjct  54   SKIVQLY-AESALRKLRIFNSAGVLLSETVWKHPGGRLIGMSWSDDQTLISIVQDGTIYR  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                A+ +     +GK+C   +VV+CVFW  GV
Sbjct  113  YNIHAELIQPNVTMGKECFEQNVVECVFWGNGV  145



>ref|NP_001078020.1| vacuoleless1 [Arabidopsis thaliana]
 gb|AEC09480.1| vacuoleless1 [Arabidopsis thaliana]
Length=834

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 35/93 (38%), Positives = 50/93 (54%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQLY A +         +  I +++TVW++P  RL GM W+DDQTLI          
Sbjct  54   SKIVQLY-AESALRKLRIFNSAGILLSETVWKHPGGRLIGMSWSDDQTLICIVQDGTIYR  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                A+ +     +G++C   +VV+CVFW  GV
Sbjct  113  YNIHAELIEPNMSMGQECFEQNVVECVFWGNGV  145



>gb|EYU33990.1| hypothetical protein MIMGU_mgv1a001320mg [Erythranthe guttata]
Length=840

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 38/93 (41%), Positives = 53/93 (57%), Gaps = 2/93 (2%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            +KIVQLY A +        T++   I++TVW+NP  RL G+ WTDD TL+          
Sbjct  54   AKIVQLY-AESALRKLRIFTSSGRLISETVWKNPGGRLIGISWTDDLTLVCITQDGTVYS  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                A+ L +   LGK+C  +SVV+CVFW +GV
Sbjct  113  YDIHAE-LVSTFSLGKECFANSVVECVFWGSGV  144



>ref|XP_010505412.1| PREDICTED: protein VACUOLELESS1-like [Camelina sativa]
Length=858

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 34/93 (37%), Positives = 50/93 (54%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQLY A +         +  + +++T+W++P  RL GM W+DDQTLI          
Sbjct  54   SKIVQLY-AESALRKLRIFNSAGLLLSETIWKHPGGRLIGMSWSDDQTLICVVQDGTIYR  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                A+ +     +GK+C   +VV+CVFW  GV
Sbjct  113  YNIHAELIEPNMSMGKECFEQNVVECVFWGNGV  145



>ref|XP_010509236.1| PREDICTED: protein VACUOLELESS1 [Camelina sativa]
Length=858

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 34/93 (37%), Positives = 50/93 (54%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQLY A +         +  + +++T+W++P  RL GM W+DDQTLI          
Sbjct  54   SKIVQLY-AESALRKLRIFNSAGLLLSETIWKHPGGRLIGMSWSDDQTLICIVQDGTIYR  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                A+ +     +GK+C   +VV+CVFW  GV
Sbjct  113  YNIHAELIEPNMSMGKECFEQNVVECVFWGNGV  145



>ref|XP_004303883.1| PREDICTED: protein VACUOLELESS1 isoform X2 [Fragaria vesca subsp. 
vesca]
Length=857

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 39/100 (39%), Positives = 54/100 (54%), Gaps = 15/100 (15%)
 Frame = +2

Query  194  SKIVQLYSASTP-----FGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLI--LHY  352
            SKIVQL   S       F SS       + + +T+W++P  RL GM WTDDQTL+  +  
Sbjct  54   SKIVQLRGESAQRKLRIFNSS------GLLLGETIWKHPGGRLIGMSWTDDQTLVCLVQD  107

Query  353  SGRHRLPVLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
               +R  +L  A+ +     +GK+C   +VVDCVFW  GV
Sbjct  108  GTVYRYNIL--AEIVEPSISMGKECFERNVVDCVFWGNGV  145



>emb|CDP06151.1| unnamed protein product [Coffea canephora]
Length=840

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 37/93 (40%), Positives = 49/93 (53%), Gaps = 2/93 (2%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            +KIVQLYS S          +  + I++TVWRN   RL GM W+DD  LI   +    + 
Sbjct  54   AKIVQLYSESA-LRKLRIFNSAGVQISETVWRNAGGRLIGMAWSDDLKLIC-ITQDGTVY  111

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
              +    L     LG+D L HS+V+CVFW  GV
Sbjct  112  CYSFHAELIKTLSLGQDGLKHSIVECVFWGNGV  144



>ref|XP_010918871.1| PREDICTED: protein VACUOLELESS1 [Elaeis guineensis]
Length=846

 Score = 55.8 bits (133),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 36/101 (36%), Positives = 47/101 (47%), Gaps = 17/101 (17%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTL--------ILH  349
            SKIVQLY+ S          +  + +A   W  P  RL GM WTDDQ+L        +  
Sbjct  56   SKIVQLYAESAR-RKLHIFNSAGVPLASAAWDRPGGRLVGMAWTDDQSLVCVVQDGTVYF  114

Query  350  YSGRHRLPVLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
            Y+ R  L    SA        +GK+C    VV+CVFW  G+
Sbjct  115  YNLRAEL----SAPQF----SMGKECFEQGVVECVFWGNGM  147


 Score = 28.9 bits (63),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 10/18 (56%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = +3

Query  63   RLLYKRHYRKPELYNMHW  116
            +LL+ R+YRK E+Y+M W
Sbjct  13   QLLHDRYYRKLEIYSMQW  30



>gb|AES70033.2| vacuolar protein sorting-associated-like protein [Medicago truncatula]
Length=850

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 37/93 (40%), Positives = 47/93 (51%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQL+  S        S++  + +A TVWRNP  RL GM WTDD TL+          
Sbjct  54   SKIVQLHGESALRKLRLFSSSGHL-LADTVWRNPGGRLIGMSWTDDHTLVCVVQDGTVYR  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                A+ +     LGK+C   +V DC FW  GV
Sbjct  113  YDVHARLIEPNLSLGKECFESNVADCAFWGNGV  145



>ref|XP_003599782.1| Vacuolar protein sorting-associated protein-like protein [Medicago 
truncatula]
Length=856

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 37/93 (40%), Positives = 47/93 (51%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQL+  S        S++  + +A TVWRNP  RL GM WTDD TL+          
Sbjct  54   SKIVQLHGESALRKLRLFSSSGHL-LADTVWRNPGGRLIGMSWTDDHTLVCVVQDGTVYR  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                A+ +     LGK+C   +V DC FW  GV
Sbjct  113  YDVHARLIEPNLSLGKECFESNVADCAFWGNGV  145



>gb|KEH16900.1| vacuolar protein sorting-associated-like protein [Medicago truncatula]
Length=850

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 37/93 (40%), Positives = 47/93 (51%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQL+  S        S++  + +A TVWRNP  RL GM WTDD TL+          
Sbjct  54   SKIVQLHGESALRKLRLFSSSGHL-LADTVWRNPGGRLIGMSWTDDHTLVCVVQDGTVYR  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                A+ +     LGK+C   +V DC FW  GV
Sbjct  113  YDVHARLIEPNLSLGKECFESNVADCAFWGNGV  145



>ref|XP_004499978.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Cicer arietinum]
Length=850

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 37/93 (40%), Positives = 47/93 (51%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQL+  S        S++  + +A TVWRNP  RL GM WTDD TL+          
Sbjct  54   SKIVQLHGESALRKLRIFSSSGHL-LADTVWRNPGGRLIGMSWTDDHTLVCVVQDGTVYR  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                A+ +     LGK+C   +V DC FW  GV
Sbjct  113  YDVHARLIEPNLSLGKECFESNVADCAFWGNGV  145



>ref|XP_008811095.1| PREDICTED: protein VACUOLELESS1 [Phoenix dactylifera]
Length=844

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 47/97 (48%), Gaps = 9/97 (9%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSG----R  361
            SKIVQLY+ S          +  +H+A   W  P  RL GM WTDDQ+L+         R
Sbjct  54   SKIVQLYAESAR-RKLHIFNSAGVHLASAAWDRPGGRLVGMAWTDDQSLVCVVQDGTVYR  112

Query  362  HRLPVLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
            + L    SA        +GK+C    VV+CVFW  G+
Sbjct  113  YNLRAELSAPQF----SMGKECFEQGVVECVFWGNGM  145



>ref|XP_010517084.1| PREDICTED: protein VACUOLELESS1-like [Camelina sativa]
Length=858

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 35/93 (38%), Positives = 51/93 (55%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQLY+ S        ++   +H ++T+W++P  RL GM W+DDQTLI          
Sbjct  54   SKIVQLYAESALRKLRIFNSAGLLH-SETIWKHPGGRLIGMSWSDDQTLICIVQDGTIYR  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                A+ +     +GK+C   +VV+CVFW  GV
Sbjct  113  YNIHAELIEPNMSMGKECDEQNVVECVFWGNGV  145



>ref|XP_011467591.1| PREDICTED: protein VACUOLELESS1 isoform X1 [Fragaria vesca subsp. 
vesca]
Length=891

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 39/100 (39%), Positives = 54/100 (54%), Gaps = 15/100 (15%)
 Frame = +2

Query  194  SKIVQLYSASTP-----FGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLI--LHY  352
            SKIVQL   S       F SS       + + +T+W++P  RL GM WTDDQTL+  +  
Sbjct  54   SKIVQLRGESAQRKLRIFNSS------GLLLGETIWKHPGGRLIGMSWTDDQTLVCLVQD  107

Query  353  SGRHRLPVLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
               +R  +L  A+ +     +GK+C   +VVDCVFW  GV
Sbjct  108  GTVYRYNIL--AEIVEPSISMGKECFERNVVDCVFWGNGV  145



>ref|XP_010271338.1| PREDICTED: protein VACUOLELESS1 isoform X2 [Nelumbo nucifera]
Length=691

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 35/95 (37%), Positives = 50/95 (53%), Gaps = 5/95 (5%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTL--ILHYSGRHR  367
            SKIVQLY A +         +  + +++TVWR+   RL GM WTDDQ L  ++     +R
Sbjct  54   SKIVQLY-AESALRKLRIFNSAGVQLSETVWRHSGGRLVGMAWTDDQILVCVVQDGTVYR  112

Query  368  LPVLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
              V    Q       +GK+C   +VV+CVFW  G+
Sbjct  113  YNVHAELQE--PNISMGKECFEQNVVECVFWGNGM  145



>ref|XP_010271337.1| PREDICTED: protein VACUOLELESS1 isoform X1 [Nelumbo nucifera]
Length=841

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 35/95 (37%), Positives = 50/95 (53%), Gaps = 5/95 (5%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTL--ILHYSGRHR  367
            SKIVQLY A +         +  + +++TVWR+   RL GM WTDDQ L  ++     +R
Sbjct  54   SKIVQLY-AESALRKLRIFNSAGVQLSETVWRHSGGRLVGMAWTDDQILVCVVQDGTVYR  112

Query  368  LPVLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
              V    Q       +GK+C   +VV+CVFW  G+
Sbjct  113  YNVHAELQE--PNISMGKECFEQNVVECVFWGNGM  145



>ref|XP_008229565.1| PREDICTED: protein VACUOLELESS1 [Prunus mume]
Length=841

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 34/93 (37%), Positives = 49/93 (53%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQL   S        S++  + + +T+W++P  RL GM WTDDQTL+          
Sbjct  54   SKIVQLGGESAQRKLRIFSSSGHL-LGETIWKHPGGRLIGMAWTDDQTLVCLVQDGTVFR  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                A+ L     +G++C   +VVDCVFW  G+
Sbjct  113  YTIHAELLEPSISMGQECFERNVVDCVFWGNGL  145


 Score = 48.5 bits (114),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 38/118 (32%), Positives = 51/118 (43%), Gaps = 28/118 (24%)
 Frame = +3

Query  63   RLLYKRHYRKPELYNMHWKHVRPNAQQGRLIPLEAAP*TISATTPKSYSSTAQVRPSEAP  242
            +LLY R+YRKPE+Y M WKHV  N  +     +  AP        +  S   Q+   E+ 
Sbjct  11   QLLYNRYYRKPEIYRMSWKHVELNRNK-----VACAPFGGPIAVIRDDSKIVQL-GGESA  64

Query  243  NLQLRRRFTSHKLSGETL-------------TADSTACSGPTTRR*YCITQDGTDYRY  377
              +LR   +S  L GET+             T D T           C+ QDGT +RY
Sbjct  65   QRKLRIFSSSGHLLGETIWKHPGGRLIGMAWTDDQTLV---------CLVQDGTVFRY  113



>ref|XP_003551927.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Glycine max]
Length=843

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 37/95 (39%), Positives = 51/95 (54%), Gaps = 5/95 (5%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTL--ILHYSGRHR  367
            SKIVQL+ A +        +++   +A  VWR+P  RL GM WTDDQTL  ++     +R
Sbjct  54   SKIVQLH-AESALRKLRLFSSSGRPLADAVWRHPGGRLVGMSWTDDQTLLCVVQDGTVYR  112

Query  368  LPVLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
              V   A  +     LGK+C   +V DCVFW  G+
Sbjct  113  YDV--HANLIEPNLSLGKECFEDNVADCVFWGNGL  145



>ref|XP_008342344.1| PREDICTED: protein VACUOLELESS1 [Malus domestica]
Length=840

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 34/93 (37%), Positives = 47/93 (51%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQL   S        S+   + + +T+W++P  RL GM WTDDQ L+          
Sbjct  54   SKIVQLGGESAQRKLRIFSSAGHL-LGETIWKHPGGRLIGMAWTDDQNLVCLVQDGTVFR  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                A+ +     +GK+C   +VVDCVFW  GV
Sbjct  113  YTIHAELVEPSISMGKECFERNVVDCVFWGNGV  145



>ref|XP_007214933.1| hypothetical protein PRUPE_ppa001364mg [Prunus persica]
 gb|EMJ16132.1| hypothetical protein PRUPE_ppa001364mg [Prunus persica]
Length=844

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 33/93 (35%), Positives = 48/93 (52%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQL   S        S++  + + +T+W++P  RL GM WTDDQTL+          
Sbjct  54   SKIVQLGGESAQRKLRIFSSSGHL-LGETIWKHPGGRLIGMAWTDDQTLVCLVQDGTVFR  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                 + L     +G++C   +VVDCVFW  G+
Sbjct  113  YTIHTELLEPSISMGQECFERNVVDCVFWGNGL  145


 Score = 48.5 bits (114),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 38/118 (32%), Positives = 51/118 (43%), Gaps = 28/118 (24%)
 Frame = +3

Query  63   RLLYKRHYRKPELYNMHWKHVRPNAQQGRLIPLEAAP*TISATTPKSYSSTAQVRPSEAP  242
            +LLY R+YRKPE+Y M WKHV  N  +     +  AP        +  S   Q+   E+ 
Sbjct  11   QLLYNRYYRKPEIYRMSWKHVELNRNK-----VACAPFGGPIAVIRDDSKIVQL-GGESA  64

Query  243  NLQLRRRFTSHKLSGETL-------------TADSTACSGPTTRR*YCITQDGTDYRY  377
              +LR   +S  L GET+             T D T           C+ QDGT +RY
Sbjct  65   QRKLRIFSSSGHLLGETIWKHPGGRLIGMAWTDDQTLV---------CLVQDGTVFRY  113



>gb|ABF69968.1| vacuolar protein sorting 16 (VPS16) family protein [Musa acuminata]
Length=280

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 46/98 (47%), Gaps = 11/98 (11%)
 Frame = +2

Query  194  SKIVQLYSASTP-----FGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSG  358
            SKIVQLY+ S       F ++  +  +AI      W  P  RL GM WTDDQ L+     
Sbjct  54   SKIVQLYAESARRKLLIFNAAGRALASAI------WDRPGGRLVGMAWTDDQVLVCVVQD  107

Query  359  RHRLPVLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                     A+    +  +GK+C    VVDCVFW  G+
Sbjct  108  GTVYRYNVHAELCAPQFSMGKECFEQGVVDCVFWGNGM  145



>ref|XP_007146219.1| hypothetical protein PHAVU_006G022400g [Phaseolus vulgaris]
 gb|ESW18213.1| hypothetical protein PHAVU_006G022400g [Phaseolus vulgaris]
Length=843

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 37/95 (39%), Positives = 50/95 (53%), Gaps = 5/95 (5%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTL--ILHYSGRHR  367
            SKIVQL+ A +        +++   +A TVWR+   RL GM WTDDQTL  I+     +R
Sbjct  54   SKIVQLH-AESALRKLRLFSSSGRPLADTVWRHSGGRLIGMSWTDDQTLLCIVQDGTVYR  112

Query  368  LPVLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
              V   A  +     LGK+C   +V DC FW  G+
Sbjct  113  YDV--HANLIEPNLSLGKECFEDNVADCAFWGNGL  145



>ref|XP_003532091.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Glycine max]
Length=843

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 36/95 (38%), Positives = 50/95 (53%), Gaps = 5/95 (5%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTL--ILHYSGRHR  367
            SKIVQL+ A +        +++   +A  VWR+P  RL GM WTDDQTL  ++     +R
Sbjct  54   SKIVQLH-AESALRKLRLFSSSGRPLADAVWRHPGGRLVGMSWTDDQTLLCVVQDGTVYR  112

Query  368  LPVLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
              V   A  +     LGK+C   +V DC FW  G+
Sbjct  113  YDV--HANLIEPNLSLGKECFEDNVADCAFWGHGL  145



>ref|XP_006854657.1| hypothetical protein AMTR_s00030p00200210 [Amborella trichopoda]
 gb|ERN16124.1| hypothetical protein AMTR_s00030p00200210 [Amborella trichopoda]
Length=855

 Score = 51.6 bits (122),  Expect(2) = 6e-07, Method: Composition-based stats.
 Identities = 33/93 (35%), Positives = 41/93 (44%), Gaps = 1/93 (1%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKI+QL S        +      I +A TVW  P  RL  M WTD QTL           
Sbjct  53   SKIIQLLSEPAR-RKLQIFNAAGIPLASTVWDRPGGRLVAMAWTDHQTLACLVQDGTLFF  111

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                A  L     +G++C   +VV+CVFW  GV
Sbjct  112  YDIHAHILEPSLSMGRECREQNVVECVFWGNGV  144


 Score = 28.1 bits (61),  Expect(2) = 6e-07, Method: Composition-based stats.
 Identities = 9/21 (43%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = +3

Query  63   RLLYKRHYRKPELYNMHWKHV  125
            ++L   +Y+KPELY+M W+++
Sbjct  10   QILSSHYYQKPELYSMCWRNM  30



>ref|XP_009416537.1| PREDICTED: protein VACUOLELESS1 [Musa acuminata subsp. malaccensis]
Length=842

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 35/98 (36%), Positives = 46/98 (47%), Gaps = 11/98 (11%)
 Frame = +2

Query  194  SKIVQLYSASTP-----FGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSG  358
            SKIVQLY+ S       F ++  +  +AI      W  P  RL GM WTDDQ L+     
Sbjct  54   SKIVQLYAESARRKLLIFNAAGRALASAI------WDRPGGRLVGMAWTDDQVLVCVVQD  107

Query  359  RHRLPVLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                     A+    +  +GK+C    VVDCVFW  G+
Sbjct  108  GTVYRYNVHAELCAPQFSMGKECFEQGVVDCVFWGNGM  145



>ref|XP_009377216.1| PREDICTED: LOW QUALITY PROTEIN: protein VACUOLELESS1 [Pyrus x 
bretschneideri]
Length=831

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 34/93 (37%), Positives = 46/93 (49%), Gaps = 2/93 (2%)
 Frame = +2

Query  194  SKIVQLYSASTPFGSSESSTTTAIHIAQTVWRNPDRRLDGMFWTDDQTLILHYSGRHRLP  373
            SKIVQL   S        S+   + + +T+W++P  RL GM WTDDQ L+          
Sbjct  54   SKIVQLGGESAQRKLRIFSSAGHL-LGETIWKHPGGRLIGMAWTDDQNLVCLVQDGTVFR  112

Query  374  VLTSAQSLWNRSHLGKDCLTHSVVDCVFWNTGV  472
                A+ +     +GKD    +VVDCVFW  GV
Sbjct  113  YTIHAELVEPSISMGKD-FERNVVDCVFWGNGV  144



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557548962370