BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS096D11

Length=554
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009608928.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    300   7e-94   Nicotiana tomentosiformis
ref|XP_009803575.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    298   3e-93   Nicotiana sylvestris
ref|XP_004251613.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    295   4e-92   Solanum lycopersicum
ref|XP_008337363.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    291   9e-91   
ref|XP_009371440.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    291   1e-90   Pyrus x bretschneideri [bai li]
ref|XP_010254066.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    291   1e-90   Nelumbo nucifera [Indian lotus]
ref|XP_009374040.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    291   2e-90   Pyrus x bretschneideri [bai li]
gb|AFS41246.1|  cinnamoyl-CoA hydratase-dehydrogenase                   290   5e-90   Petunia x hybrida [garden petunia]
ref|XP_006353465.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    289   6e-90   Solanum tuberosum [potatoes]
gb|KDO42234.1|  hypothetical protein CISIN_1g004726mg                   284   1e-89   Citrus sinensis [apfelsine]
ref|XP_004287395.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    289   1e-89   Fragaria vesca subsp. vesca
gb|KDO42235.1|  hypothetical protein CISIN_1g004726mg                   285   1e-89   Citrus sinensis [apfelsine]
ref|XP_008242673.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    288   2e-89   Prunus mume [ume]
ref|XP_007204255.1|  hypothetical protein PRUPE_ppa002052mg             288   2e-89   Prunus persica
ref|XP_007013128.1|  Enoyl-CoA hydratase/isomerase family               287   4e-89   
gb|KDO42233.1|  hypothetical protein CISIN_1g004726mg                   284   4e-89   Citrus sinensis [apfelsine]
ref|XP_006352155.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    287   4e-89   Solanum tuberosum [potatoes]
ref|XP_011048390.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    287   5e-89   Populus euphratica
ref|XP_011048389.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    287   7e-89   Populus euphratica
ref|XP_006352154.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    287   8e-89   Solanum tuberosum [potatoes]
gb|KGN60609.1|  hypothetical protein Csa_2G003610                       285   1e-88   Cucumis sativus [cucumbers]
ref|XP_002324426.2|  hypothetical protein POPTR_0018s08940g             287   1e-88   
ref|XP_004242934.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    285   2e-88   Solanum lycopersicum
ref|XP_004139346.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    285   3e-88   Cucumis sativus [cucumbers]
ref|XP_010688243.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    285   4e-88   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU32938.1|  hypothetical protein MIMGU_mgv1a002041mg                285   4e-88   Erythranthe guttata [common monkey flower]
ref|XP_011078309.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    285   5e-88   Sesamum indicum [beniseed]
ref|XP_006451189.1|  hypothetical protein CICLE_v10007590mg             284   5e-88   
ref|XP_008354515.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    281   5e-88   
emb|CDP03312.1|  unnamed protein product                                284   6e-88   Coffea canephora [robusta coffee]
ref|XP_004164759.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    284   7e-88   
ref|XP_006451188.1|  hypothetical protein CICLE_v10007590mg             284   7e-88   Citrus clementina [clementine]
gb|KDO42231.1|  hypothetical protein CISIN_1g004726mg                   284   8e-88   Citrus sinensis [apfelsine]
ref|XP_006475648.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    284   8e-88   Citrus sinensis [apfelsine]
gb|KDO42232.1|  hypothetical protein CISIN_1g004726mg                   284   8e-88   Citrus sinensis [apfelsine]
gb|KDO42229.1|  hypothetical protein CISIN_1g004726mg                   284   9e-88   Citrus sinensis [apfelsine]
gb|KDO42228.1|  hypothetical protein CISIN_1g004726mg                   284   1e-87   Citrus sinensis [apfelsine]
ref|XP_009595622.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    283   1e-87   Nicotiana tomentosiformis
ref|XP_009766308.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    283   1e-87   Nicotiana sylvestris
ref|XP_008458462.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    282   4e-87   Cucumis melo [Oriental melon]
ref|XP_002284283.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    281   8e-87   Vitis vinifera
gb|KJB27144.1|  hypothetical protein B456_004G280500                    279   1e-86   Gossypium raimondii
ref|XP_003620604.1|  Peroxisomal fatty acid beta-oxidation multif...    279   4e-86   Medicago truncatula
gb|KJB27143.1|  hypothetical protein B456_004G280500                    279   5e-86   Gossypium raimondii
emb|CAN66465.1|  hypothetical protein VITISV_006222                     281   7e-86   Vitis vinifera
ref|XP_006283211.1|  hypothetical protein CARUB_v10004242mg             276   9e-85   Capsella rubella
ref|XP_010541187.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    276   1e-84   
emb|CDY35240.1|  BnaA01g07910D                                          275   2e-84   Brassica napus [oilseed rape]
gb|KDP33693.1|  hypothetical protein JCGZ_07264                         274   3e-84   Jatropha curcas
gb|ADU15551.1|  MFP                                                     274   3e-84   Gossypium hirsutum [American cotton]
emb|CDY06852.1|  BnaC01g09510D                                          274   4e-84   
ref|XP_002514279.1|  3-hydroxyacyl-CoA dehyrogenase, putative           274   5e-84   Ricinus communis
dbj|BAJ91250.1|  predicted protein                                      273   5e-84   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010089224.1|  Peroxisomal fatty acid beta-oxidation multif...    273   6e-84   
dbj|BAK04391.1|  predicted protein                                      273   8e-84   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDM81268.1|  unnamed protein product                                273   8e-84   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006412890.1|  hypothetical protein EUTSA_v10024533mg             272   2e-83   Eutrema salsugineum [saltwater cress]
ref|XP_004952203.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    272   3e-83   Setaria italica
gb|KFK29448.1|  hypothetical protein AALP_AA7G135800                    272   3e-83   Arabis alpina [alpine rockcress]
ref|XP_002451943.1|  hypothetical protein SORBIDRAFT_04g010370          271   5e-83   Sorghum bicolor [broomcorn]
ref|XP_009129069.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    271   6e-83   Brassica rapa
ref|XP_010100830.1|  Peroxisomal fatty acid beta-oxidation multif...    273   6e-83   
ref|XP_008679760.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    271   6e-83   
ref|XP_003572416.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    271   8e-83   Brachypodium distachyon [annual false brome]
dbj|BAJ93145.1|  predicted protein                                      271   8e-83   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004512985.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    269   1e-82   
emb|CDX97462.1|  BnaC08g13270D                                          270   1e-82   
ref|XP_004952202.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    271   1e-82   
gb|EMS66784.1|  Peroxisomal fatty acid beta-oxidation multifuncti...    268   2e-82   Triticum urartu
ref|XP_004512984.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    269   3e-82   Cicer arietinum [garbanzo]
ref|NP_001046536.1|  Os02g0274100                                       269   3e-82   
ref|XP_006647155.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    269   3e-82   Oryza brachyantha
gb|EEC72899.1|  hypothetical protein OsI_06722                          269   3e-82   Oryza sativa Indica Group [Indian rice]
gb|AAQ13901.1|  multifunctional protein                                 269   3e-82   Oryza sativa [red rice]
ref|XP_010089223.1|  Peroxisomal fatty acid beta-oxidation multif...    269   4e-82   Morus notabilis
ref|XP_004952201.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    268   6e-82   
ref|NP_001148087.1|  LOC100281695                                       268   6e-82   
ref|XP_009109066.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    268   6e-82   Brassica rapa
gb|KHN45635.1|  Peroxisomal fatty acid beta-oxidation multifuncti...    268   7e-82   Glycine soja [wild soybean]
ref|XP_003534202.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    268   8e-82   Glycine max [soybeans]
emb|CDX92908.1|  BnaC07g41660D                                          269   8e-82   
ref|XP_010047906.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    267   2e-81   Eucalyptus grandis [rose gum]
ref|XP_010050568.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    263   3e-81   
gb|KHN20673.1|  Peroxisomal fatty acid beta-oxidation multifuncti...    266   4e-81   Glycine soja [wild soybean]
ref|XP_003528905.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    266   5e-81   Glycine max [soybeans]
gb|AAL35606.1|AF442962_1  peroxisomal multifunctional protein           265   1e-80   Oryza sativa [red rice]
gb|EMT05771.1|  Peroxisomal fatty acid beta-oxidation multifuncti...    263   2e-80   
emb|CDY69211.1|  BnaCnng62430D                                          262   2e-80   Brassica napus [oilseed rape]
ref|XP_010438362.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    263   8e-80   Camelina sativa [gold-of-pleasure]
ref|XP_010433148.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    263   8e-80   Camelina sativa [gold-of-pleasure]
ref|NP_194630.1|  fatty acid beta-oxidation multifunctional prote...    263   9e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010447902.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    263   9e-80   Camelina sativa [gold-of-pleasure]
ref|XP_010925875.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    263   1e-79   Elaeis guineensis
ref|XP_009137821.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    262   1e-79   Brassica rapa
ref|XP_007152846.1|  hypothetical protein PHAVU_004G164800g             262   1e-79   Phaseolus vulgaris [French bean]
gb|EMT19952.1|  Peroxisomal fatty acid beta-oxidation multifuncti...    262   1e-79   
gb|KCW79923.1|  hypothetical protein EUGRSUZ_C01265                     262   1e-79   Eucalyptus grandis [rose gum]
ref|XP_008775812.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    262   1e-79   Phoenix dactylifera
gb|EMS59767.1|  Peroxisomal fatty acid beta-oxidation multifuncti...    263   2e-79   Triticum urartu
ref|XP_002867428.1|  hypothetical protein ARALYDRAFT_491857             262   2e-79   
ref|XP_009409458.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    261   5e-79   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011071437.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    260   1e-78   Sesamum indicum [beniseed]
gb|KJB07188.1|  hypothetical protein B456_001G006400                    259   2e-78   Gossypium raimondii
gb|KJB07187.1|  hypothetical protein B456_001G006400                    259   2e-78   Gossypium raimondii
ref|XP_006349823.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    259   2e-78   Solanum tuberosum [potatoes]
gb|EPS61414.1|  hypothetical protein M569_13383                         255   4e-78   Genlisea aurea
ref|XP_008344094.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    255   4e-78   
ref|XP_010314711.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    256   2e-77   Solanum lycopersicum
ref|XP_004252912.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    256   3e-77   Solanum lycopersicum
ref|XP_002516945.1|  3-hydroxyacyl-CoA dehyrogenase, putative           251   4e-77   
gb|AER62376.1|  hypothetical protein                                    245   4e-77   Hordeum vulgare subsp. spontaneum [wild barley]
gb|AER62392.1|  hypothetical protein                                    245   5e-77   Henrardia persica
dbj|BAG16526.1|  putative glyoxysomal fatty acid beta-oxidation m...    255   6e-77   Capsicum chinense [bonnet pepper]
gb|AER62400.1|  hypothetical protein                                    244   6e-77   Brachypodium sp. D49c
gb|AER62395.1|  hypothetical protein                                    245   7e-77   Hordeum bogdanii
gb|AER62391.1|  hypothetical protein                                    245   8e-77   Eremopyrum triticeum
gb|AER62383.1|  hypothetical protein                                    245   8e-77   Taeniatherum caput-medusae
gb|AER62399.1|  hypothetical protein                                    244   9e-77   Aegilops speltoides var. ligustica
gb|AER62398.1|  hypothetical protein                                    243   9e-77   Aegilops speltoides var. speltoides
gb|AER62386.1|  hypothetical protein                                    244   9e-77   Agropyron mongolicum
gb|AER62390.1|  hypothetical protein                                    244   1e-76   Eremopyrum bonaepartis
gb|AER62382.1|  hypothetical protein                                    244   1e-76   Taeniatherum caput-medusae
gb|AER62381.1|  hypothetical protein                                    244   2e-76   Pseudoroegneria spicata [beardless wheatgrass]
gb|EYU29809.1|  hypothetical protein MIMGU_mgv1a002065mg                254   2e-76   Erythranthe guttata [common monkey flower]
gb|AER62389.1|  hypothetical protein                                    244   2e-76   Australopyrum retrofractum
ref|XP_010915852.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    254   2e-76   Elaeis guineensis
ref|XP_008390228.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    254   2e-76   
gb|AER62378.1|  hypothetical protein                                    244   2e-76   Dasypyrum villosum
gb|EYU45545.1|  hypothetical protein MIMGU_mgv1a002038mg                253   3e-76   Erythranthe guttata [common monkey flower]
gb|AER62388.1|  hypothetical protein                                    243   3e-76   Australopyrum retrofractum
gb|AER62396.1|  hypothetical protein                                    243   3e-76   Hordeum marinum subsp. marinum
gb|AER62377.1|  hypothetical protein                                    243   3e-76   Aegilops tauschii
gb|AER62385.1|  hypothetical protein                                    243   3e-76   Dasypyrum villosum
gb|AER62402.1|  hypothetical protein                                    243   3e-76   Dasypyrum villosum
ref|XP_009769326.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    253   4e-76   Nicotiana sylvestris
emb|CDO98847.1|  unnamed protein product                                253   4e-76   Coffea canephora [robusta coffee]
gb|AER62384.1|  hypothetical protein                                    243   5e-76   Dasypyrum villosum
gb|AER62404.1|  hypothetical protein                                    243   5e-76   Secale cereale
gb|AER62379.1|  hypothetical protein                                    243   6e-76   Psathyrostachys juncea
ref|XP_008800762.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    253   6e-76   Phoenix dactylifera
gb|AER62387.1|  hypothetical protein                                    243   7e-76   Psathyrostachys juncea
ref|XP_011010197.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    251   2e-75   Populus euphratica
ref|XP_002314377.1|  MULTIFUNCTIONAL family protein                     251   2e-75   Populus trichocarpa [western balsam poplar]
ref|XP_006833340.1|  hypothetical protein AMTR_s00109p00083880          251   2e-75   Amborella trichopoda
ref|NP_001234975.1|  peroxisomal fatty acid beta-oxidation multif...    251   2e-75   
ref|XP_009124621.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    251   3e-75   Brassica rapa
gb|KHN02955.1|  Glyoxysomal fatty acid beta-oxidation multifuncti...    251   3e-75   Glycine soja [wild soybean]
ref|XP_009622777.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    250   4e-75   Nicotiana tomentosiformis
gb|AER62397.1|  hypothetical protein                                    240   5e-75   Aegilops longissima
gb|AER62380.1|  hypothetical protein                                    240   5e-75   Elymus libanoticus
ref|XP_009147124.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    250   5e-75   Brassica rapa
emb|CDY24662.1|  BnaA05g30610D                                          250   6e-75   Brassica napus [oilseed rape]
emb|CDY34924.1|  BnaA01g32550D                                          250   6e-75   Brassica napus [oilseed rape]
ref|XP_006380154.1|  MULTIFUNCTIONAL family protein                     249   7e-75   Populus trichocarpa [western balsam poplar]
gb|AFW80681.1|  hypothetical protein ZEAMMB73_867373                    243   8e-75   
ref|XP_006380155.1|  hypothetical protein POPTR_0008s22410g             249   8e-75   
gb|AFW65775.1|  hypothetical protein ZEAMMB73_546088                    241   1e-74   
ref|XP_007013129.1|  Enoyl-CoA hydratase/isomerase family               249   2e-74   
ref|XP_003529561.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    248   2e-74   Glycine max [soybeans]
ref|XP_006833339.1|  hypothetical protein AMTR_s00109p00082150          248   2e-74   Amborella trichopoda
ref|XP_004487834.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    248   2e-74   Cicer arietinum [garbanzo]
ref|XP_006600114.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    249   3e-74   Glycine max [soybeans]
ref|XP_010693603.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    248   3e-74   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB72709.1|  hypothetical protein B456_011G191800                    246   3e-74   Gossypium raimondii
emb|CDY05296.1|  BnaC05g45070D                                          248   4e-74   
ref|XP_002882497.1|  hypothetical protein ARALYDRAFT_478006             248   4e-74   
gb|KJB72710.1|  hypothetical protein B456_011G191800                    246   4e-74   Gossypium raimondii
gb|KCW61184.1|  hypothetical protein EUGRSUZ_H039482                    244   4e-74   Eucalyptus grandis [rose gum]
gb|KDO71725.1|  hypothetical protein CISIN_1g008576mg                   242   5e-74   Citrus sinensis [apfelsine]
emb|CDX74076.1|  BnaA03g29710D                                          247   5e-74   
gb|KDP27817.1|  hypothetical protein JCGZ_18897                         247   6e-74   Jatropha curcas
sp|O49809.2|MFPA_BRANA  RecName: Full=Glyoxysomal fatty acid beta...    247   6e-74   Brassica napus [oilseed rape]
emb|CDY08028.1|  BnaC03g34950D                                          247   6e-74   Brassica napus [oilseed rape]
gb|KDO71722.1|  hypothetical protein CISIN_1g008576mg                   243   6e-74   Citrus sinensis [apfelsine]
gb|KDO71721.1|  hypothetical protein CISIN_1g008576mg                   243   7e-74   Citrus sinensis [apfelsine]
ref|XP_007035631.1|  Multifunctional protein 2                          247   7e-74   
ref|XP_009623955.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    247   8e-74   Nicotiana tomentosiformis
ref|NP_187342.1|  fatty acid beta-oxidation multifunctional prote...    247   8e-74   Arabidopsis thaliana [mouse-ear cress]
gb|KJB72707.1|  hypothetical protein B456_011G191800                    246   9e-74   Gossypium raimondii
gb|KJB72711.1|  hypothetical protein B456_011G191800                    246   1e-73   Gossypium raimondii
ref|XP_010105147.1|  Glyoxysomal fatty acid beta-oxidation multif...    246   1e-73   Morus notabilis
gb|ABR18131.1|  unknown                                                 246   1e-73   Picea sitchensis
ref|XP_006407895.1|  hypothetical protein EUTSA_v10020152mg             246   1e-73   Eutrema salsugineum [saltwater cress]
gb|KDO71719.1|  hypothetical protein CISIN_1g008576mg                   243   1e-73   Citrus sinensis [apfelsine]
gb|KJB72706.1|  hypothetical protein B456_011G191800                    246   1e-73   Gossypium raimondii
gb|KDO71723.1|  hypothetical protein CISIN_1g008576mg                   243   1e-73   Citrus sinensis [apfelsine]
gb|KDO71724.1|  hypothetical protein CISIN_1g008576mg                   242   1e-73   Citrus sinensis [apfelsine]
ref|XP_004508202.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    246   1e-73   Cicer arietinum [garbanzo]
ref|XP_007154175.1|  hypothetical protein PHAVU_003G096500g             246   2e-73   Phaseolus vulgaris [French bean]
ref|XP_010486216.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    246   2e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010445439.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    243   2e-73   Camelina sativa [gold-of-pleasure]
ref|XP_011003910.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    246   2e-73   Populus euphratica
ref|XP_006365183.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    245   2e-73   Solanum tuberosum [potatoes]
gb|EPS73418.1|  hypothetical protein M569_01334                         245   2e-73   Genlisea aurea
ref|XP_010464276.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    245   3e-73   Camelina sativa [gold-of-pleasure]
gb|KHG21889.1|  Peroxisomal fatty acid beta-oxidation multifuncti...    245   3e-73   Gossypium arboreum [tree cotton]
gb|AER62403.1|  hypothetical protein                                    236   3e-73   Elymus libanoticus
gb|ABK24476.1|  unknown                                                 245   3e-73   Picea sitchensis
ref|XP_006297065.1|  hypothetical protein CARUB_v10013066mg             245   3e-73   Capsella rubella
ref|XP_008784762.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    243   4e-73   
gb|AES91892.2|  glyoxysomal fatty acid beta-oxidation MFP-A protein     245   4e-73   Medicago truncatula
gb|KJB34649.1|  hypothetical protein B456_006G076600                    245   4e-73   Gossypium raimondii
ref|XP_003550336.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    244   6e-73   Glycine max [soybeans]
ref|XP_010024717.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    244   8e-73   Eucalyptus grandis [rose gum]
ref|XP_004968710.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    244   8e-73   Setaria italica
ref|XP_002270067.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    244   8e-73   Vitis vinifera
gb|KCW61185.1|  hypothetical protein EUGRSUZ_H039482                    244   1e-72   Eucalyptus grandis [rose gum]
ref|XP_010524718.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    244   1e-72   Tarenaya hassleriana [spider flower]
ref|XP_010445530.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    244   1e-72   Camelina sativa [gold-of-pleasure]
gb|KHG21753.1|  Peroxisomal fatty acid beta-oxidation multifuncti...    244   1e-72   Gossypium arboreum [tree cotton]
ref|XP_010325170.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    243   1e-72   Solanum lycopersicum
dbj|BAJ86175.1|  predicted protein                                      244   1e-72   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001042973.1|  Os01g0348600                                       243   2e-72   
gb|AIL29217.1|  fatty acid beta-oxidation multifunctional protein       243   2e-72   Camellia oleifera [abura-tsubaki]
emb|CBI22983.3|  unnamed protein product                                244   2e-72   Vitis vinifera
gb|KFK38149.1|  hypothetical protein AALP_AA3G075600                    243   2e-72   Arabis alpina [alpine rockcress]
ref|XP_003578000.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    243   2e-72   Brachypodium distachyon [annual false brome]
ref|XP_006419532.1|  hypothetical protein CICLE_v10004429mg             243   2e-72   Citrus clementina [clementine]
ref|XP_008784760.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    243   3e-72   Phoenix dactylifera
ref|XP_009134933.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    243   3e-72   Brassica rapa
ref|XP_010259502.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    243   3e-72   Nelumbo nucifera [Indian lotus]
gb|ACN35901.1|  unknown                                                 243   4e-72   Zea mays [maize]
ref|XP_007012079.1|  Enoyl-CoA hydratase/isomerase family isoform 2     242   4e-72   
ref|XP_009413815.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    241   4e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007012081.1|  Enoyl-CoA hydratase/isomerase family, putati...    242   4e-72   
ref|XP_008784761.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    241   5e-72   Phoenix dactylifera
ref|XP_008810214.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    242   5e-72   Phoenix dactylifera
ref|XP_009413814.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    242   6e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004153517.1|  PREDICTED: LOW QUALITY PROTEIN: glyoxysomal ...    232   8e-72   
ref|XP_004153595.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    233   8e-72   
emb|CDM81353.1|  unnamed protein product                                241   9e-72   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010931678.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    241   9e-72   Elaeis guineensis
ref|NP_001152306.1|  glyoxysomal fatty acid beta-oxidation multif...    241   9e-72   Zea mays [maize]
ref|XP_006489051.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    241   1e-71   
ref|XP_006840485.1|  hypothetical protein AMTR_s00045p00190660          241   1e-71   
ref|XP_007012078.1|  Peroxisomal fatty acid beta-oxidation multif...    242   1e-71   
ref|XP_008390640.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    241   2e-71   
gb|KJB64950.1|  hypothetical protein B456_010G073100                    237   2e-71   Gossypium raimondii
gb|KJB64949.1|  hypothetical protein B456_010G073100                    237   2e-71   Gossypium raimondii
emb|CAA55910.1|  protein MFP-b                                          239   2e-71   Cucumis sativus [cucumbers]
ref|XP_008340793.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    240   3e-71   
ref|XP_010547011.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    239   4e-71   Tarenaya hassleriana [spider flower]
ref|XP_001780666.1|  predicted protein                                  239   4e-71   
ref|XP_004296857.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    239   6e-71   Fragaria vesca subsp. vesca
ref|XP_008458418.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    239   7e-71   Cucumis melo [Oriental melon]
ref|XP_004148210.1|  PREDICTED: LOW QUALITY PROTEIN: glyoxysomal ...    239   8e-71   
gb|KEH37224.1|  glyoxysomal fatty acid beta-oxidation MFP-A protein     239   9e-71   Medicago truncatula
ref|XP_004168411.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    239   1e-70   
ref|XP_010921650.1|  PREDICTED: LOW QUALITY PROTEIN: glyoxysomal ...    238   1e-70   Elaeis guineensis
ref|XP_008458439.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    238   1e-70   Cucumis melo [Oriental melon]
ref|XP_003609695.1|  Glyoxysomal fatty acid beta-oxidation multif...    238   1e-70   
ref|XP_004168410.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    239   2e-70   
gb|KGN47371.1|  hypothetical protein Csa_6G306330                       239   2e-70   Cucumis sativus [cucumbers]
ref|XP_009604119.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    237   2e-70   Nicotiana tomentosiformis
ref|XP_007221966.1|  hypothetical protein PRUPE_ppa002036mg             237   4e-70   Prunus persica
ref|XP_008223215.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    237   4e-70   Prunus mume [ume]
ref|XP_009352290.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    237   4e-70   Pyrus x bretschneideri [bai li]
ref|XP_004173119.1|  PREDICTED: LOW QUALITY PROTEIN: glyoxysomal ...    231   5e-70   
ref|XP_006644156.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    237   5e-70   Oryza brachyantha
gb|KJB64948.1|  hypothetical protein B456_010G073100                    236   5e-70   Gossypium raimondii
gb|KCW61179.1|  hypothetical protein EUGRSUZ_H03943                     234   6e-70   Eucalyptus grandis [rose gum]
dbj|BAG80663.1|  multifunctional protein                                234   2e-69   Nicotiana tabacum [American tobacco]
gb|EMS61353.1|  Glyoxysomal fatty acid beta-oxidation multifuncti...    235   2e-69   Triticum urartu
ref|XP_009787311.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    234   3e-69   Nicotiana sylvestris
ref|XP_007154174.1|  hypothetical protein PHAVU_003G096400g             234   7e-69   Phaseolus vulgaris [French bean]
ref|XP_009381090.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    233   1e-68   Musa acuminata subsp. malaccensis [pisang utan]
gb|KGN47431.1|  hypothetical protein Csa_6G319770                       233   1e-68   Cucumis sativus [cucumbers]
dbj|BAJ85471.1|  predicted protein                                      231   6e-68   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001765398.1|  predicted protein                                  230   1e-67   
gb|AAV32217.1|  putative fatty acid beta-oxidation multifunctiona...    229   2e-67   Oryza sativa Japonica Group [Japonica rice]
gb|EMS51968.1|  Glyoxysomal fatty acid beta-oxidation multifuncti...    229   2e-67   Triticum urartu
gb|KHG01746.1|  Peroxisomal fatty acid beta-oxidation multifuncti...    229   3e-67   Gossypium arboreum [tree cotton]
gb|EEE59589.1|  hypothetical protein OsJ_11897                          229   3e-67   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054687.1|  Os05g0155000                                       229   4e-67   
ref|XP_003569321.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    229   5e-67   Brachypodium distachyon [annual false brome]
ref|XP_001773623.1|  predicted protein                                  228   9e-67   
gb|EMT06606.1|  Glyoxysomal fatty acid beta-oxidation multifuncti...    228   1e-66   
ref|XP_002966745.1|  hypothetical protein SELMODRAFT_168461             225   8e-66   Selaginella moellendorffii
ref|XP_002978003.1|  hypothetical protein SELMODRAFT_176660             225   8e-66   Selaginella moellendorffii
ref|XP_004962329.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    224   1e-65   
ref|XP_004962328.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    225   2e-65   
ref|XP_008646894.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    223   3e-65   
gb|KHN03349.1|  Glyoxysomal fatty acid beta-oxidation multifuncti...    224   3e-65   
ref|XP_006354399.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    223   4e-65   
ref|XP_008649524.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    223   6e-65   
ref|XP_008649523.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    223   7e-65   
gb|EEC79068.1|  hypothetical protein OsI_19644                          223   9e-65   
ref|XP_002439650.1|  hypothetical protein SORBIDRAFT_09g017970          223   9e-65   
gb|EEE63425.1|  hypothetical protein OsJ_18237                          222   1e-64   
gb|AAT38103.1|  putative glyoxysomal fatty acid beta-oxidation mu...    222   1e-64   
gb|KDO71720.1|  hypothetical protein CISIN_1g008576mg                   214   3e-64   
ref|XP_006654304.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    221   4e-64   
ref|XP_010039870.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    218   5e-63   
ref|XP_006342814.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    218   7e-63   
ref|XP_010321770.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    217   2e-62   
gb|EMT31909.1|  Glyoxysomal fatty acid beta-oxidation multifuncti...    212   7e-61   
ref|XP_007050972.1|  Multifunctional protein 2, putative isoform 3      210   1e-60   
ref|XP_005643487.1|  putative glyoxysomal fatty acid beta-oxidati...    209   1e-59   
gb|KDD75648.1|  3-hydroxyacyl-CoA dehydrogenase                         208   1e-59   
ref|XP_007050971.1|  Multifunctional protein 2, putative isoform 2      208   1e-59   
ref|XP_007050970.1|  Multifunctional protein 2, putative isoform 1      209   1e-59   
ref|XP_005844329.1|  hypothetical protein CHLNCDRAFT_59763              202   2e-57   
ref|XP_009393205.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    202   4e-57   
ref|XP_011398680.1|  Glyoxysomal fatty acid beta-oxidation multif...    198   5e-56   
ref|NP_001055313.1|  Os05g0362100                                       193   2e-55   
ref|XP_002504050.1|  predicted protein                                  194   2e-54   
ref|XP_002949054.1|  hypothetical protein VOLCADRAFT_74021              185   3e-51   
ref|XP_002966785.1|  hypothetical protein SELMODRAFT_439712             180   2e-49   
ref|XP_002977962.1|  hypothetical protein SELMODRAFT_176615             180   2e-49   
ref|XP_011082448.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    176   7e-48   
ref|XP_001417042.1|  predicted protein                                  176   7e-48   
ref|XP_011082449.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    176   7e-48   
ref|XP_011082447.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    176   8e-48   
ref|XP_009621182.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    161   7e-46   
gb|EEE56719.1|  hypothetical protein OsJ_06221                          166   2e-45   
ref|XP_006355814.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    167   4e-45   
gb|EEC78551.1|  hypothetical protein OsI_18514                          164   4e-45   
ref|XP_006355813.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    167   5e-45   
ref|XP_006355812.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    167   7e-45   
emb|CEF97273.1|  6-phosphogluconate dehydrogenase,C-terminal-like       166   3e-44   
ref|XP_001699366.1|  hypothetical protein CHLREDRAFT_132158             166   3e-44   
ref|XP_010321853.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    163   2e-43   
ref|XP_003078359.1|  putative tetrafunct (ISS)                          166   3e-43   
ref|XP_004240549.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    163   3e-43   
gb|EYU42227.1|  hypothetical protein MIMGU_mgv1a002069mg                160   2e-42   
ref|XP_003054896.1|  predicted protein                                  157   2e-41   
ref|WP_025561488.1|  MULTISPECIES: hypothetical protein                 155   2e-40   
ref|XP_005718521.1|  Fatty acid beta-oxydation multifunctional pr...    157   2e-40   
ref|WP_028879689.1|  3-hydroxyacyl-CoA dehydrogenase                    154   4e-40   
gb|AHB60730.1|  3-hydroxyacyl-CoA dehydrogenase                         149   9e-40   
gb|ABK96102.1|  unknown                                                 149   9e-40   
ref|WP_025050980.1|  3-hydroxyacyl-CoA dehydrogenase                    152   1e-39   
ref|XP_007512071.1|  predicted protein                                  152   2e-39   
ref|WP_008248066.1|  3-hydroxyacyl-CoA dehydrogenase                    152   3e-39   
ref|XP_009371482.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    150   3e-39   
ref|XP_005703692.1|  peroxisomal fatty acid beta-oxidation multif...    152   9e-39   
ref|WP_037924779.1|  3-hydroxyacyl-CoA dehydrogenase                    149   1e-38   
ref|WP_026244426.1|  3-hydroxyacyl-CoA dehydrogenase                    149   2e-38   
dbj|BAL56908.1|  3-hydroxybutyryl-CoA dehydrogenase                     144   2e-38   
ref|WP_028954991.1|  3-hydroxyacyl-CoA dehydrogenase                    149   3e-38   
dbj|BAD94583.1|  AIM1 protein                                           145   9e-38   
ref|WP_023049524.1|  3-hydroxyacyl-CoA dehydrogenase                    145   1e-37   
gb|KGI92141.1|  3-hydroxyacyl-CoA dehydrogenase                         147   1e-37   
ref|WP_029524990.1|  3-hydroxyacyl-CoA dehydrogenase                    147   2e-37   
ref|XP_004338983.1|  3hydroxyacyl-CoA dehydrogenase, NAD binding ...    145   2e-37   
ref|WP_033698560.1|  3-hydroxyacyl-CoA dehydrogenase                    147   2e-37   
ref|WP_028613423.1|  3-hydroxyacyl-CoA dehydrogenase                    147   2e-37   
ref|WP_043745398.1|  3-hydroxyacyl-CoA dehydrogenase                    146   2e-37   
gb|EAQ14510.1|  enoyl-CoA hydratase/isomerase/3-hydroxyacyl-CoA d...    146   2e-37   
ref|WP_019560772.1|  3-hydroxyacyl-CoA dehydrogenase                    145   4e-37   
ref|WP_011722923.1|  MULTISPECIES: 3-hydroxybutyryl-CoA dehydroge...    140   8e-37   
ref|WP_028624907.1|  3-hydroxyacyl-CoA dehydrogenase                    145   9e-37   
ref|WP_027693283.1|  MULTISPECIES: 3-hydroxyacyl-CoA dehydrogenase      145   9e-37   
ref|WP_028040627.1|  3-hydroxyacyl-CoA dehydrogenase                    144   1e-36   
ref|WP_027596381.1|  3-hydroxyacyl-CoA dehydrogenase                    144   1e-36   
ref|WP_036202130.1|  3-hydroxyacyl-CoA dehydrogenase                    144   1e-36   
ref|WP_012518226.1|  3-hydroxyacyl-CoA dehydrogenase                    144   1e-36   
ref|WP_011801233.1|  3-hydroxyacyl-CoA dehydrogenase                    144   1e-36   
ref|WP_006913995.1|  3-hydroxyacyl-CoA dehydrogenase                    144   1e-36   
ref|WP_043202980.1|  3-hydroxyacyl-CoA dehydrogenase                    144   1e-36   
ref|WP_008920073.1|  3-hydroxyacyl-CoA dehydrogenase                    142   1e-36   
gb|EWS60902.1|  Fatty acid oxidation complex subunit alpha              142   1e-36   
ref|WP_039632841.1|  3-hydroxybutyryl-CoA dehydrogenase                 139   1e-36   
ref|WP_024016196.1|  3-hydroxyacyl-CoA dehydrogenase                    144   2e-36   
ref|WP_006993799.1|  MULTISPECIES: 3-hydroxyacyl-CoA dehydrogenase      144   2e-36   
ref|WP_020745822.1|  3-hydroxyacyl-CoA dehydrogenase                    144   2e-36   
ref|WP_042660361.1|  hypothetical protein                               141   2e-36   
ref|WP_043101817.1|  3-hydroxyacyl-CoA dehydrogenase                    144   2e-36   
ref|WP_040616999.1|  3-hydroxyacyl-CoA dehydrogenase                    144   2e-36   
ref|WP_020743438.1|  3-hydroxyacyl-CoA dehydrogenase                    144   2e-36   
ref|WP_014810758.1|  3-hydroxyacyl-CoA dehydrogenase                    144   2e-36   
ref|WP_041015464.1|  3-hydroxyacyl-CoA dehydrogenase                    144   2e-36   
ref|WP_025254989.1|  3-hydroxyacyl-CoA dehydrogenase                    144   2e-36   
ref|WP_008756777.1|  3-hydroxyacyl-CoA dehydrogenase                    143   2e-36   
ref|WP_035521929.1|  3-hydroxyacyl-CoA dehydrogenase                    141   2e-36   
ref|WP_024717595.1|  3-hydroxyacyl-CoA dehydrogenase                    143   3e-36   
ref|WP_040885787.1|  3-hydroxyacyl-CoA dehydrogenase                    143   3e-36   
ref|WP_016500611.1|  putative fatty acid oxidation complex alpha ...    143   3e-36   
ref|WP_011829371.1|  3-hydroxyacyl-CoA dehydrogenase                    143   3e-36   
ref|WP_034766445.1|  3-hydroxyacyl-CoA dehydrogenase                    141   3e-36   
ref|WP_027830456.1|  3-hydroxyacyl-CoA dehydrogenase                    143   3e-36   
gb|KCZ47514.1|  hypothetical protein HY17_18635                         141   3e-36   
ref|XP_005101104.1|  PREDICTED: peroxisomal bifunctional enzyme-like    143   3e-36   
ref|WP_005258491.1|  hypothetical protein                               143   4e-36   
gb|EFO31223.1|  noyl-CoA hydratase/3,2-trans-enoyl-CoA isomerase/...    144   4e-36   
ref|WP_003282459.1|  3-hydroxyacyl-CoA dehydrogenase                    143   4e-36   
ref|WP_009806491.1|  3-hydroxyacyl-CoA dehydrogenase                    143   4e-36   
ref|WP_016395069.1|  short chain enoyl-CoA hydratase / 3-hydroxya...    143   5e-36   
ref|WP_011574730.1|  3-hydroxyacyl-CoA dehydrogenase                    143   5e-36   
ref|WP_035079765.1|  3-hydroxyacyl-CoA dehydrogenase                    142   5e-36   
ref|XP_393806.2|  PREDICTED: trifunctional enzyme subunit alpha, ...    143   5e-36   
ref|WP_039229750.1|  3-hydroxyacyl-CoA dehydrogenase                    142   6e-36   
ref|WP_025043619.1|  3-hydroxyacyl-CoA dehydrogenase                    142   6e-36   
ref|WP_036804636.1|  3-hydroxyacyl-CoA dehydrogenase                    142   6e-36   
emb|CCF79063.1|  NAD-dependent beta-hydroxybutyryl-CoA dehydrogenase    134   6e-36   
gb|KHA51157.1|  Enoyl-CoA hydratase/isomerase/3-hydroxyacyl-CoA d...    142   6e-36   
ref|WP_008940340.1|  fatty oxidation complex alpha subunit              142   6e-36   
emb|CCF79065.1|  NAD-dependent beta-hydroxybutyryl-CoA dehydrogenase    134   6e-36   
ref|WP_007155731.1|  3-hydroxyacyl-CoA dehydrogenase                    142   7e-36   
ref|WP_008095586.1|  3-hydroxyacyl-CoA dehydrogenase                    142   7e-36   
ref|XP_005538607.1|  fusion protein of glyoxysomal fatty acid oxi...    144   7e-36   
ref|WP_007106530.1|  3-hydroxyacyl-CoA dehydrogenase                    142   7e-36   
ref|WP_014998153.1|  3-hydroxyacyl-CoA dehydrogenase                    142   7e-36   
ref|WP_026780048.1|  3-hydroxyacyl-CoA dehydrogenase                    142   8e-36   
ref|WP_017245866.1|  3-hydroxyacyl-CoA dehydrogenase                    142   9e-36   
ref|WP_037905846.1|  3-hydroxyacyl-CoA dehydrogenase                    142   9e-36   
ref|WP_007988043.1|  MULTISPECIES: 3-hydroxyacyl-CoA dehydrogenase      142   9e-36   
ref|WP_013753694.1|  3-hydroxyacyl-CoA dehydrogenase                    142   9e-36   
ref|WP_011483487.1|  3-hydroxyacyl-CoA dehydrogenase                    142   9e-36   
ref|WP_039282046.1|  3-hydroxybutyryl-CoA dehydrogenase                 137   1e-35   
ref|WP_028286797.1|  3-hydroxyacyl-CoA dehydrogenase                    142   1e-35   
ref|WP_014979125.1|  3-hydroxyacyl-CoA dehydrogenase                    142   1e-35   
ref|WP_014976334.1|  3-hydroxyacyl-CoA dehydrogenase                    142   1e-35   
ref|WP_014949230.1|  3-hydroxyacyl-CoA dehydrogenase                    142   1e-35   
ref|WP_039232506.1|  3-hydroxyacyl-CoA dehydrogenase                    142   1e-35   
gb|ELU09146.1|  hypothetical protein CAPTEDRAFT_228818                  140   1e-35   
ref|WP_018715810.1|  3-hydroxybutyryl-CoA dehydrogenase                 136   1e-35   
ref|WP_039237976.1|  MULTISPECIES: 3-hydroxybutyryl-CoA dehydroge...    136   2e-35   
ref|WP_038664936.1|  3-hydroxyacyl-CoA dehydrogenase                    141   2e-35   
ref|WP_040192666.1|  3-hydroxybutyryl-CoA dehydrogenase                 136   2e-35   
ref|WP_036247721.1|  3-hydroxyacyl-CoA dehydrogenase                    141   2e-35   
dbj|BAO83317.1|  3-hydroxyacyl-CoA dehydrogenase                        141   2e-35   
ref|WP_042116214.1|  3-hydroxyacyl-CoA dehydrogenase                    141   2e-35   
ref|XP_002776796.1|  3-hydroxyacyl-CoA dehyrogenase, putative           141   2e-35   
ref|WP_011723049.1|  3-hydroxybutyryl-CoA dehydrogenase                 136   2e-35   
ref|WP_017751920.1|  3-hydroxybutyryl-CoA dehydrogenase                 136   2e-35   
ref|WP_034356130.1|  3-hydroxyacyl-CoA dehydrogenase                    141   2e-35   
ref|WP_027675129.1|  3-hydroxyacyl-CoA dehydrogenase                    141   2e-35   
ref|WP_039224018.1|  3-hydroxyacyl-CoA dehydrogenase                    141   2e-35   
ref|WP_041604808.1|  3-hydroxyacyl-CoA dehydrogenase                    141   2e-35   
gb|AFK52471.1|  peroxisomal bifunctional enzyme                         141   2e-35   
ref|XP_004345013.1|  trifunctional protein                              141   2e-35   
ref|WP_039014311.1|  3-hydroxyacyl-CoA dehydrogenase                    136   3e-35   
ref|WP_003364514.1|  MULTISPECIES: 3-hydroxybutyryl-CoA dehydroge...    135   3e-35   
ref|WP_027263043.1|  3-hydroxyacyl-CoA dehydrogenase                    140   3e-35   
ref|WP_029375124.1|  3-hydroxyacyl-CoA dehydrogenase                    140   3e-35   
ref|WP_011100550.1|  3-hydroxybutyryl-CoA dehydrogenase                 135   3e-35   
ref|WP_019407373.1|  3-hydroxyacyl-CoA dehydrogenase                    140   3e-35   
ref|WP_027355767.1|  3-hydroxybutyryl-CoA dehydrogenase                 135   3e-35   
ref|WP_026163888.1|  3-hydroxyacyl-CoA dehydrogenase                    139   3e-35   
ref|WP_013981300.1|  3-hydroxyacyl-CoA dehydrogenase                    140   3e-35   
ref|WP_041645923.1|  3-hydroxyacyl-CoA dehydrogenase                    140   3e-35   
ref|WP_040602530.1|  3-hydroxyacyl-CoA dehydrogenase                    139   3e-35   
ref|WP_011464671.1|  3-hydroxyacyl-CoA dehydrogenase                    140   3e-35   
gb|ADP99705.1|  fatty oxidation complex alpha subunit                   140   3e-35   
ref|WP_034690843.1|  3-hydroxyacyl-CoA dehydrogenase                    140   4e-35   
ref|WP_021245978.1|  hypothetical protein                               138   4e-35   
ref|WP_025049652.1|  3-hydroxyacyl-CoA dehydrogenase                    140   4e-35   
ref|WP_020228723.1|  hypothetical protein                               140   4e-35   
gb|AIZ03737.1|  3-hydroxybutyryl-CoA dehydrogenase                      135   5e-35   
ref|WP_025899532.1|  3-hydroxyacyl-CoA dehydrogenase                    140   5e-35   
ref|WP_013783790.1|  3-hydroxyacyl-CoA dehydrogenase                    140   5e-35   
ref|WP_020309042.1|  enoyl-CoA hydratase                                140   5e-35   
ref|WP_008091284.1|  3-hydroxyacyl-CoA dehydrogenase                    140   5e-35   
ref|WP_039257174.1|  3-hydroxybutyryl-CoA dehydrogenase                 135   5e-35   
ref|WP_011911348.1|  3-hydroxyacyl-CoA dehydrogenase                    140   5e-35   
ref|WP_035250311.1|  3-hydroxyacyl-CoA dehydrogenase                    140   5e-35   
ref|WP_015063253.1|  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA ...    137   5e-35   
ref|WP_043358128.1|  3-hydroxyacyl-CoA dehydrogenase                    138   6e-35   
dbj|BAP77612.1|  enoyl-CoA hydratase                                    140   6e-35   
ref|WP_014595385.1|  3-hydroxyacyl-CoA dehydrogenase                    140   6e-35   
ref|WP_039989632.1|  3-hydroxyacyl-CoA dehydrogenase                    140   6e-35   
ref|WP_039259812.1|  3-hydroxybutyryl-CoA dehydrogenase                 135   6e-35   
emb|CBA26305.1|  Peroxisomal bifunctional enzyme                        140   6e-35   
ref|WP_020797734.1|  MULTISPECIES: 3-hydroxyacyl-CoA dehydrogenase      139   6e-35   
ref|WP_019374665.1|  3-hydroxyacyl-CoA dehydrogenase                    138   7e-35   
ref|WP_010656493.1|  3-hydroxyacyl-CoA dehydrogenase                    139   7e-35   
ref|WP_013901329.1|  3-hydroxyacyl-CoA dehydrogenase                    139   7e-35   
dbj|GAC19735.1|  3-hydroxyacyl-CoA dehydrogenase                        139   7e-35   
ref|WP_010237079.1|  3-hydroxybutyryl-CoA dehydrogenase                 134   8e-35   
ref|XP_006614173.1|  PREDICTED: trifunctional enzyme subunit alph...    140   8e-35   
ref|WP_037484899.1|  3-hydroxyacyl-CoA dehydrogenase                    139   8e-35   
ref|WP_003445569.1|  short chain enoyl-CoA hydratase / 3-hydroxya...    139   8e-35   
gb|ERO64156.1|  hypothetical protein P308_02595                         138   8e-35   
ref|WP_035845661.1|  3-hydroxyacyl-CoA dehydrogenase                    139   9e-35   
ref|WP_036133872.1|  3-hydroxyacyl-CoA dehydrogenase                    139   9e-35   
gb|ETO31814.1|  3-hydroxyacyl-CoA dehydrogenase, domain family          135   1e-34   
ref|WP_007874497.1|  3-hydroxyacyl-CoA dehydrogenase                    139   1e-34   
gb|KCZ86205.1|  NAD-binding 3-hydroxyacyl-CoA dehydrogenase             137   1e-34   
ref|WP_019408228.1|  hypothetical protein                               139   1e-34   
ref|WP_035571035.1|  3-hydroxyacyl-CoA dehydrogenase                    137   1e-34   
ref|WP_026377146.1|  3-hydroxyacyl-CoA dehydrogenase                    139   1e-34   
ref|WP_040603066.1|  3-hydroxyacyl-CoA dehydrogenase                    139   1e-34   
ref|WP_033370966.1|  3-hydroxyacyl-CoA dehydrogenase                    136   1e-34   
ref|WP_025249076.1|  3-hydroxyacyl-CoA dehydrogenase                    139   1e-34   
ref|WP_032096580.1|  MULTISPECIES: 3-hydroxyacyl-CoA dehydrogenase      139   2e-34   
ref|WP_027363719.1|  3-hydroxybutyryl-CoA dehydrogenase                 134   2e-34   
gb|EQA98715.1|  hypothetical protein L485_16985                         139   2e-34   
ref|WP_012138386.1|  fatty oxidation complex alpha subunit              139   2e-34   
emb|CCF78542.1|  NAD-dependent beta-hydroxybutyryl-CoA dehydrogenase    134   2e-34   
ref|WP_008842912.1|  3-hydroxyacyl-CoA dehydrogenase                    139   2e-34   
ref|WP_011300913.1|  3-hydroxyacyl-CoA dehydrogenase                    136   2e-34   
ref|WP_005794402.1|  3-hydroxyacyl-CoA dehydrogenase                    138   2e-34   
ref|WP_011795967.1|  3-hydroxyacyl-CoA dehydrogenase                    138   2e-34   
ref|WP_036681167.1|  3-hydroxybutyryl-CoA dehydrogenase                 134   2e-34   
ref|WP_015478679.1|  short chain enoyl-CoA hydratase / 3-hydroxya...    138   2e-34   
ref|WP_038339213.1|  3-hydroxyacyl-CoA dehydrogenase                    138   2e-34   
ref|WP_007117716.1|  3-hydroxyacyl-CoA dehydrogenase                    138   2e-34   
ref|WP_014822120.1|  3-hydroxyacyl-CoA dehydrogenase                    138   2e-34   
dbj|BAO81062.1|  3-hydroxyacyl-CoA dehydrogenase                        138   2e-34   



>ref|XP_009608928.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 [Nicotiana tomentosiformis]
Length=724

 Score =   300 bits (767),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S +    D+GLKP  +KKVA+IGGGLMGSGIATAL+LSNI V+LKEINPEYL KG+K
Sbjct  290  RATSKVPNVTDIGLKPRPMKKVAIIGGGLMGSGIATALVLSNIFVILKEINPEYLQKGIK  349

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             +E N+RGLV+RKKL QDKA K+LSI+KG LDYSEF+DVDMVIEAVIEN PLKQ+IFSDI
Sbjct  350  AVEANIRGLVARKKLQQDKANKALSIVKGVLDYSEFKDVDMVIEAVIENFPLKQQIFSDI  409

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQT  552
            EK CPSHCILATNTSTIDLN+IG++TRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ 
Sbjct  410  EKVCPSHCILATNTSTIDLNLIGEKTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQA  468



>ref|XP_009803575.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 [Nicotiana sylvestris]
Length=725

 Score =   298 bits (763),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            D+GLKP  +KKVA+IGGGLMGSGIATAL+LSNI V+LKEINPEYL +G+K +E N+RGLV
Sbjct  300  DIGLKPRPMKKVAIIGGGLMGSGIATALVLSNIFVILKEINPEYLQRGIKAVEANIRGLV  359

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            +RKKL QDKA K+LSI+KG LDYSEF+DVDMVIEAVIENVPLKQ+IFSDIEK CP HCIL
Sbjct  360  ARKKLQQDKANKALSIVKGVLDYSEFKDVDMVIEAVIENVPLKQQIFSDIEKVCPPHCIL  419

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQT  552
            ATNTSTIDLN+IG++TRSQDR+IGAHFFSPAHVMPLLEIVRTEKTSAQ 
Sbjct  420  ATNTSTIDLNLIGEKTRSQDRVIGAHFFSPAHVMPLLEIVRTEKTSAQA  468



>ref|XP_004251613.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 [Solanum lycopersicum]
Length=724

 Score =   295 bits (755),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S +    D+GLKP S+KKVA+IGGGLMGSGIAT+L+LSNI V++KEINPEYL KG+K
Sbjct  290  RATSKVPNVTDIGLKPRSVKKVAIIGGGLMGSGIATSLVLSNIFVIIKEINPEYLQKGIK  349

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
            T+E N+RGLV+RKKL QDKA K+LS++KG LDYSEF+DVDMVIEAVIENVPLKQ+IF DI
Sbjct  350  TVEANIRGLVARKKLQQDKANKALSMVKGVLDYSEFKDVDMVIEAVIENVPLKQQIFIDI  409

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQT  552
            EK CP HCILA+NTSTIDLNIIGQ+T SQDRIIGAHFFSPAHVMPLLEI+RTEKTSAQ 
Sbjct  410  EKICPPHCILASNTSTIDLNIIGQKTSSQDRIIGAHFFSPAHVMPLLEIIRTEKTSAQA  468



>ref|XP_008337363.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Malus domestica]
Length=724

 Score =   291 bits (746),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 138/178 (78%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S +    DVGLKP  IKKVAVIGGGLMGSGIATALL+SNI+VVLKE+N EYL KG+K
Sbjct  290  RATSKVPNVTDVGLKPRQIKKVAVIGGGLMGSGIATALLVSNISVVLKEVNSEYLQKGIK  349

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
            TIEGNV+GLV+R++L QDKA+K+L +LKG+LDYS+F+DVDMVIEAVIE+VPLKQKIFS++
Sbjct  350  TIEGNVKGLVTRRRLTQDKAQKALXLLKGSLDYSDFKDVDMVIEAVIESVPLKQKIFSEL  409

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CPSHC+LATNTSTIDLN++G++T S DRI+GAHFFSPAHVMPLLEIVRTEKTSAQ
Sbjct  410  EKVCPSHCVLATNTSTIDLNVVGEKTNSHDRIVGAHFFSPAHVMPLLEIVRTEKTSAQ  467



>ref|XP_009371440.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Pyrus x bretschneideri]
Length=724

 Score =   291 bits (745),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            DVGLKP  IKKVAVIGGGLMGSGIATALLLSNI+VVLKE+NPEYL KG+K IEGNV+GLV
Sbjct  300  DVGLKPRQIKKVAVIGGGLMGSGIATALLLSNISVVLKEVNPEYLQKGIKKIEGNVKGLV  359

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            +R+ L QDK +KSL++LKG+LDYS+F+DVDMVIEAVIE+VPLKQKIFS++EK CP HC+L
Sbjct  360  TRRGLTQDKEQKSLALLKGSLDYSDFKDVDMVIEAVIESVPLKQKIFSELEKVCPPHCVL  419

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            ATNTSTIDLN++G++T S DRI+GAHFFSPAHVMPLLEIVRTEKTSAQ
Sbjct  420  ATNTSTIDLNVVGEKTNSHDRIVGAHFFSPAHVMPLLEIVRTEKTSAQ  467



>ref|XP_010254066.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 [Nelumbo nucifera]
Length=727

 Score =   291 bits (745),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            D+GLK TSIKKVAVIGGGLMGSGIATALLLSNI+V+LKEIN EYL KG+K+IE N+R LV
Sbjct  300  DLGLKLTSIKKVAVIGGGLMGSGIATALLLSNISVILKEINSEYLQKGMKSIEANLRSLV  359

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            +R KL QDKAEK+ SILKG LDYSEF++VDMVIEAVIEN+PLKQ IF+++EK+CP HCIL
Sbjct  360  TRGKLTQDKAEKAFSILKGVLDYSEFKNVDMVIEAVIENIPLKQSIFNELEKSCPPHCIL  419

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            ATNTSTIDLNIIG++TRSQDRI+GAHFFSPAHVMPLLEIVRTEKTSAQ
Sbjct  420  ATNTSTIDLNIIGEKTRSQDRIVGAHFFSPAHVMPLLEIVRTEKTSAQ  467



>ref|XP_009374040.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 [Pyrus x bretschneideri]
Length=734

 Score =   291 bits (745),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            DVGLKP  IKKVAVIGGGLMGSGIATALL+SNI+VVLKE+N EYL KG+K+IEGNV+GLV
Sbjct  310  DVGLKPRQIKKVAVIGGGLMGSGIATALLVSNISVVLKEVNSEYLQKGIKSIEGNVKGLV  369

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            +R++L QDKA+K+LS+LKG+LDYS+F+D DMVIEAVIE+VPLKQKIFS++EK CPSHC+L
Sbjct  370  TRRRLTQDKAQKALSLLKGSLDYSDFKDADMVIEAVIESVPLKQKIFSELEKVCPSHCVL  429

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            ATNTSTIDLN++G++T S DRI+GAHFFSPAHVMPLLEIVRTEKTSAQ
Sbjct  430  ATNTSTIDLNVVGEKTNSHDRIVGAHFFSPAHVMPLLEIVRTEKTSAQ  477



>gb|AFS41246.1| cinnamoyl-CoA hydratase-dehydrogenase [Petunia x hybrida]
Length=724

 Score =   290 bits (741),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 158/179 (88%), Gaps = 0/179 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S +    D+GLKP ++KKVAVIGGGLMGSGIATAL LSN  VVLKEIN EYL KG+K
Sbjct  290  RATSKVPNVTDIGLKPRTVKKVAVIGGGLMGSGIATALALSNTFVVLKEINSEYLQKGMK  349

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             IE NVRGLV+RKKL QDKA+K+LS++KGALDYS+F+DVDMVIEAVIE+VPLKQKIFS+I
Sbjct  350  AIEANVRGLVARKKLPQDKADKALSMVKGALDYSDFKDVDMVIEAVIESVPLKQKIFSEI  409

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQT  552
            EK CP HCILA+NTSTIDLNIIG+ TRS+DRIIGAHFFSPAH+MPLLEIVRTEKTS Q 
Sbjct  410  EKVCPPHCILASNTSTIDLNIIGENTRSKDRIIGAHFFSPAHIMPLLEIVRTEKTSTQA  468



>ref|XP_006353465.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Solanum tuberosum]
Length=724

 Score =   289 bits (740),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            D+GLKP  +KKVA+IGGGLMGSGIAT+L+LSNI V++KEINPEYL KG+KT+E N+RGLV
Sbjct  300  DIGLKPRPVKKVAIIGGGLMGSGIATSLVLSNIFVIIKEINPEYLQKGIKTVEANIRGLV  359

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            +RKKL QDKA K+ S++KG LDYSEF+DVDMVIEAVIENVPLKQ+IF DIEK CP HCIL
Sbjct  360  ARKKLQQDKANKAFSMVKGVLDYSEFKDVDMVIEAVIENVPLKQQIFIDIEKVCPPHCIL  419

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQT  552
            A+NTSTIDLN+IG++T SQDR+IGAHFFSPAHVMPLLEI+RTEKTSAQ 
Sbjct  420  ASNTSTIDLNVIGKKTSSQDRVIGAHFFSPAHVMPLLEIIRTEKTSAQA  468



>gb|KDO42234.1| hypothetical protein CISIN_1g004726mg [Citrus sinensis]
Length=539

 Score =   284 bits (727),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            D+GLKP  ++KVAVIGGGLMGSGIATA +L+NI VVLKE+N EYL KG+KTIE NVRGLV
Sbjct  300  DIGLKPRGVRKVAVIGGGLMGSGIATAHILNNIYVVLKEVNSEYLLKGIKTIEANVRGLV  359

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            +R KL QDKA  +L +LKG LDYSEF+DVDMVIEAVIE+VPLKQKIFS++EKACP HCIL
Sbjct  360  TRGKLTQDKANNALKMLKGVLDYSEFKDVDMVIEAVIESVPLKQKIFSELEKACPPHCIL  419

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            ATNTSTIDLNI+G++T SQDRIIGAHFFSPAHVMPLLEIVRTE+TSAQ
Sbjct  420  ATNTSTIDLNIVGEKTSSQDRIIGAHFFSPAHVMPLLEIVRTERTSAQ  467



>ref|XP_004287395.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 [Fragaria vesca subsp. vesca]
Length=723

 Score =   289 bits (739),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            DVGLKP  IKKVA+IGGGLMGSGIATAL+LSNI+VVLKEIN EYL KG++TIEGNV+GLV
Sbjct  300  DVGLKPRHIKKVAIIGGGLMGSGIATALILSNISVVLKEINSEYLQKGIRTIEGNVKGLV  359

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            +R KL +DKA+K+LS+LKG+LDYS+F+DVDMVIEAVIE+VPLKQKIF ++EK CPSHCIL
Sbjct  360  ARGKLTRDKADKALSLLKGSLDYSDFKDVDMVIEAVIESVPLKQKIFGELEKVCPSHCIL  419

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            A+NTSTIDLN+IG++T SQDRI+GAHFFSPAHVMPLLEIVRT+KTSAQ
Sbjct  420  ASNTSTIDLNVIGEKTSSQDRIVGAHFFSPAHVMPLLEIVRTDKTSAQ  467



>gb|KDO42235.1| hypothetical protein CISIN_1g004726mg [Citrus sinensis]
Length=563

 Score =   285 bits (728),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            D+GLKP  ++KVAVIGGGLMGSGIATA +L+NI VVLKE+N EYL KG+KTIE NVRGLV
Sbjct  139  DIGLKPRGVRKVAVIGGGLMGSGIATAHILNNIYVVLKEVNSEYLLKGIKTIEANVRGLV  198

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            +R KL QDKA  +L +LKG LDYSEF+DVDMVIEAVIE+VPLKQKIFS++EKACP HCIL
Sbjct  199  TRGKLTQDKANNALKMLKGVLDYSEFKDVDMVIEAVIESVPLKQKIFSELEKACPPHCIL  258

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            ATNTSTIDLNI+G++T SQDRIIGAHFFSPAHVMPLLEIVRTE+TSAQ
Sbjct  259  ATNTSTIDLNIVGEKTSSQDRIIGAHFFSPAHVMPLLEIVRTERTSAQ  306



>ref|XP_008242673.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 [Prunus mume]
Length=724

 Score =   288 bits (737),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            DVGLKP  +KKVAVIGGGLMGSGIATALLLSNI VVLKE+N EYL KG+KTIE NV+GLV
Sbjct  300  DVGLKPRHVKKVAVIGGGLMGSGIATALLLSNIYVVLKEVNSEYLQKGIKTIEANVKGLV  359

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            ++ KL QDKA+++LS+LKG+LDYS+F+DVDMVIEAVIENVPLKQKIF ++EK CPSHCIL
Sbjct  360  TKGKLTQDKAQQALSLLKGSLDYSDFKDVDMVIEAVIENVPLKQKIFGELEKVCPSHCIL  419

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            ATNTSTIDLN++G++T S DRI+GAHFFSPAHVMPLLEIVRTEKTSAQ
Sbjct  420  ATNTSTIDLNVVGEKTSSHDRIVGAHFFSPAHVMPLLEIVRTEKTSAQ  467



>ref|XP_007204255.1| hypothetical protein PRUPE_ppa002052mg [Prunus persica]
 gb|EMJ05454.1| hypothetical protein PRUPE_ppa002052mg [Prunus persica]
Length=724

 Score =   288 bits (737),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            DVGLKP  +KKVAVIGGGLMGSGIATALLLSNI VVLKE+N EYL KG+KTIE NV+GLV
Sbjct  300  DVGLKPRHVKKVAVIGGGLMGSGIATALLLSNIYVVLKEVNSEYLQKGIKTIEANVKGLV  359

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            ++ KL QDKA+++LS+LKG+LDYS+F+DVDMVIEAVIENVPLKQKIF ++EK CPSHCIL
Sbjct  360  TKGKLTQDKAQQTLSLLKGSLDYSDFKDVDMVIEAVIENVPLKQKIFGELEKVCPSHCIL  419

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            ATNTSTIDLN++G++T S DRI+GAHFFSPAHVMPLLEIVRTEKTSAQ
Sbjct  420  ATNTSTIDLNVVGEKTSSHDRIVGAHFFSPAHVMPLLEIVRTEKTSAQ  467



>ref|XP_007013128.1| Enoyl-CoA hydratase/isomerase family [Theobroma cacao]
 gb|EOY30747.1| Enoyl-CoA hydratase/isomerase family [Theobroma cacao]
Length=724

 Score =   287 bits (735),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            DVGLKP   KKVAVIGGGLMGSGIATAL++SNI VVLKE+N EYL KG+K IE NV+GLV
Sbjct  300  DVGLKPRQTKKVAVIGGGLMGSGIATALIVSNIFVVLKEVNSEYLLKGIKMIEANVQGLV  359

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            SR KL +DKAEK+LS+LKG LDYSEFRDVDMVIEAVIENVPLKQKIFS+IEKACP HCIL
Sbjct  360  SRGKLTKDKAEKALSMLKGVLDYSEFRDVDMVIEAVIENVPLKQKIFSEIEKACPPHCIL  419

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQT  552
            ATNTSTIDLN+IG++ +SQDR+IGAHFFSPAHVMPLLEIVRT+KTS Q 
Sbjct  420  ATNTSTIDLNVIGEKIKSQDRVIGAHFFSPAHVMPLLEIVRTQKTSPQA  468



>gb|KDO42233.1| hypothetical protein CISIN_1g004726mg [Citrus sinensis]
Length=589

 Score =   284 bits (727),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            D+GLKP  ++KVAVIGGGLMGSGIATA +L+NI VVLKE+N EYL KG+KTIE NVRGLV
Sbjct  300  DIGLKPRGVRKVAVIGGGLMGSGIATAHILNNIYVVLKEVNSEYLLKGIKTIEANVRGLV  359

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            +R KL QDKA  +L +LKG LDYSEF+DVDMVIEAVIE+VPLKQKIFS++EKACP HCIL
Sbjct  360  TRGKLTQDKANNALKMLKGVLDYSEFKDVDMVIEAVIESVPLKQKIFSELEKACPPHCIL  419

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            ATNTSTIDLNI+G++T SQDRIIGAHFFSPAHVMPLLEIVRTE+TSAQ
Sbjct  420  ATNTSTIDLNIVGEKTSSQDRIIGAHFFSPAHVMPLLEIVRTERTSAQ  467



>ref|XP_006352155.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like isoform X2 [Solanum tuberosum]
Length=724

 Score =   287 bits (735),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            D+GLKP ++KKVAVIGGGLMGSGIATAL LSN  V+LKEIN E+L KG+K IE NV GLV
Sbjct  300  DIGLKPRTVKKVAVIGGGLMGSGIATALALSNTIVILKEINSEFLQKGMKAIEANVSGLV  359

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            +RKKL QDKA+K+LS++KGALDYS+F+DVDMVIEAVIENVPLKQKIFS+IEK CP HCIL
Sbjct  360  ARKKLPQDKADKALSMVKGALDYSDFKDVDMVIEAVIENVPLKQKIFSEIEKVCPPHCIL  419

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            ATNTSTIDLNIIG+ T S+DRIIGAHFFSPAH+MPLLEIVRTEKTSAQ
Sbjct  420  ATNTSTIDLNIIGENTTSKDRIIGAHFFSPAHIMPLLEIVRTEKTSAQ  467



>ref|XP_011048390.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 isoform X2 [Populus euphratica]
Length=724

 Score =   287 bits (734),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            DVGLKP  IKKVAVIGGGLMGSGIATAL++SNI VVLKEIN EYL KG KTIE NVR LV
Sbjct  300  DVGLKPRHIKKVAVIGGGLMGSGIATALIVSNIHVVLKEINSEYLQKGTKTIEANVRSLV  359

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            +R KL +DKA+K+LS+LKGALDYS+F+DVDMVIEAVIE+VPLKQKIFS+IEK CP HCIL
Sbjct  360  TRGKLTRDKADKALSMLKGALDYSDFKDVDMVIEAVIESVPLKQKIFSEIEKVCPPHCIL  419

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            ATNTSTIDLN++G++T SQDRIIGAHFFSPAH+MPLLEIVRTEKTSAQ
Sbjct  420  ATNTSTIDLNLVGEKTSSQDRIIGAHFFSPAHIMPLLEIVRTEKTSAQ  467



>ref|XP_011048389.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 isoform X1 [Populus euphratica]
Length=748

 Score =   287 bits (735),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            DVGLKP  IKKVAVIGGGLMGSGIATAL++SNI VVLKEIN EYL KG KTIE NVR LV
Sbjct  300  DVGLKPRHIKKVAVIGGGLMGSGIATALIVSNIHVVLKEINSEYLQKGTKTIEANVRSLV  359

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            +R KL +DKA+K+LS+LKGALDYS+F+DVDMVIEAVIE+VPLKQKIFS+IEK CP HCIL
Sbjct  360  TRGKLTRDKADKALSMLKGALDYSDFKDVDMVIEAVIESVPLKQKIFSEIEKVCPPHCIL  419

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            ATNTSTIDLN++G++T SQDRIIGAHFFSPAH+MPLLEIVRTEKTSAQ
Sbjct  420  ATNTSTIDLNLVGEKTSSQDRIIGAHFFSPAHIMPLLEIVRTEKTSAQ  467



>ref|XP_006352154.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like isoform X1 [Solanum tuberosum]
Length=749

 Score =   287 bits (734),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            D+GLKP ++KKVAVIGGGLMGSGIATAL LSN  V+LKEIN E+L KG+K IE NV GLV
Sbjct  300  DIGLKPRTVKKVAVIGGGLMGSGIATALALSNTIVILKEINSEFLQKGMKAIEANVSGLV  359

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            +RKKL QDKA+K+LS++KGALDYS+F+DVDMVIEAVIENVPLKQKIFS+IEK CP HCIL
Sbjct  360  ARKKLPQDKADKALSMVKGALDYSDFKDVDMVIEAVIENVPLKQKIFSEIEKVCPPHCIL  419

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            ATNTSTIDLNIIG+ T S+DRIIGAHFFSPAH+MPLLEIVRTEKTSAQ
Sbjct  420  ATNTSTIDLNIIGENTTSKDRIIGAHFFSPAHIMPLLEIVRTEKTSAQ  467



>gb|KGN60609.1| hypothetical protein Csa_2G003610 [Cucumis sativus]
Length=660

 Score =   285 bits (728),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R IS +    D GLKP ++KKVA+IGGGLMGSGIATA +LSNI VV+KEINPEYL KG+K
Sbjct  226  RLISKVPNVTDRGLKPRNVKKVAIIGGGLMGSGIATAFILSNIHVVVKEINPEYLQKGIK  285

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
            TIE N+RGLV + KL QDKA K+L ILKG+LDYS+F+DVDMVIEA +ENVPLKQKIFS+I
Sbjct  286  TIEANLRGLVVKGKLTQDKANKALLILKGSLDYSDFKDVDMVIEAAVENVPLKQKIFSEI  345

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CP+HCILATNTSTIDLN++G++TRS DRIIGAHFFSPAHVMPLLEIVRTEKTS Q
Sbjct  346  EKICPAHCILATNTSTIDLNLVGEKTRSMDRIIGAHFFSPAHVMPLLEIVRTEKTSPQ  403



>ref|XP_002324426.2| hypothetical protein POPTR_0018s08940g [Populus trichocarpa]
 gb|EEF02991.2| hypothetical protein POPTR_0018s08940g [Populus trichocarpa]
Length=763

 Score =   287 bits (734),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            DVGLKP  IKKVAVIGGGLMGSGIATAL++SNI VVLKEIN EYL KG KTIE NVR LV
Sbjct  339  DVGLKPRHIKKVAVIGGGLMGSGIATALIVSNIHVVLKEINSEYLQKGTKTIEANVRSLV  398

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            +R KL +DKA+K+LS+LKGALDYS+F+DVDMVIEAVIE+VPLKQKIFS+IEK CP HCIL
Sbjct  399  TRGKLTRDKADKALSMLKGALDYSDFKDVDMVIEAVIESVPLKQKIFSEIEKICPPHCIL  458

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            ATNTSTIDLN++G++T SQDRIIGAHFFSPAH+MPLLEIVRTEKTSAQ
Sbjct  459  ATNTSTIDLNLVGEKTSSQDRIIGAHFFSPAHIMPLLEIVRTEKTSAQ  506



>ref|XP_004242934.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Solanum lycopersicum]
Length=723

 Score =   285 bits (730),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            D+GLKP ++KKVAVIGGGLMGSGIATAL LSN  V+LKEIN E+L KG+K IE NV GLV
Sbjct  300  DIGLKPRTVKKVAVIGGGLMGSGIATALALSNTIVILKEINSEFLQKGMKAIEANVSGLV  359

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            +RK L QDKA+K+LS++KGALDYS+F+DVDMVIEAVIENVPLKQKIFS+IEK CP HCIL
Sbjct  360  ARKNLPQDKADKALSMVKGALDYSDFKDVDMVIEAVIENVPLKQKIFSEIEKVCPPHCIL  419

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            ATNTSTIDLNIIG+ T S+DRIIGAHFFSPAH+MPLLEIVRTEKTSAQ
Sbjct  420  ATNTSTIDLNIIGENTTSKDRIIGAHFFSPAHIMPLLEIVRTEKTSAQ  467



>ref|XP_004139346.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Cucumis sativus]
Length=724

 Score =   285 bits (729),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R IS +    D GLKP ++KKVA+IGGGLMGSGIATA +LSNI VV+KEINPEYL KG+K
Sbjct  290  RLISKVPNVTDRGLKPRNVKKVAIIGGGLMGSGIATAFILSNIHVVVKEINPEYLQKGIK  349

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
            TIE N+RGLV + KL QDKA K+L ILKG+LDYS+F+DVDMVIEA +ENVPLKQKIFS+I
Sbjct  350  TIEANLRGLVVKGKLTQDKANKALLILKGSLDYSDFKDVDMVIEAAVENVPLKQKIFSEI  409

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CP+HCILATNTSTIDLN++G++TRS DRIIGAHFFSPAHVMPLLEIVRTEKTS Q
Sbjct  410  EKICPAHCILATNTSTIDLNLVGEKTRSMDRIIGAHFFSPAHVMPLLEIVRTEKTSPQ  467



>ref|XP_010688243.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 [Beta vulgaris subsp. vulgaris]
Length=722

 Score =   285 bits (728),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 156/171 (91%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  DVGLKP  +KKVAVIGGGLMGSGIATALLLSN+ VVLKE+N E+L+KG+K++EGN+R
Sbjct  296  GVSDVGLKPRRMKKVAVIGGGLMGSGIATALLLSNVQVVLKEVNAEFLAKGIKSVEGNIR  355

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
            GLV+R KL +DKAEK+L++LKG LDYSEF+DVDMVIEAV+ENV LKQ IFSD+EK CP H
Sbjct  356  GLVTRGKLVKDKAEKALALLKGGLDYSEFKDVDMVIEAVVENVSLKQTIFSDLEKICPPH  415

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            CILATNTSTIDLN+IG++T SQ+RI+GAHFFSPAH+MPLLEIVRT KTSAQ
Sbjct  416  CILATNTSTIDLNVIGERTNSQERIVGAHFFSPAHIMPLLEIVRTHKTSAQ  466



>gb|EYU32938.1| hypothetical protein MIMGU_mgv1a002041mg [Erythranthe guttata]
Length=723

 Score =   285 bits (728),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            D+GLKP  IKKVAVIGGGLMGSGIATAL+LS+I V+LKEIN EYL KG+K +E NVRGLV
Sbjct  299  DIGLKPRPIKKVAVIGGGLMGSGIATALILSDIYVILKEINSEYLLKGIKMVEANVRGLV  358

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            SRKKL +DKAEK+L +LKG LDYSEF+DVDMVIEAVIEN+PLK+KIF DIEKACP HCIL
Sbjct  359  SRKKLVEDKAEKALLMLKGVLDYSEFKDVDMVIEAVIENIPLKRKIFGDIEKACPPHCIL  418

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            A+NTSTIDL+I+G++T+SQDRI+GAHFFSPAHVMPLLEI+RT+KTS Q
Sbjct  419  ASNTSTIDLDIVGEKTKSQDRIVGAHFFSPAHVMPLLEIIRTDKTSPQ  466



>ref|XP_011078309.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 [Sesamum indicum]
Length=724

 Score =   285 bits (728),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            D+GLKP SIKKVAVIGGGLMGSGIATAL+LS+I V+LKE+N EYL KG+K IE NVRGLV
Sbjct  300  DIGLKPRSIKKVAVIGGGLMGSGIATALILSDIYVILKEVNSEYLLKGIKAIEANVRGLV  359

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            S++KLAQDKAEK+L +LKG LDY+EF DVDMVIEAVIEN+ LKQ+IF DIEKACP HCIL
Sbjct  360  SKRKLAQDKAEKALLMLKGVLDYAEFSDVDMVIEAVIENISLKQQIFGDIEKACPPHCIL  419

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            A+NTSTIDLNI+G +T+SQDRI+GAHFFSPAHVMPLLEI+RTEKTS Q
Sbjct  420  ASNTSTIDLNIVGAKTKSQDRIVGAHFFSPAHVMPLLEIIRTEKTSPQ  467



>ref|XP_006451189.1| hypothetical protein CICLE_v10007590mg [Citrus clementina]
 gb|ESR64429.1| hypothetical protein CICLE_v10007590mg [Citrus clementina]
Length=703

 Score =   284 bits (726),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            D+GLKP  ++KVAVIGGGLMGSGIATA +L+NI VVLKE+N EYL KG+KTIE NVRGLV
Sbjct  279  DIGLKPRGVRKVAVIGGGLMGSGIATAHILNNIYVVLKEVNSEYLLKGIKTIEANVRGLV  338

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            +R KL QDKA  +L +LKG LDYSEF+DVDMVIEAVIE+VPLKQKIFS++EKACP HCIL
Sbjct  339  TRGKLTQDKANNALKMLKGVLDYSEFKDVDMVIEAVIESVPLKQKIFSELEKACPPHCIL  398

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            ATNTSTIDLNI+G++T SQDRIIGAHFFSPAHVMPLLEIVRTE+TSAQ
Sbjct  399  ATNTSTIDLNIVGEKTSSQDRIIGAHFFSPAHVMPLLEIVRTERTSAQ  446



>ref|XP_008354515.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like, partial [Malus domestica]
Length=575

 Score =   281 bits (718),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            DVGLKP  I KVA+IGGGLMGSGIATALL SNI+VVLKE+N EYL KG++ IEGNV+GLV
Sbjct  151  DVGLKPRQINKVAIIGGGLMGSGIATALLRSNISVVLKEVNSEYLQKGIEKIEGNVKGLV  210

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            +R+ L QDKA+K+L +LKG+LDYS+F+DVDMVIEAVIE+VPLKQKIFS++EK CP HC+L
Sbjct  211  TRRGLTQDKAQKALXLLKGSLDYSDFKDVDMVIEAVIESVPLKQKIFSELEKVCPPHCVL  270

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            ATNTSTIDLN++G++T S DRI+GAHFFSPAH+MPLLEIVRTEKTSAQ
Sbjct  271  ATNTSTIDLNVVGEETNSHDRIVGAHFFSPAHLMPLLEIVRTEKTSAQ  318



>emb|CDP03312.1| unnamed protein product [Coffea canephora]
Length=724

 Score =   284 bits (727),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S +    DVGLKP  +K+VAVIGGGLMGSGIATAL+LSNI VVLKEIN EYL KG+K
Sbjct  290  RATSKVPNVTDVGLKPRPVKRVAVIGGGLMGSGIATALILSNIYVVLKEINSEYLLKGVK  349

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             IE NV GLVSRKKL  DKA+K+LS+LKG LDYSEF+DVDMVIEAV+EN+ LKQKIF ++
Sbjct  350  AIEANVWGLVSRKKLTDDKAQKALSLLKGVLDYSEFKDVDMVIEAVVENISLKQKIFGEL  409

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CP HCILATNTSTIDLNIIG+ T+SQDRI+GAHFFSPAHVMPLLEIVRTEKTSAQ
Sbjct  410  EKICPPHCILATNTSTIDLNIIGEGTKSQDRIVGAHFFSPAHVMPLLEIVRTEKTSAQ  467



>ref|XP_004164759.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Cucumis sativus]
Length=719

 Score =   284 bits (726),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            D GLKP ++KKVA+IGGGLMGSGIATA +LSNI VV+KEINPEYL KG+KTIE N+RGLV
Sbjct  295  DRGLKPRNVKKVAIIGGGLMGSGIATAFILSNIHVVVKEINPEYLQKGIKTIEANLRGLV  354

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
             + KL QDKA K+L ILKG+LDYS+F+DVDMVIEA +ENVPLKQKIFS+IEK CP+HCIL
Sbjct  355  VKGKLTQDKANKALLILKGSLDYSDFKDVDMVIEAAVENVPLKQKIFSEIEKICPAHCIL  414

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            ATNTSTIDLN++G++TRS DRIIGAHFFSPAHVMPLLEIVRTEKTS Q
Sbjct  415  ATNTSTIDLNLVGEKTRSMDRIIGAHFFSPAHVMPLLEIVRTEKTSPQ  462



>ref|XP_006451188.1| hypothetical protein CICLE_v10007590mg [Citrus clementina]
 gb|ESR64428.1| hypothetical protein CICLE_v10007590mg [Citrus clementina]
Length=724

 Score =   284 bits (726),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            D+GLKP  ++KVAVIGGGLMGSGIATA +L+NI VVLKE+N EYL KG+KTIE NVRGLV
Sbjct  300  DIGLKPRGVRKVAVIGGGLMGSGIATAHILNNIYVVLKEVNSEYLLKGIKTIEANVRGLV  359

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            +R KL QDKA  +L +LKG LDYSEF+DVDMVIEAVIE+VPLKQKIFS++EKACP HCIL
Sbjct  360  TRGKLTQDKANNALKMLKGVLDYSEFKDVDMVIEAVIESVPLKQKIFSELEKACPPHCIL  419

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            ATNTSTIDLNI+G++T SQDRIIGAHFFSPAHVMPLLEIVRTE+TSAQ
Sbjct  420  ATNTSTIDLNIVGEKTSSQDRIIGAHFFSPAHVMPLLEIVRTERTSAQ  467



>gb|KDO42231.1| hypothetical protein CISIN_1g004726mg [Citrus sinensis]
Length=721

 Score =   284 bits (726),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            D+GLKP  ++KVAVIGGGLMGSGIATA +L+NI VVLKE+N EYL KG+KTIE NVRGLV
Sbjct  297  DIGLKPRGVRKVAVIGGGLMGSGIATAHILNNIYVVLKEVNSEYLLKGIKTIEANVRGLV  356

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            +R KL QDKA  +L +LKG LDYSEF+DVDMVIEAVIE+VPLKQKIFS++EKACP HCIL
Sbjct  357  TRGKLTQDKANNALKMLKGVLDYSEFKDVDMVIEAVIESVPLKQKIFSELEKACPPHCIL  416

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            ATNTSTIDLNI+G++T SQDRIIGAHFFSPAHVMPLLEIVRTE+TSAQ
Sbjct  417  ATNTSTIDLNIVGEKTSSQDRIIGAHFFSPAHVMPLLEIVRTERTSAQ  464



>ref|XP_006475648.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Citrus sinensis]
Length=724

 Score =   284 bits (726),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            D+GLKP  ++KVAVIGGGLMGSGIATA +L+NI VVLKE+N EYL KG+KTIE NVRGLV
Sbjct  300  DIGLKPRGVRKVAVIGGGLMGSGIATAHILNNIYVVLKEVNSEYLLKGIKTIEANVRGLV  359

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            +R KL QDKA  +L +LKG LDYSEF+DVDMVIEAVIE+VPLKQKIFS++EKACP HCIL
Sbjct  360  TRGKLTQDKANNALKMLKGVLDYSEFKDVDMVIEAVIESVPLKQKIFSELEKACPPHCIL  419

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            ATNTSTIDLNI+G++T SQDRIIGAHFFSPAHVMPLLEIVRTE+TSAQ
Sbjct  420  ATNTSTIDLNIVGEKTSSQDRIIGAHFFSPAHVMPLLEIVRTERTSAQ  467



>gb|KDO42232.1| hypothetical protein CISIN_1g004726mg [Citrus sinensis]
Length=733

 Score =   284 bits (726),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            D+GLKP  ++KVAVIGGGLMGSGIATA +L+NI VVLKE+N EYL KG+KTIE NVRGLV
Sbjct  300  DIGLKPRGVRKVAVIGGGLMGSGIATAHILNNIYVVLKEVNSEYLLKGIKTIEANVRGLV  359

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            +R KL QDKA  +L +LKG LDYSEF+DVDMVIEAVIE+VPLKQKIFS++EKACP HCIL
Sbjct  360  TRGKLTQDKANNALKMLKGVLDYSEFKDVDMVIEAVIESVPLKQKIFSELEKACPPHCIL  419

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            ATNTSTIDLNI+G++T SQDRIIGAHFFSPAHVMPLLEIVRTE+TSAQ
Sbjct  420  ATNTSTIDLNIVGEKTSSQDRIIGAHFFSPAHVMPLLEIVRTERTSAQ  467



>gb|KDO42229.1| hypothetical protein CISIN_1g004726mg [Citrus sinensis]
 gb|KDO42230.1| hypothetical protein CISIN_1g004726mg [Citrus sinensis]
Length=724

 Score =   284 bits (726),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            D+GLKP  ++KVAVIGGGLMGSGIATA +L+NI VVLKE+N EYL KG+KTIE NVRGLV
Sbjct  300  DIGLKPRGVRKVAVIGGGLMGSGIATAHILNNIYVVLKEVNSEYLLKGIKTIEANVRGLV  359

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            +R KL QDKA  +L +LKG LDYSEF+DVDMVIEAVIE+VPLKQKIFS++EKACP HCIL
Sbjct  360  TRGKLTQDKANNALKMLKGVLDYSEFKDVDMVIEAVIESVPLKQKIFSELEKACPPHCIL  419

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            ATNTSTIDLNI+G++T SQDRIIGAHFFSPAHVMPLLEIVRTE+TSAQ
Sbjct  420  ATNTSTIDLNIVGEKTSSQDRIIGAHFFSPAHVMPLLEIVRTERTSAQ  467



>gb|KDO42228.1| hypothetical protein CISIN_1g004726mg [Citrus sinensis]
Length=725

 Score =   284 bits (726),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            D+GLKP  ++KVAVIGGGLMGSGIATA +L+NI VVLKE+N EYL KG+KTIE NVRGLV
Sbjct  300  DIGLKPRGVRKVAVIGGGLMGSGIATAHILNNIYVVLKEVNSEYLLKGIKTIEANVRGLV  359

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            +R KL QDKA  +L +LKG LDYSEF+DVDMVIEAVIE+VPLKQKIFS++EKACP HCIL
Sbjct  360  TRGKLTQDKANNALKMLKGVLDYSEFKDVDMVIEAVIESVPLKQKIFSELEKACPPHCIL  419

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            ATNTSTIDLNI+G++T SQDRIIGAHFFSPAHVMPLLEIVRTE+TSAQ
Sbjct  420  ATNTSTIDLNIVGEKTSSQDRIIGAHFFSPAHVMPLLEIVRTERTSAQ  467



>ref|XP_009595622.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Nicotiana tomentosiformis]
Length=724

 Score =   283 bits (724),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            D+GLKP ++KKVAVIGGGLMGSGIATAL LSN  VVLKEIN EYL KG+K IE NVRGLV
Sbjct  300  DIGLKPRTVKKVAVIGGGLMGSGIATALALSNTFVVLKEINSEYLQKGMKAIEENVRGLV  359

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            +RKKL Q KA+K+LS++KGAL YS+F+DVD+VIEAVIEN+PLKQKIFS+IEK CP HCIL
Sbjct  360  ARKKLPQGKADKALSMVKGALGYSDFKDVDVVIEAVIENIPLKQKIFSEIEKVCPPHCIL  419

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQT  552
            A+NTSTIDLN+IG+ TRS+DRIIGAHFFSPAH+MPLLEIVRTEKTSAQ 
Sbjct  420  ASNTSTIDLNVIGENTRSKDRIIGAHFFSPAHIMPLLEIVRTEKTSAQA  468



>ref|XP_009766308.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Nicotiana sylvestris]
Length=724

 Score =   283 bits (724),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            D+GLKP ++KKVAVIGGGLMGSGIATAL LSN  VVLKEIN EYL KG+K IE NVRGLV
Sbjct  300  DIGLKPRTVKKVAVIGGGLMGSGIATALALSNTFVVLKEINSEYLQKGMKAIEENVRGLV  359

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            +RKKL Q KA+K+LS++KGAL YS+F+DVD+VIEAVIEN+PLKQKIFS+IEK CP HCIL
Sbjct  360  ARKKLPQGKADKALSMVKGALGYSDFKDVDVVIEAVIENIPLKQKIFSEIEKVCPPHCIL  419

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQT  552
            A+NTSTIDLN+IG+ TRS+DRIIGAHFFSPAH+MPLLEIVRTEKTSAQ 
Sbjct  420  ASNTSTIDLNVIGENTRSKDRIIGAHFFSPAHIMPLLEIVRTEKTSAQA  468



>ref|XP_008458462.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 [Cucumis melo]
Length=724

 Score =   282 bits (721),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R IS +    D GLKP ++KKVA+IGGGLMGSGIATAL+LSNI VV+KEI+PEYL KG+K
Sbjct  290  RLISKVPNVTDRGLKPRNVKKVAIIGGGLMGSGIATALILSNIHVVVKEISPEYLQKGIK  349

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
            TIE N+RGLV + KL QDKA K+L ILKG+LDYS+F+D DMVIEA +ENVPLKQKIFS+I
Sbjct  350  TIEANLRGLVVKGKLTQDKANKALLILKGSLDYSDFKDADMVIEAAVENVPLKQKIFSEI  409

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CP+HCILATNTSTIDLN++G++TRS DRIIGAHFFSPAHVMPLLEIVRTEKTS Q
Sbjct  410  EKICPAHCILATNTSTIDLNLVGEKTRSMDRIIGAHFFSPAHVMPLLEIVRTEKTSPQ  467



>ref|XP_002284283.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 [Vitis vinifera]
 emb|CBI28049.3| unnamed protein product [Vitis vinifera]
Length=724

 Score =   281 bits (719),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            D+GLKP ++KKVAVIGGGLMGSGIATAL+ SNI VVLKE+N EYL KG+KTIE NVRGLV
Sbjct  300  DIGLKPRNVKKVAVIGGGLMGSGIATALITSNIYVVLKEVNSEYLLKGIKTIEANVRGLV  359

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            ++ KL QDKA K+LS+LKG LDYSEF+D+DMVIEAVIEN+ LKQKIFS+IEK C  HCIL
Sbjct  360  TKGKLTQDKARKALSMLKGVLDYSEFKDIDMVIEAVIENISLKQKIFSEIEKICSPHCIL  419

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            ATNTSTIDLN++G++T SQDRIIGAHFFSPAHVMPLLE+VRTEKTSAQ
Sbjct  420  ATNTSTIDLNLVGEKTSSQDRIIGAHFFSPAHVMPLLEVVRTEKTSAQ  467



>gb|KJB27144.1| hypothetical protein B456_004G280500 [Gossypium raimondii]
 gb|KJB27145.1| hypothetical protein B456_004G280500 [Gossypium raimondii]
Length=643

 Score =   279 bits (714),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            DVGLKP  +KKVA+IGGGLMGSGIATAL+++NI VVLKE+N EYL KG+KT+E NVRGL 
Sbjct  219  DVGLKPRQVKKVAIIGGGLMGSGIATALIVNNIFVVLKEVNSEYLLKGIKTVEANVRGLA  278

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            +R K+ +DKAEK+LS+LKG LDYSEF+DVDMVIEAVIENV LKQKIFS+IEKACP HCIL
Sbjct  279  NRGKITKDKAEKALSMLKGVLDYSEFKDVDMVIEAVIENVALKQKIFSEIEKACPPHCIL  338

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            ATNTSTIDLN+IG++  SQDR+IGAHFFSPAH+MPLLEIVRT+KTS Q
Sbjct  339  ATNTSTIDLNLIGEKMNSQDRLIGAHFFSPAHLMPLLEIVRTQKTSPQ  386



>ref|XP_003620604.1| Peroxisomal fatty acid beta-oxidation multifunctional protein 
[Medicago truncatula]
 gb|AES76822.1| glyoxysomal fatty acid beta-oxidation MFP-A protein [Medicago 
truncatula]
Length=722

 Score =   279 bits (714),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 154/178 (87%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R IS + G  D+GLKP +++K AVIGGGLMGSGIATAL+L NI V+LKE+N EYL KG+K
Sbjct  288  RTISKIPGVTDIGLKPRNVRKAAVIGGGLMGSGIATALILGNIRVILKEVNSEYLQKGIK  347

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
            TIE NVRGLV+RKKL Q KAE +LS+LKG LDY+EF+DVDMVIEAVIE V LKQ IFSD+
Sbjct  348  TIEANVRGLVTRKKLTQQKAEGALSLLKGVLDYAEFKDVDMVIEAVIEKVSLKQDIFSDL  407

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CP HCILA+NTSTIDLNIIG++  SQDR+IGAHFFSPAH+MPLLEIVRT KTSAQ
Sbjct  408  EKICPPHCILASNTSTIDLNIIGEKISSQDRVIGAHFFSPAHIMPLLEIVRTNKTSAQ  465



>gb|KJB27143.1| hypothetical protein B456_004G280500 [Gossypium raimondii]
Length=724

 Score =   279 bits (714),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            DVGLKP  +KKVA+IGGGLMGSGIATAL+++NI VVLKE+N EYL KG+KT+E NVRGL 
Sbjct  300  DVGLKPRQVKKVAIIGGGLMGSGIATALIVNNIFVVLKEVNSEYLLKGIKTVEANVRGLA  359

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            +R K+ +DKAEK+LS+LKG LDYSEF+DVDMVIEAVIENV LKQKIFS+IEKACP HCIL
Sbjct  360  NRGKITKDKAEKALSMLKGVLDYSEFKDVDMVIEAVIENVALKQKIFSEIEKACPPHCIL  419

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            ATNTSTIDLN+IG++  SQDR+IGAHFFSPAH+MPLLEIVRT+KTS Q
Sbjct  420  ATNTSTIDLNLIGEKMNSQDRLIGAHFFSPAHLMPLLEIVRTQKTSPQ  467



>emb|CAN66465.1| hypothetical protein VITISV_006222 [Vitis vinifera]
Length=859

 Score =   281 bits (720),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 160/179 (89%), Gaps = 4/179 (2%)
 Frame = +1

Query  25   SVMLGTL----DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGL  192
            +++LGT+    D+GLKP ++KKVAVIGGGLMGSGIATAL+ SNI VVLKE+N EYL KG+
Sbjct  374  NLILGTVPNVTDIGLKPRNVKKVAVIGGGLMGSGIATALITSNIYVVLKEVNSEYLLKGI  433

Query  193  KTIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSD  372
            KTIE NVRGLV++ KL QDKA K+LS+LKG LDYSEF+D+DMVIEAVIEN+ LKQKIFS+
Sbjct  434  KTIEANVRGLVTKGKLTQDKARKALSMLKGVLDYSEFKDIDMVIEAVIENIXLKQKIFSE  493

Query  373  IEKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            IEK C  HCILATNTSTIDLN++G++T SQDRIIGAHFFSPAHVMPLLE+VRTEKTSAQ
Sbjct  494  IEKICSPHCILATNTSTIDLNLVGEKTSSQDRIIGAHFFSPAHVMPLLEVVRTEKTSAQ  552



>ref|XP_006283211.1| hypothetical protein CARUB_v10004242mg [Capsella rubella]
 gb|EOA16109.1| hypothetical protein CARUB_v10004242mg [Capsella rubella]
Length=721

 Score =   276 bits (705),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 150/168 (89%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            D GLKP  IKKVAVIGGGLMGSGIATALLLSNI VVLKEINPEYL KG+KT+EGN++GLV
Sbjct  301  DAGLKPRPIKKVAVIGGGLMGSGIATALLLSNIRVVLKEINPEYLMKGIKTVEGNIKGLV  360

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            SR KL QDKA K+LS+LKG LDY+EF+DVDMVIEAVIEN+ LKQ IF ++EK CP HCIL
Sbjct  361  SRGKLTQDKAGKALSLLKGVLDYTEFKDVDMVIEAVIENIQLKQNIFKELEKVCPPHCIL  420

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            A+NTSTIDLN+IG++T S+DRI+GAHFFSPAH+M LLEIVR+E TS Q
Sbjct  421  ASNTSTIDLNVIGEKTNSKDRIVGAHFFSPAHLMTLLEIVRSENTSPQ  468



>ref|XP_010541187.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 [Tarenaya hassleriana]
Length=741

 Score =   276 bits (705),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 151/168 (90%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            DVGLKP  +KKVAVIGGGLMGSGI TALLLSNI VVLKE+N EYL KG+K++E NV+GLV
Sbjct  315  DVGLKPRPMKKVAVIGGGLMGSGITTALLLSNIIVVLKEVNSEYLLKGIKSVEANVKGLV  374

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            SR KL QDKA+K+LS+LKG LDY+EF+DVDMVIEAVIENV LKQ IF +IEKACP HCIL
Sbjct  375  SRGKLTQDKADKALSLLKGVLDYTEFKDVDMVIEAVIENVTLKQNIFREIEKACPPHCIL  434

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            ATNTSTIDL++IG++  S+DRIIGAHFFSPAHVMPLLEIVR+E TSAQ
Sbjct  435  ATNTSTIDLDVIGEKISSKDRIIGAHFFSPAHVMPLLEIVRSENTSAQ  482



>emb|CDY35240.1| BnaA01g07910D [Brassica napus]
Length=722

 Score =   275 bits (702),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 151/168 (90%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            DVGLKP  +KKVAVIGGGLMGSGIATALLLSN  VVLKEINP+YL KG+K++E N++ LV
Sbjct  301  DVGLKPRPMKKVAVIGGGLMGSGIATALLLSNTRVVLKEINPDYLQKGIKSVEANLKSLV  360

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            SR KL QDKA K+LS+LKGALDYSEF+DVDMVIEAVIEN+ LKQKIF +IE+ CP HCIL
Sbjct  361  SRGKLTQDKAGKALSLLKGALDYSEFKDVDMVIEAVIENIQLKQKIFKEIEEICPPHCIL  420

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            A+NTSTIDLN+IG++T S+DRI+GAHFFSPAH+M LLEIVRTE TSAQ
Sbjct  421  ASNTSTIDLNVIGEKTNSKDRIVGAHFFSPAHIMTLLEIVRTENTSAQ  468



>gb|KDP33693.1| hypothetical protein JCGZ_07264 [Jatropha curcas]
Length=718

 Score =   274 bits (701),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            D+GLKP  IKKVAVIGGGLMGSGIATAL++SNI VVLKEIN EYLSKG+K IE N++ LV
Sbjct  293  DLGLKPREIKKVAVIGGGLMGSGIATALIMSNIHVVLKEINSEYLSKGIKIIEANIQNLV  352

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            +R+ LA+DKA+K+LS+LKG LDYS+ +DVDMVIEAVIE++PLKQKIFS+IE  CP HCIL
Sbjct  353  TRRMLARDKADKALSMLKGVLDYSDLKDVDMVIEAVIESIPLKQKIFSEIETVCPPHCIL  412

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQT  552
            ATNTSTIDLN++G++T +QDRIIGAHFFSPAH+MPLLEIVRT+ TSAQ 
Sbjct  413  ATNTSTIDLNLVGEKTSAQDRIIGAHFFSPAHIMPLLEIVRTDNTSAQA  461



>gb|ADU15551.1| MFP [Gossypium hirsutum]
Length=721

 Score =   274 bits (701),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 151/168 (90%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            DVGLKP  +KKVA+IGGGLMGSGIATAL+++NI VVLKE+N EYL KG+KT+E NVRGL 
Sbjct  300  DVGLKPRQVKKVAIIGGGLMGSGIATALIVNNIFVVLKEVNSEYLLKGIKTVEANVRGLA  359

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            +R K+ +DKAEK+LS+LKG LDYSEF+DVDMVIEAV+ENV LKQKIFS+IEKACP HCIL
Sbjct  360  NRGKMTKDKAEKALSMLKGVLDYSEFKDVDMVIEAVVENVALKQKIFSEIEKACPPHCIL  419

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            ATNTSTIDLN+IG++  SQDR++GAHFFSPAH+MPLLE VRT+K S Q
Sbjct  420  ATNTSTIDLNLIGEKMNSQDRLVGAHFFSPAHLMPLLETVRTQKASPQ  467



>emb|CDY06852.1| BnaC01g09510D [Brassica napus]
Length=722

 Score =   274 bits (701),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 150/168 (89%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            DVGLKP  +KKVAVIGGGLMGSGIATALLLSN  VVLKEINP+YL KGLK++E N++ LV
Sbjct  301  DVGLKPRPMKKVAVIGGGLMGSGIATALLLSNTRVVLKEINPDYLQKGLKSVEANLKSLV  360

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            SR KL QDKA K+LS+LKG LDYSEF+DVDMVIEAVIEN+ LKQKIF +IE+ CP HCIL
Sbjct  361  SRGKLTQDKAGKALSLLKGVLDYSEFKDVDMVIEAVIENIQLKQKIFKEIEEVCPPHCIL  420

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            A+NTSTIDLN+IG++T S+DRI+GAHFFSPAH+M LLEIVRTE TSAQ
Sbjct  421  ASNTSTIDLNVIGEKTNSKDRIVGAHFFSPAHIMTLLEIVRTENTSAQ  468



>ref|XP_002514279.1| 3-hydroxyacyl-CoA dehyrogenase, putative [Ricinus communis]
 gb|EEF48233.1| 3-hydroxyacyl-CoA dehyrogenase, putative [Ricinus communis]
Length=724

 Score =   274 bits (700),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            D+GLKP  IKKVAVIGGGLMGSGI TAL+ S I VVLKEIN EYL KG+K +E NVRGLV
Sbjct  300  DIGLKPRQIKKVAVIGGGLMGSGIITALITSGIYVVLKEINSEYLLKGIKMVEANVRGLV  359

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            +R KL+ DKA+K+LS+LKG LDYS+FRDVDMVIEAVIE++PLKQKIFS+IEKACP HCIL
Sbjct  360  TRGKLSPDKADKALSMLKGVLDYSDFRDVDMVIEAVIESIPLKQKIFSEIEKACPPHCIL  419

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQT  552
            ATNTSTIDLN++G++T +QD IIGAHFFSPAH+MPLLEIVRT+KTS Q 
Sbjct  420  ATNTSTIDLNLVGKKTSAQDCIIGAHFFSPAHIMPLLEIVRTDKTSPQA  468



>dbj|BAJ91250.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=692

 Score =   273 bits (698),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D+ LKP +I+KVAVIGGGLMGSGIATALL+ NI+VVLKE+NP++L +G KTI GN+ 
Sbjct  264  GVTDIQLKPRNIRKVAVIGGGLMGSGIATALLVGNISVVLKEVNPQFLQRGQKTIAGNLE  323

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
            GLV R  L +DK  K++S+LKGALDYS+F+DVDMVIEAVIE VPLKQ IF+DIEK CP H
Sbjct  324  GLVKRGSLTKDKMSKAISLLKGALDYSDFKDVDMVIEAVIEKVPLKQSIFADIEKICPPH  383

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQT  552
            CILATNTSTIDLN++G++T SQDRIIGAHFFSPAH+MPLLEIVRTEKTS Q 
Sbjct  384  CILATNTSTIDLNVVGEKTNSQDRIIGAHFFSPAHIMPLLEIVRTEKTSPQA  435



>ref|XP_010089224.1| Peroxisomal fatty acid beta-oxidation multifunctional protein 
AIM1 [Morus notabilis]
 gb|EXB37513.1| Peroxisomal fatty acid beta-oxidation multifunctional protein 
AIM1 [Morus notabilis]
Length=702

 Score =   273 bits (698),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 151/168 (90%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            D+GLKP  IKKVA+IGGGLMGSGIATA +LSNI+VVLKEIN EYL KG K IE NV+ LV
Sbjct  278  DIGLKPRPIKKVAIIGGGLMGSGIATAFILSNISVVLKEINNEYLLKGRKMIEANVQVLV  337

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            S+ KL +DKA+K+LS+LKG LDY+EFRDVDMVIEAVIEN+ LKQ IFS+IEKACPSHCIL
Sbjct  338  SKGKLPRDKADKALSLLKGVLDYTEFRDVDMVIEAVIENISLKQTIFSEIEKACPSHCIL  397

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            A+NTSTIDL ++G++T SQDRI+GAHFFSPAHVMPLLEIVRTEKTS Q
Sbjct  398  ASNTSTIDLRLVGEKTSSQDRILGAHFFSPAHVMPLLEIVRTEKTSPQ  445



>dbj|BAK04391.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88897.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=728

 Score =   273 bits (699),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D+ LKP +I+KVAVIGGGLMGSGIATALL+ NI+VVLKE+NP++L +G KTI GN+ 
Sbjct  300  GVTDIQLKPRNIRKVAVIGGGLMGSGIATALLVGNISVVLKEVNPQFLQRGQKTIAGNLE  359

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
            GLV R  L +DK  K++S+LKGALDYS+F+DVDMVIEAVIE VPLKQ IF+DIEK CP H
Sbjct  360  GLVKRGSLTKDKMSKAISLLKGALDYSDFKDVDMVIEAVIEKVPLKQSIFADIEKICPPH  419

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQT  552
            CILATNTSTIDLN++G++T SQDRIIGAHFFSPAH+MPLLEIVRTEKTS Q 
Sbjct  420  CILATNTSTIDLNVVGEKTNSQDRIIGAHFFSPAHIMPLLEIVRTEKTSPQA  471



>emb|CDM81268.1| unnamed protein product [Triticum aestivum]
Length=726

 Score =   273 bits (699),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D+ LKP +I+KVAVIGGGLMGSGIATALL+ NI+VVLKE+NP++L +G KTI GN+ 
Sbjct  298  GVTDIQLKPRNIRKVAVIGGGLMGSGIATALLVGNISVVLKEVNPQFLQRGQKTIAGNLE  357

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
            GLV R  L +DK  K++S+LKGALDYS+F+DVDMVIEAVIE VPLKQ IF+DIEK CP H
Sbjct  358  GLVKRGSLTKDKMSKAISLLKGALDYSDFKDVDMVIEAVIEKVPLKQSIFADIEKICPPH  417

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQT  552
            CILATNTSTIDLN++G++T SQDRIIGAHFFSPAH+MPLLEIVRTEKTS Q 
Sbjct  418  CILATNTSTIDLNVVGEKTNSQDRIIGAHFFSPAHIMPLLEIVRTEKTSPQA  469



>ref|XP_006412890.1| hypothetical protein EUTSA_v10024533mg [Eutrema salsugineum]
 gb|ESQ54343.1| hypothetical protein EUTSA_v10024533mg [Eutrema salsugineum]
Length=721

 Score =   272 bits (696),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 149/168 (89%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            DVGLKP  +KKVAVIGGGLMGSGIATALLLSNI VVLKEIN EYL KG+K++E N++GLV
Sbjct  301  DVGLKPRPMKKVAVIGGGLMGSGIATALLLSNIRVVLKEINSEYLQKGIKSVEANLKGLV  360

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            SR KL QDKA K+LS+LKG LDY+EF+DVDMVIEAVIEN+ LKQ IF +IEK CP HCIL
Sbjct  361  SRGKLTQDKAGKALSMLKGVLDYTEFKDVDMVIEAVIENIQLKQNIFKEIEKVCPPHCIL  420

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            A+NTSTIDLN+IG++T S DRI+GAHFFSPAH+M LLEIVRTE TSAQ
Sbjct  421  ASNTSTIDLNVIGEKTNSNDRIVGAHFFSPAHLMTLLEIVRTESTSAQ  468



>ref|XP_004952203.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein-like isoform X2 [Setaria italica]
Length=727

 Score =   272 bits (695),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 149/172 (87%), Gaps = 0/172 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D+ LKP  I+KVAVIGGGLMGSGIATALL+SNI+VVLKE+NP++L +G K I GN+ 
Sbjct  299  GVTDIQLKPRQIRKVAVIGGGLMGSGIATALLVSNISVVLKEVNPQFLQRGEKMIAGNLE  358

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
            GLV R  L +DK  K++S+LKGALDYS+F+DVDMVIEAVIE +PLKQ IF+DIEK CP H
Sbjct  359  GLVKRGSLTKDKKNKAMSLLKGALDYSDFKDVDMVIEAVIEKIPLKQSIFADIEKICPKH  418

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQT  552
            CILATNTSTIDLN++G++T SQDRIIGAHFFSPAH+MPLLEIVRTEKTS Q 
Sbjct  419  CILATNTSTIDLNVVGEKTNSQDRIIGAHFFSPAHIMPLLEIVRTEKTSPQA  470



>gb|KFK29448.1| hypothetical protein AALP_AA7G135800 [Arabis alpina]
Length=721

 Score =   272 bits (695),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 150/168 (89%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            DVGLKP  +KKVAVIGGGLMGSGIATALLLSNI VVLKEIN EYLSKG+KT+E N++GLV
Sbjct  301  DVGLKPRPMKKVAVIGGGLMGSGIATALLLSNIRVVLKEINSEYLSKGIKTVEANLKGLV  360

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            SR KLAQDKA K+ S+LKG LDY+EF DVDMVIEAVIEN+ LKQ IF +IEK CP HCIL
Sbjct  361  SRGKLAQDKAGKAFSLLKGVLDYTEFNDVDMVIEAVIENIQLKQNIFKEIEKVCPPHCIL  420

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            A+NTSTID+++IG++T S+DRI+GAHFFSPAH+M LLEIVR+E TSAQ
Sbjct  421  ASNTSTIDIDVIGEKTNSKDRIVGAHFFSPAHLMTLLEIVRSENTSAQ  468



>ref|XP_002451943.1| hypothetical protein SORBIDRAFT_04g010370 [Sorghum bicolor]
 gb|EES04919.1| hypothetical protein SORBIDRAFT_04g010370 [Sorghum bicolor]
Length=727

 Score =   271 bits (694),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 149/172 (87%), Gaps = 0/172 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  DV LKP  I+KVAVIGGGLMGSGIAT+LL+SNI+VVLKE+NP++L +G K I GN+ 
Sbjct  299  GVTDVQLKPRPIRKVAVIGGGLMGSGIATSLLVSNISVVLKEVNPQFLQRGEKMIAGNLE  358

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
            GLV R  L +D+  K++S+LKGALDYS+F+DVDMVIEAVIE +PLKQ IFSDIEK CP H
Sbjct  359  GLVKRGSLTKDRMHKAMSLLKGALDYSDFKDVDMVIEAVIEKIPLKQSIFSDIEKICPKH  418

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQT  552
            CILATNTSTIDLN++G++T SQDRIIGAHFFSPAH+MPLLEIVRTEKTS Q 
Sbjct  419  CILATNTSTIDLNVVGEKTNSQDRIIGAHFFSPAHIMPLLEIVRTEKTSPQA  470



>ref|XP_009129069.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 [Brassica rapa]
Length=722

 Score =   271 bits (693),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 150/168 (89%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            DVGLKP  +KKVAVIGGGLMGSGIATALLLSN  VVLKEINP+YL KGLK++E N++ LV
Sbjct  301  DVGLKPRPMKKVAVIGGGLMGSGIATALLLSNTRVVLKEINPDYLQKGLKSVEANLKSLV  360

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            SR KL QD+A K+LS+LKG LDY+EF+DVDMVIEAVIEN+ LKQKIF +IE+ CP HCIL
Sbjct  361  SRGKLTQDEAGKALSLLKGVLDYAEFKDVDMVIEAVIENIQLKQKIFKEIEEICPPHCIL  420

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            A+NTSTIDLN+IG++T S+DRI+GAHFFSPAH+M LLEIVRTE TSAQ
Sbjct  421  ASNTSTIDLNVIGEKTNSKDRIVGAHFFSPAHIMTLLEIVRTENTSAQ  468



>ref|XP_010100830.1| Peroxisomal fatty acid beta-oxidation multifunctional protein 
AIM1 [Morus notabilis]
 gb|EXB84763.1| Peroxisomal fatty acid beta-oxidation multifunctional protein 
AIM1 [Morus notabilis]
Length=830

 Score =   273 bits (698),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 151/168 (90%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            D+GLKP  IKKVA+IGGGLMGSGIATA +LSNI+VVLKEIN EYL KG K IE NV+ LV
Sbjct  379  DIGLKPRPIKKVAIIGGGLMGSGIATAFILSNISVVLKEINNEYLLKGRKMIEANVQVLV  438

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            S+ KL +DKA+K+LS+LKG LDY+EFRDVDMVIEAVIEN+ LKQ IFS+IEKACPSHCIL
Sbjct  439  SKGKLPRDKADKALSLLKGVLDYTEFRDVDMVIEAVIENISLKQTIFSEIEKACPSHCIL  498

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            A+NTSTIDL ++G++T SQDRI+GAHFFSPAHVMPLLEIVRTEKTS Q
Sbjct  499  ASNTSTIDLRLVGEKTSSQDRILGAHFFSPAHVMPLLEIVRTEKTSPQ  546



>ref|XP_008679760.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein-like [Zea mays]
Length=731

 Score =   271 bits (693),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 153/179 (85%), Gaps = 0/179 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  DV LKP  I+KVAVIGGGLMGSGIAT+LL+SNI+VVLKE+NP++L +G K
Sbjct  296  RLCSSVPGVTDVQLKPRPIRKVAVIGGGLMGSGIATSLLVSNISVVLKEVNPQFLQRGEK  355

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
            TI GN+ GLV R  L +D+  K++++LKGALDYS+F+DVDMVIEAVIE +PLKQ IF+DI
Sbjct  356  TIAGNLEGLVKRGSLTKDRMHKAMALLKGALDYSDFKDVDMVIEAVIEKIPLKQSIFADI  415

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQT  552
            EK CP HCILATNTSTIDLN++G++T SQDRIIGAHFFSPAH+MPLLEIVRTEKTS Q 
Sbjct  416  EKICPKHCILATNTSTIDLNVVGKKTNSQDRIIGAHFFSPAHIMPLLEIVRTEKTSPQA  474



>ref|XP_003572416.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein [Brachypodium distachyon]
Length=726

 Score =   271 bits (692),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 149/172 (87%), Gaps = 0/172 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D+ +KP  IKKVAVIGGGLMGSGIATALL+ NI+VVLKE+NP++L +G  TI GN+ 
Sbjct  298  GVTDIQIKPRQIKKVAVIGGGLMGSGIATALLVGNISVVLKEVNPQFLKRGQNTIAGNLE  357

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
            GLV R  L +DK  K++S+LKGALDYS+F+DVDMVIEAVIE +PLKQ IF+DIEK CP H
Sbjct  358  GLVKRGSLTKDKMNKAISLLKGALDYSDFKDVDMVIEAVIEKIPLKQSIFADIEKICPPH  417

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQT  552
            CILATNTSTIDLN++G++T+SQDRIIGAHFFSPAH+MPLLEIVRTEKTS Q 
Sbjct  418  CILATNTSTIDLNVVGEKTKSQDRIIGAHFFSPAHIMPLLEIVRTEKTSPQA  469



>dbj|BAJ93145.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=728

 Score =   271 bits (692),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 149/172 (87%), Gaps = 0/172 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D+ LKP +I+KVAVIGGGLMGSGIATALL+ NI+VVLKE+NP++L +G KTI GN+ 
Sbjct  300  GVTDIQLKPRNIRKVAVIGGGLMGSGIATALLVGNISVVLKEVNPQFLQRGQKTIAGNLE  359

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
            GLV R  L +DK  K++S+LKGALDYS+F+DVDMVIEAVIE VPLKQ IF+DIEK CP H
Sbjct  360  GLVKRGSLTKDKMSKAISLLKGALDYSDFKDVDMVIEAVIEKVPLKQSIFADIEKICPPH  419

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQT  552
            CILATNTSTID N++G++T SQDRIIGAHFFSPAH+MPLLEIVRTEKTS Q 
Sbjct  420  CILATNTSTIDSNVVGEKTNSQDRIIGAHFFSPAHIMPLLEIVRTEKTSPQA  471



>ref|XP_004512985.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like isoform X2 [Cicer arietinum]
Length=655

 Score =   269 bits (687),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R IS + G  DVGLKP +++K A+IGGGLMGSGIATALLL NI V+LKE+N EYL KGLK
Sbjct  221  RTISKVPGVTDVGLKPRNVRKAAIIGGGLMGSGIATALLLGNIRVILKEVNSEYLQKGLK  280

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
            TIEGN+R LV+R KL++ K + +LS+LKG LDY+EF+DVD+VIEAVIE + LKQ+IFSD+
Sbjct  281  TIEGNIRSLVTRGKLSKQKGDGALSLLKGVLDYNEFKDVDLVIEAVIEKLSLKQEIFSDL  340

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CP HCILATNTSTIDLN IG++  +QDR+IGAHFFSPAH+MPLLEIVRT KTSAQ
Sbjct  341  EKICPPHCILATNTSTIDLNNIGEKINAQDRLIGAHFFSPAHIMPLLEIVRTNKTSAQ  398



>emb|CDX97462.1| BnaC08g13270D [Brassica napus]
Length=721

 Score =   270 bits (691),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 150/168 (89%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            DVGLKP  +KKVAVIGGGLMGSGIATALLLSNI V+LKEIN EYL KG+K++E N++GLV
Sbjct  301  DVGLKPRPMKKVAVIGGGLMGSGIATALLLSNIRVLLKEINSEYLLKGIKSVEANLKGLV  360

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            SR KL QDKA K+ S+LKG LDY+EF+DVDMVIEAVIEN+ LKQKIF +IE+ CP HCIL
Sbjct  361  SRGKLTQDKAGKAFSLLKGVLDYTEFKDVDMVIEAVIENIQLKQKIFKEIEEVCPPHCIL  420

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            A+NTSTIDLN+IG++T S+DRI+GAHFFSPAH+M LLEIVRTE TSAQ
Sbjct  421  ASNTSTIDLNVIGEKTNSKDRIVGAHFFSPAHLMTLLEIVRTENTSAQ  468



>ref|XP_004952202.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein-like isoform X1 [Setaria italica]
Length=799

 Score =   271 bits (694),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 149/172 (87%), Gaps = 0/172 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D+ LKP  I+KVAVIGGGLMGSGIATALL+SNI+VVLKE+NP++L +G K I GN+ 
Sbjct  299  GVTDIQLKPRQIRKVAVIGGGLMGSGIATALLVSNISVVLKEVNPQFLQRGEKMIAGNLE  358

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
            GLV R  L +DK  K++S+LKGALDYS+F+DVDMVIEAVIE +PLKQ IF+DIEK CP H
Sbjct  359  GLVKRGSLTKDKKNKAMSLLKGALDYSDFKDVDMVIEAVIEKIPLKQSIFADIEKICPKH  418

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQT  552
            CILATNTSTIDLN++G++T SQDRIIGAHFFSPAH+MPLLEIVRTEKTS Q 
Sbjct  419  CILATNTSTIDLNVVGEKTNSQDRIIGAHFFSPAHIMPLLEIVRTEKTSPQA  470



>gb|EMS66784.1| Peroxisomal fatty acid beta-oxidation multifunctional protein 
[Triticum urartu]
Length=668

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 150/175 (86%), Gaps = 3/175 (2%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D+ LKP +I+KVAVIGGGLMGSGIATALL+ NI+VVLKE+NP++L +G KTI GN+ 
Sbjct  298  GVTDIQLKPRNIRKVAVIGGGLMGSGIATALLVGNISVVLKEVNPQFLQRGQKTIAGNLE  357

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIE---AVIENVPLKQKIFSDIEKAC  387
            GLV R  L +DK  K++S+LKGALDYS+F+DVDMVIE   AVIE VPLKQ IF+DIEK C
Sbjct  358  GLVKRGSLTKDKMSKAISLLKGALDYSDFKDVDMVIEVVLAVIEKVPLKQSIFADIEKIC  417

Query  388  PSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQT  552
            P HCILATNTSTIDLN+IG++T SQDRIIGAHFFSPAH+MPLLEIVRTEKTS Q 
Sbjct  418  PPHCILATNTSTIDLNVIGEKTNSQDRIIGAHFFSPAHIMPLLEIVRTEKTSPQA  472



>ref|XP_004512984.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like isoform X1 [Cicer arietinum]
Length=724

 Score =   269 bits (688),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R IS + G  DVGLKP +++K A+IGGGLMGSGIATALLL NI V+LKE+N EYL KGLK
Sbjct  290  RTISKVPGVTDVGLKPRNVRKAAIIGGGLMGSGIATALLLGNIRVILKEVNSEYLQKGLK  349

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
            TIEGN+R LV+R KL++ K + +LS+LKG LDY+EF+DVD+VIEAVIE + LKQ+IFSD+
Sbjct  350  TIEGNIRSLVTRGKLSKQKGDGALSLLKGVLDYNEFKDVDLVIEAVIEKLSLKQEIFSDL  409

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CP HCILATNTSTIDLN IG++  +QDR+IGAHFFSPAH+MPLLEIVRT KTSAQ
Sbjct  410  EKICPPHCILATNTSTIDLNNIGEKINAQDRLIGAHFFSPAHIMPLLEIVRTNKTSAQ  467



>ref|NP_001046536.1| Os02g0274100 [Oryza sativa Japonica Group]
 sp|Q8W1L6.2|MFP_ORYSJ RecName: Full=Peroxisomal fatty acid beta-oxidation multifunctional 
protein; Short=MFP; Includes: RecName: Full=Enoyl-CoA 
hydratase/3-2-trans-enoyl-CoA isomerase/3-hydroxybutyryl-CoA 
epimerase; Includes: RecName: Full=3-hydroxyacyl-CoA dehydrogenase 
[Oryza sativa Japonica Group]
 dbj|BAD21833.1| Peroxisomal fatty acid beta-oxidation multifunctional protein 
[Oryza sativa Japonica Group]
 dbj|BAF08450.1| Os02g0274100 [Oryza sativa Japonica Group]
 gb|AGH17543.1| 3-hydroxyacyl-CoA dehydrogenase [Oryza sativa]
Length=726

 Score =   269 bits (688),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 147/172 (85%), Gaps = 0/172 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  DV LKP  I+KVAVIGGGLMGSGIATALL+SN +VVLKE+NP++L +G K I  N+ 
Sbjct  298  GVTDVQLKPRKIRKVAVIGGGLMGSGIATALLVSNTSVVLKEVNPQFLQRGQKMIAANLE  357

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
            GLV R  L +DK  K++S+LKGALDYS+F+DVDMVIEAVIE +PLKQ IFSD+EK CP H
Sbjct  358  GLVKRGSLTKDKMNKAMSLLKGALDYSDFKDVDMVIEAVIEKIPLKQSIFSDLEKVCPPH  417

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQT  552
            CILATNTSTIDLN++G++T SQDRIIGAHFFSPAH+MPLLEIVRTEKTS Q 
Sbjct  418  CILATNTSTIDLNVVGEKTNSQDRIIGAHFFSPAHIMPLLEIVRTEKTSPQA  469



>ref|XP_006647155.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein-like [Oryza brachyantha]
Length=726

 Score =   269 bits (688),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 147/172 (85%), Gaps = 0/172 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  DV LKP  I+KVAVIGGGLMGSGIATALL+SN +VVLKE+NP++L +G K I  N+ 
Sbjct  298  GVTDVQLKPRKIRKVAVIGGGLMGSGIATALLVSNTSVVLKEVNPQFLQRGQKMIAANLE  357

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
            GLV R  L ++K  K++S+LKGALDYS+F+DVDMVIEAVIE VPLKQ IFSDIEK CP H
Sbjct  358  GLVKRGSLTKEKMNKAMSLLKGALDYSDFKDVDMVIEAVIEKVPLKQSIFSDIEKVCPPH  417

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQT  552
            CILATNTSTIDLN++G++T SQDRIIGAHFFSPAH+MPLLEIVRTEKTS Q 
Sbjct  418  CILATNTSTIDLNVVGEKTNSQDRIIGAHFFSPAHIMPLLEIVRTEKTSPQA  469



>gb|EEC72899.1| hypothetical protein OsI_06722 [Oryza sativa Indica Group]
Length=726

 Score =   269 bits (688),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 147/172 (85%), Gaps = 0/172 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  DV LKP  I+KVAVIGGGLMGSGIATALL+SN +VVLKE+NP++L +G K I  N+ 
Sbjct  298  GVTDVQLKPRKIRKVAVIGGGLMGSGIATALLVSNTSVVLKEVNPQFLQRGQKMIAANLE  357

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
            GLV R  L +DK  K++S+LKGALDYS+F+DVDMVIEAVIE +PLKQ IFSD+EK CP H
Sbjct  358  GLVKRGSLTKDKMNKAMSLLKGALDYSDFKDVDMVIEAVIEKIPLKQSIFSDLEKVCPPH  417

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQT  552
            CILATNTSTIDLN++G++T SQDRIIGAHFFSPAH+MPLLEIVRTEKTS Q 
Sbjct  418  CILATNTSTIDLNVVGEKTNSQDRIIGAHFFSPAHIMPLLEIVRTEKTSPQA  469



>gb|AAQ13901.1| multifunctional protein [Oryza sativa]
Length=718

 Score =   269 bits (687),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 147/172 (85%), Gaps = 0/172 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  DV LKP  I+KVAVIGGGLMGSGIATALL+SN +VVLKE+NP++L +G K I  N+ 
Sbjct  290  GVTDVQLKPRKIRKVAVIGGGLMGSGIATALLVSNTSVVLKEVNPQFLQRGQKMIAANLE  349

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
            GLV R  L +DK  K++S+LKGALDYS+F+DVDMVIEAVIE +PLKQ IFSD+EK CP H
Sbjct  350  GLVKRGSLTKDKMNKAMSLLKGALDYSDFKDVDMVIEAVIEKIPLKQSIFSDLEKVCPPH  409

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQT  552
            CILATNTSTIDLN++G++T SQDRIIGAHFFSPAH+MPLLEIVRTEKTS Q 
Sbjct  410  CILATNTSTIDLNVVGEKTNSQDRIIGAHFFSPAHIMPLLEIVRTEKTSPQA  461



>ref|XP_010089223.1| Peroxisomal fatty acid beta-oxidation multifunctional protein 
AIM1 [Morus notabilis]
 gb|EXB37512.1| Peroxisomal fatty acid beta-oxidation multifunctional protein 
AIM1 [Morus notabilis]
Length=724

 Score =   269 bits (687),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            D+GLKP  IKKVA+IGGGLMGSGIATALLLSNI+VV+KE+N EY+ K  K IE N++GL+
Sbjct  300  DIGLKPRHIKKVAIIGGGLMGSGIATALLLSNISVVIKEVNSEYVLKARKMIEANIQGLI  359

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            ++ KL QDKAEK+L++LKG LDY+EF+DVD+VIEAVIEN+ LKQ IFS+IEK CPSHCIL
Sbjct  360  TKGKLTQDKAEKALTLLKGVLDYTEFKDVDVVIEAVIENITLKQTIFSEIEKVCPSHCIL  419

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            A+NTST+DL+++G++TRSQ RI+GAHFFSPAHVMPLLEIVRTEKTS Q
Sbjct  420  ASNTSTLDLHVVGEKTRSQGRIVGAHFFSPAHVMPLLEIVRTEKTSPQ  467



>ref|XP_004952201.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein-like [Setaria italica]
Length=727

 Score =   268 bits (686),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 147/172 (85%), Gaps = 0/172 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  +V LKP   +KVA+IGGGLMGSGIAT+LL+SNI+VVLKE+NP++L +G K I  N+ 
Sbjct  299  GVTNVQLKPRKTRKVAIIGGGLMGSGIATSLLISNISVVLKEVNPQFLQRGQKMIAANLE  358

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
            GLV R  L +DK  K++S+LKGALDYSEF+DVDMVIEAVIEN+PLKQ IFSDIEK CP H
Sbjct  359  GLVKRGSLTKDKINKAMSLLKGALDYSEFKDVDMVIEAVIENIPLKQSIFSDIEKICPPH  418

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQT  552
            CI ATNTSTIDLN++G++T SQDRIIGAHFFSPAH+MPLLEIVRTEKTS Q 
Sbjct  419  CIFATNTSTIDLNVVGEKTNSQDRIIGAHFFSPAHIMPLLEIVRTEKTSPQA  470



>ref|NP_001148087.1| LOC100281695 [Zea mays]
 gb|ACG29687.1| peroxisomal fatty acid beta-oxidation multifunctional protein 
[Zea mays]
Length=727

 Score =   268 bits (686),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 148/172 (86%), Gaps = 0/172 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  DV LKP  I+KVAVIGGGLMGSGIAT+LL+SNI+VVLKE+NP++L +G K I GN+ 
Sbjct  299  GVTDVQLKPRPIRKVAVIGGGLMGSGIATSLLVSNISVVLKEVNPQFLQRGEKMIAGNLE  358

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
            GL+ +  L +D+  K++S+ KGALDYS+F+DVDMVIEAVIE +PLKQ IFSDIEK CP H
Sbjct  359  GLIKKGSLTKDRMHKAMSLFKGALDYSDFKDVDMVIEAVIEKIPLKQSIFSDIEKICPKH  418

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQT  552
            CILATNTSTIDLN++G++T SQDRIIGAHFFSPAH+MPLLEIVRTEKTS Q 
Sbjct  419  CILATNTSTIDLNVVGEKTNSQDRIIGAHFFSPAHIMPLLEIVRTEKTSPQA  470



>ref|XP_009109066.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Brassica rapa]
 emb|CDY66477.1| BnaA08g30740D [Brassica napus]
Length=721

 Score =   268 bits (686),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 150/168 (89%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            DVGLKP  +KKVAVIGGGLMGSGIATALLLSNI VVLKEIN EYL KG+K++E N++GLV
Sbjct  301  DVGLKPRPMKKVAVIGGGLMGSGIATALLLSNIRVVLKEINSEYLLKGIKSVEANLKGLV  360

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            SR KL QDKA K+ S+LKG LDY+EF+DVDMVIEAVIEN+ LKQKIF +IE+ CP +CIL
Sbjct  361  SRGKLTQDKAGKAFSLLKGVLDYTEFKDVDMVIEAVIENIQLKQKIFKEIEEVCPPNCIL  420

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            A+NTSTIDLN+IG++T S+DRI+GAHFFSPAH+M LLEIVRTE TSAQ
Sbjct  421  ASNTSTIDLNVIGEKTNSKDRIVGAHFFSPAHLMTLLEIVRTENTSAQ  468



>gb|KHN45635.1| Peroxisomal fatty acid beta-oxidation multifunctional protein 
AIM1 [Glycine soja]
Length=724

 Score =   268 bits (685),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R IS + G  D+GLKP ++KK AVIGGGLMGSGIATAL+L NI V+LKEINPE+L KG+K
Sbjct  290  RAISKVPGVTDIGLKPRNVKKAAVIGGGLMGSGIATALILGNIHVILKEINPEFLLKGIK  349

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
            TIE NV GLV R KL + KA+ +LS+L+G LDYSEF+DVD+VIEAVIEN+ LKQ IFSD+
Sbjct  350  TIEANVNGLVRRGKLTKQKADAALSLLRGVLDYSEFKDVDLVIEAVIENISLKQTIFSDL  409

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CP HCILA+NTSTIDL+++G+ T SQ+RI GAHFFSPAH+MPLLEI+RT+KTSAQ
Sbjct  410  EKICPPHCILASNTSTIDLDVVGKTTSSQNRIAGAHFFSPAHIMPLLEIIRTDKTSAQ  467



>ref|XP_003534202.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Glycine max]
Length=724

 Score =   268 bits (685),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R IS + G  D+GLKP ++KK AVIGGGLMGSGIATAL+L NI V+LKEINPE+L KG+K
Sbjct  290  RAISKVPGVTDIGLKPRNVKKAAVIGGGLMGSGIATALILGNIHVILKEINPEFLLKGIK  349

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
            TIE NV GLV R KL + KA+ +LS+L+G LDYSEF+DVD+VIEAVIEN+ LKQ IFSD+
Sbjct  350  TIEANVNGLVRRGKLTKQKADAALSLLRGVLDYSEFKDVDLVIEAVIENISLKQTIFSDL  409

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CP HCILA+NTSTIDL+++G+ T SQ+RI GAHFFSPAH+MPLLEI+RT+KTSAQ
Sbjct  410  EKICPPHCILASNTSTIDLDVVGKTTSSQNRIAGAHFFSPAHIMPLLEIIRTDKTSAQ  467



>emb|CDX92908.1| BnaC07g41660D [Brassica napus]
Length=787

 Score =   269 bits (688),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R IS +    DVGLKP  +KKVAVIGGGLMGSGI TALLLSNI VVLKEIN EYL KG+ 
Sbjct  291  RAISKVPNVTDVGLKPRPMKKVAVIGGGLMGSGITTALLLSNIRVVLKEINSEYLLKGIN  350

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
            ++E N+  LVSR KL QDKAEK+ S+LKG LDY++F+DVDMVIEAVIEN+ LKQKIF +I
Sbjct  351  SVEANLNSLVSRGKLTQDKAEKAFSLLKGVLDYTDFKDVDMVIEAVIENIELKQKIFIEI  410

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            E+ACPSHCILA+NTSTIDLN+IG++T S+DRI+GAHFFSPAH+M LLEIVRTE TS Q
Sbjct  411  EEACPSHCILASNTSTIDLNVIGEKTNSKDRIVGAHFFSPAHIMTLLEIVRTENTSPQ  468



>ref|XP_010047906.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Eucalyptus grandis]
 gb|KCW79920.1| hypothetical protein EUGRSUZ_C01261 [Eucalyptus grandis]
Length=724

 Score =   267 bits (683),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 149/168 (89%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            DVGLKP  +KKVAVIGGGLMGSGIATAL+++NI VVLKEIN EYL KG+K +E NVRGLV
Sbjct  300  DVGLKPRKVKKVAVIGGGLMGSGIATALIVNNIYVVLKEINSEYLLKGVKMVEANVRGLV  359

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
             + KL Q  AEK+LS+LKGALDY++F+DVDMVIEAVIEN+ LKQ IFS+IEK CP HCIL
Sbjct  360  VKGKLTQGNAEKALSMLKGALDYADFKDVDMVIEAVIENISLKQAIFSEIEKICPPHCIL  419

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            ATNTS+IDLN IG++T SQDRI+GAHFFSPAH+M LLEIVRTE+TSAQ
Sbjct  420  ATNTSSIDLNKIGERTSSQDRIVGAHFFSPAHIMSLLEIVRTERTSAQ  467



>ref|XP_010050568.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Eucalyptus grandis]
Length=563

 Score =   263 bits (671),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            DVGLKP  +KKVAVIGGGLMGSGIATAL+++NI VVLKEIN EYL KG+K +E NVRGLV
Sbjct  139  DVGLKPRKVKKVAVIGGGLMGSGIATALIVNNIYVVLKEINSEYLLKGVKMVEANVRGLV  198

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
             + KL Q  AEK+LS+LKG LDY++F+DVDMVIEAVIEN+ LKQ IFS+IEK CP HCIL
Sbjct  199  VKGKLTQGNAEKALSMLKGVLDYADFKDVDMVIEAVIENISLKQAIFSEIEKICPPHCIL  258

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            ATNTS+IDLN IG++T SQDR++GAHFFSPAH+  LLEIVRTE+TSAQ
Sbjct  259  ATNTSSIDLNKIGERTSSQDRVVGAHFFSPAHIKSLLEIVRTERTSAQ  306



>gb|KHN20673.1| Peroxisomal fatty acid beta-oxidation multifunctional protein 
AIM1 [Glycine soja]
Length=724

 Score =   266 bits (680),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 151/178 (85%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R IS + G  D+GLKP ++KK AVIGGGLMGSGIATAL+L NI V+LKEIN E+L KG+K
Sbjct  290  RAISKVPGVTDIGLKPRNVKKAAVIGGGLMGSGIATALILGNIRVILKEINSEFLLKGIK  349

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
            TIE NV GLV R KL + KA+ +LS+LKG LDYSEF+DVD+VIEAVIEN+ LKQ IF D+
Sbjct  350  TIEANVNGLVRRGKLTKQKADAALSLLKGVLDYSEFKDVDLVIEAVIENISLKQTIFGDL  409

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CP HCILA+NTSTIDL+++G+ T SQDRI GAHFFSPAH+MPLLEI+RT+KTSAQ
Sbjct  410  EKICPPHCILASNTSTIDLDVVGKTTSSQDRIAGAHFFSPAHIMPLLEIIRTDKTSAQ  467



>ref|XP_003528905.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Glycine max]
Length=724

 Score =   266 bits (680),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 151/178 (85%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R IS + G  D+GLKP ++KK AVIGGGLMGSGIATAL+L NI V+LKEIN E+L KG+K
Sbjct  290  RAISKVPGVTDIGLKPRNVKKAAVIGGGLMGSGIATALILGNIRVILKEINSEFLLKGIK  349

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
            TIE NV GLV R KL + KA+ +LS+LKG LDYSEF+DVD+VIEAVIEN+ LKQ IF D+
Sbjct  350  TIEANVNGLVRRGKLTKQKADAALSLLKGVLDYSEFKDVDLVIEAVIENISLKQTIFGDL  409

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CP HCILA+NTSTIDL+++G+ T SQDRI GAHFFSPAH+MPLLEI+RT+KTSAQ
Sbjct  410  EKICPPHCILASNTSTIDLDVVGKTTSSQDRIAGAHFFSPAHIMPLLEIIRTDKTSAQ  467



>gb|AAL35606.1|AF442962_1 peroxisomal multifunctional protein [Oryza sativa]
Length=725

 Score =   265 bits (676),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 145/172 (84%), Gaps = 0/172 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  DV LKP  I+KVAVIGGGLMGSGIATALL+SN +VVLKE+NP++  +G K I  N+ 
Sbjct  298  GVTDVQLKPRKIRKVAVIGGGLMGSGIATALLVSNTSVVLKEVNPQFRQRGQKMIAANLE  357

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
            GLV R  L +DK  K++S+LKGALDY +F+DVDMVIEAVIE +PLKQ IFSD+EK CP H
Sbjct  358  GLVKRGSLTKDKMNKAMSLLKGALDYCDFKDVDMVIEAVIEKIPLKQSIFSDLEKVCPPH  417

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQT  552
            CILATNTSTIDLN++G++T SQDRIIGAHFFSPAH+MPLLEIVRTEKTS Q 
Sbjct  418  CILATNTSTIDLNVVGEKTNSQDRIIGAHFFSPAHIMPLLEIVRTEKTSPQA  469



>gb|EMT05771.1| Peroxisomal fatty acid beta-oxidation multifunctional protein 
[Aegilops tauschii]
Length=661

 Score =   263 bits (672),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 147/172 (85%), Gaps = 3/172 (2%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D+ LKP  I+KVAVIGGGLMGSGIATALL+SNI+VVLKE+NP++L +G KTI GN+ 
Sbjct  297  GVTDIQLKPRKIRKVAVIGGGLMGSGIATALLVSNISVVLKEVNPQFLQRGQKTIAGNLE  356

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
            GLV R  L +DK  K++S+LKGALDYS+F+DVDM   AVIE VPLKQ IF+DIEK CP H
Sbjct  357  GLVKRGSLTKDKMSKAISLLKGALDYSDFKDVDM---AVIEKVPLKQSIFADIEKICPPH  413

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQT  552
            CILATNTSTIDLNI+G++T SQDRIIGAHFFSPAH+MPLLEIVRTE+TS Q 
Sbjct  414  CILATNTSTIDLNIVGEKTNSQDRIIGAHFFSPAHIMPLLEIVRTERTSPQA  465



>emb|CDY69211.1| BnaCnng62430D, partial [Brassica napus]
Length=610

 Score =   262 bits (669),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 150/178 (84%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R IS +    DVGLKP  +KKVAVIGGGLMGSGIATALLLSNI VV+KEIN EYL KG+K
Sbjct  180  RAISKVPNVTDVGLKPRHMKKVAVIGGGLMGSGIATALLLSNIRVVIKEINSEYLLKGIK  239

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
            +IE N+  LVSR K+ QDKA ++ S+LKG LDY+EF+DVDMVIEAVIEN+ LKQ IF +I
Sbjct  240  SIEANLNSLVSRGKMTQDKAGEAFSLLKGVLDYTEFKDVDMVIEAVIENIELKQNIFKEI  299

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            E+ CP HCILA+NTSTIDLN+IG++T S+DRI+GAHFFSPAH+M LLEIVRTE TS +
Sbjct  300  EEVCPPHCILASNTSTIDLNVIGEKTNSKDRIVGAHFFSPAHIMTLLEIVRTENTSPR  357



>ref|XP_010438362.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Camelina sativa]
Length=721

 Score =   263 bits (671),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 149/168 (89%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            DVGLKP  IKKVA+IGGGLMGSGIATALLLSNI V+LKEIN EYL KG+K++E N++GLV
Sbjct  301  DVGLKPRPIKKVAIIGGGLMGSGIATALLLSNIRVLLKEINTEYLMKGIKSVEANIKGLV  360

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            SR KL QDKA K+LS+LKG LDY+EF+DVDMVIEAVIEN+ LKQ IF ++EK C  HCIL
Sbjct  361  SRGKLTQDKAGKALSLLKGVLDYTEFKDVDMVIEAVIENIQLKQNIFKELEKVCSPHCIL  420

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            A+NTSTIDL++IG++T S+DRI+GAHFFSPAH+M LLEIVR++ TSAQ
Sbjct  421  ASNTSTIDLDVIGEKTNSKDRIVGAHFFSPAHLMTLLEIVRSKNTSAQ  468



>ref|XP_010433148.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 [Camelina sativa]
Length=721

 Score =   263 bits (671),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 149/168 (89%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            DVGLKP  IKKVA+IGGGLMGSGIATALLLSNI V+LKEIN EYL KG+K++E N++GLV
Sbjct  301  DVGLKPRPIKKVAIIGGGLMGSGIATALLLSNIRVLLKEINTEYLMKGIKSVEANIKGLV  360

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            SR KL QDKA K+LS+LKG LDY+EF+DVDMVIEAVIEN+ LKQ IF ++EK C  HCIL
Sbjct  361  SRGKLTQDKAGKALSLLKGVLDYTEFKDVDMVIEAVIENIQLKQNIFKELEKVCSPHCIL  420

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            A+NTSTIDL++IG++T S+DRI+GAHFFSPAH+M LLEIVR++ TSAQ
Sbjct  421  ASNTSTIDLDVIGEKTNSKDRIVGAHFFSPAHLMTLLEIVRSKNTSAQ  468



>ref|NP_194630.1| fatty acid beta-oxidation multifunctional protein AIM1 [Arabidopsis 
thaliana]
 sp|Q9ZPI6.1|AIM1_ARATH RecName: Full=Peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1; AltName: Full=Protein ABNORMAL INFLORESCENCE 
MERISTEM 1; Short=AtAIM1; Includes: RecName: Full=Enoyl-CoA 
hydratase/3-2-trans-enoyl-CoA isomerase/3-hydroxybutyryl-CoA 
epimerase; Includes: RecName: Full=3-hydroxyacyl-CoA 
dehydrogenase [Arabidopsis thaliana]
 gb|AAD18041.1| AIM1 protein [Arabidopsis thaliana]
 emb|CAB43915.1| AIM1 protein [Arabidopsis thaliana]
 emb|CAB79659.1| AIM1 protein [Arabidopsis thaliana]
 gb|AAL24297.1| AIM1 protein [Arabidopsis thaliana]
 gb|AAL59895.1| putative AIM1 protein [Arabidopsis thaliana]
 gb|AAM20293.1| putative AIM1 protein [Arabidopsis thaliana]
 gb|AEE85572.1| fatty acid beta-oxidation multifunctional protein AIM1 [Arabidopsis 
thaliana]
Length=721

 Score =   263 bits (671),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            DVGLKP  IKKVAVIGGGLMGSGIATALLLSNI VVLKEIN E+L KG+K++E N++ LV
Sbjct  301  DVGLKPRPIKKVAVIGGGLMGSGIATALLLSNIRVVLKEINSEFLMKGIKSVEANMKSLV  360

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            SR KL QDKA K+LS+ KG LDY+EF DVDMVIEAVIEN+ LKQ IF +IEK C  HCIL
Sbjct  361  SRGKLTQDKAGKALSLFKGVLDYTEFNDVDMVIEAVIENIQLKQNIFKEIEKVCSPHCIL  420

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            A+NTSTIDL++IG++T S+DRI+GAHFFSPAH+MPLLEIVR++ TSAQ
Sbjct  421  ASNTSTIDLDVIGEKTNSKDRIVGAHFFSPAHLMPLLEIVRSKNTSAQ  468



>ref|XP_010447902.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Camelina sativa]
Length=721

 Score =   263 bits (671),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 149/168 (89%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            DVGLKP  IKKVA+IGGGLMGSGIATALLLSNI V+LKEIN EYL KG+K++E N++GLV
Sbjct  301  DVGLKPRPIKKVAIIGGGLMGSGIATALLLSNIRVLLKEINTEYLMKGIKSVEANIKGLV  360

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            SR KL QDKA K+LS+LKG LDY+EF+DVDMVIEAVIEN+ LKQ IF ++EK C  HCIL
Sbjct  361  SRGKLTQDKAGKALSLLKGVLDYTEFKDVDMVIEAVIENIQLKQSIFKELEKVCSPHCIL  420

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            A+NTSTIDL++IG++T S+DRI+GAHFFSPAH+M LLEIVR++ TSAQ
Sbjct  421  ASNTSTIDLDVIGEKTNSKDRIVGAHFFSPAHLMTLLEIVRSKNTSAQ  468



>ref|XP_010925875.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein [Elaeis guineensis]
Length=725

 Score =   263 bits (671),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            DVGL+P  IK+VAVIGGGLMGSGIATAL+L+NI+V+LKEI+ ++L KGLKTIE N+ GLV
Sbjct  300  DVGLRPRQIKRVAVIGGGLMGSGIATALILNNISVLLKEIDSKFLQKGLKTIEANLEGLV  359

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
             +  L  DK  K+LS+L+G LDYSEF+ VDMVIEAVIENV LKQ IFSDIEK CP  CIL
Sbjct  360  KKGSLTPDKMNKALSLLRGVLDYSEFKHVDMVIEAVIENVSLKQSIFSDIEKFCPPTCIL  419

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            ATNTSTIDLNI+G++T SQDRI+GAHFFSPAHVMPLLEIVRTEKTS Q
Sbjct  420  ATNTSTIDLNIVGEKTHSQDRILGAHFFSPAHVMPLLEIVRTEKTSPQ  467



>ref|XP_009137821.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Brassica rapa]
Length=700

 Score =   262 bits (669),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 150/178 (84%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R IS +    DVGLKP  +KKVAVIGGGLMGSGIATALLLSNI VV+KEIN EYL KG+K
Sbjct  270  RAISKVPNVTDVGLKPRHMKKVAVIGGGLMGSGIATALLLSNIRVVIKEINSEYLLKGIK  329

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
            ++E N+  LVSR K+ QDKA ++ S+LKG LDY+EF+DVDMVIEAVIEN+ LKQ IF +I
Sbjct  330  SVEANLNSLVSRGKMTQDKAGEAFSLLKGVLDYTEFKDVDMVIEAVIENIELKQNIFKEI  389

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            E+ CP HCILA+NTSTIDLN+IG++T S+DRI+GAHFFSPAH+M LLEIVRTE TS +
Sbjct  390  EEVCPPHCILASNTSTIDLNVIGEKTNSKDRIVGAHFFSPAHIMTLLEIVRTENTSPR  447



>ref|XP_007152846.1| hypothetical protein PHAVU_004G164800g [Phaseolus vulgaris]
 gb|ESW24840.1| hypothetical protein PHAVU_004G164800g [Phaseolus vulgaris]
Length=724

 Score =   262 bits (670),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 150/178 (84%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R I+ + G  D+GLKP ++KK AV+GGGLMGSGIATALLL NI V+LKEIN E L KG+K
Sbjct  290  RAITKVPGVTDIGLKPRNVKKAAVVGGGLMGSGIATALLLGNIHVLLKEINSELLMKGIK  349

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
            TIEGNV  L+ R KL + KA+ +LS+L+G LDYSEF+DVD+VIEAVIEN+ LKQ IFSD+
Sbjct  350  TIEGNVNALLRRGKLTKQKADAALSLLQGVLDYSEFKDVDLVIEAVIENLSLKQTIFSDL  409

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CP HCILA+NTSTIDLN++G+ T SQDRI GAHFFSPAHVMPLLEI+RT+KTS Q
Sbjct  410  EKICPPHCILASNTSTIDLNLVGKMTSSQDRIAGAHFFSPAHVMPLLEIIRTDKTSPQ  467



>gb|EMT19952.1| Peroxisomal fatty acid beta-oxidation multifunctional protein 
[Aegilops tauschii]
Length=723

 Score =   262 bits (670),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 150/179 (84%), Gaps = 7/179 (4%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D+ LKP +I+KVAVIGGGLMGSGIATALL+ NI+VVLKE+NP++L +G KTI GN+ 
Sbjct  298  GVTDIQLKPRNIRKVAVIGGGLMGSGIATALLVGNISVVLKEVNPQFLQRGQKTIAGNLE  357

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIE---AVIENVPLKQKIFSDIEKAC  387
            GLV R  L +DK  K++S+LKGALDYS+F+DVDMVIE   AVIE VPLKQ IF+DIEK C
Sbjct  358  GLVKRGSLTKDKMSKAISLLKGALDYSDFKDVDMVIEVVLAVIEKVPLKQSIFADIEKIC  417

Query  388  PSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFF----SPAHVMPLLEIVRTEKTSAQT  552
            P HCILATNTSTIDLN+IG++T SQDRIIGAHFF    SPAH+MPLLEIVRTEKTS Q 
Sbjct  418  PPHCILATNTSTIDLNVIGEKTNSQDRIIGAHFFRDIKSPAHIMPLLEIVRTEKTSPQA  476



>gb|KCW79923.1| hypothetical protein EUGRSUZ_C01265 [Eucalyptus grandis]
Length=724

 Score =   262 bits (670),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            DVGLKP  +KKVAVIGGGLMGSGIATAL+++NI VVLKEIN EYL KG+K +E NVRGLV
Sbjct  300  DVGLKPRKVKKVAVIGGGLMGSGIATALIVNNIYVVLKEINSEYLLKGVKMVEANVRGLV  359

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
             + KL Q  AEK+LS+LKG LDY++F+DVDMVIEAVIEN+ LKQ IFS+IEK CP HCIL
Sbjct  360  VKGKLTQGNAEKALSMLKGVLDYADFKDVDMVIEAVIENISLKQAIFSEIEKICPPHCIL  419

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            ATNTS+IDLN IG++T SQDR++GAHFFSPAH+  LLEIVRTE+TSAQ
Sbjct  420  ATNTSSIDLNKIGERTSSQDRVVGAHFFSPAHIKSLLEIVRTERTSAQ  467



>ref|XP_008775812.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein-like [Phoenix dactylifera]
Length=725

 Score =   262 bits (670),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 148/168 (88%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            D+G+ P +IKKVAVIGGGLMGSGIATAL+LS+I+V+LKEI+ ++L KGLKTI  N+ GLV
Sbjct  300  DIGITPRNIKKVAVIGGGLMGSGIATALILSDISVILKEIDSKFLQKGLKTISANLEGLV  359

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
             +  L +DK  K+LS+LKGALDYSEF+ VDMVIEAVIENV LKQ IF++IEK CP  CIL
Sbjct  360  KKGSLTKDKMNKALSLLKGALDYSEFKHVDMVIEAVIENVSLKQSIFAEIEKICPPTCIL  419

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            ATNTSTIDLNI+G++TRSQDRI+GAHFFSPAHVMPLLEIVRTEKTS Q
Sbjct  420  ATNTSTIDLNIVGERTRSQDRILGAHFFSPAHVMPLLEIVRTEKTSPQ  467



>gb|EMS59767.1| Peroxisomal fatty acid beta-oxidation multifunctional protein 
[Triticum urartu]
Length=749

 Score =   263 bits (671),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 147/172 (85%), Gaps = 3/172 (2%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D+ LKP  I+KVAVIGGGLMGSGIATALL+SNI+VVLKE+NP++L +G KTI GN+ 
Sbjct  385  GVTDIQLKPRKIRKVAVIGGGLMGSGIATALLVSNISVVLKEVNPQFLKRGQKTIAGNLE  444

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
            GLV R  L +DK  K++S+LKGALDYS+F+DVDM   AVIE +PLKQ IF+DIEK CP H
Sbjct  445  GLVKRGSLTKDKMSKAISLLKGALDYSDFKDVDM---AVIEKIPLKQSIFADIEKICPPH  501

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQT  552
            CILATNTSTIDLNI+G++T SQDRIIGAHFFSPAH+MPLLEIVRTE+TS Q 
Sbjct  502  CILATNTSTIDLNIVGEKTNSQDRIIGAHFFSPAHIMPLLEIVRTERTSPQA  553



>ref|XP_002867428.1| hypothetical protein ARALYDRAFT_491857 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43687.1| hypothetical protein ARALYDRAFT_491857 [Arabidopsis lyrata subsp. 
lyrata]
Length=721

 Score =   262 bits (669),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            DVGLKP  IKKVAVIGGGLMGSGI TALLLSNI VVLKEIN EYL KG K++E N++GLV
Sbjct  301  DVGLKPRPIKKVAVIGGGLMGSGITTALLLSNIRVVLKEINSEYLMKGTKSVEANIKGLV  360

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            SR KL QDKA K+LS+ KG LDY+EF+DVDMVIEAVIEN+ LKQ IF +IEK C  HCIL
Sbjct  361  SRGKLTQDKAGKALSLFKGVLDYTEFKDVDMVIEAVIENIQLKQNIFKEIEKVCSPHCIL  420

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            A+NTSTIDL++IG++T S+DRI+GAHFFSPAH+M LLEIVR++ TSAQ
Sbjct  421  ASNTSTIDLDVIGEKTNSKDRIVGAHFFSPAHLMTLLEIVRSKNTSAQ  468



>ref|XP_009409458.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein [Musa acuminata subsp. malaccensis]
Length=725

 Score =   261 bits (666),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            DVGL+P  IK+VAVIGGGLMGSGIATAL+LSN  V+LKEI+   L KGLK I  N+ GLV
Sbjct  300  DVGLRPRKIKRVAVIGGGLMGSGIATALILSNTPVILKEIDSNLLQKGLKMIRANLEGLV  359

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
             +  L QDK  K+LS+LKG LDYSEF+ VDMVIEAVIE V LKQ IF+D+EKACP HCIL
Sbjct  360  KKGSLTQDKMNKALSLLKGVLDYSEFKHVDMVIEAVIEKVSLKQSIFADLEKACPPHCIL  419

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            A+NTSTIDLNI+G++TRSQDRIIGAHFFSPAHVMPLLEIVRT+KTS Q
Sbjct  420  ASNTSTIDLNIVGEKTRSQDRIIGAHFFSPAHVMPLLEIVRTDKTSPQ  467



>ref|XP_011071437.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a [Sesamum indicum]
Length=724

 Score =   260 bits (664),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 148/171 (87%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D+GLKP SIKKVA++GGGLMGSGIATAL+LSN  V+LKE+N ++L  G+  ++GN++
Sbjct  300  GVTDLGLKPRSIKKVAILGGGLMGSGIATALILSNYQVILKEVNDKFLQAGIGRVKGNLQ  359

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V + +++Q+K EK+LS+LKG LDY  FRDVDMVIEAVIENV LKQ+IFSD+EK CP H
Sbjct  360  SRVKKGQMSQEKFEKTLSLLKGVLDYESFRDVDMVIEAVIENVSLKQQIFSDLEKFCPPH  419

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            CIL +NTSTIDLN+IG++TRSQDRIIGAHFFSPAHVMPLLEIVRT+KTS Q
Sbjct  420  CILGSNTSTIDLNLIGEKTRSQDRIIGAHFFSPAHVMPLLEIVRTQKTSPQ  470



>gb|KJB07188.1| hypothetical protein B456_001G006400 [Gossypium raimondii]
Length=719

 Score =   259 bits (662),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 145/168 (86%), Gaps = 5/168 (3%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            DVGLKP  IKKV VIGGGLMG GIATAL++SNI V+LKE+N +YL KG+K I+ NV GLV
Sbjct  300  DVGLKPRQIKKVGVIGGGLMGCGIATALIVSNICVLLKELNSDYLLKGIKRIQANVGGLV  359

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            +R KL +DKAEK+LSILKG LDYSEF+DVDMVIEA IENV LKQKIFS+IEKACP HCIL
Sbjct  360  TRGKLTKDKAEKALSILKGVLDYSEFKDVDMVIEAAIENVGLKQKIFSEIEKACPPHCIL  419

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            ATNTSTIDLN+I     + DR+IGAHFFSPAHVMPLLEIVRT+KTS Q
Sbjct  420  ATNTSTIDLNLI-----ADDRVIGAHFFSPAHVMPLLEIVRTQKTSPQ  462



>gb|KJB07187.1| hypothetical protein B456_001G006400 [Gossypium raimondii]
Length=721

 Score =   259 bits (662),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 145/168 (86%), Gaps = 5/168 (3%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            DVGLKP  IKKV VIGGGLMG GIATAL++SNI V+LKE+N +YL KG+K I+ NV GLV
Sbjct  300  DVGLKPRQIKKVGVIGGGLMGCGIATALIVSNICVLLKELNSDYLLKGIKRIQANVGGLV  359

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            +R KL +DKAEK+LSILKG LDYSEF+DVDMVIEA IENV LKQKIFS+IEKACP HCIL
Sbjct  360  TRGKLTKDKAEKALSILKGVLDYSEFKDVDMVIEAAIENVGLKQKIFSEIEKACPPHCIL  419

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            ATNTSTIDLN+I     + DR+IGAHFFSPAHVMPLLEIVRT+KTS Q
Sbjct  420  ATNTSTIDLNLI-----ADDRVIGAHFFSPAHVMPLLEIVRTQKTSPQ  462



>ref|XP_006349823.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like [Solanum tuberosum]
Length=727

 Score =   259 bits (661),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 148/171 (87%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D+GLKP  IKKVA++GGGLMGSGIATALLLSN  V+LKE+N ++L  GL  ++ N++
Sbjct  303  GVTDLGLKPRRIKKVAILGGGLMGSGIATALLLSNYPVILKEVNDKFLQAGLGRVKANLQ  362

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V + K++Q+K EK+LS+LKGALDY +FRDVDMVIEAVIENV LKQ+IF+D+EK CP H
Sbjct  363  SSVKKGKMSQEKFEKTLSLLKGALDYEDFRDVDMVIEAVIENVSLKQQIFADLEKYCPPH  422

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            CIL +NTSTIDLN+IG++T+SQDRIIGAHFFSPAHVMPLLEIVRT+KTS Q
Sbjct  423  CILGSNTSTIDLNLIGEKTKSQDRIIGAHFFSPAHVMPLLEIVRTQKTSPQ  473



>gb|EPS61414.1| hypothetical protein M569_13383, partial [Genlisea aurea]
Length=569

 Score =   255 bits (651),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            D+GLKP  ++KVAVIGGGLMGSGIATAL+++ + V+LKEI+ E++ K +  ++GNV  L 
Sbjct  243  DIGLKPREVRKVAVIGGGLMGSGIATALIVNGVNVILKEISSEHVKKAIHAVKGNVTNLA  302

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            SRK L QDKAEK+L  LKGALDYSEF DV+MVIEAVIEN+PLKQKIFS++EK CP HC+L
Sbjct  303  SRKVLTQDKAEKALLRLKGALDYSEFHDVEMVIEAVIENIPLKQKIFSELEKVCPPHCVL  362

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            A+NTSTIDL  IG+ T SQDRIIGAHFFSPAH+MPLLE+VRTEKTS Q
Sbjct  363  ASNTSTIDLYTIGENTASQDRIIGAHFFSPAHLMPLLEVVRTEKTSPQ  410



>ref|XP_008344094.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Malus domestica]
Length=579

 Score =   255 bits (651),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S +    DVGLKP  I KVA  GGGLMGSGIATALL SNI+VVLKE+N EYL KG+ 
Sbjct  290  RATSKVPNVTDVGLKPRQIXKVAXXGGGLMGSGIATALLXSNISVVLKEVNXEYLQKGIX  349

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             IEGNV GLV+R+ L QDKA+K+L++LKG+LDYS+F+DVDMVIEAVIE+VPLKQKIFS++
Sbjct  350  KIEGNVEGLVTRRGLTQDKAQKALALLKGSLDYSDFKDVDMVIEAVIESVPLKQKIFSEL  409

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            E  CP HC+LATNTSTIDLN++G++T S DRI+GAHFFSPAHVMPLLEIVRTEKTSAQ
Sbjct  410  ENVCPPHCVLATNTSTIDLNVVGEKTNSHDRIVGAHFFSPAHVMPLLEIVRTEKTSAQ  467



>ref|XP_010314711.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a isoform X2 [Solanum lycopersicum]
Length=726

 Score =   256 bits (654),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 147/171 (86%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D+GLKP  IKKVA++GGGLMGSGIATALLLSN  V+LKE+N ++L  GL  ++ N++
Sbjct  302  GVTDLGLKPRRIKKVAILGGGLMGSGIATALLLSNYPVILKEVNDKFLQAGLGRVKANLQ  361

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V + K++ +K EK+LS+LKGALDY +FRDVDMVIEAVIENV LKQ+IF+D+EK CP H
Sbjct  362  SSVKKGKMSPEKFEKTLSLLKGALDYEDFRDVDMVIEAVIENVSLKQQIFADLEKYCPPH  421

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            CIL +NTSTIDLN+IG++T+SQDRIIGAHFFSPAHVMPLLEIVRT+KTS Q
Sbjct  422  CILGSNTSTIDLNLIGEKTKSQDRIIGAHFFSPAHVMPLLEIVRTQKTSPQ  472



>ref|XP_004252912.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a isoform X1 [Solanum lycopersicum]
Length=727

 Score =   256 bits (654),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 147/171 (86%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D+GLKP  IKKVA++GGGLMGSGIATALLLSN  V+LKE+N ++L  GL  ++ N++
Sbjct  303  GVTDLGLKPRRIKKVAILGGGLMGSGIATALLLSNYPVILKEVNDKFLQAGLGRVKANLQ  362

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V + K++ +K EK+LS+LKGALDY +FRDVDMVIEAVIENV LKQ+IF+D+EK CP H
Sbjct  363  SSVKKGKMSPEKFEKTLSLLKGALDYEDFRDVDMVIEAVIENVSLKQQIFADLEKYCPPH  422

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            CIL +NTSTIDLN+IG++T+SQDRIIGAHFFSPAHVMPLLEIVRT+KTS Q
Sbjct  423  CILGSNTSTIDLNLIGEKTKSQDRIIGAHFFSPAHVMPLLEIVRTQKTSPQ  473



>ref|XP_002516945.1| 3-hydroxyacyl-CoA dehyrogenase, putative [Ricinus communis]
 gb|EEF45559.1| 3-hydroxyacyl-CoA dehyrogenase, putative [Ricinus communis]
Length=541

 Score =   251 bits (642),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 143/172 (83%), Gaps = 0/172 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D GL P  + KVAV+GGGLMGSGIATAL+LSN  V+LKE+N ++L  G+  +  N++
Sbjct  159  GITDKGLIPRRVNKVAVLGGGLMGSGIATALILSNYPVILKEVNQQFLDAGINRVRANLQ  218

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V + K++Q+K EK+LS+LKG LDY  F+DVDMVIEAVIENV LKQ+IF+D+EK CP H
Sbjct  219  SRVKKGKMSQEKFEKTLSLLKGVLDYESFKDVDMVIEAVIENVSLKQQIFADLEKYCPPH  278

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQT  552
            CILA+NTSTIDLN+IGQ+TRSQDRIIGAHFFSPAH+MPLLEIVRT +TSAQ 
Sbjct  279  CILASNTSTIDLNLIGQKTRSQDRIIGAHFFSPAHIMPLLEIVRTNQTSAQA  330



>gb|AER62376.1| hypothetical protein, partial [Hordeum vulgare subsp. spontaneum]
Length=315

 Score =   245 bits (625),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  I KVA++GGGLMGSGIATA++LSN  V+LKE+N ++L+ G+ 
Sbjct  92   RATSKVPGATDLGLMPRKIMKVAILGGGLMGSGIATAMILSNYPVLLKEVNEKFLNAGID  151

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             I+ N++  V + K+ +++ EK+LS+L GAL Y +F++VD+VIEAVIENV LKQ+IF+D+
Sbjct  152  RIKANLQSRVRKGKMTEERYEKALSLLSGALGYEKFKEVDLVIEAVIENVKLKQQIFADL  211

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CPSHCILATNTSTIDLN+IG++T+SQDRI+GAHFFSPAHVMPLLEIVRT+ TSAQ
Sbjct  212  EKYCPSHCILATNTSTIDLNLIGEKTKSQDRIVGAHFFSPAHVMPLLEIVRTQHTSAQ  269



>gb|AER62392.1| hypothetical protein, partial [Henrardia persica]
 gb|AER62393.1| hypothetical protein, partial [Henrardia persica]
Length=339

 Score =   245 bits (626),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  I KVA++GGGLMGSGIATA++LSN  V+LKE+N ++L+ G+ 
Sbjct  99   RATSKVPGATDLGLMPRKITKVAILGGGLMGSGIATAMILSNYPVLLKEVNEKFLNAGID  158

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             I+ N++  V + K+ +++ EK+LS+L GAL Y +F++VD+VIEAVIENV LKQ+IF+D+
Sbjct  159  RIKANLQSRVRKGKMTEERYEKALSLLSGALGYEKFKEVDLVIEAVIENVKLKQQIFADL  218

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CPSHCILATNTSTIDLN+IG++T+SQDRIIGAHFFSPAHVMPLLEIVRT+ TSAQ
Sbjct  219  EKYCPSHCILATNTSTIDLNLIGEKTKSQDRIIGAHFFSPAHVMPLLEIVRTQHTSAQ  276



>dbj|BAG16526.1| putative glyoxysomal fatty acid beta-oxidation multifunctional 
protein [Capsicum chinense]
Length=725

 Score =   255 bits (652),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 147/171 (86%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D+GLKP  IKKVA++GGGLMGSGIATALL S   V+LKE+N ++L  GL  ++ N++
Sbjct  301  GVTDLGLKPRRIKKVAILGGGLMGSGIATALLRSGYPVILKEVNDKFLQAGLGRVKANLQ  360

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V + K++Q+K EK+LS+LKGALDY  FRDVDMVIEAVIENV LKQ++F+D+EK CPSH
Sbjct  361  SSVKKGKMSQEKFEKTLSLLKGALDYEGFRDVDMVIEAVIENVSLKQQVFADLEKYCPSH  420

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            CILA+NTSTIDLN+IG++T+SQDRIIGAHFFSPAHVMPLLEIVRT+KTS Q
Sbjct  421  CILASNTSTIDLNLIGEKTKSQDRIIGAHFFSPAHVMPLLEIVRTQKTSPQ  471



>gb|AER62400.1| hypothetical protein, partial [Brachypodium sp. D49c]
Length=306

 Score =   244 bits (623),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  I KVA++GGGLMGSGIATA++LSN  V+LKE+N ++L+ G+ 
Sbjct  70   RATSKVPGATDLGLMPRKITKVAILGGGLMGSGIATAMILSNYPVILKEVNEKFLNAGID  129

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             I+ N++  V + K+ +++ EK+LS++ GAL Y  F++VD+VIEAVIENV LKQ+IF+D+
Sbjct  130  RIKANLQSRVRKGKMTEERYEKALSLVTGALGYENFKEVDLVIEAVIENVKLKQQIFADL  189

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CPSHCILATNTSTIDLN+IG++T+SQDRI+GAHFFSPAHVMPLLEIVRT+ TSAQ
Sbjct  190  EKYCPSHCILATNTSTIDLNLIGEKTKSQDRIVGAHFFSPAHVMPLLEIVRTQHTSAQ  247



>gb|AER62395.1| hypothetical protein, partial [Hordeum bogdanii]
Length=338

 Score =   245 bits (625),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  I KVA++GGGLMGSGIATA++LSN  V+LKE+N ++L+ G+ 
Sbjct  99   RATSKVPGATDLGLMPRKIMKVAILGGGLMGSGIATAMILSNYPVLLKEVNEKFLNAGID  158

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             I+ N++  V + K+ +++ EK+LS+L GAL Y +F++VD+VIEAVIENV LKQ+IF+D+
Sbjct  159  RIKANLQSRVRKGKMTEERYEKALSLLSGALGYEKFKEVDLVIEAVIENVKLKQQIFADL  218

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CPSHCILATNTSTIDLN+IG++T+SQDRI+GAHFFSPAHVMPLLEIVRT+ TSAQ
Sbjct  219  EKYCPSHCILATNTSTIDLNLIGEKTKSQDRIVGAHFFSPAHVMPLLEIVRTQHTSAQ  276



>gb|AER62391.1| hypothetical protein, partial [Eremopyrum triticeum]
Length=339

 Score =   245 bits (625),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  I KVA++GGGLMGSGIATA++LSN  V+LKE+N ++L+ G+ 
Sbjct  99   RATSKVPGATDLGLMPRKITKVAILGGGLMGSGIATAMILSNYPVLLKEVNEKFLNAGID  158

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             I+ N++  V + K+ +++ EK+LS+L GAL Y +F++VD+VIEAVIENV LKQ+IF+D+
Sbjct  159  RIKANLQSRVRKGKMTEERYEKALSLLSGALGYEKFKEVDLVIEAVIENVKLKQQIFADL  218

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CPSHCILATNTSTIDLN+IG++T+SQDRI+GAHFFSPAHVMPLLEIVRT+ TSAQ
Sbjct  219  EKYCPSHCILATNTSTIDLNLIGEKTKSQDRIVGAHFFSPAHVMPLLEIVRTQHTSAQ  276



>gb|AER62383.1| hypothetical protein, partial [Taeniatherum caput-medusae]
 gb|AER62394.1| hypothetical protein, partial [Triticum monococcum subsp. aegilopoides]
Length=339

 Score =   245 bits (625),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  I KVA++GGGLMGSGIATA++LSN  V+LKE+N ++L+ G+ 
Sbjct  99   RATSKVPGATDLGLMPRKITKVAILGGGLMGSGIATAMILSNYPVLLKEVNEKFLNAGID  158

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             I+ N++  V + K+ +++ EK+LS+L GAL Y +F++VD+VIEAVIENV LKQ+IF+D+
Sbjct  159  RIKANLQSRVRKGKMTEERYEKALSLLSGALGYEKFKEVDLVIEAVIENVKLKQQIFADL  218

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CPSHCILATNTSTIDLN+IG++T+SQDRI+GAHFFSPAHVMPLLEIVRT+ TSAQ
Sbjct  219  EKYCPSHCILATNTSTIDLNLIGEKTKSQDRIVGAHFFSPAHVMPLLEIVRTQHTSAQ  276



>gb|AER62399.1| hypothetical protein, partial [Aegilops speltoides var. ligustica]
Length=325

 Score =   244 bits (623),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  I KVA++GGGLMGSGIATA++LSN  V+LKE+N ++L+ G+ 
Sbjct  96   RATSKVPGATDLGLMPRKITKVAILGGGLMGSGIATAMILSNYPVLLKEVNEKFLNAGID  155

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             I+ N++  V + K+ +++ EK+LS++ GAL Y +F++VD+VIEAVIENV LKQ+IF+D+
Sbjct  156  RIKANLQSRVRKGKMTEERYEKALSLVTGALGYEKFKEVDLVIEAVIENVKLKQQIFADL  215

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CPSHCILATNTSTIDLN+IG++T+SQDRI+GAHFFSPAHVMPLLEIVRT+ TSAQ
Sbjct  216  EKYCPSHCILATNTSTIDLNLIGEKTKSQDRIVGAHFFSPAHVMPLLEIVRTQHTSAQ  273



>gb|AER62398.1| hypothetical protein, partial [Aegilops speltoides var. speltoides]
Length=304

 Score =   243 bits (621),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  I KVA++GGGLMGSGIATA++LSN  V+LKE+N ++L+ G+ 
Sbjct  82   RATSKVPGATDLGLMPRKITKVAILGGGLMGSGIATAMILSNYPVLLKEVNEKFLNAGID  141

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             I+ N++  V + K+ +++ EK+LS++ GAL Y +F++VD+VIEAVIENV LKQ+IF+D+
Sbjct  142  RIKANLQSRVRKGKMTEERYEKALSLVTGALGYEKFKEVDLVIEAVIENVKLKQQIFADL  201

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CPSHCILATNTSTIDLN+IG++T+SQDRI+GAHFFSPAHVMPLLEIVRT+ TSAQ
Sbjct  202  EKYCPSHCILATNTSTIDLNLIGEKTKSQDRIVGAHFFSPAHVMPLLEIVRTQHTSAQ  259



>gb|AER62386.1| hypothetical protein, partial [Agropyron mongolicum]
Length=335

 Score =   244 bits (624),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  I KVA++GGGLMGSGIATA++LSN  V+LKE+N ++L+ G+ 
Sbjct  97   RATSKVPGATDLGLMPRKIMKVAILGGGLMGSGIATAMILSNYPVLLKEVNEKFLNAGID  156

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             I+ N++  V + K+ +++ EK+LS+L GAL Y +F++VD+VIEAVIENV LKQ+IF+D+
Sbjct  157  RIKANLQSRVRKGKMTEERYEKALSLLSGALGYEKFKEVDLVIEAVIENVKLKQQIFADL  216

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CPSHCILATNTSTIDLN+IG++T+SQDRI+GAHFFSPAHVMPLLEIVRT+ TSAQ
Sbjct  217  EKYCPSHCILATNTSTIDLNLIGEKTKSQDRIVGAHFFSPAHVMPLLEIVRTQHTSAQ  274



>gb|AER62390.1| hypothetical protein, partial [Eremopyrum bonaepartis]
Length=332

 Score =   244 bits (623),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  I KVA++GGGLMGSGIATA++LSN  V+LKE+N ++L+ G+ 
Sbjct  96   RATSKVPGATDLGLMPRKITKVAILGGGLMGSGIATAMILSNYPVLLKEVNEKFLNAGID  155

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             I+ N++  V + K+ +++ EK+LS+L GAL Y +F++VD+VIEAVIENV LKQ+IF+D+
Sbjct  156  RIKANLQSRVRKGKMTEERYEKALSLLSGALGYEKFKEVDLVIEAVIENVKLKQQIFADL  215

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CPSHCILATNTSTIDLN+IG++T SQDRIIGAHFFSPAHVMPLLEIVRT+ TSAQ
Sbjct  216  EKYCPSHCILATNTSTIDLNLIGEKTNSQDRIIGAHFFSPAHVMPLLEIVRTQHTSAQ  273



>gb|AER62382.1| hypothetical protein, partial [Taeniatherum caput-medusae]
Length=339

 Score =   244 bits (623),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  I KVA++GGGLMGSGIATA++LSN  V+LKE+N ++L+ G+ 
Sbjct  99   RATSKVPGATDLGLMPRKITKVAILGGGLMGSGIATAMILSNYPVLLKEVNEKFLNAGID  158

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             ++ N++  V + K+ +++ EK+LS+L GAL Y +F++VD+VIEAVIENV LKQ+IF+D+
Sbjct  159  RVKANLQSRVRKGKMTEERYEKALSLLSGALGYEKFKEVDLVIEAVIENVKLKQQIFADL  218

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CPSHCILATNTSTIDLN+IG++T+SQDRI+GAHFFSPAHVMPLLEIVRT+ TSAQ
Sbjct  219  EKYCPSHCILATNTSTIDLNLIGEKTKSQDRIVGAHFFSPAHVMPLLEIVRTQHTSAQ  276



>gb|AER62381.1| hypothetical protein, partial [Elymus spicatus]
Length=339

 Score =   244 bits (623),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  I+KVA++GGGLMGSGIATA++LSN  V+LKE+N ++L+ G+ 
Sbjct  99   RATSKVPGATDLGLMPRKIRKVAILGGGLMGSGIATAMILSNYPVLLKEVNEKFLNAGID  158

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             I+ N++  V + K+ +++ EK+LS+L G L Y +F++VD+VIEAVIENV LKQ+IF+D+
Sbjct  159  RIKANLQSRVRKGKMTEERYEKALSLLTGTLGYEKFKEVDLVIEAVIENVKLKQQIFADL  218

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CPSHCILATNTSTIDLN+IG++T+SQDRI+GAHFFSPAHVMPLLEIVRT+ TSAQ
Sbjct  219  EKYCPSHCILATNTSTIDLNLIGEKTKSQDRIVGAHFFSPAHVMPLLEIVRTQHTSAQ  276



>gb|EYU29809.1| hypothetical protein MIMGU_mgv1a002065mg [Erythranthe guttata]
Length=720

 Score =   254 bits (648),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 146/168 (87%), Gaps = 4/168 (2%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            D+G KP  +KKVAVIGGGLMGSGIATAL+L +I+V+LKEIN EYL KG+KT+E N+RGL 
Sbjct  300  DIGRKPRPVKKVAVIGGGLMGSGIATALILGDISVLLKEINSEYLLKGIKTVEANIRGL-  358

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
               +L  DKAEK+L  LKG +DYSEF+ VDM IEAV EN+ LKQKIF+D E+ACP HCIL
Sbjct  359  ---ELTDDKAEKALMRLKGVVDYSEFKYVDMAIEAVNENIALKQKIFADTERACPPHCIL  415

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            A+NTSTIDLNI+G++T+S+DRI+GAHFFSPAH+MPLLEIVRTEKTS+Q
Sbjct  416  ASNTSTIDLNIVGEKTKSKDRIVGAHFFSPAHIMPLLEIVRTEKTSSQ  463



>gb|AER62389.1| hypothetical protein, partial [Australopyrum retrofractum]
Length=333

 Score =   244 bits (622),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  I KVA++GGGLMGSGIATA++LSN  V+LKE+N ++L+ G+ 
Sbjct  97   RATSKVPGATDLGLMPRKITKVAILGGGLMGSGIATAMILSNYPVLLKEVNEKFLNAGID  156

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             I+ N++  V + K+ +++ EK+LS++ GAL Y +F++VD+VIEAVIENV LKQ+IF+D+
Sbjct  157  RIKANLQSRVRKGKMTEERYEKALSLVTGALGYEKFKEVDLVIEAVIENVKLKQQIFADL  216

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CPSHCILATNTSTIDLN+IG++T+SQDRI+GAHFFSPAHVMPLLEIVRT+ TSAQ
Sbjct  217  EKYCPSHCILATNTSTIDLNLIGEKTKSQDRIVGAHFFSPAHVMPLLEIVRTQHTSAQ  274



>ref|XP_010915852.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein-like [Elaeis guineensis]
Length=725

 Score =   254 bits (648),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            D+G++P +IKKVAVIGGGLMGSGIATAL+LS+I+V+LKEI+  +L KGLK +  N+ GLV
Sbjct  300  DIGIRPRNIKKVAVIGGGLMGSGIATALILSDISVILKEIDSSFLQKGLKVVSVNLEGLV  359

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
             +  L +DK  K+LS+LKG LDYSEF+ VDMVIEAVIEN+ LKQ IF++IEK CP  C+L
Sbjct  360  KKGSLTKDKMNKALSLLKGVLDYSEFKHVDMVIEAVIENISLKQSIFAEIEKICPLTCVL  419

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            ATNTSTIDLNI+G++T+SQDRIIGAHFFSPAHVMPLLEIVRTEKTS Q
Sbjct  420  ATNTSTIDLNIVGEKTQSQDRIIGAHFFSPAHVMPLLEIVRTEKTSPQ  467



>ref|XP_008390228.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Malus domestica]
Length=724

 Score =   254 bits (648),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 149/168 (89%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            DVGLKP  I KVA  GGGLMGSGIATALL SNI+VVLKE+N EYL KG+  IEGNV GLV
Sbjct  300  DVGLKPRQIXKVAXXGGGLMGSGIATALLXSNISVVLKEVNXEYLQKGIXKIEGNVEGLV  359

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            +R+ L QDKA+K+L +LKG+LDYS+F+DVDMVIEAVIE+VPLKQKIFS++E  CP HC+L
Sbjct  360  TRRGLTQDKAQKALXLLKGSLDYSDFKDVDMVIEAVIESVPLKQKIFSELENVCPPHCVL  419

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            ATNTSTIDLN++G++T S DRI+GAHFFSPAHVMPLLEIVRTEKTSAQ
Sbjct  420  ATNTSTIDLNVVGEKTNSHDRIVGAHFFSPAHVMPLLEIVRTEKTSAQ  467



>gb|AER62378.1| hypothetical protein, partial [Dasypyrum villosum]
Length=338

 Score =   244 bits (622),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  I KVA++GGGLMGSGIATA++LSN  V+LKE+N ++L+ G+ 
Sbjct  99   RATSKVPGATDLGLMPRKITKVAILGGGLMGSGIATAMILSNYPVILKEVNEKFLNAGID  158

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             I+ N++  V + K+ + + EK+LS++ GAL Y +F++VD+VIEAVIENV LKQ+IF+D+
Sbjct  159  RIKANLQSRVRKGKMTEQRYEKALSLVTGALGYEKFKEVDLVIEAVIENVKLKQQIFADL  218

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CPSHCILATNTSTIDLN+IG++T+SQDRI+GAHFFSPAHVMPLLEIVRT+ TSAQ
Sbjct  219  EKYCPSHCILATNTSTIDLNLIGEKTKSQDRIVGAHFFSPAHVMPLLEIVRTQHTSAQ  276



>gb|EYU45545.1| hypothetical protein MIMGU_mgv1a002038mg [Erythranthe guttata]
Length=724

 Score =   253 bits (647),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 148/171 (87%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D+GLKP  I KVA++GGGLMGSGIATAL+LSN TV+LKE+N ++L  G+  ++GN++
Sbjct  300  GVTDLGLKPRKINKVAILGGGLMGSGIATALILSNYTVILKEVNDKFLQAGIGRVKGNLQ  359

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V + +++ +K EK+L++LKG+LDY  FRDVDMVIEAVIENV LKQ+IFSD+EK CP H
Sbjct  360  SRVKKGQMSTEKFEKTLTLLKGSLDYESFRDVDMVIEAVIENVSLKQQIFSDLEKYCPPH  419

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            CILA+NTSTIDL++IG++T+SQDRIIGAHFFSPAHVMPLLEIVRT+KTS Q
Sbjct  420  CILASNTSTIDLDLIGERTKSQDRIIGAHFFSPAHVMPLLEIVRTQKTSPQ  470



>gb|AER62388.1| hypothetical protein, partial [Australopyrum retrofractum]
Length=339

 Score =   243 bits (621),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  I KVA++GGGLMGSGIATA++LSN  V+LKE+N ++L+ G+ 
Sbjct  99   RATSKVPGATDLGLMPRKITKVAILGGGLMGSGIATAMILSNYPVLLKEVNEKFLNAGID  158

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             I+ N++  V + K+ +++ EK+LS++ GAL Y +F++VD+VIEAVIENV LKQ+IF+D+
Sbjct  159  RIKANLQSRVRKGKMTEERYEKALSLVTGALGYEKFKEVDLVIEAVIENVKLKQQIFADL  218

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CPSHCILATNTSTIDLN+IG++T+SQDRI+GAHFFSPAHVMPLLEIVRT+ TSAQ
Sbjct  219  EKYCPSHCILATNTSTIDLNLIGEKTKSQDRIVGAHFFSPAHVMPLLEIVRTQHTSAQ  276



>gb|AER62396.1| hypothetical protein, partial [Hordeum marinum subsp. marinum]
Length=337

 Score =   243 bits (621),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  I KVA++GGGLMGSGIATA++LSN  V+LKE+N ++L+ G+ 
Sbjct  99   RATSKVPGATDLGLMPRKITKVAILGGGLMGSGIATAMILSNYPVLLKEVNEKFLNAGID  158

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             I+ N++  V + K+ +++ EK+LS++ GAL Y +F++VD+VIEAVIENV LKQ+IF+D+
Sbjct  159  RIKANLQSRVRKGKMTEERYEKALSLVTGALGYEKFKEVDLVIEAVIENVKLKQQIFADL  218

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CPSHCILATNTSTIDLN+IG++T+SQDRI+GAHFFSPAHVMPLLEIVRT+ TSAQ
Sbjct  219  EKYCPSHCILATNTSTIDLNLIGEKTKSQDRIVGAHFFSPAHVMPLLEIVRTQHTSAQ  276



>gb|AER62377.1| hypothetical protein, partial [Aegilops tauschii]
Length=339

 Score =   243 bits (621),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  I KVA++GGGLMGSGIATA++LSN  V+LKE+N ++L+ G+ 
Sbjct  99   RATSKVPGATDLGLMPRKITKVAILGGGLMGSGIATAMILSNYPVLLKEVNEKFLNAGID  158

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             I+ N++  V + K+ +++ EK+LS++ GAL Y +F++VD+VIEAVIENV LKQ+IF+D+
Sbjct  159  RIKANLQSRVRKGKMTEERYEKALSLVTGALGYEKFKEVDLVIEAVIENVKLKQQIFADL  218

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CPSHCILATNTSTIDLN+IG++T+SQDRI+GAHFFSPAHVMPLLEIVRT+ TSAQ
Sbjct  219  EKYCPSHCILATNTSTIDLNLIGEKTKSQDRIVGAHFFSPAHVMPLLEIVRTQHTSAQ  276



>gb|AER62385.1| hypothetical protein, partial [Dasypyrum villosum]
Length=337

 Score =   243 bits (621),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  I KVA++GGGLMGSGIATA++LSN  V+LKE+N ++L+ G+ 
Sbjct  99   RATSKVPGATDLGLMPRKITKVAILGGGLMGSGIATAMILSNYPVILKEVNEKFLNAGID  158

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             I+ N++  V + K+ + + EK+LS++ GAL Y +F++VD+VIEAVIENV LKQ+IF+D+
Sbjct  159  RIKANLQSRVRKGKMTEQRYEKALSLVTGALGYEKFKEVDLVIEAVIENVKLKQQIFADL  218

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CPSHCILATNTSTIDLN+IG++T+SQDRI+GAHFFSPAHVMPLLEIVRT+ TSAQ
Sbjct  219  EKYCPSHCILATNTSTIDLNLIGEKTKSQDRIVGAHFFSPAHVMPLLEIVRTQHTSAQ  276



>gb|AER62402.1| hypothetical protein, partial [Dasypyrum villosum]
Length=337

 Score =   243 bits (621),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 147/178 (83%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  I KVA++GGGLMGSGIATA++LSN  V+LKE+N ++L  G+ 
Sbjct  99   RATSKVPGATDLGLMPRKITKVAILGGGLMGSGIATAMILSNYPVILKEVNEKFLBAGID  158

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             I+ N++  V + K+ + + EK+LS++ GAL Y +F++VD+VIEAVIENV LKQ+IF+D+
Sbjct  159  RIKANLQSRVRKGKMTEQRYEKALSLVTGALGYEKFKEVDLVIEAVIENVKLKQQIFADL  218

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CPSHCILATNTSTIDLN+IG++T+SQDRI+GAHFFSPAHVMPLLEIVRT+ TSAQ
Sbjct  219  EKYCPSHCILATNTSTIDLNLIGEKTKSQDRIVGAHFFSPAHVMPLLEIVRTQHTSAQ  276



>ref|XP_009769326.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a [Nicotiana sylvestris]
Length=725

 Score =   253 bits (646),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 146/171 (85%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D+GL P  IKKVA++GGGLMGSGIATALLLS   V+LKE+N ++L  G+  ++ N++
Sbjct  301  GVTDLGLVPRRIKKVAILGGGLMGSGIATALLLSGYPVILKEVNDKFLQAGMGRVKANLQ  360

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V + K++ +K EK+LS+LKG+LDY  FRDVDMVIEAVIENV LKQ+IF+D+EK CPSH
Sbjct  361  SSVKKGKMSPEKFEKTLSLLKGSLDYESFRDVDMVIEAVIENVSLKQQIFADLEKYCPSH  420

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            CILA+NTSTIDLN+IG++TRSQDRIIGAHFFSPAHVMPLLEIVRT+KTS Q
Sbjct  421  CILASNTSTIDLNLIGEKTRSQDRIIGAHFFSPAHVMPLLEIVRTQKTSPQ  471



>emb|CDO98847.1| unnamed protein product [Coffea canephora]
Length=726

 Score =   253 bits (646),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 143/171 (84%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D GL P  IKKVA++GGGLMGSGIATAL+LSN  V+LKE+N ++L  G+  +  N+R
Sbjct  302  GITDRGLAPRRIKKVAILGGGLMGSGIATALILSNYPVILKEVNEKFLQAGIDRVRANLR  361

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V + K+ Q+K EK+LS+LKG LDY  FRDVDMVIEAVIENV LKQ+IF+D+EK CPSH
Sbjct  362  SRVKKGKMTQEKFEKNLSLLKGVLDYDSFRDVDMVIEAVIENVSLKQQIFADLEKYCPSH  421

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            CILA+NTSTIDL++IG++TRS DRIIGAHFFSPAHVMPLLEIVRT+KTS Q
Sbjct  422  CILASNTSTIDLDLIGEKTRSHDRIIGAHFFSPAHVMPLLEIVRTQKTSPQ  472



>gb|AER62384.1| hypothetical protein, partial [Dasypyrum villosum]
Length=337

 Score =   243 bits (620),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 147/178 (83%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  I KVA++GGGLMGSGIATA++LSN  V+LKE+N ++L  G+ 
Sbjct  99   RATSKVPGATDLGLMPRKITKVAILGGGLMGSGIATAMILSNYPVILKEVNEKFLDAGID  158

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             I+ N++  V + K+ + + EK+LS++ GAL Y +F++VD+VIEAVIENV LKQ+IF+D+
Sbjct  159  RIKANLQSRVRKGKMTEQRYEKALSLVTGALGYEKFKEVDLVIEAVIENVKLKQQIFADL  218

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CPSHCILATNTSTIDLN+IG++T+SQDRI+GAHFFSPAHVMPLLEIVRT+ TSAQ
Sbjct  219  EKYCPSHCILATNTSTIDLNLIGEKTKSQDRIVGAHFFSPAHVMPLLEIVRTQHTSAQ  276



>gb|AER62404.1| hypothetical protein, partial [Secale cereale]
Length=335

 Score =   243 bits (619),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  I KVA++GGGLMGSGIATA++LSN  V+LKE+N ++L+ G+ 
Sbjct  97   RATSKVPGATDLGLMPRKITKVAILGGGLMGSGIATAMILSNYPVLLKEVNEKFLNAGID  156

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             I+ N++  V + K+ +++ EK+LS+  GAL Y +F++VD+VIEAVIENV LKQ+IF+D+
Sbjct  157  RIKANLQSRVRKGKMTEERYEKALSLXXGALGYEKFKEVDLVIEAVIENVKLKQQIFADL  216

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CPSHCILATNTSTIDLN+IG++T+SQDRI+GAHFFSPAHVMPLLEIVRT+ TSAQ
Sbjct  217  EKYCPSHCILATNTSTIDLNLIGEKTKSQDRIVGAHFFSPAHVMPLLEIVRTQHTSAQ  274



>gb|AER62379.1| hypothetical protein, partial [Psathyrostachys juncea]
Length=339

 Score =   243 bits (619),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  I KVA++GGGLMGSGIATA++LSN  V+LKE+N ++L+ G+ 
Sbjct  99   RATSKVPGATDLGLMPRKITKVAILGGGLMGSGIATAMILSNYPVLLKEVNEKFLNAGID  158

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             I+ N++  V + K+ +++ EK+LS+L GAL Y +F++VD+VIEAVIE+V LKQ+IF+D+
Sbjct  159  RIKANLQSRVRKGKMTEERYEKALSLLSGALGYEKFKEVDLVIEAVIEDVKLKQQIFADL  218

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CPSHCILATNTSTIDLN+IG++T+SQDRI+GAHFFSPAHVMPLLEIVRT+ TSAQ
Sbjct  219  EKYCPSHCILATNTSTIDLNLIGEKTKSQDRIVGAHFFSPAHVMPLLEIVRTQHTSAQ  276



>ref|XP_008800762.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein-like [Phoenix dactylifera]
Length=725

 Score =   253 bits (645),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            DVGL+P  IK+VAVIG GLMGSGIAT L+L+NI+V+LKEI+ ++L KGLK IE N+ GL+
Sbjct  300  DVGLRPRQIKRVAVIGVGLMGSGIATTLILNNISVILKEIDSKFLHKGLKMIEANLEGLM  359

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
             +  L QDK  K+LS+LKG LDYS+F+ VDMVIEAVIENV LKQ IF+DIEK CP  CIL
Sbjct  360  KKGSLTQDKMNKALSLLKGVLDYSDFKHVDMVIEAVIENVSLKQSIFADIEKLCPPTCIL  419

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            ATNTS+IDLNI+G++T SQDRI+GAHFFSPAH+MPLLEIVRTEKTS Q
Sbjct  420  ATNTSSIDLNIVGERTHSQDRILGAHFFSPAHLMPLLEIVRTEKTSPQ  467



>gb|AER62387.1| hypothetical protein, partial [Psathyrostachys juncea]
Length=339

 Score =   243 bits (619),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  I KVA++GGGLMGSGIATA++LSN  V+LKE+N ++L+ G+ 
Sbjct  99   RATSKVPGATDLGLMPRKITKVAILGGGLMGSGIATAMILSNYPVLLKEVNEKFLNAGID  158

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             I+ N++  V + K+ +++ EK+LS+L GAL Y +F++VD+VIEAVIE+V LKQ+IF+D+
Sbjct  159  RIKANLQSRVRKGKMTEERYEKALSLLSGALGYEKFKEVDLVIEAVIEDVKLKQQIFADL  218

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CPSHCILATNTSTIDLN+IG++T+SQDRI+GAHFFSPAHVMPLLEIVRT+ TSAQ
Sbjct  219  EKYCPSHCILATNTSTIDLNLIGEKTKSQDRIVGAHFFSPAHVMPLLEIVRTQHTSAQ  276



>ref|XP_011010197.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like [Populus euphratica]
Length=726

 Score =   251 bits (642),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 145/171 (85%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D+GL P  +KKVAV+GGGLMGSGIATAL+LSN  V+LKE+N ++L  G+  +  N++
Sbjct  302  GITDLGLVPRRVKKVAVLGGGLMGSGIATALVLSNYPVILKEVNNQFLQAGIGRVRANLQ  361

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V + ++ Q+K EK++S+LKGALDY  F+DVDMVIEAVIENV LKQ+IFSD+EK CP H
Sbjct  362  SRVKKGRMTQEKFEKTMSLLKGALDYESFKDVDMVIEAVIENVSLKQQIFSDLEKYCPPH  421

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            CILA+NTSTIDLN+IG+QT+SQDRIIGAHFFSPAHVMPLLEIVRT++TS Q
Sbjct  422  CILASNTSTIDLNLIGKQTKSQDRIIGAHFFSPAHVMPLLEIVRTKQTSPQ  472



>ref|XP_002314377.1| MULTIFUNCTIONAL family protein [Populus trichocarpa]
 gb|EEF00548.1| MULTIFUNCTIONAL family protein [Populus trichocarpa]
Length=726

 Score =   251 bits (642),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 145/171 (85%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D+GL P  +KKVAV+GGGLMGSGIATAL+LSN  V+LKE+N ++L  G+  +  N++
Sbjct  302  GITDLGLVPRRVKKVAVLGGGLMGSGIATALVLSNYPVILKEVNNQFLQAGIGRVRANLQ  361

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V + ++ Q+K EK++S+LKGALDY  F+DVDMVIEAVIENV LKQ+IFSD+EK CP H
Sbjct  362  SRVKKGRMTQEKFEKTMSLLKGALDYESFKDVDMVIEAVIENVSLKQQIFSDLEKYCPPH  421

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            CILA+NTSTIDLN+IG+QT+SQDRIIGAHFFSPAHVMPLLEIVRT++TS Q
Sbjct  422  CILASNTSTIDLNLIGKQTKSQDRIIGAHFFSPAHVMPLLEIVRTKQTSPQ  472



>ref|XP_006833340.1| hypothetical protein AMTR_s00109p00083880 [Amborella trichopoda]
 gb|ERM98618.1| hypothetical protein AMTR_s00109p00083880 [Amborella trichopoda]
Length=721

 Score =   251 bits (641),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 144/178 (81%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL+P  IKKVAVIGGGLMGSGIATAL+LSN  V+LKE N  YL +G+ 
Sbjct  287  RTTSKITGVTDIGLRPRPIKKVAVIGGGLMGSGIATALILSNTCVILKEANSNYLQQGID  346

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             I  N++GLV++  ++ DK +K++S++KGALDYSEF  VDMVIEAVIENV LKQ +F+  
Sbjct  347  RISANLKGLVAKGTISNDKFDKTMSLVKGALDYSEFSTVDMVIEAVIENVSLKQSLFNTF  406

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CP HCILATNTSTIDLN++G +T S DRI+GAHFFSPAHVMPLLEIVR+EKTS Q
Sbjct  407  EKECPPHCILATNTSTIDLNLVGARTNSHDRIVGAHFFSPAHVMPLLEIVRSEKTSPQ  464



>ref|NP_001234975.1| peroxisomal fatty acid beta-oxidation multifunctional protein 
[Glycine max]
 dbj|BAG09370.1| peroxisomal fatty acid beta-oxidation multifunctional protein 
[Glycine max]
Length=723

 Score =   251 bits (641),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D GL P  +KKVA+IGGGLMGSGIATAL+LSN  V+LKE+N ++L  G+ 
Sbjct  292  RGTSKVPGVTDCGLAPRQVKKVAIIGGGLMGSGIATALILSNYPVILKEVNEKFLDAGIN  351

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             I+ N++  V + KL ++  EK++S+LKG+LDY  FRDVDMVIEAVIEN+ LKQ+IFSD+
Sbjct  352  RIKANLQSRVKKGKLTKENFEKTISLLKGSLDYESFRDVDMVIEAVIENISLKQQIFSDL  411

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CP HCILA+NTSTIDLN+IG++T++QDRI+GAHFFSPAHVMPLLEIVRT++TSAQ
Sbjct  412  EKYCPPHCILASNTSTIDLNLIGEKTKTQDRIVGAHFFSPAHVMPLLEIVRTKQTSAQ  469



>ref|XP_009124621.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like [Brassica rapa]
Length=725

 Score =   251 bits (640),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 145/171 (85%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D GL P  IKKVA+IGGGLMGSGIATAL+LSN +V+LKE+N ++L  G+  ++ N++
Sbjct  301  GVTDRGLVPRKIKKVAIIGGGLMGSGIATALILSNYSVILKEVNEKFLEAGIGRVKANLQ  360

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V + +++Q+K EK++S+LKG+LDY  FRDVDMVIEAVIEN+ LKQ+IF+D+EK CP H
Sbjct  361  SRVKKGRMSQEKFEKTMSLLKGSLDYESFRDVDMVIEAVIENISLKQQIFADLEKYCPQH  420

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            CILATNTSTIDLN IG++T+SQDRI+GAHFFSPAHVMPLLEIVRT  TSAQ
Sbjct  421  CILATNTSTIDLNKIGERTKSQDRIVGAHFFSPAHVMPLLEIVRTNHTSAQ  471



>gb|KHN02955.1| Glyoxysomal fatty acid beta-oxidation multifunctional protein 
MFP-a [Glycine soja]
Length=724

 Score =   251 bits (640),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D GL P  +KKVA+IGGGLMGSGIATAL+LSN  V+LKE+N ++L  G+ 
Sbjct  292  RGTSKVPGVTDCGLAPRQVKKVAIIGGGLMGSGIATALILSNYPVILKEVNEKFLDAGIN  351

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             I+ N++  V + KL ++  EK++S+LKG+LDY  FRDVD+VIEAVIEN+ LKQ+IFSD+
Sbjct  352  RIKANLQSRVKKGKLTKENFEKTISLLKGSLDYESFRDVDLVIEAVIENISLKQQIFSDL  411

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CP HCILA+NTSTIDLN+IG++T+SQDRI+GAHFFSPAHVMPLLEIVRT++TSAQ
Sbjct  412  EKYCPPHCILASNTSTIDLNLIGEKTKSQDRIVGAHFFSPAHVMPLLEIVRTKQTSAQ  469



>ref|XP_009622777.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a [Nicotiana tomentosiformis]
Length=725

 Score =   250 bits (639),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 146/171 (85%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D+GL P  IKKVA++GGGLMGSGIATALLLS   V+LKE+N ++L  G+  ++ N++
Sbjct  301  GVTDLGLVPRRIKKVAILGGGLMGSGIATALLLSGYPVILKEVNDKFLQAGMGRVKANLQ  360

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V + K++Q+K EK+LS+LKG+L+Y  FRDVDMVIEAVIENV LKQ+IF+D+EK CP H
Sbjct  361  SSVKKGKMSQEKCEKTLSLLKGSLEYEGFRDVDMVIEAVIENVSLKQQIFADLEKYCPPH  420

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            CILA+NTSTIDLN+IG++T+SQDRIIGAHFFSPAHVMPLLEIVRT+KTS Q
Sbjct  421  CILASNTSTIDLNLIGEKTKSQDRIIGAHFFSPAHVMPLLEIVRTQKTSPQ  471



>gb|AER62397.1| hypothetical protein, partial [Aegilops longissima]
Length=335

 Score =   240 bits (612),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  I KVA++GGGLMGSGIATA++LSN  V+LKE+N ++L+ G+ 
Sbjct  97   RATSKVPGATDLGLMPRKITKVAILGGGLMGSGIATAMILSNYPVLLKEVNEKFLNAGID  156

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             I+ N++  V + K+ +++ EK+LS++ GAL Y +F++VD+VIEAVIENV LKQ+IF+D+
Sbjct  157  RIKANLQSRVRKGKMTEERYEKALSLVTGALGYEKFKEVDLVIEAVIENVKLKQQIFADL  216

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CPSHCILATNTSTIDLN+IG++T+SQDRI+GAHFFSPAHVMPLLEIV T+ TSAQ
Sbjct  217  EKYCPSHCILATNTSTIDLNLIGEKTKSQDRIVGAHFFSPAHVMPLLEIVCTQHTSAQ  274



>gb|AER62380.1| hypothetical protein, partial [Elymus libanoticus]
Length=333

 Score =   240 bits (612),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  I KVA++GGGLMGSGIATA++LSN  V+LKE+N ++L+ G+ 
Sbjct  97   RATSKVPGATDLGLMPRKITKVAILGGGLMGSGIATAMILSNYPVLLKEVNEKFLNAGID  156

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             I+ N++  V + K+ +++ EK+LS++ GAL Y +F++VD+VIEAVIENV LKQ+IF+D+
Sbjct  157  RIKANLQSRVRKGKMTEERYEKALSLVTGALGYEKFKEVDLVIEAVIENVKLKQQIFADL  216

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CPSHCILATNTSTIDLN+IG++T+SQDRI+GAHFFSPAHVMPLLEIV T+ TSAQ
Sbjct  217  EKYCPSHCILATNTSTIDLNLIGEKTKSQDRIVGAHFFSPAHVMPLLEIVCTQHTSAQ  274



>ref|XP_009147124.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like [Brassica rapa]
Length=725

 Score =   250 bits (638),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 144/171 (84%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D GL P  IKKVA+IGGGLMGSGIATAL+LSN  V+LKE+N ++L  G+  ++ N++
Sbjct  301  GVTDRGLVPRKIKKVAIIGGGLMGSGIATALILSNYPVILKEVNEKFLEAGVGRVKANLQ  360

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V + +++Q+K EK++S+LKG+LDY  FRDVDMVIEAVIEN+ LKQKIF+D+EK CP H
Sbjct  361  SSVKKGRMSQEKFEKTMSLLKGSLDYESFRDVDMVIEAVIENISLKQKIFADLEKYCPQH  420

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            CILA+NTSTIDLN IG++T+SQDRIIGAHFFSPAHVMPLLEIVRT  TSAQ
Sbjct  421  CILASNTSTIDLNKIGERTKSQDRIIGAHFFSPAHVMPLLEIVRTNHTSAQ  471



>emb|CDY24662.1| BnaA05g30610D [Brassica napus]
Length=726

 Score =   250 bits (638),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 145/171 (85%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D GL P  IKKVA+IGGGLMGSGIATAL+LSN  V+LKE+N ++L  G+  ++ N++
Sbjct  301  GVTDRGLVPRKIKKVAIIGGGLMGSGIATALILSNYPVILKEVNEKFLEAGVGRVKANLQ  360

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V + +++Q+K EK++S+LKG+LDY  FRDVDMVIEAVIEN+ LKQ+IF+D+EK CP H
Sbjct  361  SSVKKGRMSQEKFEKTMSLLKGSLDYESFRDVDMVIEAVIENISLKQQIFADLEKYCPQH  420

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            CILA+NTSTIDLN IG++T+SQDRIIGAHFFSPAHVMPLLEIVRT +TSAQ
Sbjct  421  CILASNTSTIDLNKIGERTKSQDRIIGAHFFSPAHVMPLLEIVRTNRTSAQ  471



>emb|CDY34924.1| BnaA01g32550D [Brassica napus]
Length=727

 Score =   250 bits (638),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 145/171 (85%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D GL P  IKKVA+IGGGLMGSGIATAL+LSN +V+LKE+N ++L  G+  ++ N++
Sbjct  302  GVTDRGLVPRKIKKVAIIGGGLMGSGIATALILSNYSVILKEVNEKFLEAGIGRVKANLQ  361

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V + +++Q+K EK++S+LKG+LDY  FRDVDMVIEAVIEN+ LKQ+IF+D+EK CP H
Sbjct  362  SRVKKGRMSQEKFEKTMSLLKGSLDYESFRDVDMVIEAVIENISLKQQIFADLEKYCPQH  421

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            CILATNTSTIDLN IG++T+SQDRI+GAHFFSPAHVMPLLEIVRT +TS Q
Sbjct  422  CILATNTSTIDLNKIGERTKSQDRIVGAHFFSPAHVMPLLEIVRTNRTSPQ  472



>ref|XP_006380154.1| MULTIFUNCTIONAL family protein [Populus trichocarpa]
 gb|ERP57951.1| MULTIFUNCTIONAL family protein [Populus trichocarpa]
Length=726

 Score =   249 bits (637),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 144/171 (84%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D+G  P  +KKVAV+GGGLMGSGIATAL+LSN  V+LKE+N ++L  G+  +  N++
Sbjct  302  GITDLGFVPRLVKKVAVLGGGLMGSGIATALILSNYPVILKEVNDQFLQAGIGRVRANLQ  361

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V + K+ Q+K EK++S+LKG+LDY  F+DVDMVIEAVIENV LKQ+IFSD+EK CP H
Sbjct  362  SRVKKGKMTQEKFEKTMSLLKGSLDYESFKDVDMVIEAVIENVSLKQQIFSDLEKYCPPH  421

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            CILA+NTSTIDLN+IG+QT+SQDRIIGAHFFSPAHVMPLLEIVRT++TS Q
Sbjct  422  CILASNTSTIDLNLIGKQTKSQDRIIGAHFFSPAHVMPLLEIVRTKQTSPQ  472



>gb|AFW80681.1| hypothetical protein ZEAMMB73_867373 [Zea mays]
Length=460

 Score =   243 bits (621),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 146/178 (82%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  I KVA++GGGLMGSGIATA++LSN  V+LKE+N ++L+ G+ 
Sbjct  29   RATSKIPGATDLGLMPRKITKVAILGGGLMGSGIATAMVLSNYPVLLKEVNEKFLTAGIN  88

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             I+ N++  V + K+ +++ EK++S++ G LDY  F+DVD+VIEAVIENV LKQ+IFSD+
Sbjct  89   RIQANLQSRVKKGKMTEERYEKAMSLVTGVLDYERFKDVDLVIEAVIENVKLKQQIFSDL  148

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CPSHCILATNTSTIDLN+IG++T++QDRI GAHFFSPAHVMPLLEIVRT+ TS Q
Sbjct  149  EKYCPSHCILATNTSTIDLNLIGEKTKAQDRIAGAHFFSPAHVMPLLEIVRTQHTSPQ  206



>ref|XP_006380155.1| hypothetical protein POPTR_0008s22410g [Populus trichocarpa]
 gb|ERP57952.1| hypothetical protein POPTR_0008s22410g [Populus trichocarpa]
Length=721

 Score =   249 bits (637),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 144/171 (84%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D+G  P  +KKVAV+GGGLMGSGIATAL+LSN  V+LKE+N ++L  G+  +  N++
Sbjct  302  GITDLGFVPRLVKKVAVLGGGLMGSGIATALILSNYPVILKEVNDQFLQAGIGRVRANLQ  361

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V + K+ Q+K EK++S+LKG+LDY  F+DVDMVIEAVIENV LKQ+IFSD+EK CP H
Sbjct  362  SRVKKGKMTQEKFEKTMSLLKGSLDYESFKDVDMVIEAVIENVSLKQQIFSDLEKYCPPH  421

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            CILA+NTSTIDLN+IG+QT+SQDRIIGAHFFSPAHVMPLLEIVRT++TS Q
Sbjct  422  CILASNTSTIDLNLIGKQTKSQDRIIGAHFFSPAHVMPLLEIVRTKQTSPQ  472



>gb|AFW65775.1| hypothetical protein ZEAMMB73_546088 [Zea mays]
Length=407

 Score =   241 bits (616),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  103  MGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLVSRKKLAQDKAEKSLSILKG  282
            MGSGIAT+LL+SNI+VVLKE+NP++L +G KTI GN+ GLV R  L +D+  K++++LKG
Sbjct  1    MGSGIATSLLVSNISVVLKEVNPQFLQRGEKTIAGNLEGLVKRGSLTKDRMHKAMALLKG  60

Query  283  ALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCILATNTSTIDLNIIGQQTRSQ  462
            ALDYS+F+DVDMVIEAVIE +PLKQ IF+DIEK CP HCILATNTSTIDLN++G++T SQ
Sbjct  61   ALDYSDFKDVDMVIEAVIEKIPLKQSIFADIEKICPKHCILATNTSTIDLNVVGKKTNSQ  120

Query  463  DRIIGAHFFSPAHVMPLLEIVRTEKTSAQT  552
            DRIIGAHFFSPAH+MPLLEIVRTEKTS Q 
Sbjct  121  DRIIGAHFFSPAHIMPLLEIVRTEKTSPQA  150



>ref|XP_007013129.1| Enoyl-CoA hydratase/isomerase family [Theobroma cacao]
 gb|EOY30748.1| Enoyl-CoA hydratase/isomerase family [Theobroma cacao]
Length=745

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            DVGLKP  +KKVA+IGGG+MGSGIATAL+LSNI+V LKEIN EYL KG+KTIE N++GLV
Sbjct  321  DVGLKPRHVKKVAIIGGGIMGSGIATALILSNISVFLKEINSEYLLKGMKTIEANIQGLV  380

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            +R K+ QDK +K+LS+LKG  DYSEF+DVDMVIEAVIE+VPLKQKIF+++EK C S CIL
Sbjct  381  TRGKVTQDKGQKALSMLKGVSDYSEFKDVDMVIEAVIEDVPLKQKIFTELEKVCSSCCIL  440

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            ATNTSTIDLN+IG++T SQDRIIGAHFFSPAHVMPLLEIVRTEKTS Q
Sbjct  441  ATNTSTIDLNVIGEKTNSQDRIIGAHFFSPAHVMPLLEIVRTEKTSPQ  488



>ref|XP_003529561.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2-like [Glycine max]
Length=724

 Score =   248 bits (634),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 147/178 (83%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D GL P  +KKVA+IGGGLMGSGIATAL+LSN  V+LKE+N ++L  G+ 
Sbjct  292  RGTSKVPGVTDCGLAPRQVKKVAIIGGGLMGSGIATALILSNYPVILKEVNEKFLDAGIN  351

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             I+ N++  V + KL ++  EK++S+LKG+LDY  FRDVD+VIEAVIEN+ LKQ+IFSD+
Sbjct  352  RIKANLQSRVKKGKLTKENFEKTISLLKGSLDYESFRDVDLVIEAVIENISLKQQIFSDL  411

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CP HCILA+NTSTIDLN+IG++T+SQDRI+GAHFFSPAHVMPLLEIVRT++TS Q
Sbjct  412  EKYCPPHCILASNTSTIDLNLIGEKTKSQDRIVGAHFFSPAHVMPLLEIVRTKQTSPQ  469



>ref|XP_006833339.1| hypothetical protein AMTR_s00109p00082150 [Amborella trichopoda]
 gb|ERM98617.1| hypothetical protein AMTR_s00109p00082150 [Amborella trichopoda]
Length=721

 Score =   248 bits (634),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 144/178 (81%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL+P  IKKVAVIGGGLMGSGIATAL+LSN  V+LKE+N  YL +G+ 
Sbjct  287  RATSKIPGVTDIGLRPRPIKKVAVIGGGLMGSGIATALILSNTRVILKEVNSNYLQQGID  346

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             I  N++GLV +  +++DK +KS+S++KG LDYSEF  VDMVIEAV+ENV LKQ +F+  
Sbjct  347  RISANLKGLVEKGTMSKDKFDKSMSLVKGVLDYSEFSTVDMVIEAVVENVSLKQSLFNTF  406

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CP HCILATNTSTIDLN++G +T S  RI+GAHFFSPAHVMPLLEIVR+EKTS+Q
Sbjct  407  EKECPPHCILATNTSTIDLNLVGARTNSHSRIVGAHFFSPAHVMPLLEIVRSEKTSSQ  464



>ref|XP_004487834.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2-like [Cicer arietinum]
Length=721

 Score =   248 bits (634),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 147/178 (83%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D GL P  +KKVA++GGGLMGSGIATAL+LSN  V+LKE+N ++L  G+ 
Sbjct  290  RGTSKVPGVTDRGLTPRQVKKVAILGGGLMGSGIATALILSNYPVILKEVNEKFLDAGVN  349

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             ++ N++  V + K+ Q+K EK++S+LKG LDY  F+DVDMVIEAVIENV LKQ+IF+D+
Sbjct  350  RVKANLQSRVKKGKMTQEKFEKTMSLLKGTLDYESFKDVDMVIEAVIENVSLKQQIFADL  409

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CP HCILA+NTSTIDLN+IGQ+T+S+DRIIGAHFFSPAHVMPLLEIVRT++TS Q
Sbjct  410  EKYCPPHCILASNTSTIDLNLIGQKTKSEDRIIGAHFFSPAHVMPLLEIVRTKQTSPQ  467



>ref|XP_006600114.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein isoform X1 [Glycine max]
Length=759

 Score =   249 bits (635),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D GL P  +KKVA+IGGGLMGSGIATAL+LSN  V+LKE+N ++L  G+ 
Sbjct  292  RGTSKVPGVTDRGLVPRQVKKVAIIGGGLMGSGIATALILSNYPVILKEVNEKFLDAGIN  351

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             I+ N++  V + KL ++  EK++S+LKG+LDY  FRDVDMVIEAVIEN+ LKQ+IFSD+
Sbjct  352  RIKANLQSRVKKGKLTKENFEKTISLLKGSLDYGSFRDVDMVIEAVIENISLKQQIFSDL  411

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CP HCILA+NTSTIDLN+IG++T++QDRI+GAHFFSPAHVMPLLEIVRT++TSAQ
Sbjct  412  EKYCPPHCILASNTSTIDLNLIGEKTKTQDRIVGAHFFSPAHVMPLLEIVRTKQTSAQ  469



>ref|XP_010693603.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2 [Beta vulgaris subsp. vulgaris]
Length=722

 Score =   248 bits (633),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 147/178 (83%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  I+KVAVIGGGLMGSGIATAL+LS+  VVLKE+N ++L  G+ 
Sbjct  290  RGTSKVPGVTDLGLSPRKIRKVAVIGGGLMGSGIATALILSSYPVVLKEVNQKFLEAGIG  349

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             ++ N++  V + K+ ++K EK++S+L+GALDY  FRDVD+VIEAVIENV LKQ+IF D+
Sbjct  350  RVKANLQSRVKKGKMTEEKFEKTISLLEGALDYDSFRDVDIVIEAVIENVSLKQQIFGDL  409

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CP HCILA+NTSTIDLN+IG++T SQDRI+GAHFFSPAH+MPLLEIVRTEKTS Q
Sbjct  410  EKYCPPHCILASNTSTIDLNLIGEKTHSQDRIVGAHFFSPAHIMPLLEIVRTEKTSPQ  467



>gb|KJB72709.1| hypothetical protein B456_011G191800 [Gossypium raimondii]
Length=638

 Score =   246 bits (628),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 147/179 (82%), Gaps = 0/179 (0%)
 Frame = +1

Query  13   LRPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGL  192
            +R  S + G  D GL P  ++KVAV+GGGLMGSGIATAL+LSN TV+LKE+N ++L  G+
Sbjct  293  MRGTSKVPGITDRGLMPRQVRKVAVLGGGLMGSGIATALILSNYTVILKEVNEKFLEAGI  352

Query  193  KTIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSD  372
              ++ N++  V + K++Q+K EK++S+L G LDY  FRDVDMVIEAVIENV LKQ+IF+D
Sbjct  353  DRVKANLQSRVKKGKMSQEKFEKTISLLSGVLDYERFRDVDMVIEAVIENVSLKQQIFAD  412

Query  373  IEKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            +EK C  HCILA+NTSTIDLN+IG++T+SQDRI+GAHFFSPAHVMPLLEIVRT +TS Q
Sbjct  413  LEKFCSPHCILASNTSTIDLNLIGERTKSQDRIVGAHFFSPAHVMPLLEIVRTRQTSPQ  471



>emb|CDY05296.1| BnaC05g45070D [Brassica napus]
Length=725

 Score =   248 bits (632),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 142/171 (83%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D GL P  IKKVA+IGGGLMGSGIATAL+LSN  V+LKE+N ++L  GL  ++ N++
Sbjct  301  GVTDRGLVPRKIKKVAIIGGGLMGSGIATALILSNYPVILKEVNEKFLEAGLGRVKANLQ  360

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V + ++ Q++ EK++S+LKG+LDY  FRDVDMVIEAVIEN+ LKQKIF+D+EK CP H
Sbjct  361  SSVKKGRMTQERFEKTMSLLKGSLDYESFRDVDMVIEAVIENISLKQKIFADLEKYCPQH  420

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            CILA+NTSTIDLN IG++T+SQDRIIGAHFFSPAHVMPLLEIVRT  T AQ
Sbjct  421  CILASNTSTIDLNKIGERTKSQDRIIGAHFFSPAHVMPLLEIVRTNHTCAQ  471



>ref|XP_002882497.1| hypothetical protein ARALYDRAFT_478006 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58756.1| hypothetical protein ARALYDRAFT_478006 [Arabidopsis lyrata subsp. 
lyrata]
Length=723

 Score =   248 bits (632),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 143/171 (84%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D GL P  IKKVA+IGGGLMGSGIATAL+LSN  V+LKE+N ++L  G+  ++ N++
Sbjct  299  GVTDRGLAPRKIKKVAIIGGGLMGSGIATALILSNYPVILKEVNEKFLEAGIGRVKANLQ  358

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V +  ++Q+K EK++S+LKG+LDY  FRDVDMVIEAVIEN+ LKQ+IF+D+EK CP H
Sbjct  359  SRVRKGSMSQEKFEKTMSLLKGSLDYESFRDVDMVIEAVIENISLKQQIFADLEKYCPQH  418

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            CILA+NTSTIDLN IG++T+SQDRI+GAHFFSPAH+MPLLEIVRT  TSAQ
Sbjct  419  CILASNTSTIDLNKIGERTKSQDRIVGAHFFSPAHIMPLLEIVRTNHTSAQ  469



>gb|KJB72710.1| hypothetical protein B456_011G191800 [Gossypium raimondii]
Length=662

 Score =   246 bits (629),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 147/180 (82%), Gaps = 0/180 (0%)
 Frame = +1

Query  10   GLRPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKG  189
             +R  S + G  D GL P  ++KVAV+GGGLMGSGIATAL+LSN TV+LKE+N ++L  G
Sbjct  229  AMRGTSKVPGITDRGLMPRQVRKVAVLGGGLMGSGIATALILSNYTVILKEVNEKFLEAG  288

Query  190  LKTIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFS  369
            +  ++ N++  V + K++Q+K EK++S+L G LDY  FRDVDMVIEAVIENV LKQ+IF+
Sbjct  289  IDRVKANLQSRVKKGKMSQEKFEKTISLLSGVLDYERFRDVDMVIEAVIENVSLKQQIFA  348

Query  370  DIEKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            D+EK C  HCILA+NTSTIDLN+IG++T+SQDRI+GAHFFSPAHVMPLLEIVRT +TS Q
Sbjct  349  DLEKFCSPHCILASNTSTIDLNLIGERTKSQDRIVGAHFFSPAHVMPLLEIVRTRQTSPQ  408



>gb|KCW61184.1| hypothetical protein EUGRSUZ_H039482 [Eucalyptus grandis]
Length=581

 Score =   244 bits (624),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 146/179 (82%), Gaps = 0/179 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D GL P  ++ VAV+GGGLMGSGIATAL+LSN +V+LKE+N ++L  G+ 
Sbjct  150  RGTSKVPGITDRGLMPRQVRNVAVVGGGLMGSGIATALVLSNYSVILKEVNDKFLQAGIG  209

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             ++ N++  V +  + Q+K EK++S+LKG LDY  F+DVDMVIEAVIENV LKQ+IF+D+
Sbjct  210  RVKANLQSRVKKGNMTQEKFEKTMSLLKGVLDYESFKDVDMVIEAVIENVSLKQQIFADL  269

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQT  552
            E++CP HCILATNTSTIDLN++G++TRS+DRIIGAHFFSPAH+MPLLEIVRT+ TS Q 
Sbjct  270  ERSCPPHCILATNTSTIDLNLVGEKTRSRDRIIGAHFFSPAHIMPLLEIVRTQHTSPQA  328



>gb|KDO71725.1| hypothetical protein CISIN_1g008576mg [Citrus sinensis]
Length=496

 Score =   242 bits (618),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 144/178 (81%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  +KKVA++GGGLMGSGIATAL+LSN  V+LKE+N ++L  G+ 
Sbjct  129  RGTSKVPGVTDLGLAPRRVKKVAILGGGLMGSGIATALILSNYPVILKEVNEKFLEAGIG  188

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             +  N++  V + K+ Q+K EK++S+L G LDY  F+DVDMVIEA+IENV LKQ+IF+D+
Sbjct  189  RVRANLQSRVKKGKMTQEKFEKTISLLTGVLDYESFKDVDMVIEAIIENVSLKQQIFADL  248

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CP HCILA+NTSTIDLN+IG++T S+DRI+GAHFFSPAHVMPLLEIVRT +TS Q
Sbjct  249  EKYCPPHCILASNTSTIDLNLIGERTYSKDRIVGAHFFSPAHVMPLLEIVRTNQTSPQ  306



>emb|CDX74076.1| BnaA03g29710D [Brassica napus]
Length=726

 Score =   247 bits (631),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 144/171 (84%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D GL P  I KVA+IGGGLMGSGIATAL+LSN +V+LKE+N ++L  G+  ++ N++
Sbjct  301  GVTDRGLVPRKINKVAIIGGGLMGSGIATALILSNYSVILKEVNEKFLEAGIGRVKANLQ  360

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V + K++++K EK++S+LKG+LDY  FRDVDMVIEAVIEN+ LKQ+IF+D+EK CP H
Sbjct  361  SRVKKGKMSKEKFEKTMSLLKGSLDYESFRDVDMVIEAVIENISLKQQIFADLEKYCPQH  420

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            CILA+NTSTIDLN IG++T+SQDRIIGAHFFSPAHVMPLLEIVRT  TSAQ
Sbjct  421  CILASNTSTIDLNKIGERTKSQDRIIGAHFFSPAHVMPLLEIVRTNHTSAQ  471



>gb|KDP27817.1| hypothetical protein JCGZ_18897 [Jatropha curcas]
Length=725

 Score =   247 bits (631),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 141/171 (82%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D GL P  + KVAV+GGGLMGSGIATAL+LSN  V+LKE+N ++L  G+  +  N++
Sbjct  301  GVTDKGLMPRRVNKVAVLGGGLMGSGIATALILSNYPVILKEVNEKFLQAGIDRVRANLQ  360

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V + K++Q+K EK+LS+LKG LDY  F+DVDMVIEAVIEN+ LKQ+IFSD+EK CP +
Sbjct  361  SRVKKGKMSQEKFEKTLSLLKGVLDYESFKDVDMVIEAVIENISLKQQIFSDLEKYCPPN  420

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            CILA+NTSTIDLN+IGQ TRSQDRIIGAHFFSPAHVMPLLEIVRT +TS Q
Sbjct  421  CILASNTSTIDLNLIGQNTRSQDRIIGAHFFSPAHVMPLLEIVRTNQTSPQ  471



>sp|O49809.2|MFPA_BRANA RecName: Full=Glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a; Includes: RecName: Full=Enoyl-CoA hydratase/3-2-trans-enoyl-CoA 
isomerase/3-hydroxybutyryl-CoA epimerase; 
Includes: RecName: Full=3-hydroxyacyl-CoA dehydrogenase 
[Brassica napus]
 emb|CAA04386.1| Tetrafunctional protein of glyoxysomal fatty acid beta-oxidation 
[Brassica napus]
Length=725

 Score =   247 bits (631),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 144/171 (84%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D GL P  I KVA+IGGGLMGSGIATAL+LSN +V+LKE+N ++L  G+  ++ N++
Sbjct  301  GVTDRGLVPRKINKVAIIGGGLMGSGIATALILSNYSVILKEVNEKFLEAGIGRVKANLQ  360

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V + K++++K EK++S+LKG+LDY  FRDVDMVIEAVIEN+ LKQ+IF+D+EK CP H
Sbjct  361  SRVKKGKMSKEKFEKTMSLLKGSLDYESFRDVDMVIEAVIENISLKQQIFADLEKYCPQH  420

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            CILA+NTSTIDLN IG++T+SQDRIIGAHFFSPAHVMPLLEIVRT  TSAQ
Sbjct  421  CILASNTSTIDLNKIGERTKSQDRIIGAHFFSPAHVMPLLEIVRTNHTSAQ  471



>emb|CDY08028.1| BnaC03g34950D [Brassica napus]
Length=726

 Score =   247 bits (631),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 144/171 (84%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D GL P  I KVA+IGGGLMGSGIATAL+LSN +V+LKE+N ++L  G+  ++ N++
Sbjct  301  GVTDRGLVPRKINKVAIIGGGLMGSGIATALILSNYSVILKEVNEKFLEAGIGRVKANLQ  360

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V + K++++K EK++S+LKG+LDY  FRDVDMVIEAVIEN+ LKQ+IF+D+EK CP H
Sbjct  361  SRVKKGKMSKEKFEKTMSLLKGSLDYESFRDVDMVIEAVIENISLKQQIFADLEKYCPQH  420

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            CILA+NTSTIDLN IG++T+SQDRIIGAHFFSPAHVMPLLEIVRT  TSAQ
Sbjct  421  CILASNTSTIDLNKIGERTKSQDRIIGAHFFSPAHVMPLLEIVRTNHTSAQ  471



>gb|KDO71722.1| hypothetical protein CISIN_1g008576mg [Citrus sinensis]
Length=521

 Score =   243 bits (619),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 144/178 (81%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  +KKVA++GGGLMGSGIATAL+LSN  V+LKE+N ++L  G+ 
Sbjct  129  RGTSKVPGVTDLGLAPRRVKKVAILGGGLMGSGIATALILSNYPVILKEVNEKFLEAGIG  188

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             +  N++  V + K+ Q+K EK++S+L G LDY  F+DVDMVIEA+IENV LKQ+IF+D+
Sbjct  189  RVRANLQSRVKKGKMTQEKFEKTISLLTGVLDYESFKDVDMVIEAIIENVSLKQQIFADL  248

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CP HCILA+NTSTIDLN+IG++T S+DRI+GAHFFSPAHVMPLLEIVRT +TS Q
Sbjct  249  EKYCPPHCILASNTSTIDLNLIGERTYSKDRIVGAHFFSPAHVMPLLEIVRTNQTSPQ  306



>gb|KDO71721.1| hypothetical protein CISIN_1g008576mg [Citrus sinensis]
Length=518

 Score =   243 bits (619),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 144/178 (81%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  +KKVA++GGGLMGSGIATAL+LSN  V+LKE+N ++L  G+ 
Sbjct  129  RGTSKVPGVTDLGLAPRRVKKVAILGGGLMGSGIATALILSNYPVILKEVNEKFLEAGIG  188

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             +  N++  V + K+ Q+K EK++S+L G LDY  F+DVDMVIEA+IENV LKQ+IF+D+
Sbjct  189  RVRANLQSRVKKGKMTQEKFEKTISLLTGVLDYESFKDVDMVIEAIIENVSLKQQIFADL  248

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CP HCILA+NTSTIDLN+IG++T S+DRI+GAHFFSPAHVMPLLEIVRT +TS Q
Sbjct  249  EKYCPPHCILASNTSTIDLNLIGERTYSKDRIVGAHFFSPAHVMPLLEIVRTNQTSPQ  306



>ref|XP_007035631.1| Multifunctional protein 2 [Theobroma cacao]
 gb|EOY06557.1| Multifunctional protein 2 [Theobroma cacao]
Length=725

 Score =   247 bits (630),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 147/178 (83%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D GL P  +KKVAV+GGGLMGSGIATAL+LSN TV+LKE+N ++L  G+ 
Sbjct  294  RGTSKVPGITDRGLVPRRVKKVAVLGGGLMGSGIATALILSNYTVILKEVNEKFLEAGIG  353

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             ++ N++  V + K+ Q+K EK++S+L+G LDY  FRDVDMVIEAVIENV LKQ+IF+D+
Sbjct  354  RVKANLQSRVKKGKMTQEKFEKTISLLRGVLDYESFRDVDMVIEAVIENVSLKQQIFADL  413

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CP HCILA+NTSTIDLN+I ++T+SQDRI+GAHFFSPAH+MPLLEIVRT++TS Q
Sbjct  414  EKYCPPHCILASNTSTIDLNLIAERTKSQDRIVGAHFFSPAHIMPLLEIVRTKQTSPQ  471



>ref|XP_009623955.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like [Nicotiana tomentosiformis]
Length=715

 Score =   247 bits (630),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 144/171 (84%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D+GL P  +KKVA++GGGLMGSGIATALLLSN  V+LKE+N ++L  G+  ++ N++
Sbjct  298  GVTDMGLVPRQVKKVAIVGGGLMGSGIATALLLSNYPVILKEVNDKFLEAGIDRVKANLQ  357

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V++ KL++DK EK+LS+ KG LDY  FRDVDMVIEAV E+VPLKQ+IF D+EK C  H
Sbjct  358  RRVNKGKLSEDKFEKALSLFKGTLDYESFRDVDMVIEAVTEDVPLKQQIFIDLEKFCSQH  417

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            CILA+NTSTIDLN+IG++T+SQDRIIGAHFFSPAHVMPL+EIVRT++TS Q
Sbjct  418  CILASNTSTIDLNLIGEKTKSQDRIIGAHFFSPAHVMPLMEIVRTQQTSPQ  468



>ref|NP_187342.1| fatty acid beta-oxidation multifunctional protein MFP2 [Arabidopsis 
thaliana]
 sp|Q9ZPI5.1|MFP2_ARATH RecName: Full=Peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2; Short=AtMPF2; Includes: RecName: Full=Enoyl-CoA 
hydratase/3-2-trans-enoyl-CoA isomerase/3-hydroxybutyryl-CoA 
epimerase; Includes: RecName: Full=3-hydroxyacyl-CoA 
dehydrogenase [Arabidopsis thaliana]
 pdb|2WTB|A Chain A, Arabidopsis Thaliana Multifuctional Protein, Mfp2
 gb|AAF26990.1|AC016827_1 fatty acid multifunctional protein (AtMFP2) [Arabidopsis thaliana]
 gb|AAD18042.1| MFP2 [Arabidopsis thaliana]
 gb|AAL32699.1| fatty acid multifunctional protein (AtMFP2) [Arabidopsis thaliana]
 gb|AEE74468.1| fatty acid beta-oxidation multifunctional protein MFP2 [Arabidopsis 
thaliana]
Length=725

 Score =   247 bits (630),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 143/171 (84%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D GL P  IKKVA+IGGGLMGSGIATAL+LSN  V+LKE+N ++L  G+  ++ N++
Sbjct  301  GVTDRGLVPRKIKKVAIIGGGLMGSGIATALILSNYPVILKEVNEKFLEAGIGRVKANLQ  360

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V +  ++Q+K EK++S+LKG+LDY  FRDVDMVIEAVIEN+ LKQ+IF+D+EK CP H
Sbjct  361  SRVRKGSMSQEKFEKTMSLLKGSLDYESFRDVDMVIEAVIENISLKQQIFADLEKYCPQH  420

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            CILA+NTSTIDLN IG++T+SQDRI+GAHFFSPAH+MPLLEIVRT  TSAQ
Sbjct  421  CILASNTSTIDLNKIGERTKSQDRIVGAHFFSPAHIMPLLEIVRTNHTSAQ  471



>gb|KJB72707.1| hypothetical protein B456_011G191800 [Gossypium raimondii]
Length=681

 Score =   246 bits (627),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 147/179 (82%), Gaps = 0/179 (0%)
 Frame = +1

Query  13   LRPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGL  192
            +R  S + G  D GL P  ++KVAV+GGGLMGSGIATAL+LSN TV+LKE+N ++L  G+
Sbjct  293  MRGTSKVPGITDRGLMPRQVRKVAVLGGGLMGSGIATALILSNYTVILKEVNEKFLEAGI  352

Query  193  KTIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSD  372
              ++ N++  V + K++Q+K EK++S+L G LDY  FRDVDMVIEAVIENV LKQ+IF+D
Sbjct  353  DRVKANLQSRVKKGKMSQEKFEKTISLLSGVLDYERFRDVDMVIEAVIENVSLKQQIFAD  412

Query  373  IEKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            +EK C  HCILA+NTSTIDLN+IG++T+SQDRI+GAHFFSPAHVMPLLEIVRT +TS Q
Sbjct  413  LEKFCSPHCILASNTSTIDLNLIGERTKSQDRIVGAHFFSPAHVMPLLEIVRTRQTSPQ  471



>gb|KJB72711.1| hypothetical protein B456_011G191800 [Gossypium raimondii]
Length=712

 Score =   246 bits (629),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 147/179 (82%), Gaps = 0/179 (0%)
 Frame = +1

Query  13   LRPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGL  192
            +R  S + G  D GL P  ++KVAV+GGGLMGSGIATAL+LSN TV+LKE+N ++L  G+
Sbjct  293  MRGTSKVPGITDRGLMPRQVRKVAVLGGGLMGSGIATALILSNYTVILKEVNEKFLEAGI  352

Query  193  KTIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSD  372
              ++ N++  V + K++Q+K EK++S+L G LDY  FRDVDMVIEAVIENV LKQ+IF+D
Sbjct  353  DRVKANLQSRVKKGKMSQEKFEKTISLLSGVLDYERFRDVDMVIEAVIENVSLKQQIFAD  412

Query  373  IEKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            +EK C  HCILA+NTSTIDLN+IG++T+SQDRI+GAHFFSPAHVMPLLEIVRT +TS Q
Sbjct  413  LEKFCSPHCILASNTSTIDLNLIGERTKSQDRIVGAHFFSPAHVMPLLEIVRTRQTSPQ  471



>ref|XP_010105147.1| Glyoxysomal fatty acid beta-oxidation multifunctional protein 
MFP-a [Morus notabilis]
 gb|EXC03955.1| Glyoxysomal fatty acid beta-oxidation multifunctional protein 
MFP-a [Morus notabilis]
Length=726

 Score =   246 bits (629),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 143/171 (84%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D+GL P  +KKVAV+GGGLMGSGIATAL+LSN  V+LKE+N ++L  G+  +  N++
Sbjct  302  GVTDLGLVPRQVKKVAVLGGGLMGSGIATALILSNYPVILKEVNDKFLQAGIGRVRANLQ  361

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V + K+ Q+K +K++S+LKG LDY  F+DVDMVIEAVIENV LKQ+IF+D+EK CP H
Sbjct  362  SRVKKGKMTQEKFDKTISLLKGVLDYESFKDVDMVIEAVIENVSLKQQIFADLEKYCPPH  421

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            CILA+NTSTIDLN+IG++T+SQDRIIGAHFFSPAHVMPLLEI+RT KTS Q
Sbjct  422  CILASNTSTIDLNLIGKKTKSQDRIIGAHFFSPAHVMPLLEIIRTNKTSPQ  472



>gb|ABR18131.1| unknown [Picea sitchensis]
Length=723

 Score =   246 bits (628),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 143/171 (84%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D+GLKP  IKKVAV+GGGLMGSGIAT+L+LSNI VVLKE+N  +L +G+  I  N++
Sbjct  297  GVTDLGLKPRQIKKVAVLGGGLMGSGIATSLVLSNIPVVLKEVNAGFLQQGINRISANLK  356

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V +  + ++K EK++S++ G +DY+EFR+VDMVIEAV+E + LKQ+IFSD+EK CP+H
Sbjct  357  SRVKKGSMTEEKFEKTMSLITGVVDYAEFRNVDMVIEAVLEKISLKQEIFSDLEKICPAH  416

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            CILATNTSTIDLN+IG +T  QDRIIGAHFFSPAHVMPLLEIVRTEKTS Q
Sbjct  417  CILATNTSTIDLNLIGAKTHVQDRIIGAHFFSPAHVMPLLEIVRTEKTSPQ  467



>ref|XP_006407895.1| hypothetical protein EUTSA_v10020152mg [Eutrema salsugineum]
 gb|ESQ49348.1| hypothetical protein EUTSA_v10020152mg [Eutrema salsugineum]
Length=725

 Score =   246 bits (628),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 143/171 (84%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D GL P  IKKVA+IGGGLMGSGIATAL+LSN  VVLKE+N ++L  G+  ++ N++
Sbjct  301  GVTDRGLVPRKIKKVAIIGGGLMGSGIATALILSNYPVVLKEVNEKFLEAGIGRVKANLQ  360

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              + +  ++Q+K EK++S+LKG+LDY  FRDVDMVIEAVIEN+ LKQ+IF+D+EK CP H
Sbjct  361  SRLRKGSMSQEKFEKTMSLLKGSLDYESFRDVDMVIEAVIENLSLKQQIFADLEKYCPQH  420

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            CILA+NTSTIDLN IG++T+SQDRIIGAHFFSPAHVMPLLEIVRT  TSAQ
Sbjct  421  CILASNTSTIDLNKIGERTKSQDRIIGAHFFSPAHVMPLLEIVRTNHTSAQ  471



>gb|KDO71719.1| hypothetical protein CISIN_1g008576mg [Citrus sinensis]
Length=560

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 144/178 (81%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  +KKVA++GGGLMGSGIATAL+LSN  V+LKE+N ++L  G+ 
Sbjct  129  RGTSKVPGVTDLGLAPRRVKKVAILGGGLMGSGIATALILSNYPVILKEVNEKFLEAGIG  188

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             +  N++  V + K+ Q+K EK++S+L G LDY  F+DVDMVIEA+IENV LKQ+IF+D+
Sbjct  189  RVRANLQSRVKKGKMTQEKFEKTISLLTGVLDYESFKDVDMVIEAIIENVSLKQQIFADL  248

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CP HCILA+NTSTIDLN+IG++T S+DRI+GAHFFSPAHVMPLLEIVRT +TS Q
Sbjct  249  EKYCPPHCILASNTSTIDLNLIGERTYSKDRIVGAHFFSPAHVMPLLEIVRTNQTSPQ  306



>gb|KJB72706.1| hypothetical protein B456_011G191800 [Gossypium raimondii]
 gb|KJB72708.1| hypothetical protein B456_011G191800 [Gossypium raimondii]
Length=725

 Score =   246 bits (628),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 147/179 (82%), Gaps = 0/179 (0%)
 Frame = +1

Query  13   LRPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGL  192
            +R  S + G  D GL P  ++KVAV+GGGLMGSGIATAL+LSN TV+LKE+N ++L  G+
Sbjct  293  MRGTSKVPGITDRGLMPRQVRKVAVLGGGLMGSGIATALILSNYTVILKEVNEKFLEAGI  352

Query  193  KTIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSD  372
              ++ N++  V + K++Q+K EK++S+L G LDY  FRDVDMVIEAVIENV LKQ+IF+D
Sbjct  353  DRVKANLQSRVKKGKMSQEKFEKTISLLSGVLDYERFRDVDMVIEAVIENVSLKQQIFAD  412

Query  373  IEKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            +EK C  HCILA+NTSTIDLN+IG++T+SQDRI+GAHFFSPAHVMPLLEIVRT +TS Q
Sbjct  413  LEKFCSPHCILASNTSTIDLNLIGERTKSQDRIVGAHFFSPAHVMPLLEIVRTRQTSPQ  471



>gb|KDO71723.1| hypothetical protein CISIN_1g008576mg [Citrus sinensis]
Length=561

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 144/178 (81%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  +KKVA++GGGLMGSGIATAL+LSN  V+LKE+N ++L  G+ 
Sbjct  129  RGTSKVPGVTDLGLAPRRVKKVAILGGGLMGSGIATALILSNYPVILKEVNEKFLEAGIG  188

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             +  N++  V + K+ Q+K EK++S+L G LDY  F+DVDMVIEA+IENV LKQ+IF+D+
Sbjct  189  RVRANLQSRVKKGKMTQEKFEKTISLLTGVLDYESFKDVDMVIEAIIENVSLKQQIFADL  248

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CP HCILA+NTSTIDLN+IG++T S+DRI+GAHFFSPAHVMPLLEIVRT +TS Q
Sbjct  249  EKYCPPHCILASNTSTIDLNLIGERTYSKDRIVGAHFFSPAHVMPLLEIVRTNQTSPQ  306



>gb|KDO71724.1| hypothetical protein CISIN_1g008576mg [Citrus sinensis]
Length=535

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 144/178 (81%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  +KKVA++GGGLMGSGIATAL+LSN  V+LKE+N ++L  G+ 
Sbjct  129  RGTSKVPGVTDLGLAPRRVKKVAILGGGLMGSGIATALILSNYPVILKEVNEKFLEAGIG  188

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             +  N++  V + K+ Q+K EK++S+L G LDY  F+DVDMVIEA+IENV LKQ+IF+D+
Sbjct  189  RVRANLQSRVKKGKMTQEKFEKTISLLTGVLDYESFKDVDMVIEAIIENVSLKQQIFADL  248

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CP HCILA+NTSTIDLN+IG++T S+DRI+GAHFFSPAHVMPLLEIVRT +TS Q
Sbjct  249  EKYCPPHCILASNTSTIDLNLIGERTYSKDRIVGAHFFSPAHVMPLLEIVRTNQTSPQ  306



>ref|XP_004508202.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2-like [Cicer arietinum]
Length=722

 Score =   246 bits (628),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 144/171 (84%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D GL P  +KKVA++GGGLMGSGIATAL+LSN +V+LKE+N ++L  G+  I+ N++
Sbjct  298  GVTDRGLVPRHVKKVAILGGGLMGSGIATALVLSNYSVILKEVNEKFLDAGINRIKANLQ  357

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V + KL Q++ EK+ S++KG+LDY  F+DVDMVIEAVIENV LKQ+IF+D+EK CP H
Sbjct  358  SRVKKGKLTQERFEKAFSLVKGSLDYESFKDVDMVIEAVIENVSLKQQIFADLEKYCPPH  417

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            CIL +NTSTIDLN+IG++T+SQDRI+GAHFFSPAHVMPLLEIVRT++TS Q
Sbjct  418  CILGSNTSTIDLNLIGEKTKSQDRIVGAHFFSPAHVMPLLEIVRTKRTSPQ  468



>ref|XP_007154175.1| hypothetical protein PHAVU_003G096500g [Phaseolus vulgaris]
 gb|ESW26169.1| hypothetical protein PHAVU_003G096500g [Phaseolus vulgaris]
Length=722

 Score =   246 bits (628),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 147/178 (83%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P ++KKVA++GGGLMGSGIATAL+LS+  V+LKE+N ++L  G+ 
Sbjct  291  RGTSKIPGVTDLGLVPRNVKKVAILGGGLMGSGIATALILSSYPVILKEVNEKFLDAGIN  350

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             I+ N++  V + KL Q K EK++S+L+G LDY  FRDVDMVIEAVIENV LKQ+IF+D+
Sbjct  351  RIKANLQSRVRKGKLTQKKFEKAVSLLEGTLDYGSFRDVDMVIEAVIENVSLKQQIFADL  410

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CP HCILA+NTSTIDLN+IG++T+S+DRI+GAHFFSPAHVMPLLEIVRT KTS Q
Sbjct  411  EKYCPPHCILASNTSTIDLNLIGEKTKSKDRIVGAHFFSPAHVMPLLEIVRTNKTSPQ  468



>ref|XP_010486216.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2-like [Camelina sativa]
Length=725

 Score =   246 bits (628),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 143/171 (84%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D GL P  IKKVA+IGGGLMGSGIATAL+LSN  V+LKE+N ++L  G+  ++ N++
Sbjct  301  GVTDRGLMPRKIKKVAIIGGGLMGSGIATALILSNYPVILKEVNEKFLEAGIGRVKANLQ  360

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V +  ++++K EK++S+LKG+LDY  FRDVDMVIEAVIEN+ LKQ+IF+D+EK CP H
Sbjct  361  SRVRKGSMSKEKFEKTMSLLKGSLDYESFRDVDMVIEAVIENISLKQQIFADLEKYCPQH  420

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            CILA+NTSTIDLN IG++T+SQDRI+GAHFFSPAHVMPLLEIVRT  TSAQ
Sbjct  421  CILASNTSTIDLNKIGERTKSQDRIVGAHFFSPAHVMPLLEIVRTNHTSAQ  471



>ref|XP_010445439.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2-like isoform X1 [Camelina sativa]
 ref|XP_010445486.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2-like isoform X2 [Camelina sativa]
Length=604

 Score =   243 bits (621),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 143/171 (84%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D GL P  IKKVA+IGGGLMGSGIATAL+LS+  V+LKE+N ++L  G+  ++ N++
Sbjct  180  GVTDRGLMPRKIKKVAIIGGGLMGSGIATALILSSYPVILKEVNEKFLEAGIGRVKANLQ  239

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V +  ++++K EK++S+LKG+LDY  FRDVDMVIEAVIEN+ LKQ+IF+D+EK CP H
Sbjct  240  SRVRKGSMSKEKFEKTMSLLKGSLDYESFRDVDMVIEAVIENISLKQQIFADLEKYCPQH  299

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            CILA+NTSTIDLN IG++T+SQDRI+GAHFFSPAHVMPLLEIVRT  TSAQ
Sbjct  300  CILASNTSTIDLNKIGERTKSQDRIVGAHFFSPAHVMPLLEIVRTNHTSAQ  350



>ref|XP_011003910.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like [Populus euphratica]
Length=726

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 146/179 (82%), Gaps = 0/179 (0%)
 Frame = +1

Query  13   LRPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGL  192
            LR  + + G  D+GL P  +KKVAV+GGGLMGSGIAT L+LSN  V+LKE+N ++L   +
Sbjct  294  LRGTTKVPGITDLGLVPRRVKKVAVLGGGLMGSGIATTLILSNYPVILKELNDQFLQASI  353

Query  193  KTIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSD  372
              +  N++  V + K+ Q+K EK++S+LKG+LDY  F+DVDMVIEAVIENV LKQ+IFSD
Sbjct  354  GRVRANLQSRVKKGKMTQEKFEKTMSLLKGSLDYESFKDVDMVIEAVIENVSLKQQIFSD  413

Query  373  IEKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            +EK CP HCILA+NTSTIDLN+IG+ T+SQDRIIGAHFFSPAHVMPLLEIVRT++TS Q
Sbjct  414  LEKYCPPHCILASNTSTIDLNLIGKHTKSQDRIIGAHFFSPAHVMPLLEIVRTKQTSPQ  472



>ref|XP_006365183.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like isoform X1 [Solanum tuberosum]
 ref|XP_006365184.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like isoform X2 [Solanum tuberosum]
Length=710

 Score =   245 bits (626),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            D+GLKP  I+KVAV+GGGLMGSGIATAL++SNI+VVLKEIN EYLSK LK++E N++G V
Sbjct  296  DIGLKPRRIEKVAVVGGGLMGSGIATALIISNISVVLKEINHEYLSKALKSVEANLQGFV  355

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            +R KL QDK +++LS+LKG LDY + +DVDMVIEAV ENV LKQ IF DIEK C S CI 
Sbjct  356  TRGKLNQDKMKRTLSLLKGTLDYEDLKDVDMVIEAVNENVSLKQSIFEDIEKVCTSECIF  415

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            A+NTSTI L++IG++T SQDRI+G H FSPAH+MPL+EIVRTE TS Q
Sbjct  416  ASNTSTISLDVIGKRTSSQDRILGIHLFSPAHLMPLVEIVRTENTSPQ  463



>gb|EPS73418.1| hypothetical protein M569_01334 [Genlisea aurea]
Length=696

 Score =   245 bits (625),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 145/172 (84%), Gaps = 0/172 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D+GLKP SIKKVA++GGGLMGSGIATAL+LS   V+LKE++ ++L  G+  ++ N++
Sbjct  270  GVTDLGLKPRSIKKVAILGGGLMGSGIATALILSGYPVILKEVSDKFLQSGIGRVKANLQ  329

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V + ++ Q+K EK++S+LKGALDY  F DVD+VIEAVIE++ LKQ IFSD+EK CP H
Sbjct  330  SRVKKGQMNQEKFEKTISLLKGALDYGSFGDVDIVIEAVIEDINLKQNIFSDLEKFCPPH  389

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQT  552
            CILATNTSTIDLN+IG++T+SQDRIIGAHFFSPAHVMPLLEIVRT+KTS Q 
Sbjct  390  CILATNTSTIDLNLIGEKTKSQDRIIGAHFFSPAHVMPLLEIVRTQKTSPQA  441



>ref|XP_010464276.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2 [Camelina sativa]
Length=725

 Score =   245 bits (626),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 143/171 (84%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D GL P  IKKVA+IGGGLMGSGIATAL+LSN  V+LKE+N ++L  G+  ++ N++
Sbjct  301  GVTDRGLIPRKIKKVAIIGGGLMGSGIATALILSNYPVILKEVNEKFLEAGIGRVKANLQ  360

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V +  ++++K EK++S+LKG+LDY  FRDVDMVIEAVIEN+ LKQ+IF+D+EK CP H
Sbjct  361  SRVRKGSMSKEKFEKTMSLLKGSLDYESFRDVDMVIEAVIENISLKQQIFADLEKYCPQH  420

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            CILA+NTSTIDLN IG++T+SQDRI+GAHFFSPAHVMPLLEIVRT  TSAQ
Sbjct  421  CILASNTSTIDLNKIGERTKSQDRIVGAHFFSPAHVMPLLEIVRTNHTSAQ  471



>gb|KHG21889.1| Peroxisomal fatty acid beta-oxidation multifunctional MFP2 -like 
protein [Gossypium arboreum]
Length=724

 Score =   245 bits (626),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 146/178 (82%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D GL P  +KKVA++GGGLMGSGIATALLLSN TV+LKE+N ++L  G+ 
Sbjct  293  RGTSKVPGITDRGLVPRKVKKVAILGGGLMGSGIATALLLSNYTVILKEVNEKFLEAGIG  352

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             ++ N+   V + ++ Q+K +K++S+L+G LD+  FRDVDMVIEAVIENV LKQ+IF+D+
Sbjct  353  RVKANLGSRVKKGQMTQEKFDKTMSLLRGVLDFESFRDVDMVIEAVIENVSLKQQIFADL  412

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CP HCILA+NTSTIDLN+IG++T+SQDRIIGAHFFSPAH+MPLLEIVRTE TS Q
Sbjct  413  EKYCPPHCILASNTSTIDLNLIGKRTKSQDRIIGAHFFSPAHIMPLLEIVRTEHTSPQ  470



>gb|AER62403.1| hypothetical protein, partial [Elymus libanoticus]
Length=338

 Score =   236 bits (601),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 145/178 (81%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  I KVA++GGGLMGSGIATA++LSN  V+LKE+N ++L+ G+ 
Sbjct  98   RATSKVPGATDLGLMPRKIXKVAILGGGLMGSGIATAMILSNYPVLLKEVNEKFLNAGID  157

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             I+ N++  V + K+ +++  K+LS+  G L Y +F++VD+VIEAVIENV LKQ+IF+D+
Sbjct  158  RIKANLQSRVRKGKMTEERYXKALSLXTGXLGYEKFKEVDLVIEAVIENVKLKQQIFADL  217

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CPSHCILATNTSTIDLN+IG++T+SQDRI+GAHFFSPAHVMPLLEIV T+ TSAQ
Sbjct  218  EKYCPSHCILATNTSTIDLNLIGEKTKSQDRIVGAHFFSPAHVMPLLEIVXTQHTSAQ  275



>gb|ABK24476.1| unknown [Picea sitchensis]
Length=726

 Score =   245 bits (626),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 143/171 (84%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  DVGLKP  ++KVAV+GGGLMGSGIATAL+LS   V+LKE+N  +L  GL+ I+ N++
Sbjct  302  GVTDVGLKPRRVRKVAVLGGGLMGSGIATALILSGYPVILKEVNDRFLQAGLERIKANLQ  361

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V++ K++Q+K EK  S++ G +DY  FR+VD+VIEAVIENV LKQ+IFSD+EK CP H
Sbjct  362  SRVNKGKMSQEKFEKIFSLVHGTVDYENFRNVDIVIEAVIENVALKQQIFSDLEKFCPPH  421

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            C+LATNTSTIDL++IGQ+T SQDRI+GAHFFSPAH+MPLLEIVRTEKTS Q
Sbjct  422  CVLATNTSTIDLSLIGQKTNSQDRIVGAHFFSPAHIMPLLEIVRTEKTSPQ  472



>ref|XP_006297065.1| hypothetical protein CARUB_v10013066mg [Capsella rubella]
 gb|EOA29963.1| hypothetical protein CARUB_v10013066mg [Capsella rubella]
Length=725

 Score =   245 bits (626),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 143/171 (84%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D GL P  IKKVA+IGGGLMGSGIATAL+LSN  V+LKE+N ++L  G+  ++ N++
Sbjct  301  GVTDGGLVPRKIKKVAIIGGGLMGSGIATALILSNYPVILKEVNEKFLEAGIGRVKANLQ  360

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V +  ++++K EK++S+LKG+LDY  FRDVDMVIEAVIEN+ LKQ+IF+D+EK CP H
Sbjct  361  SRVRKGSMSKEKFEKTMSLLKGSLDYESFRDVDMVIEAVIENISLKQQIFADLEKYCPQH  420

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            CILA+NTSTIDLN IG++T+SQDRI+GAHFFSPAHVMPLLEIVRT  TSAQ
Sbjct  421  CILASNTSTIDLNKIGERTKSQDRIVGAHFFSPAHVMPLLEIVRTNHTSAQ  471



>ref|XP_008784762.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like isoform X3 [Phoenix dactylifera]
Length=636

 Score =   243 bits (621),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 142/178 (80%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  I+KVA++GGGLMGSGIATAL+LSN  V+LKE+N  +L  G+ 
Sbjct  205  RATSKVPGITDIGLTPRRIRKVAIVGGGLMGSGIATALILSNYLVILKEVNENFLQSGVG  264

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             ++ N++G V ++K+ Q++  K+LS+L G LDY  F+DVDMVIEAVIENV LKQ+IFSD+
Sbjct  265  KVKANLQGYVKKRKMTQEECGKALSLLIGVLDYEHFKDVDMVIEAVIENVSLKQQIFSDL  324

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CP HCILA+NTSTIDLN IG++T SQDRI+GAHFFSPAHVMPLLEIV T  TS Q
Sbjct  325  EKYCPPHCILASNTSTIDLNSIGEKTMSQDRIVGAHFFSPAHVMPLLEIVYTRTTSPQ  382



>gb|AES91892.2| glyoxysomal fatty acid beta-oxidation MFP-A protein [Medicago 
truncatula]
Length=723

 Score =   245 bits (625),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 146/178 (82%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D GL P  +KKVA++GGGLMGSGIATAL+LSN +V+LKE+N ++L  G+ 
Sbjct  292  RGTSKVPGVTDRGLVPRPVKKVAILGGGLMGSGIATALILSNYSVILKEVNEKFLDAGIN  351

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             I+ N++  V +  L Q++ EK+ S++KG+LDY  FRDVDMVIEAVIENV LKQ+IF+D+
Sbjct  352  RIKANLQSRVKKGNLTQERFEKAFSLVKGSLDYDSFRDVDMVIEAVIENVSLKQQIFADL  411

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CP HCIL +NTSTIDL++IG++T+SQDRIIGAHFFSPAHVMPLLEIVRT++TS Q
Sbjct  412  EKYCPPHCILGSNTSTIDLDLIGEKTKSQDRIIGAHFFSPAHVMPLLEIVRTKRTSPQ  469



>gb|KJB34649.1| hypothetical protein B456_006G076600 [Gossypium raimondii]
Length=724

 Score =   245 bits (625),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 145/178 (81%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D GL P  +KKVA++GGGLMGSGIA ALLLSN TV+LKE+N ++L  G+ 
Sbjct  293  RGTSKVPGITDRGLVPRKVKKVAILGGGLMGSGIAMALLLSNYTVILKEVNEKFLEAGIG  352

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             ++ N+   V + ++ Q+K EK++S+L+G LD+  FRDVDMVIEAVIENV LKQ+IF+D+
Sbjct  353  RVKANLGSRVKKGQMTQEKFEKTMSLLRGVLDFESFRDVDMVIEAVIENVSLKQQIFADL  412

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CP HCILA+NTSTIDLN+IG++T+SQDRIIGAHFFSPAH+MPLLEIVRTE TS Q
Sbjct  413  EKYCPPHCILASNTSTIDLNLIGKRTKSQDRIIGAHFFSPAHIMPLLEIVRTEHTSPQ  470



>ref|XP_003550336.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2-like [Glycine max]
 gb|KHN03350.1| Peroxisomal fatty acid beta-oxidation multifunctional protein 
MFP2 [Glycine soja]
Length=722

 Score =   244 bits (624),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 146/178 (82%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D GL P  +KKVA+IGGGLMGSGIATAL+LS+  ++LKE+N ++L  G+ 
Sbjct  291  RGTSKVPGVTDCGLVPRHVKKVAIIGGGLMGSGIATALILSSYPIILKEVNEKFLEAGIN  350

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             I+ N++  V + KL Q+  E ++S+LKG LDY  F+DVDMVIEAV+ENV LKQ+IF+D+
Sbjct  351  RIKANLQSRVKKGKLTQENFENTVSLLKGTLDYESFKDVDMVIEAVVENVSLKQQIFADL  410

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CP HCILA+NTSTIDLN+IG++T+SQDRI+GAHFFSPAHVMPLLEIVRT++TSAQ
Sbjct  411  EKYCPPHCILASNTSTIDLNLIGERTKSQDRIVGAHFFSPAHVMPLLEIVRTKQTSAQ  468



>ref|XP_010024717.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like [Eucalyptus grandis]
 gb|KCW61183.1| hypothetical protein EUGRSUZ_H039482 [Eucalyptus grandis]
Length=725

 Score =   244 bits (623),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 146/179 (82%), Gaps = 0/179 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D GL P  ++ VAV+GGGLMGSGIATAL+LSN +V+LKE+N ++L  G+ 
Sbjct  294  RGTSKVPGITDRGLMPRQVRNVAVVGGGLMGSGIATALVLSNYSVILKEVNDKFLQAGIG  353

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             ++ N++  V +  + Q+K EK++S+LKG LDY  F+DVDMVIEAVIENV LKQ+IF+D+
Sbjct  354  RVKANLQSRVKKGNMTQEKFEKTMSLLKGVLDYESFKDVDMVIEAVIENVSLKQQIFADL  413

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQT  552
            E++CP HCILATNTSTIDLN++G++TRS+DRIIGAHFFSPAH+MPLLEIVRT+ TS Q 
Sbjct  414  ERSCPPHCILATNTSTIDLNLVGEKTRSRDRIIGAHFFSPAHIMPLLEIVRTQHTSPQA  472



>ref|XP_004968710.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like [Setaria italica]
Length=723

 Score =   244 bits (623),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 147/178 (83%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  I K+A++GGGLMGSGIATA++LSN  V+LKE+N ++L+ G+ 
Sbjct  292  RATSKIPGATDLGLMPRKISKIAILGGGLMGSGIATAMILSNYPVILKEVNEKFLNAGID  351

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             I+ N++  V + K+  ++ EK++S++ G LDY  F+DVD+VIEAVIENV LKQ+IFSD+
Sbjct  352  RIKANLQSRVRKGKMTDERYEKAMSLVTGVLDYEHFKDVDLVIEAVIENVKLKQQIFSDL  411

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CPSHC+LATNTSTIDLN+IG++T+SQDRI+GAHFFSPAH+MPLLEIVRT++TS Q
Sbjct  412  EKYCPSHCVLATNTSTIDLNLIGEKTKSQDRIVGAHFFSPAHIMPLLEIVRTQRTSPQ  469



>ref|XP_002270067.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a [Vitis vinifera]
Length=724

 Score =   244 bits (623),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 143/178 (80%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  I KVA++GGGLMGSGIATAL+LSN  V+LKE+N ++L  G+ 
Sbjct  293  RGTSKVPGIADLGLVPRRINKVAILGGGLMGSGIATALMLSNYPVILKEVNEKFLQAGIG  352

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             +  N++  V +  + Q+K EK+ S+LKG LDY  F+DVDMVIEAVIENV LKQ+IF+D+
Sbjct  353  RVRANLQSRVKKGAMTQEKFEKTFSLLKGVLDYESFKDVDMVIEAVIENVSLKQQIFADL  412

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CP HCILA+NTSTIDLN+IG++TRS DRI+GAHFFSPAHVMPLLEIVRT++TS Q
Sbjct  413  EKFCPPHCILASNTSTIDLNLIGEKTRSHDRIVGAHFFSPAHVMPLLEIVRTQRTSPQ  470



>gb|KCW61185.1| hypothetical protein EUGRSUZ_H039482 [Eucalyptus grandis]
Length=732

 Score =   244 bits (623),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 146/178 (82%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D GL P  ++ VAV+GGGLMGSGIATAL+LSN +V+LKE+N ++L  G+ 
Sbjct  294  RGTSKVPGITDRGLMPRQVRNVAVVGGGLMGSGIATALVLSNYSVILKEVNDKFLQAGIG  353

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             ++ N++  V +  + Q+K EK++S+LKG LDY  F+DVDMVIEAVIENV LKQ+IF+D+
Sbjct  354  RVKANLQSRVKKGNMTQEKFEKTMSLLKGVLDYESFKDVDMVIEAVIENVSLKQQIFADL  413

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            E++CP HCILATNTSTIDLN++G++TRS+DRIIGAHFFSPAH+MPLLEIVRT+ TS Q
Sbjct  414  ERSCPPHCILATNTSTIDLNLVGEKTRSRDRIIGAHFFSPAHIMPLLEIVRTQHTSPQ  471



>ref|XP_010524718.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2 [Tarenaya hassleriana]
Length=725

 Score =   244 bits (622),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 145/178 (81%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D GL P  IKKVA+IGGGLMGSGIATAL+LSN  V+LKE+N ++L  G+ 
Sbjct  294  RGTSKVPGVTDRGLVPRPIKKVAIIGGGLMGSGIATALILSNYQVILKEVNEKFLEAGIG  353

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             +  N++  V +  ++++K EK++S+LKG LDY  FRD+D+VIEAVIEN+ LKQ+IF+D+
Sbjct  354  RVRANLQSRVKKGNMSKEKFEKTMSLLKGVLDYESFRDIDLVIEAVIENISLKQQIFADL  413

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CP HCILA+NTSTIDLN IG++T+SQDRI+GAHFFSPAHVMPLLEIVRT+ TSAQ
Sbjct  414  EKYCPPHCILASNTSTIDLNKIGEKTKSQDRIVGAHFFSPAHVMPLLEIVRTDHTSAQ  471



>ref|XP_010445530.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2-like isoform X3 [Camelina sativa]
Length=725

 Score =   244 bits (622),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 143/171 (84%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D GL P  IKKVA+IGGGLMGSGIATAL+LS+  V+LKE+N ++L  G+  ++ N++
Sbjct  301  GVTDRGLMPRKIKKVAIIGGGLMGSGIATALILSSYPVILKEVNEKFLEAGIGRVKANLQ  360

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V +  ++++K EK++S+LKG+LDY  FRDVDMVIEAVIEN+ LKQ+IF+D+EK CP H
Sbjct  361  SRVRKGSMSKEKFEKTMSLLKGSLDYESFRDVDMVIEAVIENISLKQQIFADLEKYCPQH  420

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            CILA+NTSTIDLN IG++T+SQDRI+GAHFFSPAHVMPLLEIVRT  TSAQ
Sbjct  421  CILASNTSTIDLNKIGERTKSQDRIVGAHFFSPAHVMPLLEIVRTNHTSAQ  471



>gb|KHG21753.1| Peroxisomal fatty acid beta-oxidation multifunctional MFP2 -like 
protein [Gossypium arboreum]
Length=725

 Score =   244 bits (622),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 148/179 (83%), Gaps = 0/179 (0%)
 Frame = +1

Query  13   LRPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGL  192
            +R  S + G  D GL P  ++KVAV+GGGLMGSGIATAL+LSN TV+LKE+N ++L  G+
Sbjct  293  MRGTSKVPGITDRGLMPRQVRKVAVLGGGLMGSGIATALILSNYTVILKEVNEKFLEAGI  352

Query  193  KTIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSD  372
              ++ N++  V + K++Q+K EK++S+L G LDY  FRDVDMVIEAVIENV LKQ+IF+D
Sbjct  353  GRVKANLQSRVKKGKMSQEKFEKTISLLSGVLDYESFRDVDMVIEAVIENVSLKQQIFAD  412

Query  373  IEKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            +EK C  HCILA+NTSTIDL++IG++T+SQDRI+GAHFFSPAHVMPLLEIVRT++TS Q
Sbjct  413  LEKFCSPHCILASNTSTIDLSLIGERTKSQDRIVGAHFFSPAHVMPLLEIVRTKQTSPQ  471



>ref|XP_010325170.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Solanum lycopersicum]
Length=710

 Score =   243 bits (621),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            D GLKP  I+KVAV+GGGLMGSGIATAL++SNI+VV+KEIN EYLSK LK++E N++G V
Sbjct  296  DTGLKPRRIEKVAVVGGGLMGSGIATALIISNISVVVKEINHEYLSKALKSVEANLQGFV  355

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            +R KL QDK +++LS+LKG LDY + +DVDMVIEAV ENV LKQ IF DIEK C S CI 
Sbjct  356  TRGKLNQDKMKRTLSLLKGTLDYEDLKDVDMVIEAVNENVSLKQSIFEDIEKVCTSECIF  415

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            A+NTSTI L++IG++T SQDRI+G H FSPAH+MPL+EIVRTE TS Q
Sbjct  416  ASNTSTISLDVIGKRTTSQDRILGIHLFSPAHLMPLVEIVRTENTSPQ  463



>dbj|BAJ86175.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=761

 Score =   244 bits (623),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  I KVA++GGGLMGSGIATA++LSN  V+LKE+N ++L+ G+ 
Sbjct  329  RATSKVPGATDLGLMPRKIMKVAILGGGLMGSGIATAMILSNYPVLLKEVNEKFLNAGID  388

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             I+ N++  V + K+ +++ EK+LS+L GAL Y +F++VD+VIEAVIENV LKQ+IF+D+
Sbjct  389  RIKANLQSRVRKGKMTEERYEKALSLLSGALGYEKFKEVDLVIEAVIENVKLKQQIFADL  448

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CPSHCILATNTSTIDLN+IG++T+SQDRI+GAHFFSPAHVMPLLEIVRT+ TSAQ
Sbjct  449  EKYCPSHCILATNTSTIDLNLIGEKTKSQDRIVGAHFFSPAHVMPLLEIVRTQHTSAQ  506



>ref|NP_001042973.1| Os01g0348600 [Oryza sativa Japonica Group]
 dbj|BAB63893.1| putative tetrafunctional protein of glyoxysomal fatty acid beta-oxidation 
[Oryza sativa Japonica Group]
 dbj|BAB93398.1| putative tetrafunctional protein of glyoxysomal fatty acid beta-oxidation 
[Oryza sativa Japonica Group]
 dbj|BAF04887.1| Os01g0348600 [Oryza sativa Japonica Group]
 gb|EAZ11803.1| hypothetical protein OsJ_01677 [Oryza sativa Japonica Group]
 dbj|BAG94610.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70593.1| hypothetical protein OsI_01815 [Oryza sativa Indica Group]
 gb|AGW30398.1| glyoxysomal fatty acid beta-chain multifunctional protein [Oryza 
sativa]
Length=727

 Score =   243 bits (621),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 147/178 (83%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  + KVA++GGGLMGSGIATA++LSN  V+LKE+N ++L+ G+ 
Sbjct  296  RATSKVPGATDLGLMPRKVTKVAILGGGLMGSGIATAMILSNYPVILKEVNEKFLNAGID  355

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             I+ N++  V + K+ +++ EK++S++ G LDY  F+DVD+VIEAVIENV LKQ+IFSD+
Sbjct  356  RIKANLQSRVRKGKMTEERYEKAMSLVTGVLDYERFKDVDLVIEAVIENVKLKQQIFSDL  415

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CPSHC+LATNTSTIDLN+IG++TRS+DRI+GAHFFSPAHVMPLLEIVRT+ TS Q
Sbjct  416  EKYCPSHCVLATNTSTIDLNLIGEKTRSKDRIVGAHFFSPAHVMPLLEIVRTQHTSPQ  473



>gb|AIL29217.1| fatty acid beta-oxidation multifunctional protein [Camellia oleifera]
Length=725

 Score =   243 bits (621),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 140/172 (81%), Gaps = 0/172 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D GL P  I KVA++GGGLMGSGIATAL+LSN  V+LKE+N ++L  G+  +  N++
Sbjct  301  GITDRGLVPRRINKVAILGGGLMGSGIATALILSNYPVILKEVNDKFLQAGIGRVRANLQ  360

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V + K+ Q+K EK+LS+L+G LDY  F DVDMVIEAVIEN+ LKQ+IF+D+EK CP H
Sbjct  361  SRVKKGKMTQEKFEKTLSLLRGVLDYESFGDVDMVIEAVIENISLKQQIFADLEKYCPPH  420

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQT  552
            CILA+NTSTIDLN+IG++T+S DRIIGAHFFSPAHVMPLLEIVRTEKTS Q 
Sbjct  421  CILASNTSTIDLNLIGEKTKSHDRIIGAHFFSPAHVMPLLEIVRTEKTSPQA  472



>emb|CBI22983.3| unnamed protein product [Vitis vinifera]
Length=765

 Score =   244 bits (623),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 143/178 (80%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  I KVA++GGGLMGSGIATAL+LSN  V+LKE+N ++L  G+ 
Sbjct  334  RGTSKVPGIADLGLVPRRINKVAILGGGLMGSGIATALMLSNYPVILKEVNEKFLQAGIG  393

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             +  N++  V +  + Q+K EK+ S+LKG LDY  F+DVDMVIEAVIENV LKQ+IF+D+
Sbjct  394  RVRANLQSRVKKGAMTQEKFEKTFSLLKGVLDYESFKDVDMVIEAVIENVSLKQQIFADL  453

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CP HCILA+NTSTIDLN+IG++TRS DRI+GAHFFSPAHVMPLLEIVRT++TS Q
Sbjct  454  EKFCPPHCILASNTSTIDLNLIGEKTRSHDRIVGAHFFSPAHVMPLLEIVRTQRTSPQ  511



>gb|KFK38149.1| hypothetical protein AALP_AA3G075600 [Arabis alpina]
Length=725

 Score =   243 bits (620),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 142/171 (83%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D GL P  IKKVA+IGGGLMGSGIATAL+LSN  VVLKE+N ++L  G+  ++ N++
Sbjct  301  GVTDRGLVPRKIKKVAIIGGGLMGSGIATALILSNYPVVLKEVNEKFLEAGIGRVKANLQ  360

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V +  ++++K EK++S+LKG+LDY  FRDVDMVIEAVIE + LKQ+IF+D+EK CP H
Sbjct  361  SRVRKGSMSKEKFEKTMSLLKGSLDYESFRDVDMVIEAVIEKLSLKQQIFADLEKYCPQH  420

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            CILA+NTSTIDLN IG++T+SQDRI+GAHFFSPAHVMPLLEIVRT  TSAQ
Sbjct  421  CILASNTSTIDLNKIGERTKSQDRIVGAHFFSPAHVMPLLEIVRTNHTSAQ  471



>ref|XP_003578000.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like [Brachypodium distachyon]
Length=723

 Score =   243 bits (620),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  I KVA++GGGLMGSGIATA++LSN  V+LKE+N ++L+ G+ 
Sbjct  292  RATSKVPGATDLGLMPRKITKVAILGGGLMGSGIATAMILSNYPVILKEVNEKFLNAGID  351

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             I+ N++  V + K+ +++ EK+LS++ GAL Y  F++VD+VIEAVIENV LKQ+IF+D+
Sbjct  352  RIKANLQSRVRKGKMTEERYEKALSLVTGALGYENFKEVDLVIEAVIENVKLKQQIFADL  411

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CPSHCILATNTSTIDLN+IG++T+SQDRI+GAHFFSPAHVMPLLEIVRT+ TSAQ
Sbjct  412  EKYCPSHCILATNTSTIDLNLIGEKTKSQDRIVGAHFFSPAHVMPLLEIVRTQHTSAQ  469



>ref|XP_006419532.1| hypothetical protein CICLE_v10004429mg [Citrus clementina]
 gb|ESR32772.1| hypothetical protein CICLE_v10004429mg [Citrus clementina]
Length=725

 Score =   243 bits (620),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 144/178 (81%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  +KKVA++GGGLMGSGIATAL+LSN  V+LKE+N ++L  G+ 
Sbjct  294  RGTSKVPGVTDLGLAPRRVKKVAILGGGLMGSGIATALILSNYPVILKEVNEKFLEAGIG  353

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             +  N++  V + K+ Q+K EK++S+L G LDY  F+DVDMVIEAVIENV LKQ+IF+D+
Sbjct  354  RVRANLQSRVKKGKMTQEKFEKTISLLTGVLDYESFKDVDMVIEAVIENVSLKQQIFADL  413

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CP HCILA+NTSTIDLN+IG++T S+DRI+GAHFFSPAHVMPLLEIVRT +TS Q
Sbjct  414  EKYCPPHCILASNTSTIDLNLIGERTYSKDRIVGAHFFSPAHVMPLLEIVRTNQTSPQ  471



>ref|XP_008784760.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like isoform X1 [Phoenix dactylifera]
Length=719

 Score =   243 bits (619),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 142/178 (80%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  I+KVA++GGGLMGSGIATAL+LSN  V+LKE+N  +L  G+ 
Sbjct  288  RATSKVPGITDIGLTPRRIRKVAIVGGGLMGSGIATALILSNYLVILKEVNENFLQSGVG  347

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             ++ N++G V ++K+ Q++  K+LS+L G LDY  F+DVDMVIEAVIENV LKQ+IFSD+
Sbjct  348  KVKANLQGYVKKRKMTQEECGKALSLLIGVLDYEHFKDVDMVIEAVIENVSLKQQIFSDL  407

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CP HCILA+NTSTIDLN IG++T SQDRI+GAHFFSPAHVMPLLEIV T  TS Q
Sbjct  408  EKYCPPHCILASNTSTIDLNSIGEKTMSQDRIVGAHFFSPAHVMPLLEIVYTRTTSPQ  465



>ref|XP_009134933.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a [Brassica rapa]
Length=725

 Score =   243 bits (619),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 143/171 (84%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D GL P  I K+A+IGGGLMGS IATAL+LSN +V+LKE+N ++L  G+  ++ N++
Sbjct  301  GVTDRGLVPRKINKLAIIGGGLMGSEIATALILSNYSVILKEVNEKFLEAGIGRVKANLQ  360

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V + K++++K EK++S+LKG+LDY  FRDVDMVIEAVIEN+ LKQ+IF+D+EK CP H
Sbjct  361  SRVKKGKMSKEKFEKTMSLLKGSLDYESFRDVDMVIEAVIENISLKQQIFADLEKYCPQH  420

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            CILA+NTSTIDLN IG++T+SQDRIIGAHFFSPAHVMPLLEIVRT  TSAQ
Sbjct  421  CILASNTSTIDLNKIGERTKSQDRIIGAHFFSPAHVMPLLEIVRTNHTSAQ  471



>ref|XP_010259502.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a [Nelumbo nucifera]
Length=725

 Score =   243 bits (619),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 142/171 (83%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D+GL P  IKKVA++GGGLMGSGIATAL+LSN  V+LKE+N ++L  G+  I+ N+R
Sbjct  301  GITDLGLVPRRIKKVAILGGGLMGSGIATALILSNYPVILKEVNEKFLQAGIDRIKANLR  360

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V + K+ ++K EK+LS++KG LDY  F+DVDMVIEAVIENV LKQ+IF+D+E  CP H
Sbjct  361  SRVKKGKMTEEKLEKTLSLIKGVLDYESFKDVDMVIEAVIENVSLKQQIFADLETYCPPH  420

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            CILA+NTSTIDLN+IG++ +SQDRI+GAHFFSPAHVMPLLEIV T+KTS Q
Sbjct  421  CILASNTSTIDLNLIGERIKSQDRIVGAHFFSPAHVMPLLEIVCTQKTSPQ  471



>gb|ACN35901.1| unknown [Zea mays]
 gb|AFW80683.1| glyoxysomal fatty acid beta-oxidation multifunctional protein 
MFP-a [Zea mays]
Length=723

 Score =   243 bits (619),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 146/178 (82%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  I KVA++GGGLMGSGIATA++LSN  V+LKE+N ++L+ G+ 
Sbjct  292  RATSKIPGATDLGLMPRKITKVAILGGGLMGSGIATAMVLSNYPVLLKEVNEKFLTAGIN  351

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             I+ N++  V + K+ +++ EK++S++ G LDY  F+DVD+VIEAVIENV LKQ+IFSD+
Sbjct  352  RIQANLQSRVKKGKMTEERYEKAMSLVTGVLDYERFKDVDLVIEAVIENVKLKQQIFSDL  411

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CPSHCILATNTSTIDLN+IG++T++QDRI GAHFFSPAHVMPLLEIVRT+ TS Q
Sbjct  412  EKYCPSHCILATNTSTIDLNLIGEKTKAQDRIAGAHFFSPAHVMPLLEIVRTQHTSPQ  469



>ref|XP_007012079.1| Enoyl-CoA hydratase/isomerase family isoform 2 [Theobroma cacao]
 ref|XP_007012080.1| Enoyl-CoA hydratase/isomerase family isoform 2 [Theobroma cacao]
 gb|EOY29698.1| Enoyl-CoA hydratase/isomerase family isoform 2 [Theobroma cacao]
 gb|EOY29699.1| Enoyl-CoA hydratase/isomerase family isoform 2 [Theobroma cacao]
Length=716

 Score =   242 bits (618),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 142/178 (80%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D GLKP  I KV VIG GLMGSGI TAL+LSNI VVLKE+N EYL +G+K
Sbjct  292  RATSQVRGVTDAGLKPRPIGKVGVIGAGLMGSGITTALILSNIHVVLKELNSEYLQRGIK  351

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             IE N++ LV++ KL ++  +K+LS L+G  DYSEF+DVD+VIEAVIE++ LKQ IF +I
Sbjct  352  KIEANLQALVTKGKLDENGVKKALSFLRGVSDYSEFKDVDLVIEAVIEDLSLKQSIFEEI  411

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            +K CP HCILA+ TS IDLN IG++T SQDRI+GAHFFSPAH+MPLLEIVRTEKTS Q
Sbjct  412  DKVCPPHCILASGTSGIDLNKIGERTSSQDRIVGAHFFSPAHIMPLLEIVRTEKTSTQ  469



>ref|XP_009413815.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein-like isoform X2 [Musa acuminata subsp. malaccensis]
Length=682

 Score =   241 bits (616),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 139/168 (83%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            DVG++P  IK+VA+IGGGLMGSGIAT+L+L+N  V+LKEI+   L KGLK IE N++ LV
Sbjct  257  DVGIRPRKIKRVAIIGGGLMGSGIATSLILNNTPVILKEIDSNLLQKGLKMIEANLQSLV  316

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
             +     +K  K+L +L G LDYSEF++VDMVIEAV+E V LKQ IF++IEKACP HCI 
Sbjct  317  KKGSFTIEKMNKALPLLTGVLDYSEFKNVDMVIEAVVEKVSLKQSIFAEIEKACPPHCIF  376

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            ATNTSTIDL+I+G++T SQDRIIGAHFFSPAHVMPLLEIVRT+KTS Q
Sbjct  377  ATNTSTIDLHIVGEKTHSQDRIIGAHFFSPAHVMPLLEIVRTDKTSPQ  424



>ref|XP_007012081.1| Enoyl-CoA hydratase/isomerase family, putative isoform 4 [Theobroma 
cacao]
 gb|EOY29700.1| Enoyl-CoA hydratase/isomerase family, putative isoform 4 [Theobroma 
cacao]
Length=726

 Score =   242 bits (618),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 142/178 (80%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D GLKP  I KV VIG GLMGSGI TAL+LSNI VVLKE+N EYL +G+K
Sbjct  292  RATSQVRGVTDAGLKPRPIGKVGVIGAGLMGSGITTALILSNIHVVLKELNSEYLQRGIK  351

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             IE N++ LV++ KL ++  +K+LS L+G  DYSEF+DVD+VIEAVIE++ LKQ IF +I
Sbjct  352  KIEANLQALVTKGKLDENGVKKALSFLRGVSDYSEFKDVDLVIEAVIEDLSLKQSIFEEI  411

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            +K CP HCILA+ TS IDLN IG++T SQDRI+GAHFFSPAH+MPLLEIVRTEKTS Q
Sbjct  412  DKVCPPHCILASGTSGIDLNKIGERTSSQDRIVGAHFFSPAHIMPLLEIVRTEKTSTQ  469



>ref|XP_008784761.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like isoform X2 [Phoenix dactylifera]
Length=690

 Score =   241 bits (616),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 139/171 (81%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D+GL P  I+KVA++GGGLMGSGIATAL+LSN  V+LKE+N  +L  G+  ++ N++
Sbjct  266  GITDIGLTPRRIRKVAIVGGGLMGSGIATALILSNYLVILKEVNENFLQSGVGKVKANLQ  325

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
            G V ++K+ Q++  K+LS+L G LDY  F+DVDMVIEAVIENV LKQ+IFSD+EK CP H
Sbjct  326  GYVKKRKMTQEECGKALSLLIGVLDYEHFKDVDMVIEAVIENVSLKQQIFSDLEKYCPPH  385

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            CILA+NTSTIDLN IG++T SQDRI+GAHFFSPAHVMPLLEIV T  TS Q
Sbjct  386  CILASNTSTIDLNSIGEKTMSQDRIVGAHFFSPAHVMPLLEIVYTRTTSPQ  436



>ref|XP_008810214.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2 [Phoenix dactylifera]
Length=723

 Score =   242 bits (617),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 145/178 (81%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  I KVA++GGGLMGSGIATAL+LSN  V+LKE+N ++L  G+ 
Sbjct  293  RATSKVPGVTDLGLVPRKITKVAILGGGLMGSGIATALILSNYPVILKEVNEKFLKSGID  352

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             ++ N++  V++ K++Q+K E++LS+L G LDY  F+DVDMVIEAVIENV LKQ+IF+D+
Sbjct  353  RVKANLQSRVNKGKMSQEKCERTLSLLTGVLDYQLFKDVDMVIEAVIENVSLKQQIFADL  412

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK C  HCILATNTSTIDLN+IG++T SQDRI+GAHFFSPAH+MPLLEIVRT KTS Q
Sbjct  413  EKFCSPHCILATNTSTIDLNLIGEKTMSQDRIVGAHFFSPAHIMPLLEIVRTRKTSPQ  470



>ref|XP_009413814.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein-like isoform X1 [Musa acuminata subsp. malaccensis]
Length=725

 Score =   242 bits (617),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 139/168 (83%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            DVG++P  IK+VA+IGGGLMGSGIAT+L+L+N  V+LKEI+   L KGLK IE N++ LV
Sbjct  300  DVGIRPRKIKRVAIIGGGLMGSGIATSLILNNTPVILKEIDSNLLQKGLKMIEANLQSLV  359

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
             +     +K  K+L +L G LDYSEF++VDMVIEAV+E V LKQ IF++IEKACP HCI 
Sbjct  360  KKGSFTIEKMNKALPLLTGVLDYSEFKNVDMVIEAVVEKVSLKQSIFAEIEKACPPHCIF  419

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            ATNTSTIDL+I+G++T SQDRIIGAHFFSPAHVMPLLEIVRT+KTS Q
Sbjct  420  ATNTSTIDLHIVGEKTHSQDRIIGAHFFSPAHVMPLLEIVRTDKTSPQ  467



>ref|XP_004153517.1| PREDICTED: LOW QUALITY PROTEIN: glyoxysomal fatty acid beta-oxidation 
multifunctional protein MFP-a-like, partial [Cucumis 
sativus]
Length=350

 Score =   232 bits (592),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 137/171 (80%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D+GL P  I KVAVIGGGLMGSGIATAL+LSN  V+LKE+N ++L  GL  ++ N++
Sbjct  33   GVSDLGLTPRRINKVAVIGGGLMGSGIATALILSNYHVILKEVNEKFLEAGLGRVKANLQ  92

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V +  +  +K E+++S+LKG LDY  F+DVDMVIEAVIEN+ LKQ+I  D+EK CP H
Sbjct  93   SRVRKGTMTPEKFERTISLLKGVLDYESFKDVDMVIEAVIENISLKQQIIVDLEKYCPPH  152

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            CILATNTSTIDL++IG++T S DRI+GAHFFSPAHVMPLLE+VRT +T+ Q
Sbjct  153  CILATNTSTIDLDLIGEKTNSHDRIVGAHFFSPAHVMPLLEVVRTNRTAPQ  203



>ref|XP_004153595.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like, partial [Cucumis sativus]
Length=356

 Score =   233 bits (593),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 137/171 (80%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D+GL P  I KVAVIGGGLMGSGIATAL+LSN  V+LKE+N ++L  GL  ++ N++
Sbjct  151  GVSDLGLTPRRINKVAVIGGGLMGSGIATALILSNYPVILKEVNEKFLEAGLGRVKANLQ  210

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V +  +  +K E+++S+LKG LDY  F+DVDMVIEAVIEN+ LKQ+I  D+EK CP H
Sbjct  211  SRVRKGTMTPEKFERTISLLKGVLDYESFKDVDMVIEAVIENISLKQQIIVDLEKYCPPH  270

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            CILATNTSTIDL++IG++T S DRI+GAHFFSPAH+MPLLE+VRT +T+ Q
Sbjct  271  CILATNTSTIDLDLIGEKTNSHDRIVGAHFFSPAHIMPLLEVVRTNRTAPQ  321



>emb|CDM81353.1| unnamed protein product [Triticum aestivum]
 emb|CDM81375.1| unnamed protein product [Triticum aestivum]
Length=724

 Score =   241 bits (616),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  I KVA++GGGLMGSGIATA++LSN  V+LKE+N ++L  G+ 
Sbjct  292  RATSKVPGATDLGLMPRKITKVAILGGGLMGSGIATAMILSNYPVLLKEVNEKFLIAGID  351

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             I+ N++  V + K+ +++ EK++S+L GAL Y +F++VD+VIEAVIENV LKQ+IF+D+
Sbjct  352  RIKANLQSRVIKGKMTEERYEKAMSLLSGALGYEKFKEVDLVIEAVIENVKLKQQIFADL  411

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CPSHCILATNTSTIDLN+IG++T+SQDRI+GAHFFSPAHVMPLLEIVRT+ TSAQ
Sbjct  412  EKYCPSHCILATNTSTIDLNLIGEKTKSQDRIVGAHFFSPAHVMPLLEIVRTQHTSAQ  469



>ref|XP_010931678.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like [Elaeis guineensis]
Length=722

 Score =   241 bits (616),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 144/178 (81%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  I KVA++GGGLMGSGIATAL+LSN  V+LKE+N ++L  G+ 
Sbjct  291  RATSKVPGVTDLGLVPRKITKVAILGGGLMGSGIATALILSNYPVMLKEVNEKFLKAGID  350

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             ++ N++  V + K++Q+K E++LS+L G LDY  F+DVDMVIEAVIENV LKQ+IF+D+
Sbjct  351  RVKANLQSRVKKGKMSQEKFERTLSLLTGVLDYESFKDVDMVIEAVIENVSLKQQIFADL  410

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK C  HCILATNTSTIDLN+IG++T SQDRI+GAHFFSPAH+MPLLEIVRT KTS Q
Sbjct  411  EKFCSPHCILATNTSTIDLNLIGEKTMSQDRIVGAHFFSPAHIMPLLEIVRTHKTSPQ  468



>ref|NP_001152306.1| glyoxysomal fatty acid beta-oxidation multifunctional protein 
MFP-a [Zea mays]
 gb|ACG46924.1| glyoxysomal fatty acid beta-oxidation multifunctional protein 
MFP-a [Zea mays]
Length=723

 Score =   241 bits (616),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 145/178 (81%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  I KVA++GGGLMGSGIATA++LSN  V+LKE+N ++L+ G+ 
Sbjct  292  RATSKIPGATDLGLMPRKITKVAILGGGLMGSGIATAMVLSNYPVLLKEVNEKFLTAGIN  351

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             I+ N++  V + K+  ++ EK++S++ G LDY  F+DVD+VIEAVIENV LKQ+IFSD+
Sbjct  352  RIQANLQSRVRKGKMTDERYEKAMSLVTGVLDYERFKDVDLVIEAVIENVKLKQQIFSDL  411

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CPSHCILATNTSTIDLN+IG++T++QDRI GAHFFSPAHVMPLLEIVRT+ TS Q
Sbjct  412  EKYCPSHCILATNTSTIDLNLIGEKTKAQDRIAGAHFFSPAHVMPLLEIVRTQHTSPQ  469



>ref|XP_006489051.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2-like [Citrus sinensis]
Length=725

 Score =   241 bits (615),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 144/178 (81%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  +KKVA++GGGLMGSGIATAL+LSN  V+LKE+N ++L  G+ 
Sbjct  294  RGTSKVPGVTDLGLAPRRVKKVAILGGGLMGSGIATALILSNYPVILKEVNEKFLEAGIG  353

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             +  N++  V + K+ Q+K EK++S+LKG LDY  F+DVDMVIEAVIENV LKQ+IF+D+
Sbjct  354  RVRANLQSRVKKGKMTQEKFEKTMSLLKGVLDYESFKDVDMVIEAVIENVSLKQQIFADL  413

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK C  HCILA+NTSTIDLN+IG++T S+DRI+GAHFFSPAHVMPLLEIVRT +TS Q
Sbjct  414  EKYCLPHCILASNTSTIDLNLIGERTNSKDRIVGAHFFSPAHVMPLLEIVRTNQTSPQ  471



>ref|XP_006840485.1| hypothetical protein AMTR_s00045p00190660 [Amborella trichopoda]
 gb|ERN02160.1| hypothetical protein AMTR_s00045p00190660 [Amborella trichopoda]
Length=717

 Score =   241 bits (615),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 142/178 (80%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D+GL P  I KVA+IGGGLMGSGIATAL+LS   V++KE+N ++L  G+ 
Sbjct  292  RATSKVPGITDLGLMPRKIHKVAIIGGGLMGSGIATALILSGYPVLVKEVNAQFLQAGMD  351

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             ++ N++  V + K+ Q+K E++ S++KG LDY  FRDVDMVIEAVIE V LKQ+IF+D+
Sbjct  352  RVKANLQSRVKKGKMTQEKFERTFSLIKGVLDYESFRDVDMVIEAVIEKVSLKQQIFADL  411

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CP HC+LATNTSTIDLN+IGQQT S++RI+GAHFFSPAH+MPLLEIVR E+TS Q
Sbjct  412  EKYCPPHCVLATNTSTIDLNLIGQQTNSRERIVGAHFFSPAHIMPLLEIVRAERTSPQ  469



>ref|XP_007012078.1| Peroxisomal fatty acid beta-oxidation multifunctional protein, 
putative isoform 1 [Theobroma cacao]
 gb|EOY29697.1| Peroxisomal fatty acid beta-oxidation multifunctional protein, 
putative isoform 1 [Theobroma cacao]
Length=812

 Score =   242 bits (618),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 142/178 (80%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D GLKP  I KV VIG GLMGSGI TAL+LSNI VVLKE+N EYL +G+K
Sbjct  388  RATSQVRGVTDAGLKPRPIGKVGVIGAGLMGSGITTALILSNIHVVLKELNSEYLQRGIK  447

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             IE N++ LV++ KL ++  +K+LS L+G  DYSEF+DVD+VIEAVIE++ LKQ IF +I
Sbjct  448  KIEANLQALVTKGKLDENGVKKALSFLRGVSDYSEFKDVDLVIEAVIEDLSLKQSIFEEI  507

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            +K CP HCILA+ TS IDLN IG++T SQDRI+GAHFFSPAH+MPLLEIVRTEKTS Q
Sbjct  508  DKVCPPHCILASGTSGIDLNKIGERTSSQDRIVGAHFFSPAHIMPLLEIVRTEKTSTQ  565



>ref|XP_008390640.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like [Malus domestica]
Length=725

 Score =   241 bits (614),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 140/178 (79%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D GL P  + KVAVIGGGLMGSGIATAL+LS   V+LKE+N ++L  G+ 
Sbjct  294  RGTSKVPGVTDRGLMPRRVTKVAVIGGGLMGSGIATALILSGYPVILKEVNDKFLQAGIX  353

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             +  N++  V + K+ Q+K EK+ SILKG LDY  FRDVDMVIEAVIE V LKQ+IF+D+
Sbjct  354  RVRANLQSRVKKGKMXQEKFEKTTSILKGVLDYDSFRDVDMVIEAVIEKVSLKQQIFADL  413

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CP HCILA+NTSTIDLN+IG++T+S DRIIGAHFFSPAHVMPLLEIVRT +TS Q
Sbjct  414  EKYCPQHCILASNTSTIDLNLIGEKTKSHDRIIGAHFFSPAHVMPLLEIVRTNQTSPQ  471



>gb|KJB64950.1| hypothetical protein B456_010G073100 [Gossypium raimondii]
Length=557

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 151/168 (90%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            DVGLKP  +KKV +IGGG+MGSGIAT+L+LSNITV LKEIN EYL KG+KT+E N++ LV
Sbjct  131  DVGLKPNHVKKVGIIGGGIMGSGIATSLMLSNITVFLKEINSEYLLKGMKTVEANIQSLV  190

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            +R K+ QDKA K+LS+L+G  DYSEF+++DMVIEAVIE++PLKQ+IFS++EK C S CIL
Sbjct  191  ARGKVTQDKARKALSMLEGVSDYSEFKEMDMVIEAVIEDIPLKQEIFSELEKVCSSCCIL  250

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            ATNTS+IDL++IG++T+SQDRIIGAHFFSPAH+MPLLEI+RTEKTS Q
Sbjct  251  ATNTSSIDLSVIGEKTKSQDRIIGAHFFSPAHIMPLLEIIRTEKTSPQ  298



>gb|KJB64949.1| hypothetical protein B456_010G073100 [Gossypium raimondii]
Length=563

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 151/168 (90%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            DVGLKP  +KKV +IGGG+MGSGIAT+L+LSNITV LKEIN EYL KG+KT+E N++ LV
Sbjct  137  DVGLKPNHVKKVGIIGGGIMGSGIATSLMLSNITVFLKEINSEYLLKGMKTVEANIQSLV  196

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
            +R K+ QDKA K+LS+L+G  DYSEF+++DMVIEAVIE++PLKQ+IFS++EK C S CIL
Sbjct  197  ARGKVTQDKARKALSMLEGVSDYSEFKEMDMVIEAVIEDIPLKQEIFSELEKVCSSCCIL  256

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            ATNTS+IDL++IG++T+SQDRIIGAHFFSPAH+MPLLEI+RTEKTS Q
Sbjct  257  ATNTSSIDLSVIGEKTKSQDRIIGAHFFSPAHIMPLLEIIRTEKTSPQ  304



>emb|CAA55910.1| protein MFP-b [Cucumis sativus]
Length=633

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 140/171 (82%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D+GL P  IKKVA++GGGLMGSGIATAL+LSN  VVLKE+N ++L  G+  +  N++
Sbjct  209  GVTDLGLVPRQIKKVAIVGGGLMGSGIATALILSNYHVVLKEVNDKFLQAGIDRVRANLQ  268

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V +  +  +K EKS+S+LKG L+Y  F+DVDMVIEAVIENV LKQ+IFSD+EK CP H
Sbjct  269  SRVKKGNMTNEKFEKSISLLKGVLNYESFKDVDMVIEAVIENVSLKQQIFSDLEKYCPPH  328

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            C+LATNTSTIDL +IG++ +S+DRIIGAHFFSPAH+MPLLEIVRT+ T+AQ
Sbjct  329  CMLATNTSTIDLELIGERIKSRDRIIGAHFFSPAHIMPLLEIVRTKHTAAQ  379



>ref|XP_008340793.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like, partial [Malus domestica]
Length=721

 Score =   240 bits (612),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 140/179 (78%), Gaps = 0/179 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D GL P  + KVAVIGGGLMGSGIATAL+LS   V+LKE+N ++L  G+ 
Sbjct  290  RGTSKVPGVTDRGLMPRRVTKVAVIGGGLMGSGIATALILSGYPVILKEVNDKFLQAGIG  349

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             +  N++  V + K+ Q+K EK+ S+LKG LDY  FRDVDMVIEAVIE V LKQ+IF+D+
Sbjct  350  RVRANLQSRVKKGKMTQEKFEKTXSLLKGVLDYENFRDVDMVIEAVIEKVSLKQQIFADL  409

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQT  552
            EK CP HCILA+NTSTIDLN+IG++T+S DRIIGAHFFSPAHVMPLLEIVRT +TS Q 
Sbjct  410  EKYCPQHCILASNTSTIDLNLIGEKTKSHDRIIGAHFFSPAHVMPLLEIVRTNQTSPQA  468



>ref|XP_010547011.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a [Tarenaya hassleriana]
Length=725

 Score =   239 bits (611),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 141/178 (79%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D GL P  I KVA+IGGGLMGSGIAT  +LSN  V+LKE+N ++L  G+ 
Sbjct  294  RGTSKVPGVTDRGLVPRRINKVAIIGGGLMGSGIATVFILSNYQVILKEVNEKFLEVGIG  353

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             +  N++  V + K++Q+K EK++S+LKG LDY  FRDVDMVIEAVIEN+ LKQ+IF+D+
Sbjct  354  RVRANLQSRVKKGKMSQEKFEKTMSLLKGVLDYESFRDVDMVIEAVIENLSLKQQIFADL  413

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CP HCILA+NTSTIDLN IG++T+S DR+IGAHFFSPAHVMPLLEIVRT  TSAQ
Sbjct  414  EKYCPPHCILASNTSTIDLNKIGEKTKSPDRMIGAHFFSPAHVMPLLEIVRTNHTSAQ  471



>ref|XP_001780666.1| predicted protein [Physcomitrella patens]
 gb|EDQ54552.1| predicted protein [Physcomitrella patens]
Length=726

 Score =   239 bits (611),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 140/172 (81%), Gaps = 3/172 (2%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D GLKP  +K VAVIGGGLMGSGIATAL L+N+ V+LKE+N E+L  GLK IE NV 
Sbjct  302  GVTDSGLKPHKMKSVAVIGGGLMGSGIATALALNNVPVILKEVNQEFLQAGLKRIEANVN  361

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
               +R + A +KA+K LS +KG LDY++F DVDMVIEAVIE++PLKQ+IF+D+EK C S 
Sbjct  362  ---ARLRSASEKAQKVLSFVKGTLDYADFSDVDMVIEAVIESIPLKQQIFADLEKYCKST  418

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQT  552
            C+LA+NTSTIDL +IGQ+T+SQDRIIGAHFFSPAHVMPLLEIVRT  TS Q 
Sbjct  419  CLLASNTSTIDLGLIGQKTKSQDRIIGAHFFSPAHVMPLLEIVRTHDTSKQA  470



>ref|XP_004296857.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2 [Fragaria vesca subsp. vesca]
Length=725

 Score =   239 bits (610),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 141/178 (79%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D GL P  + KVAVIGGGLMGSGI TAL+LSN  V+LKE+N ++L  G+ 
Sbjct  294  RGTSKVPGITDRGLMPRRVTKVAVIGGGLMGSGITTALILSNYPVILKEVNEKFLQAGIG  353

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             ++ N++  V + K+  +K EK+ ++LKGALDY  FRDVDMVIEAVIE V LKQ+IF+D+
Sbjct  354  RVKANLQSRVKKGKMTPEKFEKTFALLKGALDYESFRDVDMVIEAVIEKVSLKQEIFADL  413

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CP HCILA+NTSTIDLN+IG++T+S DRIIGAHFFSPAH+MPLLEIVRT +TS Q
Sbjct  414  EKYCPQHCILASNTSTIDLNLIGEKTKSHDRIIGAHFFSPAHIMPLLEIVRTNRTSPQ  471



>ref|XP_008458418.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like [Cucumis melo]
Length=725

 Score =   239 bits (610),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 141/171 (82%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D+GL P  I KVAVIGGGLMGSGIAT L+LSN +V+LKE+N ++L  GL  ++ N++
Sbjct  301  GVSDLGLTPRRINKVAVIGGGLMGSGIATTLILSNYSVILKEVNEKFLEAGLGRVKANLQ  360

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V + K+  +K E+++S+LKG LDY  F+DVDMVIEAVIEN+ LKQ+IF D+EK CP H
Sbjct  361  SQVRKGKMTPEKFERTISLLKGVLDYESFKDVDMVIEAVIENISLKQQIFVDLEKYCPPH  420

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            CILATNTSTIDL++IG++T+S DRIIGAHFFSPAHVMPLLE+VRT++T+ Q
Sbjct  421  CILATNTSTIDLDLIGEKTKSHDRIIGAHFFSPAHVMPLLEVVRTKRTAPQ  471



>ref|XP_004148210.1| PREDICTED: LOW QUALITY PROTEIN: glyoxysomal fatty acid beta-oxidation 
multifunctional protein MFP-a-like [Cucumis sativus]
Length=713

 Score =   239 bits (609),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 140/171 (82%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D+GL P  IKKVA++GGGLMGSGIATAL+LSN  VVLKE+N ++L  G+  +  N++
Sbjct  301  GVTDLGLVPRQIKKVAIVGGGLMGSGIATALILSNYPVVLKEVNDKFLQAGIDRVRANLQ  360

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V +  +  +K EKS+S+LKG L+Y  F+DVDMVIEAVIENV LKQ+IFSD+EK CP H
Sbjct  361  SRVKKGNMTNEKFEKSISLLKGVLNYESFKDVDMVIEAVIENVSLKQQIFSDLEKYCPPH  420

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            C+LATNTSTIDL +IG++ +S+DRIIGAHFFSPAH+MPLLEIVRT+ T+AQ
Sbjct  421  CMLATNTSTIDLELIGERIKSRDRIIGAHFFSPAHIMPLLEIVRTKHTAAQ  471



>gb|KEH37224.1| glyoxysomal fatty acid beta-oxidation MFP-A protein [Medicago 
truncatula]
Length=721

 Score =   239 bits (609),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 146/178 (82%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   RPISVMLGTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLK  195
            R  S + G  D GL P  +KKVA++GGGLMGSGIATAL+LSN  V+LKE+N ++L  G+ 
Sbjct  290  RGTSKVPGVTDRGLVPRQVKKVAILGGGLMGSGIATALILSNYPVILKEVNEKFLEAGVN  349

Query  196  TIEGNVRGLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDI  375
             ++ N++  V + ++ ++K EK++S+LKG +DY  F+DVD+VIEAVIENV LKQ+IF+D+
Sbjct  350  RVKANLQSRVKKGQMTKEKFEKTISLLKGTIDYESFKDVDLVIEAVIENVVLKQQIFADL  409

Query  376  EKACPSHCILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            EK CP HCILA+NTSTIDLN+IG+ T+S+DRI+GAHFFSPAHVMPLLEIVRT++TS Q
Sbjct  410  EKYCPPHCILASNTSTIDLNLIGKNTKSEDRIVGAHFFSPAHVMPLLEIVRTKQTSPQ  467



>ref|XP_004168411.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like isoform 2 [Cucumis sativus]
 sp|Q39659.1|MFPA_CUCSA RecName: Full=Glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a; Includes: RecName: Full=Enoyl-CoA hydratase/3-2-trans-enoyl-CoA 
isomerase/3-hydroxybutyryl-CoA epimerase; 
Includes: RecName: Full=3-hydroxyacyl-CoA dehydrogenase 
[Cucumis sativus]
 emb|CAA55630.1| tetrafunctional protein [Cucumis sativus]
Length=725

 Score =   239 bits (609),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 140/171 (82%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D+GL P  IKKVA++GGGLMGSGIATAL+LSN  VVLKE+N ++L  G+  +  N++
Sbjct  301  GVTDLGLVPRQIKKVAIVGGGLMGSGIATALILSNYHVVLKEVNDKFLQAGIDRVRANLQ  360

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V +  +  +K EKS+S+LKG L+Y  F+DVDMVIEAVIENV LKQ+IFSD+EK CP H
Sbjct  361  SRVKKGNMTNEKFEKSISLLKGVLNYESFKDVDMVIEAVIENVSLKQQIFSDLEKYCPPH  420

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            C+LATNTSTIDL +IG++ +S+DRIIGAHFFSPAH+MPLLEIVRT+ T+AQ
Sbjct  421  CMLATNTSTIDLELIGERIKSRDRIIGAHFFSPAHIMPLLEIVRTKHTAAQ  471



>ref|XP_010921650.1| PREDICTED: LOW QUALITY PROTEIN: glyoxysomal fatty acid beta-oxidation 
multifunctional protein MFP-a-like [Elaeis guineensis]
Length=720

 Score =   238 bits (608),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 139/168 (83%), Gaps = 0/168 (0%)
 Frame = +1

Query  46   DVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVRGLV  225
            D+GLKP  I KVA+IGGGLMGSGIATAL+LSN  V+LKE+N  +L  G+  ++ N++G V
Sbjct  298  DIGLKPRGIHKVAIIGGGLMGSGIATALILSNFLVILKEVNENFLQSGIGRVKANLQGHV  357

Query  226  SRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSHCIL  405
             + K+ Q++  K++S+L G  DY  F+DVDMVIEAVIENV LKQ+IF+D+EK C  HCIL
Sbjct  358  KKGKMTQEECGKAISLLIGVHDYEHFKDVDMVIEAVIENVSLKQQIFADLEKYCSPHCIL  417

Query  406  ATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            A+NTSTIDLN IG++T SQDRI+GAHFFSPAHVMPLLEIVRT+KTS+Q
Sbjct  418  ASNTSTIDLNSIGEKTMSQDRIVGAHFFSPAHVMPLLEIVRTQKTSSQ  465



>ref|XP_008458439.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a [Cucumis melo]
Length=725

 Score =   238 bits (608),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 141/171 (82%), Gaps = 0/171 (0%)
 Frame = +1

Query  37   GTLDVGLKPTSIKKVAVIGGGLMGSGIATALLLSNITVVLKEINPEYLSKGLKTIEGNVR  216
            G  D+GL P  IKKVA++GGGLMGSGIATAL+LS+  VVLKE+N ++L  G+  +  N++
Sbjct  301  GVTDLGLVPRQIKKVAIVGGGLMGSGIATALILSDYHVVLKEVNDKFLQAGIDRVRANLQ  360

Query  217  GLVSRKKLAQDKAEKSLSILKGALDYSEFRDVDMVIEAVIENVPLKQKIFSDIEKACPSH  396
              V +  + ++K EK++S+LKG LDY  F+DVDMVIEAVIENV LKQ+IFSD+EK CP H
Sbjct  361  SRVKKGNMTKEKFEKTISLLKGVLDYESFKDVDMVIEAVIENVSLKQQIFSDLEKYCPPH  420

Query  397  CILATNTSTIDLNIIGQQTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQ  549
            C+LATNTSTIDL +IG++ +S+DRIIGAHFFSPAHVMPLLEIVRT+ T+AQ
Sbjct  421  CMLATNTSTIDLELIGERIKSRDRIIGAHFFSPAHVMPLLEIVRTKHTAAQ  471



Lambda      K        H        a         alpha
   0.317    0.135    0.366    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 603802497760