BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS094C05

Length=609
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009592686.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    197   6e-55   Nicotiana tomentosiformis
ref|XP_009592687.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    196   1e-54   Nicotiana tomentosiformis
gb|AIM41270.1|  chloroplast ATP-dependent Clp protease chaperone ...    193   2e-53   Nicotiana benthamiana
gb|AIM41271.1|  chloroplast ATP-dependent Clp protease chaperone ...    193   2e-53   Nicotiana benthamiana
ref|XP_009615664.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    192   6e-53   Nicotiana tomentosiformis
ref|XP_009769540.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    192   6e-53   Nicotiana sylvestris
ref|XP_009798134.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    192   8e-53   Nicotiana sylvestris
gb|AIM41268.1|  chloroplast ATP-dependent Clp protease chaperone ...    190   2e-52   Nicotiana benthamiana
ref|XP_006346636.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    187   3e-51   Solanum tuberosum [potatoes]
ref|XP_004252280.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    187   3e-51   
sp|P31542.1|CLPAB_SOLLC  RecName: Full=ATP-dependent Clp protease...    186   8e-51   Solanum lycopersicum
ref|XP_004297496.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    181   6e-49   Fragaria vesca subsp. vesca
gb|AIM41269.1|  chloroplast ATP-dependent Clp protease chaperone ...    181   8e-49   Nicotiana benthamiana
ref|XP_004171086.1|  PREDICTED: chaperone protein ClpC, chloropla...    175   3e-48   
ref|XP_008464372.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    178   7e-48   Cucumis melo [Oriental melon]
gb|ADN33858.1|  ATP-dependent clp protease                              178   7e-48   Cucumis melo subsp. melo
ref|XP_010099042.1|  Chaperone protein ClpC                             174   1e-47   
ref|XP_004138021.1|  PREDICTED: chaperone protein ClpC, chloropla...    175   8e-47   
ref|XP_008239551.1|  PREDICTED: chaperone protein ClpC, chloropla...    175   1e-46   Prunus mume [ume]
emb|CBI15747.3|  unnamed protein product                                173   2e-46   Vitis vinifera
ref|XP_007210385.1|  hypothetical protein PRUPE_ppa001062mg             173   5e-46   Prunus persica
emb|CDO98310.1|  unnamed protein product                                173   5e-46   Coffea canephora [robusta coffee]
sp|P31541.1|CLPAA_SOLLC  RecName: Full=ATP-dependent Clp protease...    172   1e-45   Solanum lycopersicum
ref|XP_004235839.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    172   1e-45   
ref|XP_006341485.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    171   2e-45   Solanum tuberosum [potatoes]
ref|XP_010663794.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    170   5e-45   Vitis vinifera
gb|KDP22549.1|  hypothetical protein JCGZ_26380                         170   6e-45   Jatropha curcas
gb|KHG07735.1|  Chaperone ClpC, chloroplastic                           167   3e-44   Gossypium arboreum [tree cotton]
gb|KJB19711.1|  hypothetical protein B456_003G116200                    166   5e-44   Gossypium raimondii
ref|XP_008457503.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    167   6e-44   Cucumis melo [Oriental melon]
ref|XP_007038115.1|  CLPC                                               166   1e-43   
gb|KJB19712.1|  hypothetical protein B456_003G116200                    166   2e-43   Gossypium raimondii
ref|XP_004152900.1|  PREDICTED: chaperone protein ClpC, chloropla...    166   2e-43   Cucumis sativus [cucumbers]
ref|XP_002511102.1|  ATP-dependent clp protease, putative               166   2e-43   Ricinus communis
gb|KJB19710.1|  hypothetical protein B456_003G116200                    166   2e-43   Gossypium raimondii
ref|XP_006367832.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    165   3e-43   Solanum tuberosum [potatoes]
gb|EPS63111.1|  hypothetical protein M569_11677                         154   4e-43   Genlisea aurea
gb|AAD02267.1|  ClpC protease                                           164   6e-43   Spinacia oleracea
gb|KJB07945.1|  hypothetical protein B456_001G054700                    162   4e-42   Gossypium raimondii
ref|XP_010678345.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    160   1e-41   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH35688.1|  ATP-dependent Clp protease ATP-binding subunit          160   1e-41   Medicago truncatula
gb|KCW48520.1|  hypothetical protein EUGRSUZ_K02198                     157   2e-41   Eucalyptus grandis [rose gum]
gb|EYU24516.1|  hypothetical protein MIMGU_mgv1a0010411mg               153   1e-40   Erythranthe guttata [common monkey flower]
ref|XP_004501745.1|  PREDICTED: chaperone protein ClpC, chloropla...    157   2e-40   Cicer arietinum [garbanzo]
ref|XP_010036862.1|  PREDICTED: chaperone protein ClpC, chloropla...    157   2e-40   Eucalyptus grandis [rose gum]
ref|XP_010036860.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    157   2e-40   Eucalyptus grandis [rose gum]
ref|XP_007159971.1|  hypothetical protein PHAVU_002G282500g             156   3e-40   Phaseolus vulgaris [French bean]
ref|XP_003526929.1|  PREDICTED: chaperone protein ClpC, chloropla...    156   3e-40   Glycine max [soybeans]
ref|XP_002322299.1|  ATP-dependent clp protease ATP-binding subun...    156   4e-40   
ref|XP_010249192.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    156   5e-40   Nelumbo nucifera [Indian lotus]
gb|KHN31263.1|  Chaperone protein ClpC, chloroplastic                   155   7e-40   Glycine soja [wild soybean]
ref|XP_003523172.1|  PREDICTED: chaperone protein ClpC, chloropla...    155   7e-40   Glycine max [soybeans]
sp|P35100.1|CLPC_PEA  RecName: Full=Chaperone protein ClpC, chlor...    155   1e-39   Pisum sativum [garden pea]
ref|XP_009368798.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    155   1e-39   Pyrus x bretschneideri [bai li]
ref|XP_008374277.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    155   1e-39   
ref|XP_009337515.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    155   1e-39   Pyrus x bretschneideri [bai li]
ref|XP_006376920.1|  hypothetical protein POPTR_0012s10770g             155   1e-39   
ref|XP_011042955.1|  PREDICTED: chaperone protein ClpC, chloropla...    154   2e-39   Populus euphratica
ref|XP_003630582.1|  ATP-dependent Clp protease ATP-binding subun...    153   4e-39   Medicago truncatula
ref|XP_008778670.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    143   9e-39   Phoenix dactylifera
ref|XP_010519480.1|  PREDICTED: chaperone protein ClpC1, chloropl...    152   1e-38   Tarenaya hassleriana [spider flower]
ref|XP_007137864.1|  hypothetical protein PHAVU_009G162100g             152   2e-38   Phaseolus vulgaris [French bean]
ref|XP_006402040.1|  hypothetical protein EUTSA_v10012603mg             152   2e-38   Eutrema salsugineum [saltwater cress]
ref|XP_008392716.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    151   3e-38   Malus domestica [apple tree]
ref|NP_568746.1|  ATP-dependent Clp protease ATP-binding subunit ...    151   3e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010250552.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    151   3e-38   Nelumbo nucifera [Indian lotus]
ref|XP_011040255.1|  PREDICTED: chaperone protein ClpC, chloropla...    150   8e-38   Populus euphratica
ref|XP_002865831.1|  heat shock protein 93-V                            149   1e-37   
ref|XP_010250553.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    149   1e-37   Nelumbo nucifera [Indian lotus]
ref|XP_003525431.1|  PREDICTED: chaperone protein ClpC, chloropla...    149   1e-37   Glycine max [soybeans]
gb|KEH35794.1|  ATP-dependent Clp protease ATP-binding subunit          149   2e-37   Medicago truncatula
gb|AAC04687.1|  ClpC                                                    147   4e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006279971.1|  hypothetical protein CARUB_v10025837mg             147   5e-37   Capsella rubella
ref|XP_010550758.1|  PREDICTED: chaperone protein ClpC1, chloropl...    147   8e-37   Tarenaya hassleriana [spider flower]
emb|CDX83052.1|  BnaA01g20520D                                          146   1e-36   
ref|XP_009151567.1|  PREDICTED: chaperone protein ClpC2, chloropl...    146   1e-36   Brassica rapa
gb|KHN16879.1|  Chaperone protein ClpC, chloroplastic                   146   1e-36   Glycine soja [wild soybean]
ref|XP_003532383.1|  PREDICTED: chaperone protein ClpC, chloropla...    146   2e-36   Glycine max [soybeans]
ref|XP_011083076.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    146   2e-36   
ref|XP_010942381.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    145   2e-36   Elaeis guineensis
ref|XP_010482409.1|  PREDICTED: chaperone protein ClpC1, chloropl...    145   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010442575.1|  PREDICTED: chaperone protein ClpC1, chloropl...    145   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010555578.1|  PREDICTED: chaperone protein ClpC1, chloropl...    145   3e-36   Tarenaya hassleriana [spider flower]
ref|XP_010442573.1|  PREDICTED: chaperone protein ClpC1, chloropl...    145   4e-36   
ref|XP_010426385.1|  PREDICTED: chaperone protein ClpC2, chloropl...    144   7e-36   Camelina sativa [gold-of-pleasure]
ref|XP_002877635.1|  AtClpC                                             144   8e-36   
ref|XP_006290258.1|  hypothetical protein CARUB_v10016640mg             143   8e-36   
ref|XP_010536586.1|  PREDICTED: chaperone protein ClpC1, chloropl...    144   8e-36   Tarenaya hassleriana [spider flower]
ref|XP_010536587.1|  PREDICTED: chaperone protein ClpC1, chloropl...    144   8e-36   Tarenaya hassleriana [spider flower]
gb|EYU21822.1|  hypothetical protein MIMGU_mgv1a000973mg                144   8e-36   Erythranthe guttata [common monkey flower]
ref|XP_004503801.1|  PREDICTED: chaperone protein ClpC, chloropla...    144   1e-35   Cicer arietinum [garbanzo]
ref|XP_006290259.1|  hypothetical protein CARUB_v10016640mg             143   2e-35   
emb|CDX68504.1|  BnaC01g25820D                                          142   3e-35   
ref|XP_011073186.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    142   4e-35   Sesamum indicum [beniseed]
ref|XP_010503529.1|  PREDICTED: chaperone protein ClpC2, chloropl...    142   6e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010515218.1|  PREDICTED: chaperone protein ClpC2, chloropl...    140   2e-34   Camelina sativa [gold-of-pleasure]
ref|XP_008791045.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    140   2e-34   Phoenix dactylifera
emb|CDY45800.1|  BnaC03g16230D                                          139   5e-34   Brassica napus [oilseed rape]
ref|XP_009132682.1|  PREDICTED: chaperone protein ClpC1, chloropl...    139   5e-34   Brassica rapa
ref|XP_008811697.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    139   5e-34   Phoenix dactylifera
ref|XP_009149790.1|  PREDICTED: LOW QUALITY PROTEIN: chaperone pr...    137   2e-33   
ref|XP_006485108.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    137   2e-33   Citrus sinensis [apfelsine]
gb|AAL10478.1|  AT3g48870/T21J18_140                                    134   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009387981.1|  PREDICTED: chaperone protein ClpC1, chloropl...    136   5e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009393873.1|  PREDICTED: chaperone protein ClpC1, chloropl...    136   5e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403788.1|  PREDICTED: chaperone protein ClpC1, chloropl...    135   8e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001190035.1|  Clp ATPase                                         134   2e-32   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566912.2|  Clp ATPase                                            134   2e-32   Arabidopsis thaliana [mouse-ear cress]
emb|CAB87915.1|  AtClpC                                                 134   2e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010929657.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    134   3e-32   Elaeis guineensis
ref|XP_006404210.1|  hypothetical protein EUTSA_v10010105mg             134   3e-32   Eutrema salsugineum [saltwater cress]
ref|XP_010921845.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    131   2e-31   Elaeis guineensis
ref|XP_009411804.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    130   6e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009404743.1|  PREDICTED: chaperone protein ClpC1, chloropl...    129   9e-31   Musa acuminata subsp. malaccensis [pisang utan]
tpg|DAA38057.1|  TPA: hypothetical protein ZEAMMB73_563254              122   1e-30   
emb|CDY05878.1|  BnaC08g20550D                                          129   2e-30   
ref|XP_003575035.1|  PREDICTED: chaperone protein ClpC1, chloropl...    125   5e-29   Brachypodium distachyon [annual false brome]
sp|P46523.1|CLPA_BRANA  RecName: Full=ATP-dependent Clp protease ...    124   6e-29   Brassica napus [oilseed rape]
ref|XP_003575034.2|  PREDICTED: chaperone protein ClpC1, chloropl...    124   7e-29   Brachypodium distachyon [annual false brome]
emb|CAN78847.1|  hypothetical protein VITISV_010724                     124   9e-29   Vitis vinifera
gb|EMS54417.1|  ATP-dependent Clp protease ATP-binding subunit cl...    120   1e-28   Triticum urartu
gb|EMT20100.1|  ATP-dependent Clp protease ATP-binding subunit cl...    119   6e-28   
gb|EMS48250.1|  ATP-dependent Clp protease ATP-binding subunit cl...    116   6e-28   Triticum urartu
ref|XP_004975454.1|  PREDICTED: chaperone protein ClpC1, chloropl...    121   9e-28   Setaria italica
ref|XP_004975455.1|  PREDICTED: chaperone protein ClpC1, chloropl...    121   9e-28   Setaria italica
gb|KGN63436.1|  hypothetical protein Csa_1G000600                       120   1e-27   Cucumis sativus [cucumbers]
gb|EMS46268.1|  ATP-dependent Clp protease ATP-binding subunit cl...    120   1e-27   Triticum urartu
ref|XP_008663153.1|  PREDICTED: chaperone protein ClpC1, chloropl...    120   1e-27   Zea mays [maize]
ref|XP_001690745.1|  hypothetical protein CHLREDRAFT_110360             110   5e-27   Chlamydomonas reinhardtii
ref|XP_002447724.1|  hypothetical protein SORBIDRAFT_06g014590          119   5e-27   Sorghum bicolor [broomcorn]
gb|EEC77204.1|  hypothetical protein OsI_15716                          118   8e-27   Oryza sativa Indica Group [Indian rice]
ref|XP_010238595.1|  PREDICTED: chaperone protein ClpC2, chloropl...    118   1e-26   Brachypodium distachyon [annual false brome]
sp|Q7F9I1.2|CLPC1_ORYSJ  RecName: Full=Chaperone protein ClpC1, c...    118   1e-26   Oryza sativa Japonica Group [Japonica rice]
emb|CAE05148.2|  OSJNBa0039C07.4                                        117   1e-26   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ30583.1|  hypothetical protein OsJ_14634                          118   1e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006652229.1|  PREDICTED: chaperone protein ClpC1, chloropl...    117   2e-26   
ref|XP_006663917.1|  PREDICTED: chaperone protein ClpC2, chloropl...    117   2e-26   Oryza brachyantha
dbj|BAJ99801.1|  predicted protein                                      117   2e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|WP_032554674.1|  hypothetical protein                               107   4e-26   
ref|XP_004960741.1|  PREDICTED: chaperone protein ClpC2, chloropl...    116   5e-26   Setaria italica
ref|WP_032558761.1|  hypothetical protein                               107   6e-26   
ref|NP_001169540.1|  uncharacterized protein LOC100383416               115   6e-26   Zea mays [maize]
ref|WP_032553896.1|  hypothetical protein                               107   9e-26   
gb|KIY94281.1|  ATP-dependent Clp protease ATP-binding subunit ClpC     111   1e-25   Monoraphidium neglectum
ref|XP_001756645.1|  predicted protein                                  115   1e-25   
ref|NP_001066442.1|  Os12g0230100                                       114   1e-25   
gb|EEC69045.1|  hypothetical protein OsI_37876                          115   2e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_001779162.1|  predicted protein                                  114   2e-25   
ref|XP_002977161.1|  hypothetical protein SELMODRAFT_176012             113   4e-25   
gb|EDZ93048.1|  Clp domain protein                                      110   4e-25   Arthrospira maxima CS-328
ref|XP_002952540.1|  hypothetical protein VOLCADRAFT_75431              113   6e-25   Volvox carteri f. nagariensis
gb|AAB67745.1|  ClpC                                                    112   8e-25   Synechococcus elongatus PCC 7942
dbj|BAD79443.1|  ATP-dependent Clp protease regulatory subunit ClpC     112   8e-25   Synechococcus elongatus PCC 6301
gb|AFW96628.1|  ATP-dependent Clp family protein                        112   9e-25   Anabaena sp. 90
gb|KIZ07494.1|  ATP-dependent Clp protease ATP-binding subunit ClpC     112   9e-25   Monoraphidium neglectum
dbj|BAB74698.1|  endopeptidase Clp ATP-binding chain                    112   1e-24   Nostoc sp. PCC 7120
gb|AFY46028.1|  ATPase with chaperone activity, ATP-binding subunit     112   1e-24   Nostoc sp. PCC 7524
ref|XP_010446016.1|  PREDICTED: chaperone protein ClpC1, chloropl...    110   1e-24   
ref|XP_002965312.1|  hypothetical protein SELMODRAFT_439163             112   1e-24   Selaginella moellendorffii
gb|EHC12174.1|  ATPase AAA-2 domain protein                             112   1e-24   Fischerella thermalis
gb|ABK95905.1|  unknown                                                 112   1e-24   Populus trichocarpa [western balsam poplar]
ref|XP_006374569.1|  hypothetical protein POPTR_0015s11640g             112   1e-24   
ref|WP_044105586.1|  Clp protease ClpX                                  111   1e-24   cyanobacterium endosymbiont of Epithemia turgida
emb|CDX84888.1|  BnaA03g13420D                                          111   2e-24   
ref|WP_015162264.1|  ATPase with chaperone activity, ATP-binding ...    111   2e-24   Chamaesiphon minutus
gb|EMT29575.1|  ATP-dependent Clp protease ATP-binding subunit cl...    111   2e-24   
ref|WP_007100194.1|  ATP-dependent Clp protease ATP-binding protein     111   2e-24   Synechococcus sp. RS9917
ref|WP_038544339.1|  Clp protease ClpX                                  111   2e-24   Synechococcus sp. KORDI-100
ref|WP_028951828.1|  Clp protease ClpX                                  111   2e-24   Synechococcus sp. CC9616
ref|WP_015107874.1|  chaperone ATPase                                   111   2e-24   Cyanobium gracile
ref|WP_039899756.1|  Clp protease ClpX                                  110   2e-24   Microcystis sp. T1-4
ref|WP_011127803.1|  ATP-dependent Clp protease ATP-binding protein     111   2e-24   Synechococcus
ref|WP_010317861.1|  ATP-dependent Clp protease ATP-binding protein     111   2e-24   Synechococcus sp. CB0205
gb|AHF63374.1|  ATPase                                                  111   2e-24   Synechococcus sp. WH 8109
ref|WP_041428551.1|  Clp protease ClpX                                  111   2e-24   Synechococcus sp. WH 7803
ref|WP_007098208.1|  ATP-dependent Clp protease ATP-binding protein     111   2e-24   Synechococcus sp. RS9916
ref|WP_043691512.1|  Clp protease ClpX                                  111   2e-24   Synechococcus sp. KORDI-49
ref|WP_006852318.1|  ATP-dependent Clp protease ATP-binding protein     111   2e-24   Synechococcus sp. WH 8016
ref|WP_012162462.1|  ATP-dependent Clp protease ATP-binding protein     111   2e-24   Acaryochloris marina
ref|WP_010467511.1|  ATP-dependent Clp protease ATP-binding protein     110   3e-24   Acaryochloris sp. CCMEE 5410
ref|WP_038554285.1|  Clp protease ClpX                                  111   3e-24   Synechococcus sp. KORDI-52
ref|WP_011364587.1|  ATP-dependent Clp protease ATP-binding protein     111   3e-24   Synechococcus sp. CC9605
ref|WP_006170858.1|  ATP-dependent Clp protease ATP-binding protein     111   3e-24   Synechococcus sp. WH 5701
ref|WP_041555480.1|  Clp protease ClpX                                  110   3e-24   Nostoc sp. PCC 7524
ref|WP_006041704.1|  ATP-dependent Clp protease ATP-binding protein     110   3e-24   Synechococcus sp. WH 7805
ref|YP_001293474.1|  Clp protease ATP binding subunit                   110   3e-24   Rhodomonas salina
ref|WP_008226206.1|  ATP-dependent Clp protease, ATP-binding subu...    110   3e-24   Richelia intracellularis
ref|WP_002777520.1|  ATP-dependent Clp protease ATP-binding protein     110   3e-24   Microcystis aeruginosa
ref|NP_050661.1|  Clp protease ATP binding subunit                      110   3e-24   Guillardia theta
ref|WP_004158851.1|  ATP-dependent Clp protease ATP-binding protein     110   3e-24   Microcystis aeruginosa
ref|WP_006910091.1|  ATP-dependent Clp protease ATP-binding protein     110   3e-24   Cyanobium sp. PCC 7001
ref|WP_044521582.1|  Clp protease ClpX                                  110   3e-24   Nostocaceae
ref|WP_016952177.1|  ATP-dependent Clp protease ATP-binding protein     110   3e-24   Anabaena sp. PCC 7108
ref|WP_010303504.1|  ATP-dependent Clp protease ATP-binding protein     110   3e-24   Synechococcus sp. CB0101
ref|WP_029638478.1|  Clp protease ClpX [                                110   3e-24   [Scytonema hofmanni] UTEX B 1581
ref|WP_011935205.1|  ATP-dependent Clp protease ATP-binding protein     110   3e-24   Synechococcus sp. RCC307
ref|WP_004160623.1|  ATP-dependent Clp protease ATP-binding subun...    110   3e-24   Microcystis
ref|WP_002732350.1|  ATP-dependent Clp protease ATP-binding protein     110   3e-24   Microcystis aeruginosa
ref|WP_008231833.1|  ATP-dependent Clp protease, ATP-binding subu...    110   3e-24   Richelia intracellularis
ref|WP_027404746.1|  Clp protease ClpX                                  110   3e-24   Aphanizomenon flos-aquae
ref|WP_011317764.1|  ATP-dependent Clp protease ATP-binding protein     110   3e-24   Trichormus variabilis
ref|WP_002765002.1|  ATP-dependent Clp protease ATP-binding protein     110   3e-24   Microcystis aeruginosa
ref|WP_039200429.1|  Clp protease ClpX                                  110   3e-24   Aphanizomenon flos-aquae
ref|WP_037222416.1|  Clp protease ClpX                                  110   3e-24   
ref|WP_023074118.1|  atp-dependent clp protease atp-binding protein     110   3e-24   Leptolyngbya sp. Heron Island J
ref|WP_015111477.1|  ATPase                                             110   3e-24   Nostoc sp. PCC 7107
ref|WP_009626822.1|  ATPase AAA-2 domain protein                        110   3e-24   Pseudanabaena biceps
ref|WP_013192942.1|  ATP-dependent Clp protease ATP-binding protein     110   3e-24   Trichormus azollae
ref|WP_006454749.1|  ATP-dependent Clp protease ATP-binding protein     110   3e-24   Synechococcus sp. PCC 7335
ref|WP_023174246.1|  ATPase AAA-2 domain protein                        110   3e-24   Gloeobacter kilaueensis
ref|WP_012412218.1|  ATP-dependent Clp protease ATP-binding protein     110   3e-24   Nostoc punctiforme
ref|WP_006518530.1|  ATPase with chaperone activity, ATP-binding ...    110   3e-24   Leptolyngbya sp. PCC 7375
gb|KIE07407.1|  Clp protease ClpX                                       110   3e-24   Tolypothrix bouteillei VB521301
ref|WP_011618961.1|  ATP-dependent Clp protease ATP-binding protein     110   3e-24   Synechococcus sp. CC9311
ref|WP_039740335.1|  Clp protease ClpX                                  110   3e-24   
ref|WP_028090149.1|  Clp protease ClpX                                  110   3e-24   Dolichospermum circinale
ref|WP_028082153.1|  Clp protease ClpX                                  110   3e-24   Dolichospermum circinale
ref|WP_012630051.1|  ATP-dependent Clp protease ATP-binding protein     110   3e-24   Cyanothece sp. PCC 7425
ref|WP_019498394.1|  ATP-dependent Clp protease ATP-binding protein     110   3e-24   Pseudanabaena sp. PCC 6802
ref|WP_006198453.1|  ATP-dependent Clp protease ATP-binding protein     110   3e-24   Nodularia spumigena
ref|WP_015126250.1|  chaperone ATPase                                   110   3e-24   Synechococcus sp. PCC 6312
ref|WP_015189078.1|  ATPase AAA-2 domain protein                        110   3e-24   Gloeocapsa sp. PCC 7428
ref|WP_022603946.1|  ATPase with chaperone activity, ATP-binding ...    110   3e-24   Rubidibacter lacunae
ref|WP_041458572.1|  Clp protease ClpX                                  110   3e-24   Anabaena sp. 90
ref|WP_015128787.1|  ATPase                                             110   3e-24   Calothrix sp. PCC 7507
gb|AGW80480.1|  Clp protease ATP binding subunit                        110   3e-24   Planktothrix agardhii NIVA-CYA 68
ref|WP_036485541.1|  Clp protease ClpX                                  110   3e-24   Myxosarcina sp. GI1
ref|WP_017318713.1|  ATP-dependent Clp protease ATP-binding protein     110   3e-24   Mastigocladopsis repens
ref|WP_015166859.1|  chaperone ATPase                                   110   3e-24   Synechococcus sp. PCC 7502
ref|WP_015206692.1|  ATPase with chaperone activity, ATP-binding ...    110   3e-24   Cylindrospermum stagnale
ref|WP_026795885.1|  MULTISPECIES: Clp protease ClpX                    110   3e-24   Planktothrix
ref|WP_009342297.1|  ATP-dependent Clp protease ATP-binding protein     110   3e-24   Aphanizomenonaceae
ref|WP_006277610.1|  ATP-dependent Clp protease ATP-binding protein     110   3e-24   Aphanizomenonaceae
ref|WP_017712666.1|  ATP-dependent Clp protease ATP-binding protein     110   3e-24   Prochlorothrix hollandica
ref|WP_042153862.1|  Clp protease ClpX                                  110   3e-24   Planktothrix agardhii
ref|WP_015185589.1|  chaperone ATPase                                   110   3e-24   Microcoleus sp. PCC 7113
ref|WP_017293405.1|  ATP-dependent Clp protease ATP-binding protein     110   3e-24   Geminocystis herdmanii
ref|WP_015166218.1|  ATPase                                             110   3e-24   Pseudanabaena sp. PCC 7367
ref|WP_017717294.1|  ATP-dependent Clp protease ATP-binding protein     110   4e-24   Oscillatoria sp. PCC 10802
ref|WP_027250152.1|  Clp protease ClpX                                  110   4e-24   Planktothrix agardhii
ref|WP_026785489.1|  MULTISPECIES: Clp protease ClpX                    110   4e-24   Planktothrix
ref|WP_041035515.1|  Clp protease ClpX                                  110   4e-24   Tolypothrix campylonemoides
ref|WP_011377512.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    110   4e-24   Synechococcus
ref|WP_015216290.1|  ATPase AAA-2 domain protein                        110   4e-24   Anabaena cylindrica
ref|WP_023066904.1|  istB-like ATP binding family protein               110   4e-24   Lyngbya aestuarii
ref|WP_027842712.1|  Clp protease ClpX                                  110   4e-24   Mastigocoleus testarum
ref|WP_008274497.1|  ATP-dependent Clp protease ATP-binding protein     110   4e-24   Cyanothece sp. CCY0110
ref|WP_015117004.1|  chaperone ATPase                                   110   4e-24   Rivularia sp. PCC 7116
ref|WP_015201320.1|  ATPase                                             110   4e-24   Crinalium epipsammum
gb|KIJ80614.1|  Clp protease ClpX                                       110   4e-24   Scytonema tolypothrichoides VB-61278
ref|WP_015227883.1|  chaperone ATPase                                   110   4e-24   Dactylococcopsis salina
ref|WP_009784332.1|  ATP-dependent Clp protease ATP-binding protein     110   4e-24   Lyngbya sp. PCC 8106
ref|WP_016879619.1|  ATP-dependent Clp protease ATP-binding protein     110   4e-24   Chlorogloeopsis fritschii
ref|WP_015191669.1|  ATPase AAA-2 domain protein                        110   4e-24   Stanieria cyanosphaera
ref|WP_017741509.1|  ATP-dependent Clp protease ATP-binding protein     110   4e-24   Scytonema hofmannii
ref|WP_036000319.1|  Clp protease ClpX                                  110   4e-24   [Leptolyngbya] sp. JSC-1
ref|WP_026097796.1|  Clp protease ClpX                                  110   4e-24   Geitlerinema sp. PCC 7105
ref|WP_041677108.1|  Clp protease ClpX                                  110   4e-24   Synechococcus elongatus
ref|WP_040939432.1|  Clp protease ClpX                                  110   4e-24   
ref|WP_017651562.1|  ATP-dependent Clp protease ATP-binding protein     110   4e-24   Fortiea contorta
ref|WP_009543682.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    110   4e-24   Cyanothece
ref|WP_007303900.1|  ATP-dependent Clp protease ATP-binding protein     110   4e-24   Crocosphaera watsonii
ref|WP_015225278.1|  ATPase                                             110   4e-24   Halothece sp. PCC 7418
ref|WP_007353377.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    110   4e-24   Kamptonema
ref|XP_007509860.1|  predicted protein                                  110   4e-24   Bathycoccus prasinos
ref|WP_039726508.1|  MULTISPECIES: Clp protease ClpX                    110   4e-24   Lyngbya confervoides
ref|WP_008179937.1|  ATP-dependent Clp protease ATP-binding protein     110   4e-24   Moorea producens
ref|WP_021832536.1|  ATP-dependent Clp protease, ATP-binding subu...    110   4e-24   Crocosphaera watsonii
ref|WP_006620698.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    110   4e-24   Arthrospira
ref|WP_035989117.1|  Clp protease ClpX                                  110   4e-24   Leptolyngbya sp. KIOST-1
ref|WP_017320177.1|  ATP-dependent Clp protease ATP-binding protein     110   4e-24   cyanobacterium PCC 7702
ref|WP_006618428.1|  ATP-dependent Clp protease ATP-binding protein     110   4e-24   Arthrospira platensis
ref|WP_008312190.1|  ATPase with chaperone activity, ATP-binding ...    110   4e-24   Leptolyngbya sp. PCC 6406
ref|WP_011142062.1|  ATP-dependent Clp protease ATP-binding protein     110   4e-24   Gloeobacter violaceus
ref|WP_015783654.1|  ATP-dependent Clp protease ATP-binding protein     110   4e-24   Cyanothece sp. PCC 8802
ref|WP_015147858.1|  chaperone ATPase                                   110   4e-24   Oscillatoria acuminata
ref|WP_012954277.1|  ATP-dependent Clp protease ATP-binding protein     110   4e-24   Candidatus Atelocyanobacterium thalassa
ref|WP_011612018.1|  ATP-dependent Clp protease ATP-binding protein     110   4e-24   Trichodesmium erythraeum
ref|WP_019491687.1|  ATP-dependent Clp protease ATP-binding protein     110   4e-24   Calothrix sp. PCC 7103
ref|WP_026734190.1|  Clp protease ClpX                                  110   4e-24   
ref|WP_015145231.1|  chaperone ATPase                                   110   4e-24   
ref|WP_017306413.1|  ATP-dependent Clp protease ATP-binding protein     110   4e-24   
ref|WP_018396432.1|  ATP-dependent Clp protease ATP-binding protein     110   4e-24   
ref|WP_035153450.1|  Clp protease ClpX                                  110   4e-24   
ref|WP_006102932.1|  ATP-dependent Clp protease ATP-binding protein     110   4e-24   
ref|WP_017289117.1|  ATP-dependent Clp protease ATP-binding protein     110   4e-24   
ref|WP_012594749.1|  ATP-dependent Clp protease ATP-binding protein     110   4e-24   
gb|EEE52971.1|  hypothetical protein OsJ_35634                          110   4e-24   
ref|WP_006632591.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    110   4e-24   
ref|WP_009555478.1|  ATPase with chaperone activity, ATP-binding ...    110   4e-24   
ref|WP_017324677.1|  ATP-dependent Clp protease ATP-binding protein     110   4e-24   
ref|WP_013324812.1|  ATP-dependent Clp protease ATP-binding protein     110   4e-24   
ref|WP_040943370.1|  Clp protease ClpX                                  110   4e-24   
ref|WP_019504000.1|  ATP-dependent Clp protease ATP-binding protein     110   4e-24   
ref|WP_026086344.1|  MULTISPECIES: Clp protease ClpX                    110   4e-24   
ref|WP_015170572.1|  ATPase                                             110   4e-24   
ref|WP_017300481.1|  ATP-dependent Clp protease ATP-binding protein     110   4e-24   
ref|WP_009789541.1|  ATP-dependent Clp protease ATP-binding protein     110   4e-24   
ref|WP_006512495.1|  ATPase with chaperone activity, ATP-binding ...    110   4e-24   
ref|WP_011429552.1|  ATP-dependent Clp protease ATP-binding protein     110   4e-24   
ref|WP_011360176.1|  ATP-dependent Clp protease ATP-binding protein     110   4e-24   
ref|WP_040054326.1|  Clp protease ClpX                                  110   4e-24   
ref|WP_016863560.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    110   4e-24   
ref|WP_015200797.1|  ATPase                                             110   4e-24   
ref|WP_026722984.1|  Clp protease ClpX                                  110   4e-24   
ref|WP_026086125.1|  Clp protease ClpX                                  110   4e-24   
ref|WP_012599251.1|  ATP-dependent Clp protease ATP-binding protein     110   5e-24   
ref|WP_011432255.1|  ATP-dependent Clp protease ATP-binding protein     110   5e-24   
ref|WP_015219504.1|  ATPase                                             110   5e-24   
ref|WP_028949334.1|  Clp protease ClpX                                  110   5e-24   
ref|XP_011401568.1|  ATP-dependent Clp protease ATP-binding subun...    110   5e-24   
ref|WP_010873410.1|  ATP-dependent Clp protease ATP-binding protein     110   5e-24   
ref|WP_011824074.1|  ATP-dependent Clp protease ATP-binding protein     110   6e-24   
ref|WP_036917931.1|  MULTISPECIES: Clp protease ClpX                    110   6e-24   
ref|WP_036906575.1|  Clp protease ClpX                                  110   6e-24   
ref|WP_011294749.1|  ATP-dependent Clp protease ATP-binding protein     110   6e-24   
gb|ABR23161.1|  ATP-dependent Clp protease regulatory subunit ClpC      110   6e-24   
ref|WP_038653496.1|  Clp protease ClpX                                  110   6e-24   
ref|WP_011125259.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    109   7e-24   
ref|WP_015157369.1|  ATPase                                             109   7e-24   
ref|WP_002796578.1|  ATP-dependent Clp protease ATP-binding protein     109   7e-24   
ref|WP_039713557.1|  Clp protease ClpX                                  109   7e-24   
ref|WP_036909986.1|  Clp protease ClpX                                  109   8e-24   
ref|WP_009632308.1|  ATPase with chaperone activity, ATP-binding ...    109   8e-24   
ref|WP_036902654.1|  Clp protease ClpX                                  109   8e-24   
ref|WP_024545676.1|  Clp protease ClpX                                  109   9e-24   
ref|WP_006530480.1|  ATPase with chaperone activity, ATP-binding ...    109   1e-23   
ref|WP_024123912.1|  ATP-dependent Clp protease ATPase subunit ClpC     109   1e-23   
ref|WP_012305779.1|  ATP-dependent Clp protease ATP-binding protein     109   1e-23   
ref|WP_011056163.1|  ATP-dependent Clp protease ATP-binding protein     109   1e-23   
ref|WP_015132374.1|  ATPase                                             109   1e-23   
ref|WP_030006722.1|  Clp protease ClpX                                  109   1e-23   
emb|CDY64710.1|  BnaA06g38690D                                          109   1e-23   
ref|XP_002505550.1|  predicted protein                                  109   1e-23   
ref|WP_015223717.1|  ATPase                                             108   1e-23   
ref|WP_022023066.1|  aTP-dependent Clp protease regulatory subunit      108   1e-23   
ref|WP_011825646.1|  ATP-dependent Clp protease ATP-binding protein     108   1e-23   
ref|WP_036910555.1|  MULTISPECIES: Clp protease ClpX                    108   1e-23   
ref|WP_011130433.1|  ATP-dependent Clp protease ATP-binding protein     108   1e-23   
ref|WP_032527486.1|  Clp protease ClpX                                  108   2e-23   
ref|WP_019474998.1|  hypothetical protein                               108   2e-23   
ref|XP_005844402.1|  hypothetical protein CHLNCDRAFT_32555              108   2e-23   
gb|ADJ57429.1|  clp protease ATP binding subunit                        108   2e-23   
ref|WP_025968127.1|  Clp protease ClpX                                  108   2e-23   
ref|WP_025932059.1|  Clp protease ClpX                                  108   2e-23   
ref|WP_032519126.1|  Clp protease ClpX                                  108   2e-23   
ref|WP_025958425.1|  Clp protease ClpX                                  108   2e-23   
ref|WP_025935195.1|  MULTISPECIES: Clp protease ClpX                    108   2e-23   
ref|WP_025924610.1|  Clp protease ClpX                                  108   2e-23   
ref|WP_025922419.1|  MULTISPECIES: Clp protease ClpX                    108   2e-23   
ref|WP_032515069.1|  Clp protease ClpX                                  108   2e-23   
ref|WP_025906631.1|  Clp protease ClpX                                  108   2e-23   
ref|WP_025881712.1|  MULTISPECIES: Clp protease ClpX                    108   2e-23   
ref|WP_032523561.1|  Clp protease ClpX                                  108   2e-23   
ref|WP_012007913.1|  ATP-dependent Clp protease ATP-binding protein     108   2e-23   
ref|WP_025954710.1|  Clp protease ClpX                                  108   2e-23   
ref|WP_025894690.1|  Clp protease ClpX                                  108   2e-23   
ref|WP_002807987.1|  ATP-dependent Clp protease ATP-binding protein     108   2e-23   
ref|WP_025970276.1|  Clp protease ClpX                                  108   2e-23   
ref|WP_025935959.1|  Clp protease ClpX                                  108   2e-23   
ref|WP_025890951.1|  MULTISPECIES: Clp protease ClpX                    108   2e-23   
ref|WP_011863146.1|  ATP-dependent Clp protease ATP-binding protein     108   2e-23   
ref|WP_025972244.1|  Clp protease ClpX                                  108   2e-23   
ref|WP_025925386.1|  MULTISPECIES: Clp protease ClpX                    108   2e-23   
ref|WP_042850567.1|  Clp protease ClpX                                  108   3e-23   
ref|WP_025923359.1|  Clp protease ClpX                                  108   3e-23   
ref|WP_032522603.1|  Clp protease ClpX                                  108   3e-23   
ref|WP_032514205.1|  Clp protease ClpX                                  108   3e-23   
ref|WP_025955884.1|  Clp protease ClpX                                  108   3e-23   
ref|WP_011376649.1|  ATP-dependent Clp protease ATP-binding protein     108   3e-23   
ref|WP_025965623.1|  Clp protease ClpX                                  108   3e-23   
ref|WP_025964345.1|  Clp protease ClpX                                  108   3e-23   
ref|WP_032524589.1|  Clp protease ClpX                                  108   3e-23   
ref|WP_029976482.1|  Clp protease ClpX                                  108   3e-23   
ref|WP_025926674.1|  Clp protease ClpX                                  108   3e-23   
ref|WP_025962478.1|  Clp protease ClpX                                  108   3e-23   
ref|WP_025961281.1|  Clp protease ClpX                                  108   3e-23   
ref|WP_025959792.1|  Clp protease ClpX                                  108   3e-23   
ref|WP_025956785.1|  Clp protease ClpX                                  108   3e-23   
ref|WP_025930513.1|  Clp protease ClpX                                  108   3e-23   
ref|XP_001766010.1|  predicted protein                                  108   3e-23   
ref|WP_025944115.1|  Clp protease ClpX                                  108   3e-23   
ref|WP_025893396.1|  Clp protease ClpX                                  108   3e-23   
ref|WP_025914744.1|  Clp protease ClpX                                  108   3e-23   
ref|WP_011132721.1|  ATP-dependent Clp protease ATP-binding protein     108   3e-23   
ref|WP_025941830.1|  Clp protease ClpX                                  108   3e-23   
ref|WP_011818625.1|  ATP-dependent Clp protease ATP-binding protein     108   3e-23   
ref|WP_025928515.1|  Clp protease ClpX                                  108   3e-23   
ref|WP_011820486.1|  ATP-dependent Clp protease ATP-binding protein     108   3e-23   
ref|WP_025942442.1|  MULTISPECIES: Clp protease ClpX                    108   3e-23   
ref|WP_032516684.1|  Clp protease ClpX                                  108   3e-23   
ref|WP_022491472.1|  aTP-dependent Clp protease ATP-binding subun...    108   3e-23   
gb|AJA71272.1|  HSP100                                                  107   3e-23   
ref|WP_036896901.1|  Clp protease ClpX                                  107   3e-23   
ref|YP_007947862.1|  Clp protease ATP binding subunit                   107   3e-23   
ref|WP_012195650.1|  ATP-dependent Clp protease ATP-binding protein     107   3e-23   
ref|XP_001766888.1|  predicted protein                                  107   3e-23   
ref|XP_002875732.1|  hypothetical protein ARALYDRAFT_484935             105   3e-23   
gb|AIA21566.1|  Clp protease ATP binding subunit                        107   3e-23   
ref|YP_009027615.1|  Clp protease ATP binding subunit                   107   3e-23   
gb|AFC40000.1|  Clp protease ATP binding subunit                        107   3e-23   
ref|NP_053942.1|  Clp protease ATP binding subunit                      107   4e-23   
ref|YP_537014.1|  Clp protease ATP binding subunit                      107   4e-23   
gb|AIA21360.1|  Clp protease ATP binding subunit                        107   4e-23   
ref|WP_022485745.1|  aTP-dependent Clp protease regulatory subunit      107   4e-23   
emb|CEG02027.1|  Clp, N-terminal                                        107   4e-23   
ref|WP_025781797.1|  Clp protease ClpX                                  107   5e-23   
ref|YP_277337.1|  Clp protease ATP binding subunit                      107   5e-23   
gb|AJH65889.1|  ATP-dependent Clp protease                              107   6e-23   
ref|YP_007627346.1|  Clp protease ATP binding subunit                   107   6e-23   
ref|YP_007878188.1|  Clp protease ATP binding subunit                   107   6e-23   
ref|YP_008144810.1|  ATP-dependent Clp protease ATP-binding subun...    107   7e-23   
ref|NP_045112.1|  Clp protease ATP binding subunit                      107   7e-23   
gb|EKE04399.1|  hypothetical protein ACD_20C00084G0019                  107   7e-23   
ref|YP_063564.1|  Clp protease ATP binding subunit                      107   7e-23   
gb|AJO68399.1|  Clp protease ATP binding subunit                        107   7e-23   
ref|YP_009019572.1|  Clp protease ATP binding subunit                   107   7e-23   
ref|NP_190131.1|  Double Clp-N motif-containing P-loop nucleoside...    103   9e-23   
ref|XP_003063658.1|  predicted protein                                  106   1e-22   
ref|XP_001422509.1|  chaperone, Hsp100 family, ClpC-type                105   2e-22   
ref|WP_021918297.1|  aTP-dependent Clp protease ATP-binding subun...    105   3e-22   
ref|WP_021865017.1|  aTP-dependent Clp protease ATP-binding subun...    105   3e-22   
ref|WP_022457401.1|  aTP-dependent Clp protease ATP-binding subun...    105   3e-22   
ref|WP_021945551.1|  aTP-dependent Clp protease ATP-binding subun...    105   3e-22   
ref|WP_022482201.1|  aTP-dependent Clp protease ATP-binding subun...    105   3e-22   
ref|WP_022442206.1|  aTP-dependent Clp protease ATP-binding subun...    105   3e-22   
ref|WP_022246485.1|  aTP-dependent Clp protease ATP-binding subun...    104   4e-22   
ref|YP_002049416.1|  endopeptidase Clp ATP-binding chain C              104   5e-22   
ref|WP_032555672.1|  hypothetical protein                             95.9    6e-22   
ref|YP_005088687.1|  Clp protease ATP binding subunit                   103   7e-22   
gb|AHY04404.1|  ATP-dependent clp protease ATP binding subunit          103   7e-22   
ref|YP_008145463.1|  Clp protease ATP binding subunit                   103   8e-22   
gb|AIA61144.1|  Clp protease ATP binding subunit (chloroplast)          103   1e-21   
ref|WP_011142066.1|  endopeptidase Clp ATP-binding chain              99.4    2e-21   
ref|YP_009051035.1|  Clp protease ATP binding subunit                   102   3e-21   
ref|YP_008965643.1|  ATP-dependent Clp protease ATP-binding subun...    102   3e-21   
ref|NP_849021.1|  Clp protease ATP binding subunit                      102   3e-21   
ref|WP_017285691.1|  hypothetical protein                             98.6    4e-21   
ref|WP_032525473.1|  hypothetical protein                             94.0    4e-21   
ref|YP_007476253.1|  Clp protease ATP binding subunit                   100   1e-20   
ref|WP_026735736.1|  hypothetical protein                             94.4    2e-20   
gb|ABG51946.1|  TPR repeat containing protein                           100   2e-20   
ref|XP_010687841.1|  PREDICTED: chaperone protein ClpC, chloropla...  99.4    3e-20   
ref|XP_010687844.1|  PREDICTED: chaperone protein ClpC, chloropla...  97.8    9e-20   
ref|WP_011612826.1|  ATP-dependent Clp protease ATP-binding protein   97.1    2e-19   
gb|AJH65844.1|  ATP-dependent Clp protease                            96.3    3e-19   
gb|KDO51290.1|  hypothetical protein CISIN_1g003094mg                 95.5    5e-19   
ref|WP_039961643.1|  Clp protease ClpX, partial [                     95.5    6e-19   
ref|WP_019487288.1|  ATP-dependent Clp protease ATP-binding protein   95.5    6e-19   
ref|XP_005648968.1|  hypothetical protein COCSUDRAFT_28166            95.5    6e-19   
ref|YP_003002285.1|  ATP-dependent clp protease ATP-binding subunit   95.1    9e-19   
ref|WP_011321026.1|  ATP-dependent Clp protease ATP-binding protein   94.7    9e-19   
ref|WP_015197969.1|  Clp domain-containing protein                    94.4    1e-18   
ref|WP_010996127.1|  ATP-dependent Clp protease ATP-binding protein   94.7    1e-18   
ref|WP_016953419.1|  ATP-dependent Clp protease ATP-binding protein   94.7    1e-18   
emb|CCI36398.1|  Similar to Q110X8_TRIEI TPR repeat containing pr...  94.7    1e-18   
ref|WP_019489373.1|  ATP-dependent Clp protease ATP-binding protein   93.6    2e-18   
ref|WP_017653296.1|  ATP-dependent Clp protease ATP-binding protein   93.6    3e-18   
gb|AFZ60359.1|  ATPase AAA-2 domain protein                           93.6    3e-18   
emb|CCI17334.1|  Similar to Q110X8_TRIEI TPR repeat containing pr...  94.0    3e-18   
ref|WP_015126728.1|  ATPase                                           93.6    3e-18   
ref|WP_044292615.1|  Clp protease ClpX                                93.6    3e-18   
gb|AFR24744.1|  ATP-dependent clp protease ATP-binding subunit        93.6    3e-18   
ref|WP_017321287.1|  ATP-dependent Clp protease ATP-binding protein   93.6    3e-18   
ref|YP_003002123.1|  ATP-dependent clp protease ATP-binding subunit   93.6    3e-18   
ref|WP_015137763.1|  chaperone ATPase                                 93.2    3e-18   
ref|WP_015178164.1|  ATPase AAA-2 domain protein                      93.2    3e-18   
ref|WP_006631728.1|  ATP-dependent Clp protease ATP-binding protein   93.2    3e-18   
gb|AFY59127.1|  ATPase with chaperone activity, ATP-binding subunit   93.2    3e-18   
ref|YP_003359282.1|  Clp protease ATP binding subunit                 93.2    3e-18   
ref|WP_016875482.1|  ATP-dependent Clp protease ATP-binding protein   93.2    3e-18   
gb|AFY44720.1|  Clp domain protein                                    92.0    4e-18   
gb|ELS44939.1|  clp amino terminal domain protein                     93.2    5e-18   
emb|CAO87136.1|  unnamed protein product                              93.2    5e-18   
ref|WP_027845315.1|  Clp protease ClpX                                92.8    5e-18   
ref|WP_013321074.1|  Clp domain-containing protein                    92.8    6e-18   
ref|WP_015206990.1|  ATPase with chaperone activity, ATP-binding ...  92.4    6e-18   
ref|WP_012409943.1|  ATP-dependent Clp protease ATP-binding protein   92.4    7e-18   
gb|KIJ85031.1|  Clp protease ClpX                                     92.4    7e-18   
ref|WP_006275568.1|  ATP-dependent Clp protease ATP-binding protein   92.4    7e-18   
ref|WP_041038849.1|  Clp protease ClpX                                92.4    7e-18   
ref|WP_017744020.1|  ATP-dependent Clp protease ATP-binding protein   92.4    7e-18   
gb|KIE09004.1|  Clp protease ClpX                                     92.4    7e-18   
ref|WP_042466185.1|  Clp protease ClpX                                92.0    9e-18   
ref|WP_029638259.1|  Clp protease ClpX [                              92.0    9e-18   
ref|WP_013190390.1|  ATP-dependent Clp protease ATP-binding protein   92.0    9e-18   
ref|WP_035148903.1|  Clp protease ClpX                                91.7    1e-17   
ref|WP_015199655.1|  ATPase                                           91.3    1e-17   
ref|WP_039752731.1|  Clp protease ClpX                                91.3    1e-17   
ref|WP_026735213.1|  Clp protease ClpX                                90.9    2e-17   
ref|WP_015113826.1|  ATPase                                           90.9    2e-17   
ref|WP_009630510.1|  ATPase with chaperone activity, ATP-binding ...  90.9    2e-17   
ref|WP_006196989.1|  ATP-dependent Clp protease ATP-binding protein   90.9    2e-17   
ref|WP_016866146.1|  ATP-dependent Clp protease ATP-binding protein   90.9    2e-17   
ref|WP_015147677.1|  chaperone ATPase                                 90.9    2e-17   
ref|XP_006436943.1|  hypothetical protein CICLE_v10033976mg           85.1    2e-17   
ref|WP_026082520.1|  Clp protease ClpX                                90.1    4e-17   
ref|WP_028082386.1|  Clp protease ClpX                                89.7    5e-17   
ref|WP_015083493.1|  ATP-dependent Clp protease                       89.7    5e-17   
ref|WP_028090410.1|  Clp protease ClpX                                89.7    5e-17   



>ref|XP_009592686.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic isoform X1 [Nicotiana tomentosiformis]
Length=935

 Score =   197 bits (502),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 148/174 (85%), Gaps = 4/174 (2%)
 Frame = +2

Query  86   SLGGIMARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTG  265
             L  IMAR LVQSTNIPS VAGE   +F GSGK      R V MLCS+QSPSL+LR F+G
Sbjct  8    DLWSIMARALVQSTNIPSSVAGERTTKFNGSGKTN----RTVKMLCSAQSPSLRLRDFSG  63

Query  266  LRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEAR  445
            LRG NA+DT+ RSGQTL SKVAAATS RR RG R V KAMFERFTEKAIKVIMLAQEEAR
Sbjct  64   LRGCNAIDTLVRSGQTLQSKVAAATSVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEAR  123

Query  446  RLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            RLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  124  RLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  177



>ref|XP_009592687.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic isoform X2 [Nicotiana tomentosiformis]
Length=927

 Score =   196 bits (499),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 141/173 (82%), Positives = 148/173 (86%), Gaps = 4/173 (2%)
 Frame = +2

Query  89   LGGIMARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGL  268
            +  IMAR LVQSTNIPS VAGE   +F GSGK      R V MLCS+QSPSL+LR F+GL
Sbjct  1    MWSIMARALVQSTNIPSSVAGERTTKFNGSGKTN----RTVKMLCSAQSPSLRLRDFSGL  56

Query  269  RGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARR  448
            RG NA+DT+ RSGQTL SKVAAATS RR RG R V KAMFERFTEKAIKVIMLAQEEARR
Sbjct  57   RGCNAIDTLVRSGQTLQSKVAAATSVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARR  116

Query  449  LGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            LGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  117  LGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  169



>gb|AIM41270.1| chloroplast ATP-dependent Clp protease chaperone protein [Nicotiana 
benthamiana]
Length=908

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 146/169 (86%), Gaps = 4/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MAR LVQSTNIPS V+GE   +F GSGK      R V MLCS+QSPSL+LR F+GLRG N
Sbjct  1    MARALVQSTNIPSSVSGERTTKFNGSGKTN----RTVKMLCSAQSPSLRLRDFSGLRGCN  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            A+DT+ RSGQTL SKVAAATS RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   AVDTLVRSGQTLQSKVAAATSVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  165



>gb|AIM41271.1| chloroplast ATP-dependent Clp protease chaperone protein [Nicotiana 
benthamiana]
Length=938

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 146/169 (86%), Gaps = 4/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MAR LVQSTNIPS V+GE   +F GSGK      R V MLCS+QSPSL+LR F+GLRG N
Sbjct  1    MARALVQSTNIPSSVSGERTTKFNGSGKTN----RTVKMLCSAQSPSLRLRDFSGLRGCN  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            A+DT+ RSGQTL SKVAAATS RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   AVDTLVRSGQTLQSKVAAATSVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  165



>ref|XP_009615664.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Nicotiana tomentosiformis]
Length=923

 Score =   192 bits (488),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 147/169 (87%), Gaps = 4/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MAR LVQSTNIPS VAGE   QF GSGK K    + V MLC+ QSPS++L +FTGLRG N
Sbjct  1    MARALVQSTNIPSSVAGERTRQFSGSGKNK----KTVKMLCNVQSPSIRLTNFTGLRGCN  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            A+DT+ +SGQTLHSKVAAATS RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   AIDTLVKSGQTLHSKVAAATSVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  165



>ref|XP_009769540.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Nicotiana sylvestris]
Length=923

 Score =   192 bits (488),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 147/169 (87%), Gaps = 4/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MAR LVQSTNIPS VAGE   QF GSGK K    + V MLC+ QSPS++L +FTGLRG N
Sbjct  1    MARALVQSTNIPSSVAGERTRQFSGSGKNK----KTVKMLCNVQSPSIRLTNFTGLRGCN  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            A+DT+ +SGQTLHSKVAAATS RR +G R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   AVDTLVKSGQTLHSKVAAATSVRRPKGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  165



>ref|XP_009798134.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Nicotiana sylvestris]
Length=923

 Score =   192 bits (487),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 145/169 (86%), Gaps = 4/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MAR LVQSTNIPS VAGE   +F GSGK      R V MLCS+QSPSL+LR F+GLRG N
Sbjct  1    MARALVQSTNIPSSVAGERTTKFNGSGKTN----RTVKMLCSAQSPSLRLRDFSGLRGCN  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            A+DT+ RS QTL SKVAAATS RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   AIDTLVRSEQTLQSKVAAATSVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  165



>gb|AIM41268.1| chloroplast ATP-dependent Clp protease chaperone protein [Nicotiana 
benthamiana]
Length=906

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 146/169 (86%), Gaps = 4/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MAR LVQSTNIPS VAGE   QF GSGK K    + V MLC+ Q PS++L +FTGLRG N
Sbjct  1    MARALVQSTNIPSSVAGERTRQFSGSGKNK----KTVKMLCNVQPPSIRLTNFTGLRGCN  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            A+DT+ +SGQTLHSKVAAATS RR +G R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   AIDTLVKSGQTLHSKVAAATSVRRPKGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  165



>ref|XP_006346636.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Solanum tuberosum]
Length=923

 Score =   187 bits (476),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 144/169 (85%), Gaps = 4/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MAR LVQST+IPS VAGE   +F GSGK K    R V MLC++QS SL LR FTGLRG N
Sbjct  1    MARALVQSTSIPSSVAGERTTKFNGSGKTK----RAVTMLCNAQSSSLTLRDFTGLRGCN  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            A+DT+ RSGQTL SKVAAAT  RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   AIDTLVRSGQTLQSKVAAATYVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  165



>ref|XP_004252280.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Solanum lycopersicum]
Length=923

 Score =   187 bits (476),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 144/169 (85%), Gaps = 4/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MAR LVQST+IPS VAGE   +F GSGK K    R V MLC++QS SL LR FTGLRG N
Sbjct  1    MARALVQSTSIPSSVAGERTTKFNGSGKTK----RAVTMLCNAQSSSLTLRDFTGLRGCN  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            A+DT+ RSGQTL SKVAAAT  RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   AIDTLVRSGQTLQSKVAAATYVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  165



>sp|P31542.1|CLPAB_SOLLC RecName: Full=ATP-dependent Clp protease ATP-binding subunit 
clpA homolog CD4B, chloroplastic; Flags: Precursor [Solanum 
lycopersicum]
 gb|AAA34161.1| ATP-dependent protease (CD4B) [Solanum lycopersicum]
Length=923

 Score =   186 bits (473),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 144/169 (85%), Gaps = 4/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MAR LVQST+IPS VAGE   +F GSGK K    R V MLC++QS SL LR FTGLRG N
Sbjct  1    MARALVQSTSIPSSVAGERTTKFNGSGKTK----RAVTMLCNAQSSSLTLRDFTGLRGCN  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            A+DT+ RSG+TL SKVAAAT  RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   AIDTLVRSGETLQSKVAAATYVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  165



>ref|XP_004297496.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Fragaria vesca subsp. vesca]
Length=922

 Score =   181 bits (459),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 140/169 (83%), Gaps = 4/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MARVLV STNIP LVAG+ +GQ     KG G  +R   M+CS ++P+L++ SF+GLR  N
Sbjct  1    MARVLVHSTNIPGLVAGQRLGQ----SKGSGNARRSTKMMCSLRTPALRISSFSGLRSVN  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            ALD MAR GQ L+SKV  A S RR + SR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   ALDIMARPGQDLYSKVGVAISSRRRKASRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  165



>gb|AIM41269.1| chloroplast ATP-dependent Clp protease chaperone protein [Nicotiana 
benthamiana]
Length=923

 Score =   181 bits (458),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 143/184 (78%), Gaps = 19/184 (10%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MAR LVQSTNIPS VAGE   QF GSGK K    + V MLC+ Q PS++L +FTGLRG N
Sbjct  1    MARALVQSTNIPSSVAGEMTRQFSGSGKNK----KTVKMLCNVQPPSIRLTNFTGLRGCN  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            A+DT+ +SGQTLHSKVAAATS RR +G R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   AIDTLVKSGQTLHSKVAAATSVRRPKGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  461  FV---------------gteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGS  595
            FV                  +ILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS
Sbjct  117  FVGTEQILLGLIGEGTGIAAKILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  176

Query  596  GFVA  607
            GFVA
Sbjct  177  GFVA  180



>ref|XP_004171086.1| PREDICTED: chaperone protein ClpC, chloroplastic-like, partial 
[Cucumis sativus]
Length=475

 Score =   175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 137/169 (81%), Gaps = 3/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MARVLVQSTNIP LV G   G    + +G    KR V M+ ++ SP L++R+F+GLRG N
Sbjct  1    MARVLVQSTNIPGLVGGRKNG---LTTRGSANVKRAVKMMSTAHSPGLRIRNFSGLRGFN  57

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            +LD M RS Q  HSKVA A S RR + SR V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  58   SLDNMLRSRQNFHSKVATAISSRRRKASRCVPRAMFERFTEKAIKVIMLAQEEARRLGHN  117

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  118  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  166



>ref|XP_008464372.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Cucumis melo]
Length=923

 Score =   178 bits (451),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 137/169 (81%), Gaps = 3/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MARVLVQSTNIP LV G   G    + +G    KR V M+ ++ SP L++R+F+GLRG N
Sbjct  1    MARVLVQSTNIPGLVGGRKNG---LTSRGSASVKRAVKMMATAHSPGLRIRNFSGLRGFN  57

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            +LD M RSGQ  HSK+A   S RR + SR V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  58   SLDNMLRSGQDFHSKMAITISSRRRKASRCVPRAMFERFTEKAIKVIMLAQEEARRLGHN  117

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  118  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  166



>gb|ADN33858.1| ATP-dependent clp protease [Cucumis melo subsp. melo]
Length=929

 Score =   178 bits (451),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 137/169 (81%), Gaps = 3/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MARVLVQSTNIP LV G   G    + +G    KR V M+ ++ SP L++R+F+GLRG N
Sbjct  1    MARVLVQSTNIPGLVGGRKNG---LTSRGSASVKRAVKMMATAHSPGLRIRNFSGLRGFN  57

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            +LD M RSGQ  HSK+A   S RR + SR V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  58   SLDNMLRSGQDFHSKMAITISSRRRKASRCVPRAMFERFTEKAIKVIMLAQEEARRLGHN  117

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  118  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  166



>ref|XP_010099042.1| Chaperone protein ClpC [Morus notabilis]
 gb|EXB76502.1| Chaperone protein ClpC [Morus notabilis]
Length=571

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 137/169 (81%), Gaps = 4/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MARVLVQSTN+P LV+G   GQ     KG GK KR V M+   Q+P L++R F+GLR  N
Sbjct  1    MARVLVQSTNVPGLVSGLKHGQ----SKGSGKSKRAVRMMSCIQAPGLRMRGFSGLRSFN  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            ALDTM R GQ  +SKVA   S RR + SR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   ALDTMMRPGQDFYSKVAITRSSRRQKASRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  165



>ref|XP_004138021.1| PREDICTED: chaperone protein ClpC, chloroplastic-like [Cucumis 
sativus]
Length=929

 Score =   175 bits (444),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 137/169 (81%), Gaps = 3/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MARVLVQSTNIP LV G   G    + +G    KR V M+ ++ SP L++R+F+GLRG N
Sbjct  1    MARVLVQSTNIPGLVGGRKNG---LTTRGSANVKRAVKMMSTAHSPGLRIRNFSGLRGFN  57

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            +LD M RS Q  HSKVA A S RR + SR V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  58   SLDNMLRSRQNFHSKVATAISSRRRKASRCVPRAMFERFTEKAIKVIMLAQEEARRLGHN  117

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  118  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  166



>ref|XP_008239551.1| PREDICTED: chaperone protein ClpC, chloroplastic [Prunus mume]
Length=922

 Score =   175 bits (443),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 137/169 (81%), Gaps = 4/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MARVLVQSTNIP +VAG  + Q     KG G  KR V M C+ ++P L++ SF+GLR  N
Sbjct  1    MARVLVQSTNIPGVVAGRRLSQ----SKGSGNAKRTVKMCCTLRAPGLRISSFSGLRSVN  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            ALD MA+ GQ  +SK+  A + RR + SR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   ALDIMAKPGQDFYSKMGVAITSRRRKASRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  165



>emb|CBI15747.3| unnamed protein product [Vitis vinifera]
Length=746

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 142/174 (82%), Gaps = 4/174 (2%)
 Frame = +2

Query  86   SLGGIMARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTG  265
            S+  +MAR LVQSTNI + VA    G+F+GS + K    + V M+C+ Q+P L++R F+G
Sbjct  44   SVSAVMARALVQSTNIFASVADGKHGKFQGSERTK----KSVKMMCNVQAPGLRIRGFSG  99

Query  266  LRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEAR  445
            LRG NALD + RSG   HS+VAAA S R G+ SR V +AMFERFTEKAIKVIMLAQEEAR
Sbjct  100  LRGANALDNLVRSGHDFHSRVAAAISVRGGKASRCVARAMFERFTEKAIKVIMLAQEEAR  159

Query  446  RLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            RLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  160  RLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  213



>ref|XP_007210385.1| hypothetical protein PRUPE_ppa001062mg [Prunus persica]
 gb|EMJ11584.1| hypothetical protein PRUPE_ppa001062mg [Prunus persica]
Length=921

 Score =   173 bits (438),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 134/169 (79%), Gaps = 5/169 (3%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MARVLVQSTNIP +VAG  +GQ     KG G  KR V M C+ ++P L++ SF+GLR  N
Sbjct  1    MARVLVQSTNIPGVVAGRRLGQ----SKGSGNAKRTVKMCCTLRAPGLRISSFSGLRSVN  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            ALD MA+ GQ  +SK+  A + RR        KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   ALDIMAKPGQDFYSKMGVAITSRRKASRCVP-KAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  164



>emb|CDO98310.1| unnamed protein product [Coffea canephora]
Length=923

 Score =   173 bits (438),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 141/169 (83%), Gaps = 4/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MAR +VQSTN+ SLVA    GQFKGSGK K    R V MLCS     L++R F+GLR  N
Sbjct  1    MARAIVQSTNVSSLVAPGRYGQFKGSGKNK----RAVMMLCSLHVAPLRMRGFSGLRTSN  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            ALD M ++GQ+LHSKVA ATS RRGRGSR   +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   ALDMMVKTGQSLHSKVAIATSSRRGRGSRMAPRAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  165



>sp|P31541.1|CLPAA_SOLLC RecName: Full=ATP-dependent Clp protease ATP-binding subunit 
clpA homolog CD4A, chloroplastic; Flags: Precursor [Solanum 
lycopersicum]
 gb|AAA34160.1| ATP-dependent protease (CD4A) [Solanum lycopersicum]
Length=926

 Score =   172 bits (436),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 141/171 (82%), Gaps = 5/171 (3%)
 Frame = +2

Query  98   IMARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGG  277
            +MAR LVQSTNI   VAGE  GQF GS K +    R V MLC+ +  S +L +F GLRG 
Sbjct  1    MMARALVQSTNILPSVAGERAGQFNGSRKDQ----RTVRMLCNVKCCSSRLNNFAGLRGC  56

Query  278  NALDTM-ARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLG  454
            NALDT+  +SG+TLHSKVAAAT  RR RG R V KAMFERFTEKAIKVIMLAQEEARRLG
Sbjct  57   NALDTLLVKSGETLHSKVAAATFVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLG  116

Query  455  HNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            HNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGF+A
Sbjct  117  HNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFIA  167



>ref|XP_004235839.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4A, chloroplastic [Solanum lycopersicum]
Length=926

 Score =   172 bits (436),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 141/171 (82%), Gaps = 5/171 (3%)
 Frame = +2

Query  98   IMARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGG  277
            +MAR LVQSTNI   VAGE  GQF GS K +    R V MLC+ +  S +L +F GLRG 
Sbjct  1    MMARALVQSTNILPSVAGERAGQFNGSRKDQ----RTVRMLCNVKCCSSRLNNFAGLRGC  56

Query  278  NALDTM-ARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLG  454
            NALDT+  +SG+TLHSKVAAAT  RR RG R V KAMFERFTEKAIKVIMLAQEEARRLG
Sbjct  57   NALDTLLVKSGETLHSKVAAATFVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLG  116

Query  455  HNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            HNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGF+A
Sbjct  117  HNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFIA  167



>ref|XP_006341485.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4A, chloroplastic-like [Solanum tuberosum]
Length=925

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 140/170 (82%), Gaps = 5/170 (3%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MAR LVQST+I S VA E  GQF GS K +    R V MLC+ +  S +L SF GLRG N
Sbjct  1    MARALVQSTDILSSVASERAGQFNGSRKNQ----RTVRMLCNVKCSSSRLNSFAGLRGCN  56

Query  281  ALDTM-ARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGH  457
            ALDT+  +SG+TLHSKVAAAT  RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGH
Sbjct  57   ALDTLLVKSGETLHSKVAAATFVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGH  116

Query  458  NFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGF+A
Sbjct  117  NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFIA  166



>ref|XP_010663794.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Vitis vinifera]
 ref|XP_010663795.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Vitis vinifera]
Length=923

 Score =   170 bits (431),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 139/169 (82%), Gaps = 4/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MAR LVQSTNI + VA    G+F+GS + K    + V M+C+ Q+P L++R F+GLRG N
Sbjct  1    MARALVQSTNIFASVADGKHGKFQGSERTK----KSVKMMCNVQAPGLRIRGFSGLRGAN  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            ALD + RSG   HS+VAAA S R G+ SR V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   ALDNLVRSGHDFHSRVAAAISVRGGKASRCVARAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  165



>gb|KDP22549.1| hypothetical protein JCGZ_26380 [Jatropha curcas]
Length=924

 Score =   170 bits (430),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 133/169 (79%), Gaps = 3/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MAR+LV STNIP+L  G   G    S + +   +    M+CS++ P+L LR F+GLR  N
Sbjct  1    MARLLVHSTNIPALSHGVKHG---LSQESETSRRTATKMMCSTRPPALTLRGFSGLRNSN  57

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
             LDT+ RSGQ  HS+VA + S R+ +  R + +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  58   CLDTLLRSGQDFHSRVAISMSRRQQKAKRFLPRAMFERFTEKAIKVIMLAQEEARRLGHN  117

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  118  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  166



>gb|KHG07735.1| Chaperone ClpC, chloroplastic [Gossypium arboreum]
Length=893

 Score =   167 bits (424),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 138/169 (82%), Gaps = 4/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MA++L QS  +P+L++  + G    + K  GK KR   M+CS Q+P L++RSF+GLRG N
Sbjct  1    MAKILAQSAIVPTLLSSRSHG----ASKESGKPKRSAKMMCSLQTPGLRIRSFSGLRGSN  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            +LD + R GQ  HSKV  + S +RGRGSR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   SLDNIVRYGQDFHSKVGISISSQRGRGSRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  165



>gb|KJB19711.1| hypothetical protein B456_003G116200 [Gossypium raimondii]
Length=753

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 137/169 (81%), Gaps = 4/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MA++L QS  +P+L+   + G    + K  GK KR   M+CS Q+P L++RSF+GLRG N
Sbjct  1    MAKILSQSAIVPTLLTSRSHG----ASKESGKPKRSAKMMCSLQTPGLRIRSFSGLRGSN  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            +LD + R GQ  HSKV  + S RRGRGSR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   SLDNIVRFGQDFHSKVGISISSRRGRGSRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  165



>ref|XP_008457503.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Cucumis melo]
Length=924

 Score =   167 bits (423),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 136/170 (80%), Gaps = 5/170 (3%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MARVLVQ TNIP LV    +G+   S KG G  KR V M+ S  SP +++RSF+GLRG N
Sbjct  1    MARVLVQPTNIPGLV----VGRKSPSSKGSGNSKRAVKMMSSVHSPCMRMRSFSGLRGLN  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrg-rgsravvKAMFERFTEKAIKVIMLAQEEARRLGH  457
            +LD M R GQ  HSK+A A S RR  R SR V +AMFERFTEKAIKVIMLAQEEARRLGH
Sbjct  57   SLDNMFRPGQDFHSKMAIAISSRRVGRASRCVPRAMFERFTEKAIKVIMLAQEEARRLGH  116

Query  458  NFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRG GFVA
Sbjct  117  NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGGGFVA  166



>ref|XP_007038115.1| CLPC [Theobroma cacao]
 gb|EOY22616.1| CLPC [Theobroma cacao]
Length=922

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 137/169 (81%), Gaps = 4/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MA+VL QST +P+LV   + G  K S K KG       M+CS Q+P L++RSF+GLRG N
Sbjct  1    MAKVLAQSTIVPALVTSRSHGPSKESSKSKG----SAKMMCSLQTPGLRIRSFSGLRGSN  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            +LD M R GQ   SKVA + S RRGRGSR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   SLDNMVRFGQDFRSKVAISISSRRGRGSRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  165



>gb|KJB19712.1| hypothetical protein B456_003G116200 [Gossypium raimondii]
Length=919

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 137/169 (81%), Gaps = 4/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MA++L QS  +P+L+   + G    + K  GK KR   M+CS Q+P L++RSF+GLRG N
Sbjct  1    MAKILSQSAIVPTLLTSRSHG----ASKESGKPKRSAKMMCSLQTPGLRIRSFSGLRGSN  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            +LD + R GQ  HSKV  + S RRGRGSR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   SLDNIVRFGQDFHSKVGISISSRRGRGSRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  165



>ref|XP_004152900.1| PREDICTED: chaperone protein ClpC, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004162592.1| PREDICTED: chaperone protein ClpC, chloroplastic-like [Cucumis 
sativus]
 gb|KGN65697.1| hypothetical protein Csa_1G502360 [Cucumis sativus]
Length=924

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 134/170 (79%), Gaps = 5/170 (3%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MARVLVQ TNIP LV    + +   S +G G  KRVV M+ S  SP +++RSF+GLRG N
Sbjct  1    MARVLVQPTNIPGLV----VARKSPSSRGSGNAKRVVKMMSSVHSPGMRMRSFSGLRGLN  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsra-vvKAMFERFTEKAIKVIMLAQEEARRLGH  457
            +LD M R GQ  HSKVA A S RRG      V +AMFERFTEKAIKVIMLAQEEARRLGH
Sbjct  57   SLDNMFRPGQDFHSKVAIAISSRRGGRPSRGVPRAMFERFTEKAIKVIMLAQEEARRLGH  116

Query  458  NFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRG GFVA
Sbjct  117  NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGGGFVA  166



>ref|XP_002511102.1| ATP-dependent clp protease, putative [Ricinus communis]
 gb|EEF51704.1| ATP-dependent clp protease, putative [Ricinus communis]
Length=924

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 131/169 (78%), Gaps = 3/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MAR+LV S N+P+L      GQ + SG  +    +   M+CSS+ P+L LR +TGLR  N
Sbjct  1    MARLLVHSINVPALAPHIKHGQSQESGTSRRTATK---MMCSSRLPALTLRGYTGLRSSN  57

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
             LDTM RSG   HS+VA   S R+ +  R + +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  58   CLDTMLRSGLDFHSRVAITMSRRQQKAKRFLPRAMFERFTEKAIKVIMLAQEEARRLGHN  117

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  118  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  166



>gb|KJB19710.1| hypothetical protein B456_003G116200 [Gossypium raimondii]
Length=922

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 137/169 (81%), Gaps = 4/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MA++L QS  +P+L+   + G    + K  GK KR   M+CS Q+P L++RSF+GLRG N
Sbjct  1    MAKILSQSAIVPTLLTSRSHG----ASKESGKPKRSAKMMCSLQTPGLRIRSFSGLRGSN  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            +LD + R GQ  HSKV  + S RRGRGSR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   SLDNIVRFGQDFHSKVGISISSRRGRGSRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  165



>ref|XP_006367832.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4A, chloroplastic-like [Solanum tuberosum]
Length=921

 Score =   165 bits (417),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 140/172 (81%), Gaps = 7/172 (4%)
 Frame = +2

Query  101  MARVLVQSTNIPS--LVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRG  274
            MAR LVQST+I S   VAGE  GQF GS K +    R V M+C  + PSLKL+SF GLRG
Sbjct  1    MARALVQSTDILSSVAVAGERAGQFNGSRKNQ----RTVRMICDVKFPSLKLKSFVGLRG  56

Query  275  GNALDTM-ARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRL  451
             NALDT+  +SG+TLHSKVAAAT  RR +G R V KAMFERFTEKAIK IMLAQ+EARRL
Sbjct  57   CNALDTLLVKSGETLHSKVAAATFVRRSQGCRFVPKAMFERFTEKAIKGIMLAQDEARRL  116

Query  452  GHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            GH+FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS F+ 
Sbjct  117  GHDFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSVFIT  168



>gb|EPS63111.1| hypothetical protein M569_11677, partial [Genlisea aurea]
Length=195

 Score =   154 bits (389),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 134/172 (78%), Gaps = 6/172 (3%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQ-SPSLKLRSFTGLRGG  277
            MA VLVQST++PS V+   +    G  +   K +R V MLCSS+ +P+  +RSF+G RG 
Sbjct  1    MAGVLVQSTSLPSSVS---LANNGGKLEASTKNRRAVTMLCSSRLAPARTMRSFSGFRGV  57

Query  278  NALDTMA-RSGQTLHSKvaaatsgrrg-rgsravvKAMFERFTEKAIKVIMLAQEEARRL  451
            N LD +  +S QTLHSKVA A    R  R +R   +AMFERFTEKAIKVIMLAQEEARRL
Sbjct  58   NVLDRLVQKSSQTLHSKVAEAAGPSRRGRRTRMAPRAMFERFTEKAIKVIMLAQEEARRL  117

Query  452  GHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            GHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  118  GHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  169



>gb|AAD02267.1| ClpC protease [Spinacia oleracea]
Length=891

 Score =   164 bits (415),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 137/169 (81%), Gaps = 5/169 (3%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MA  L+QSTNIPSL A +  GQF+ S KG     + V M+ S Q P  ++R+F+G+RGGN
Sbjct  1    MAGALIQSTNIPSL-AYKVNGQFQRSDKGN----KAVKMMASLQDPGYRMRTFSGVRGGN  55

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            ALDT+  + +  +SK+ A  S R+G  SR VV+AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  56   ALDTLGTTSECFYSKMRAVLSVRKGTASRGVVRAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  164



>gb|KJB07945.1| hypothetical protein B456_001G054700 [Gossypium raimondii]
 gb|KJB07946.1| hypothetical protein B456_001G054700 [Gossypium raimondii]
Length=920

 Score =   162 bits (409),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 134/169 (79%), Gaps = 6/169 (4%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MA+VL QST +PSLV   + G+        GK KR V M+ S  +P L++ SF+GLRG  
Sbjct  1    MAKVLAQSTIVPSLVTSRSHGR------STGKSKRSVKMMSSLPTPGLRINSFSGLRGST  54

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            +LD M R  Q  HSKVA + S RRGRGSR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  55   SLDNMVRVDQDFHSKVAISISSRRGRGSRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  114

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  115  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  163



>ref|XP_010678345.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Beta vulgaris subsp. vulgaris]
Length=923

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 137/169 (81%), Gaps = 4/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MA  L+QST IP+  A +  GQF+ SGKGK      V M+ S Q+P  ++R+F+GLRGGN
Sbjct  1    MAGALIQSTTIPASFAYQRNGQFQRSGKGKQG----VKMMASLQAPGYRMRNFSGLRGGN  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            ALDT+  + +  +SK+ A  S R+G  SR VV+AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   ALDTLGSTSECFYSKMRAVLSVRKGTASRGVVRAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  165



>gb|KEH35688.1| ATP-dependent Clp protease ATP-binding subunit [Medicago truncatula]
Length=922

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 133/169 (79%), Gaps = 4/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MARVL QS N+P LV G    Q KGSGK K    R V M+C+S++  L++  F+GLR  N
Sbjct  1    MARVLAQSINVPGLVVGHKQSQHKGSGKSK----RSVKMMCASRTIGLRMPGFSGLRTIN  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
             LDTM R G   H+KV+ A S RR R  R + +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   HLDTMLRPGLDFHAKVSMAISSRRARAKRIIPRAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  165



>gb|KCW48520.1| hypothetical protein EUGRSUZ_K02198 [Eucalyptus grandis]
Length=528

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 135/169 (80%), Gaps = 4/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MA VL QS N P++V+G+  G       G  K +R V M+ +  +PS+++R F+GLRG N
Sbjct  1    MAGVLAQSRNAPAIVSGQRYG----GSGGSAKSRRSVKMMSALTAPSIRMRGFSGLRGSN  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            +LDT+  S    HS+VA + S RRG+ SR VV+AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   SLDTLLNSSPDFHSRVANSISFRRGKASRGVVRAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  165



>gb|EYU24516.1| hypothetical protein MIMGU_mgv1a0010411mg, partial [Erythranthe 
guttata]
Length=400

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 132/170 (78%), Gaps = 8/170 (5%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MAR LVQSTN+PS V+      F+GS K K        MLC+S + S ++RSF+GLRG N
Sbjct  1    MARALVQSTNLPSSVSWANNCPFEGSNKTKAGP----TMLCNSLATSARMRSFSGLRGAN  56

Query  281  ALDTMARSG-QTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGH  457
            ++D M +   QTL SKV+ +  G++ R      +AMFERFTEKAIKVIMLAQEEARRLGH
Sbjct  57   SIDMMLQKNIQTLQSKVSVSRRGKKIRTGA---RAMFERFTEKAIKVIMLAQEEARRLGH  113

Query  458  NFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  114  NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  163



>ref|XP_004501745.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X1 [Cicer arietinum]
 ref|XP_004501746.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X2 [Cicer arietinum]
 ref|XP_004501747.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X3 [Cicer arietinum]
Length=923

 Score =   157 bits (397),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 129/170 (76%), Gaps = 5/170 (3%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MARVL Q  N+P LVAG    Q K SGK K    R V M+C+ ++  L++  F+GLR  N
Sbjct  1    MARVLAQPINVPGLVAGHRQNQHKASGKSK----RSVKMMCAFRTNRLRMPGFSGLRTFN  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsra-vvKAMFERFTEKAIKVIMLAQEEARRLGH  457
             LDTM R G   HSKV+ A S  R   +   + KAMFERFTEKAIKVIMLAQEEARRLGH
Sbjct  57   HLDTMLRPGLDFHSKVSIAISSSRRARATRCIPKAMFERFTEKAIKVIMLAQEEARRLGH  116

Query  458  NFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  117  NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  166



>ref|XP_010036862.1| PREDICTED: chaperone protein ClpC, chloroplastic isoform X2 [Eucalyptus 
grandis]
 gb|KCW48519.1| hypothetical protein EUGRSUZ_K02198 [Eucalyptus grandis]
Length=922

 Score =   157 bits (397),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 135/169 (80%), Gaps = 4/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MA VL QS N P++V+G+  G       G  K +R V M+ +  +PS+++R F+GLRG N
Sbjct  1    MAGVLAQSRNAPAIVSGQRYG----GSGGSAKSRRSVKMMSALTAPSIRMRGFSGLRGSN  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            +LDT+  S    HS+VA + S RRG+ SR VV+AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   SLDTLLNSSPDFHSRVANSISFRRGKASRGVVRAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  165



>ref|XP_010036860.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic isoform X1 [Eucalyptus grandis]
 ref|XP_010036861.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic isoform X1 [Eucalyptus grandis]
 gb|KCW48521.1| hypothetical protein EUGRSUZ_K02198 [Eucalyptus grandis]
Length=922

 Score =   157 bits (397),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 135/169 (80%), Gaps = 4/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MA VL QS N P++V+G+  G       G  K +R V M+ +  +PS+++R F+GLRG N
Sbjct  1    MAGVLAQSRNAPAIVSGQRYG----GSGGSAKSRRSVKMMSALTAPSIRMRGFSGLRGSN  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            +LDT+  S    HS+VA + S RRG+ SR VV+AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   SLDTLLNSSPDFHSRVANSISFRRGKASRGVVRAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  165



>ref|XP_007159971.1| hypothetical protein PHAVU_002G282500g [Phaseolus vulgaris]
 gb|ESW31965.1| hypothetical protein PHAVU_002G282500g [Phaseolus vulgaris]
Length=923

 Score =   156 bits (395),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 137/169 (81%), Gaps = 4/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MARVL QS  +P L++G+  GQ KGSGK +    R + M+ S Q P+L++ SF+GLR  N
Sbjct  1    MARVLAQSIGMPGLLSGQRHGQHKGSGKSR----RSLKMMSSLQMPALRMSSFSGLRTVN  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
             LD ++RS ++L SK+  +TS RR R  R V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   NLDLLSRSRRSLPSKMLTSTSSRRERAKRFVPRAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  165



>ref|XP_003526929.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X1 [Glycine max]
 ref|XP_006581844.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X2 [Glycine max]
 gb|KHN09721.1| Chaperone protein ClpC, chloroplastic [Glycine soja]
Length=922

 Score =   156 bits (395),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 132/169 (78%), Gaps = 4/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MARVL QS N+P LVA    GQ     KG GK KR   M+ + ++  L++  F+GLR  N
Sbjct  1    MARVLAQSVNVPGLVAEHRHGQ----QKGSGKLKRSTKMMSALRTNGLRMSGFSGLRTFN  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
             LDTM R G   HSKV+ ATS R+ R +R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   PLDTMLRPGIDFHSKVSIATSSRQARATRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  165



>ref|XP_002322299.1| ATP-dependent clp protease ATP-binding subunit clpA family protein 
[Populus trichocarpa]
 gb|EEF06426.1| ATP-dependent clp protease ATP-binding subunit clpA family protein 
[Populus trichocarpa]
Length=932

 Score =   156 bits (395),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 128/169 (76%), Gaps = 3/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MAR+LV S NIP++       QF+ S K +    R   M+ SS S  L +  ++GLR  N
Sbjct  1    MARLLVHSANIPAVAPCLRHCQFEESKKRRDSSAR---MMSSSPSQGLVMSGYSGLRSAN  57

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
             LDT+ R GQ+ HSKVA   S R+ +  R V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  58   CLDTLLRHGQSFHSKVAITISPRQQKAKRFVPRAMFERFTEKAIKVIMLAQEEARRLGHN  117

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  118  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  166



>ref|XP_010249192.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Nelumbo nucifera]
Length=916

 Score =   156 bits (394),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 132/169 (78%), Gaps = 7/169 (4%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MAR LVQSTN+ + V G+  GQF+GS +      R   M  +  +PSL LR F+GLR  N
Sbjct  1    MARALVQSTNLSAAV-GQHHGQFRGSNR------RSSIMAYNIPAPSLMLRGFSGLRASN  53

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            ALD+M RS    HSKVAAA S  R + SR V  AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  54   ALDSMLRSHCNFHSKVAAAISIPRAKASRGVAVAMFERFTEKAIKVIMLAQEEARRLGHN  113

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  114  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  162



>gb|KHN31263.1| Chaperone protein ClpC, chloroplastic [Glycine soja]
Length=907

 Score =   155 bits (393),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 131/169 (78%), Gaps = 4/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MARVL QS N+P L+A    GQ     K  GK KR   M+ + ++  L++  F+GLR  N
Sbjct  1    MARVLAQSINVPGLLAEHRHGQ----QKESGKLKRSTKMMSALRTNGLRMSGFSGLRTFN  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
             LDTM R G   HSKV+ ATS RR R +R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   PLDTMLRPGIDFHSKVSIATSSRRARATRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  165



>ref|XP_003523172.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
1 [Glycine max]
 ref|XP_003523173.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
2 [Glycine max]
Length=922

 Score =   155 bits (393),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 131/169 (78%), Gaps = 4/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MARVL QS N+P L+A    GQ     K  GK KR   M+ + ++  L++  F+GLR  N
Sbjct  1    MARVLAQSINVPGLLAEHRHGQ----QKESGKLKRSTKMMSALRTNGLRMSGFSGLRTFN  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
             LDTM R G   HSKV+ ATS RR R +R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   PLDTMLRPGIDFHSKVSIATSSRRARATRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  165



>sp|P35100.1|CLPC_PEA RecName: Full=Chaperone protein ClpC, chloroplastic; AltName: 
Full=ATP-dependent Clp protease ATP-binding subunit ClpC homolog; 
AltName: Full=Casein lytic proteinase C; Flags: Precursor 
[Pisum sativum]
 gb|AAA33680.1| nuclear encoded precursor to chloroplast protein [Pisum sativum]
Length=922

 Score =   155 bits (392),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 132/169 (78%), Gaps = 4/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MARVL QS ++P LVAG    Q KGSGK K    R V  +C+ ++  L++  F+GLR  N
Sbjct  1    MARVLAQSLSVPGLVAGHKDSQHKGSGKSK----RSVKTMCALRTSGLRMSGFSGLRTFN  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
             L+TM R G   HSKV+ A S RR R  R + +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   HLNTMMRPGLDFHSKVSKAVSSRRARAKRFIPRAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  165



>ref|XP_009368798.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Pyrus x bretschneideri]
Length=921

 Score =   155 bits (392),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 125/169 (74%), Gaps = 5/169 (3%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MAR LVQST IPS+  G  +G             R   M C+ ++P+L++ S+TGLR  N
Sbjct  1    MARNLVQSTYIPSVATGRRLG-----YSKGSGNARRTVMFCTLRAPALRMSSYTGLRSVN  55

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            ALD   +    L S V  A + RR R SR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  56   ALDVSVKPRHDLFSTVKFANTKRRERASRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  164



>ref|XP_008374277.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Malus domestica]
Length=936

 Score =   155 bits (392),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 125/169 (74%), Gaps = 5/169 (3%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MAR LVQST IPS+  G  +G             R   M C+ ++P+L++ S+TGLR  N
Sbjct  1    MARNLVQSTYIPSVATGRRLG-----YSKGSGNARRTVMFCTLRAPALRMSSYTGLRSVN  55

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            ALD   +    L S V  A + RR R SR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  56   ALDVSVKPRHDLFSTVKFANTKRRERASRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  164



>ref|XP_009337515.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Pyrus x bretschneideri]
 ref|XP_009337516.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Pyrus x bretschneideri]
Length=921

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 125/169 (74%), Gaps = 5/169 (3%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MA  LVQST IPSLV G  +G             R   MLC+ ++P+L++  +TGLR  N
Sbjct  1    MATNLVQSTYIPSLVTGRRLG-----YSKGSGNARRTVMLCTLRAPALRMSCYTGLRSVN  55

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            ALD   +  + L S V  A + R  R SR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  56   ALDISVKPRRDLFSSVKFANTKRCERASRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  164



>ref|XP_006376920.1| hypothetical protein POPTR_0012s10770g [Populus trichocarpa]
 ref|XP_006376921.1| ATP-dependent clp protease ATP-binding subunit clpA family protein 
[Populus trichocarpa]
 gb|ERP54717.1| hypothetical protein POPTR_0012s10770g [Populus trichocarpa]
 gb|ERP54718.1| ATP-dependent clp protease ATP-binding subunit clpA family protein 
[Populus trichocarpa]
Length=926

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 127/169 (75%), Gaps = 3/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MAR+LV S NIP++       Q++ S K +    +   M+CS  S  L +  ++GLR  N
Sbjct  1    MARLLVHSANIPAVAPCPRHCQYEESKKSRASSAK---MMCSLPSRGLVISGYSGLRSAN  57

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
             LDT+ R G + HSKVA   S R+ +  R V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  58   CLDTLLRHGHSFHSKVAITISPRQQKAKRFVPRAMFERFTEKAIKVIMLAQEEARRLGHN  117

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  118  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  166



>ref|XP_011042955.1| PREDICTED: chaperone protein ClpC, chloroplastic [Populus euphratica]
Length=926

 Score =   154 bits (390),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 127/169 (75%), Gaps = 3/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MAR+LV S NIP++       Q++ S K +    +   M+CS  S  L +  ++GLR  N
Sbjct  1    MARLLVHSANIPAVAPCPRHRQYEESKKSRASSAK---MMCSLPSRGLVISGYSGLRSAN  57

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
             LDT+ R G + HSKVA   S R+ +  R V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  58   CLDTLLRHGHSFHSKVAITISPRQQKAKRFVPRAMFERFTEKAIKVIMLAQEEARRLGHN  117

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  118  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  166



>ref|XP_003630582.1| ATP-dependent Clp protease ATP-binding subunit clpA-like protein 
[Medicago truncatula]
 gb|AET05058.1| ATP-dependent Clp protease ATP-binding subunit [Medicago truncatula]
Length=926

 Score =   153 bits (387),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 132/172 (77%), Gaps = 6/172 (3%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            M+R L QS N+P LVAG    +   + KG  + +R V M+ ++++ S +L S++GLR  N
Sbjct  1    MSRALAQSINVPGLVAGR---RHVNNNKGAARSRRSVRMMFTTRTASPRLSSYSGLRTLN  57

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrg---sravvKAMFERFTEKAIKVIMLAQEEARRL  451
            +LD+M R GQ  HSKV       R +G   SR V KAMFERFTEKAIKVIMLAQEEARRL
Sbjct  58   SLDSMLRPGQDFHSKVLTQIGTNRAKGGRGSRCVTKAMFERFTEKAIKVIMLAQEEARRL  117

Query  452  GHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            GHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  118  GHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  169



>ref|XP_008778670.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Phoenix dactylifera]
Length=195

 Score =   143 bits (360),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 128/169 (76%), Gaps = 4/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MA  LVQS  +PS V     GQ KG+GK +    +   M+ + +S  L+L+ F GLRG N
Sbjct  1    MAGALVQSAILPSQVVSRNRGQLKGAGKTR----KAPKMMGNLRSHPLRLQDFAGLRGAN  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
             LD ++RS Q  HS V+A  S  +G+  R V  AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   NLDLLSRSRQDFHSLVSAYISSPQGKACRGVPVAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMG+NLKDARVEVEKIIGRGSGFVA
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGVNLKDARVEVEKIIGRGSGFVA  165



>ref|XP_010519480.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Tarenaya 
hassleriana]
 ref|XP_010519481.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Tarenaya 
hassleriana]
Length=926

 Score =   152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = +2

Query  203  RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  382
            R V M+   Q+  L+++SF+GLR  NALD MARSGQ  HSKV    S  +G+G R V KA
Sbjct  30   RCVKMMSGLQASGLRMQSFSGLRSSNALDFMARSGQDFHSKVRLHISSCKGKGCRFVPKA  89

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  90   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  149

Query  563  VEVEKIIGRGSGFVA  607
            VEVEKIIGRGSGFVA
Sbjct  150  VEVEKIIGRGSGFVA  164



>ref|XP_007137864.1| hypothetical protein PHAVU_009G162100g [Phaseolus vulgaris]
 gb|ESW09858.1| hypothetical protein PHAVU_009G162100g [Phaseolus vulgaris]
Length=922

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 131/169 (78%), Gaps = 4/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MARVL QS  +P LVA    GQ     KG GK KR   M+ + ++  L++  FTGLR  N
Sbjct  1    MARVLAQSVTVPGLVAEHRHGQ----QKGSGKLKRPAKMMSAVRTNGLRMSGFTGLRTFN  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
             LDTM R G    SKV+ ATS RRGR +R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   PLDTMLRPGIDFRSKVSIATSARRGRATRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  165



>ref|XP_006402040.1| hypothetical protein EUTSA_v10012603mg [Eutrema salsugineum]
 gb|ESQ43493.1| hypothetical protein EUTSA_v10012603mg [Eutrema salsugineum]
Length=929

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 129/169 (76%), Gaps = 6/169 (4%)
 Frame = +2

Query  104  ARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSS-QSPSLKLRSFTGLRGGN  280
             RVL QST  PSL    A  Q     +G G+ +R V M+CS  Q   L+++ F GLRG N
Sbjct  5    TRVLAQSTP-PSL----ACYQRNVPSRGSGRTRRPVKMMCSQLQVSGLRMQGFLGLRGNN  59

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
             LDT+ RS Q  HS+V  A +  +G+ SR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  60   VLDTLGRSRQDFHSRVRQAMNVPKGKASRCVTKAMFERFTEKAIKVIMLAQEEARRLGHN  119

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  120  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  168



>ref|XP_008392716.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Malus domestica]
Length=921

 Score =   151 bits (381),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 125/169 (74%), Gaps = 5/169 (3%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MA  LVQST IPS+  G  +G             R   MLC+ ++P+L++  +TGLR  N
Sbjct  1    MATNLVQSTYIPSVAMGRRLG-----YSKGSGNARRTVMLCTLRAPALRMSGYTGLRSVN  55

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            ALD   +  + L S V  A + RR R SR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  56   ALDISVKPRRDLFSSVKFANTKRRERASRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  164



>ref|NP_568746.1| ATP-dependent Clp protease ATP-binding subunit ClpC [Arabidopsis 
thaliana]
 sp|Q9FI56.1|CLPC1_ARATH RecName: Full=Chaperone protein ClpC1, chloroplastic; AltName: 
Full=ATP-dependent Clp protease ATP-binding subunit ClpC homolog 
1; AltName: Full=Casein lytic proteinase C1; AltName: 
Full=Protein DE-REGULATED CAO ACCUMULATION 1; AltName: Full=Protein 
IRON-RESCUED MUTANT 1; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB08738.1| ATP-dependent Clp protease, ATP-binding subunit [Arabidopsis 
thaliana]
 gb|AAM26692.1| AT5g50920/K3K7_7 [Arabidopsis thaliana]
 dbj|BAE99213.1| ATP-dependent Clp protease [Arabidopsis thaliana]
 gb|AED96011.1| ATP-dependent Clp protease ATP-binding subunit ClpC [Arabidopsis 
thaliana]
Length=929

 Score =   151 bits (381),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 130/169 (77%), Gaps = 6/169 (4%)
 Frame = +2

Query  104  ARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSS-QSPSLKLRSFTGLRGGN  280
             RVL QST  PSL    A  Q     +G G+ +R V M+CS  Q   L+++ F GLRG N
Sbjct  5    TRVLAQSTP-PSL----ACYQRNVPSRGSGRSRRSVKMMCSQLQVSGLRMQGFMGLRGNN  59

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            ALDT+ +S Q  HSKV  A +  +G+ SR  VKAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  60   ALDTLGKSRQDFHSKVRQAMNVPKGKASRFTVKAMFERFTEKAIKVIMLAQEEARRLGHN  119

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  120  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  168



>ref|XP_010250552.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like isoform X1 [Nelumbo nucifera]
Length=945

 Score =   151 bits (381),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 130/170 (76%), Gaps = 6/170 (4%)
 Frame = +2

Query  98   IMARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGG  277
            IMA  LVQ TN+ + VAG+  GQ +GSG+   K      ML     PSL LR F+GLR  
Sbjct  29   IMAMALVQLTNLSAAVAGQCHGQLRGSGRNPSK------MLFHVPFPSLLLRGFSGLRAS  82

Query  278  NALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGH  457
            NALD+M RS    HS V AA S  RG+ SR V  AMFERFTEKAIKVIMLAQEEARRLGH
Sbjct  83   NALDSMLRSHCNFHSMVTAAISVPRGKASRGVAVAMFERFTEKAIKVIMLAQEEARRLGH  142

Query  458  NFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  143  NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  192



>ref|XP_011040255.1| PREDICTED: chaperone protein ClpC, chloroplastic [Populus euphratica]
 ref|XP_011040256.1| PREDICTED: chaperone protein ClpC, chloroplastic [Populus euphratica]
Length=926

 Score =   150 bits (378),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 126/169 (75%), Gaps = 3/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MAR+LV S NIP++       QF+ S K +      V M+ S  S  L +  ++GLR  N
Sbjct  1    MARLLVYSANIPAVAPRLRHCQFEESKKRRDSS---VKMMSSLPSRGLVMSGYSGLRSAN  57

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
             LDT+ R G + HSKVA   S R+ +  R V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  58   CLDTLLRHGHSFHSKVAITISPRQQKAKRFVPRAMFERFTEKAIKVIMLAQEEARRLGHN  117

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  118  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  166



>ref|XP_002865831.1| heat shock protein 93-V [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42090.1| heat shock protein 93-V [Arabidopsis lyrata subsp. lyrata]
Length=929

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 130/169 (77%), Gaps = 6/169 (4%)
 Frame = +2

Query  104  ARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSS-QSPSLKLRSFTGLRGGN  280
             RVL QST  PSL    A  Q     +G G+ +R V M+CS  Q   L+++ F GLRG N
Sbjct  5    TRVLAQSTP-PSL----ACYQRNVPSRGSGRSRRSVKMMCSQLQVSGLRMQGFLGLRGNN  59

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            ALDT+ ++ Q  HSKV  A +  +G+ SR  VKAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  60   ALDTLGKNRQDFHSKVRQAMNVPKGKASRFTVKAMFERFTEKAIKVIMLAQEEARRLGHN  119

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  120  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  168



>ref|XP_010250553.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like isoform X2 [Nelumbo nucifera]
 ref|XP_010250554.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like isoform X2 [Nelumbo nucifera]
Length=916

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 129/169 (76%), Gaps = 6/169 (4%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MA  LVQ TN+ + VAG+  GQ +GSG+   K      ML     PSL LR F+GLR  N
Sbjct  1    MAMALVQLTNLSAAVAGQCHGQLRGSGRNPSK------MLFHVPFPSLLLRGFSGLRASN  54

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            ALD+M RS    HS V AA S  RG+ SR V  AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  55   ALDSMLRSHCNFHSMVTAAISVPRGKASRGVAVAMFERFTEKAIKVIMLAQEEARRLGHN  114

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  115  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  163



>ref|XP_003525431.1| PREDICTED: chaperone protein ClpC, chloroplastic-like [Glycine 
max]
 gb|KHN17465.1| Chaperone protein ClpC, chloroplastic [Glycine soja]
Length=919

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 133/169 (79%), Gaps = 8/169 (5%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MARVLVQST +P L++G+  G+ KGSGK K    R V M+ + + P+L++ SF+GLR  N
Sbjct  1    MARVLVQSTGMPGLLSGQRHGKHKGSGKSK----RSVKMMSTLRMPALRMSSFSGLRTLN  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
             +D+++R   T        T+ RR R  R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   PMDSLSRPRHTF----PLNTTSRRERAKRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  112

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  113  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  161



>gb|KEH35794.1| ATP-dependent Clp protease ATP-binding subunit [Medicago truncatula]
Length=927

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 126/172 (73%), Gaps = 5/172 (3%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            M+RVL QS N+P LVAG        +        R V M+ ++Q+ +++L  F+GLR  N
Sbjct  1    MSRVLAQSINVPGLVAGRR--HVNNNNGSVRSRPRSVRMMYATQTATMRLSGFSGLRPLN  58

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrg---sravvKAMFERFTEKAIKVIMLAQEEARRL  451
            +LD+M R  Q  HSKV       R RG   SR V +AMFERFTEKAIKVIMLAQEEARRL
Sbjct  59   SLDSMFRPRQDFHSKVLTQIGTNRARGGRGSRCVTRAMFERFTEKAIKVIMLAQEEARRL  118

Query  452  GHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            GHNFVGTEQILLGLIGEGTGI AKVLKSMGINLKD+RVEVEKIIGRGSGFVA
Sbjct  119  GHNFVGTEQILLGLIGEGTGIGAKVLKSMGINLKDSRVEVEKIIGRGSGFVA  170



>gb|AAC04687.1| ClpC [Arabidopsis thaliana]
Length=928

 Score =   147 bits (372),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 128/168 (76%), Gaps = 5/168 (3%)
 Frame = +2

Query  104  ARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNA  283
             RVL QST  PSL    A  Q     +G G+ +R V M+C   +  L ++ F GLRG NA
Sbjct  5    TRVLAQSTP-PSL----ACYQRNVPSRGSGRSRRSVKMMCIIFNVWLPMQGFMGLRGNNA  59

Query  284  LDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNF  463
            LDT+ +S Q  HSKV  A +  +G+ SR  VKAMFERFTEKAIKVIMLAQEEARRLGHNF
Sbjct  60   LDTLGKSRQDFHSKVRQAMNVPKGKASRFTVKAMFERFTEKAIKVIMLAQEEARRLGHNF  119

Query  464  VgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            VGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  120  VGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  167



>ref|XP_006279971.1| hypothetical protein CARUB_v10025837mg [Capsella rubella]
 gb|EOA12869.1| hypothetical protein CARUB_v10025837mg [Capsella rubella]
Length=929

 Score =   147 bits (372),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 128/169 (76%), Gaps = 6/169 (4%)
 Frame = +2

Query  104  ARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSS-QSPSLKLRSFTGLRGGN  280
             RVL QST  PSL    A  Q     +G G+ +R V M+CS  Q    +++ F GLRG N
Sbjct  5    TRVLAQSTP-PSL----ACYQRNVPSRGSGRSRRSVKMMCSQLQVSGSRMQGFLGLRGSN  59

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            ALDT+ ++ Q  HSKV  A +  +G+ SR   KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  60   ALDTLGKTRQDFHSKVRQAMTVPKGKASRCTTKAMFERFTEKAIKVIMLAQEEARRLGHN  119

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  120  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  168



>ref|XP_010550758.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Tarenaya hassleriana]
 ref|XP_010550759.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Tarenaya hassleriana]
Length=926

 Score =   147 bits (370),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 133/169 (79%), Gaps = 5/169 (3%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MAR+L  ST + SL A     ++    +G GK +R V M+ + ++P L+++SF+GLR  N
Sbjct  1    MARLLAHST-VSSLFAS----RWNVQSQGSGKPRRYVKMMYNLEAPGLRIQSFSGLRSSN  55

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            +LD +ARSG   HSKV   TS R+G+  R V KAMFERFTEKAIKVIMLAQEEA+RLGHN
Sbjct  56   SLDFIARSGHDFHSKVRLQTSSRKGKACRFVPKAMFERFTEKAIKVIMLAQEEAQRLGHN  115

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKS+GINLK ARVEVEKIIGRGSGFVA
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSLGINLKYARVEVEKIIGRGSGFVA  164



>emb|CDX83052.1| BnaA01g20520D [Brassica napus]
Length=927

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 125/169 (74%), Gaps = 5/169 (3%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MAR+L   T  P L  G  +           K +R V M+ +SQ+P L ++SF+GLR  N
Sbjct  1    MARLLANFTARPLLGPGRHV-----QSDDYRKPRRCVKMMYTSQTPVLSIQSFSGLRAAN  55

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            A+D +AR      SKV    S R+G+ SR V KAMFERFTEKAIKVIML+QEEARRLGHN
Sbjct  56   AVDLIARPAHGFFSKVNLQISSRKGKSSRCVTKAMFERFTEKAIKVIMLSQEEARRLGHN  115

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVEVEKIIGRGSGFVA
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVEVEKIIGRGSGFVA  164



>ref|XP_009151567.1| PREDICTED: chaperone protein ClpC2, chloroplastic [Brassica rapa]
 ref|XP_009151572.1| PREDICTED: chaperone protein ClpC2, chloroplastic [Brassica rapa]
Length=928

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 125/169 (74%), Gaps = 5/169 (3%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MAR+L   T  P L  G  +           K +R V M+ +SQ+P L ++SF+GLR  N
Sbjct  1    MARLLANFTARPLLGPGRHV-----QSDDYRKPRRCVKMMYTSQTPVLSIQSFSGLRAAN  55

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            A+D +AR      SKV    S R+G+ SR V KAMFERFTEKAIKVIML+QEEARRLGHN
Sbjct  56   AVDLIARPAHGFFSKVNLQISSRKGKASRCVTKAMFERFTEKAIKVIMLSQEEARRLGHN  115

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVEVEKIIGRGSGFVA
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVEVEKIIGRGSGFVA  164



>gb|KHN16879.1| Chaperone protein ClpC, chloroplastic [Glycine soja]
Length=919

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 130/169 (77%), Gaps = 8/169 (5%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MARVL QST +P L++G   G  KGSGK K    R V M+ + + P+L++ SF+GLR  N
Sbjct  1    MARVLAQSTGMPGLLSGRRHGPHKGSGKTK----RSVKMMSTLRIPALRMSSFSGLRTLN  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
             LD+++R   T        T+ RR R  R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   PLDSVSRPRHTF----PLTTTSRRERAKRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  112

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  113  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  161



>ref|XP_003532383.1| PREDICTED: chaperone protein ClpC, chloroplastic-like [Glycine 
max]
Length=919

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 130/169 (77%), Gaps = 8/169 (5%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MARVL QST +P L++G   G  KGSGK K    R V M+ + + P+L++ SF+GLR  N
Sbjct  1    MARVLAQSTGMPGLLSGRRHGPHKGSGKTK----RSVKMMSTLRIPALRMSSFSGLRTLN  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
             LD+++R   T        T+ RR R  R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   PLDSVSRPRHTF----PLTTTSRRERAKRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  112

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  113  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  161



>ref|XP_011083076.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent Clp protease ATP-binding 
subunit clpA homolog CD4B, chloroplastic [Sesamum 
indicum]
Length=928

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 127/175 (73%), Gaps = 11/175 (6%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MAR LVQSTN+PS V     GQF+GS K K    +   MLC+S S  +++RSF+GLRG N
Sbjct  1    MARALVQSTNLPSSVGFVNNGQFEGSNKTK----KASTMLCNSWSAPVRMRSFSGLRGAN  56

Query  281  ALDTMA-RSGQTLHSKvaaats-----grrgrgsravvKAMFERFTEKAIKVIMLAQEEA  442
            ALD M  RSGQTL SKVAA  S       R            E F  KAIKVIMLAQEEA
Sbjct  57   ALDVMVQRSGQTLQSKVAATNSGKRGRKLRMAXXXXXXXXXXEGFX-KAIKVIMLAQEEA  115

Query  443  RRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            RRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  116  RRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  170



>ref|XP_010942381.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Elaeis guineensis]
Length=920

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 129/169 (76%), Gaps = 4/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MA  LVQS  +P  V      Q KGSGK +    +   M+C+ +S +L+L++F GLRG N
Sbjct  1    MAGALVQSAILPVQVVSRTCEQLKGSGKTR----KAAKMMCNLRSHALRLQAFAGLRGAN  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
             LD ++RS Q  HS V+A  S  +G+  R V  AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   NLDLLSRSRQDFHSLVSAYISAPQGKACRGVPVAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  165



>ref|XP_010482409.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Camelina sativa]
Length=929

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 128/169 (76%), Gaps = 6/169 (4%)
 Frame = +2

Query  104  ARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSS-QSPSLKLRSFTGLRGGN  280
             RVL QST  PSL    A  Q     +G G+ +R V M+CS  Q    +++ F GLRG N
Sbjct  5    TRVLAQSTP-PSL----ACYQRNVPSRGSGRSRRSVKMMCSQLQVSGSRMQGFMGLRGSN  59

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            ALDT+  + Q  HSKV  A +  +G+ SR  VKAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  60   ALDTLGSTRQDFHSKVRQAMNVPKGKASRCTVKAMFERFTEKAIKVIMLAQEEARRLGHN  119

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  120  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  168



>ref|XP_010442575.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Camelina 
sativa]
Length=929

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 128/169 (76%), Gaps = 6/169 (4%)
 Frame = +2

Query  104  ARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSS-QSPSLKLRSFTGLRGGN  280
             RVL QST  PSL    A  Q     +G G+ +R V M+CS  Q    +++ F GLRG N
Sbjct  5    TRVLAQSTP-PSL----ACYQRNVPSRGSGRSRRSVKMMCSQLQVSGSRMQGFMGLRGSN  59

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            ALDT+  + Q  HSKV  + +  +G+ SR  VKAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  60   ALDTLGSTRQDFHSKVRQSMNVPKGKASRCTVKAMFERFTEKAIKVIMLAQEEARRLGHN  119

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  120  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  168



>ref|XP_010555578.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Tarenaya hassleriana]
 ref|XP_010555579.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Tarenaya hassleriana]
Length=927

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = +2

Query  215  MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  394
            M    Q+P L+++ F GLRG N LD + RS Q  HSKV    S RRG+ SR + KAMFER
Sbjct  38   MSSQPQAPGLRIQGFLGLRGQNVLDMLGRSRQDFHSKVRLTMSSRRGKPSRCMPKAMFER  97

Query  395  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVE  574
            FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE
Sbjct  98   FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE  157

Query  575  KIIGRGSGFVA  607
            KIIGRGSGFVA
Sbjct  158  KIIGRGSGFVA  168



>ref|XP_010442573.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Camelina 
sativa]
Length=929

 Score =   145 bits (365),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 128/169 (76%), Gaps = 6/169 (4%)
 Frame = +2

Query  104  ARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSS-QSPSLKLRSFTGLRGGN  280
             RVL QST  PSL    A  Q     +G G+ +R V M+CS  Q    +++ F GLRG N
Sbjct  5    TRVLAQSTP-PSL----ACYQRNVPSRGSGRSRRSVKMMCSQLQVSGSRMQGFMGLRGRN  59

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            ALDT+  + Q  HSKV  A +  +G+ SR  VKAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  60   ALDTLGSTRQDFHSKVRQAMNVPKGKASRCTVKAMFERFTEKAIKVIMLAQEEARRLGHN  119

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  120  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  168



>ref|XP_010426385.1| PREDICTED: chaperone protein ClpC2, chloroplastic [Camelina sativa]
 ref|XP_010426386.1| PREDICTED: chaperone protein ClpC2, chloroplastic [Camelina sativa]
Length=927

 Score =   144 bits (363),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 108/133 (81%), Gaps = 0/133 (0%)
 Frame = +2

Query  209  VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  388
            V M+ S Q+P LK++ FTGLR  NALD  AR  Q   SKV    S R  +  R V KAMF
Sbjct  31   VKMMFSVQAPVLKIQCFTGLRASNALDFRARPSQDFVSKVNRNISSRNEKARRCVPKAMF  90

Query  389  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  568
            ERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVE
Sbjct  91   ERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVE  150

Query  569  VEKIIGRGSGFVA  607
            VEKIIGRGSGFVA
Sbjct  151  VEKIIGRGSGFVA  163



>ref|XP_002877635.1| AtClpC [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53894.1| AtClpC [Arabidopsis lyrata subsp. lyrata]
Length=953

 Score =   144 bits (363),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = +2

Query  209  VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  388
            V M+CS Q+P LK++SF+GLR  +ALD MAR       K   A S RR + SR V KAMF
Sbjct  56   VKMMCSLQAPVLKIQSFSGLRAPSALDYMARPSPGFLVKFKRAISSRREKASRCVPKAMF  115

Query  389  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  568
            ERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVE
Sbjct  116  ERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVE  175

Query  569  VEKIIGRGSGFVA  607
            VEKIIGRGSGFVA
Sbjct  176  VEKIIGRGSGFVA  188



>ref|XP_006290258.1| hypothetical protein CARUB_v10016640mg [Capsella rubella]
 gb|EOA23156.1| hypothetical protein CARUB_v10016640mg [Capsella rubella]
Length=750

 Score =   143 bits (361),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 106/133 (80%), Gaps = 0/133 (0%)
 Frame = +2

Query  209  VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  388
            V M+ S Q+P LKL SF GLR  N LD M R  Q   S    +   R+ +G R V KAMF
Sbjct  81   VKMMYSCQAPVLKLHSFAGLRATNPLDIMGRPRQDWFSMSKLSIPKRKDKGKRCVTKAMF  140

Query  389  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  568
            ERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVE
Sbjct  141  ERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVE  200

Query  569  VEKIIGRGSGFVA  607
            VEKIIGRGSGFVA
Sbjct  201  VEKIIGRGSGFVA  213



>ref|XP_010536586.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like isoform 
X1 [Tarenaya hassleriana]
Length=936

 Score =   144 bits (363),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  233  SPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAI  412
            SP L+++ F GLRG N LDT+ RS Q  HSK+  A +  RG+ +R+   AMFERFTEKAI
Sbjct  52   SPGLRIQGFLGLRGQNVLDTLGRSHQDFHSKIRLAMTSGRGKPTRSTPTAMFERFTEKAI  111

Query  413  KVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRG  592
            KVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRG
Sbjct  112  KVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRG  171

Query  593  SGFVA  607
            SGFVA
Sbjct  172  SGFVA  176



>ref|XP_010536587.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like isoform 
X2 [Tarenaya hassleriana]
Length=929

 Score =   144 bits (363),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  233  SPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAI  412
            SP L+++ F GLRG N LDT+ RS Q  HSK+  A +  RG+ +R+   AMFERFTEKAI
Sbjct  45   SPGLRIQGFLGLRGQNVLDTLGRSHQDFHSKIRLAMTSGRGKPTRSTPTAMFERFTEKAI  104

Query  413  KVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRG  592
            KVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRG
Sbjct  105  KVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRG  164

Query  593  SGFVA  607
            SGFVA
Sbjct  165  SGFVA  169



>gb|EYU21822.1| hypothetical protein MIMGU_mgv1a000973mg [Erythranthe guttata]
Length=925

 Score =   144 bits (363),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 130/171 (76%), Gaps = 6/171 (4%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            M   L++ TN+PS V     GQ  GS K +    +   MLCS+Q  +++L+SF+GLR  N
Sbjct  1    MTHTLIRPTNLPSSVVLGNNGQLNGSNKAR----KAPTMLCSTQPTAIRLQSFSGLRRAN  56

Query  281  ALDTMA-RSGQTLHSKvaaatsgrrg-rgsravvKAMFERFTEKAIKVIMLAQEEARRLG  454
            +LD M  +   TL SKVAAA +  R  R SR   +AMFERFTEKAIKVIMLAQEEARRLG
Sbjct  57   SLDIMVWQPRHTLQSKVAAAIAPVRQGRKSRMAPRAMFERFTEKAIKVIMLAQEEARRLG  116

Query  455  HNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            HNFVGTEQILLGLIGEG+GIAAKV+KSMGINLKDAR+EVEKIIGRGSGFVA
Sbjct  117  HNFVGTEQILLGLIGEGSGIAAKVIKSMGINLKDARIEVEKIIGRGSGFVA  167



>ref|XP_004503801.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X1 [Cicer arietinum]
 ref|XP_004503802.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X2 [Cicer arietinum]
Length=926

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 127/172 (74%), Gaps = 6/172 (3%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            M+R+LV S N+P LV G+  G    + K   K +R V M+ ++ + + ++  F+GLR  N
Sbjct  1    MSRLLVHSLNVPGLVPGQRHGN---NNKVLAKVRRPVKMMFATGTAASRMPGFSGLRTVN  57

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrg---sravvKAMFERFTEKAIKVIMLAQEEARRL  451
            +LD+M R     HSKV       R R    +R V KAMFERFTEKAIKVIMLAQEEARRL
Sbjct  58   SLDSMLRPRLDFHSKVLTQIGTNRARSGRGNRVVPKAMFERFTEKAIKVIMLAQEEARRL  117

Query  452  GHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            GHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  118  GHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  169



>ref|XP_006290259.1| hypothetical protein CARUB_v10016640mg [Capsella rubella]
 gb|EOA23157.1| hypothetical protein CARUB_v10016640mg [Capsella rubella]
Length=977

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 106/133 (80%), Gaps = 0/133 (0%)
 Frame = +2

Query  209  VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  388
            V M+ S Q+P LKL SF GLR  N LD M R  Q   S    +   R+ +G R V KAMF
Sbjct  81   VKMMYSCQAPVLKLHSFAGLRATNPLDIMGRPRQDWFSMSKLSIPKRKDKGKRCVTKAMF  140

Query  389  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  568
            ERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVE
Sbjct  141  ERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVE  200

Query  569  VEKIIGRGSGFVA  607
            VEKIIGRGSGFVA
Sbjct  201  VEKIIGRGSGFVA  213



>emb|CDX68504.1| BnaC01g25820D [Brassica napus]
Length=928

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 120/170 (71%), Gaps = 6/170 (4%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MAR+L   T  P L  G  +           K +R V M+ +SQ+P L ++SF+GLR  N
Sbjct  1    MARLLANFTARPLLGPGRHV-----QSDEYRKPRRCVKMMYTSQTPVLSIQSFSGLRSAN  55

Query  281  ALDTMARSGQTLHSKvaaatsgrr-grgsravvKAMFERFTEKAIKVIMLAQEEARRLGH  457
            A+D +AR      SKV    S R+         KAMFERFTEKAIKVIML+QEEARRLGH
Sbjct  56   AVDLIARPAHGFFSKVNLQISSRKGKASRCVTTKAMFERFTEKAIKVIMLSQEEARRLGH  115

Query  458  NFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVEVEKIIGRGSGFVA
Sbjct  116  NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVEVEKIIGRGSGFVA  165



>ref|XP_011073186.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Sesamum indicum]
Length=924

 Score =   142 bits (358),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 111/133 (83%), Gaps = 2/133 (2%)
 Frame = +2

Query  215  MLCSSQSPSLKLRSFTGLRGGNALDTMAR-SGQTLHSKvaaatsgrrg-rgsravvKAMF  388
            MLCS+    L L  FTGLR  NALD M R +GQTL SK+AA  +  +  + +R V +AMF
Sbjct  35   MLCSAHFAPLTLTGFTGLRRANALDMMVRQAGQTLQSKIAAKNTFAKRGKHARMVPRAMF  94

Query  389  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  568
            ERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVE
Sbjct  95   ERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVE  154

Query  569  VEKIIGRGSGFVA  607
            VEKIIGRGSGFVA
Sbjct  155  VEKIIGRGSGFVA  167



>ref|XP_010503529.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like [Camelina 
sativa]
 ref|XP_010503530.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like [Camelina 
sativa]
Length=928

 Score =   142 bits (357),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 110/134 (82%), Gaps = 1/134 (1%)
 Frame = +2

Query  209  VAMLCSSQSPSLKLRSFTGLRGGNALDTMAR-SGQTLHSKvaaatsgrrgrgsravvKAM  385
            V M+ SSQ+P LK++ FTGL+  NALD  AR S Q   SKV    S R  +  R V KAM
Sbjct  31   VKMMFSSQAPVLKIQCFTGLKASNALDFRARPSHQDFVSKVNLNISYRMEKARRCVPKAM  90

Query  386  FERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARV  565
            FERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RV
Sbjct  91   FERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRV  150

Query  566  EVEKIIGRGSGFVA  607
            EVEKIIGRGSGFVA
Sbjct  151  EVEKIIGRGSGFVA  164



>ref|XP_010515218.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like [Camelina 
sativa]
 ref|XP_010515219.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like [Camelina 
sativa]
Length=928

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 109/134 (81%), Gaps = 1/134 (1%)
 Frame = +2

Query  209  VAMLCSSQSPSLKLRSFTGLRGGNALDTMAR-SGQTLHSKvaaatsgrrgrgsravvKAM  385
            V M+ S Q+P LK++ FTGLR  NALD  AR S Q   SKV    S R  +  R V KAM
Sbjct  31   VKMMFSLQAPVLKIQCFTGLRASNALDFRARPSHQDFVSKVNLNISSRIEKARRCVPKAM  90

Query  386  FERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARV  565
            FERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RV
Sbjct  91   FERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRV  150

Query  566  EVEKIIGRGSGFVA  607
            EVEKIIGRGSGFVA
Sbjct  151  EVEKIIGRGSGFVA  164



>ref|XP_008791045.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Phoenix dactylifera]
Length=920

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 125/169 (74%), Gaps = 4/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MA  L QS  +P+ V     GQ KGSGK +        M+C+ +   L+L+ F GLRG N
Sbjct  1    MAGALFQSAILPAQVLSRNRGQLKGSGKAR----EAAKMMCNMRLHPLRLQGFAGLRGSN  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
             LD ++RS +  HS V+A  S  + +  R V  AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   NLDLLSRSRRDFHSVVSAYISAPQAKACRGVPVAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  165



>emb|CDY45800.1| BnaC03g16230D [Brassica napus]
Length=921

 Score =   139 bits (350),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 114/135 (84%), Gaps = 2/135 (1%)
 Frame = +2

Query  209  VAMLCSSQ--SPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  382
            V M+C+    S S +++ F GLRG NALDT+ RS Q+   KV  A +  +G+GSR VVKA
Sbjct  35   VKMMCTQLQVSGSSRMQGFLGLRGNNALDTLGRSRQSFGGKVRHAMNVPKGKGSRGVVKA  94

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  95   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  154

Query  563  VEVEKIIGRGSGFVA  607
            VEVEKIIGRGSGFVA
Sbjct  155  VEVEKIIGRGSGFVA  169



>ref|XP_009132682.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Brassica rapa]
Length=929

 Score =   139 bits (350),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 113/136 (83%), Gaps = 1/136 (1%)
 Frame = +2

Query  203  RVVAMLCSS-QSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvK  379
            R V M+C+  Q    +++ F GLRG N LDT+ RS Q+   KV  A +  +G+GSR VVK
Sbjct  33   RSVKMMCTQLQVSGSRMQGFLGLRGNNVLDTLGRSRQSFGGKVRQAMNVPKGKGSRGVVK  92

Query  380  AMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDA  559
            AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDA
Sbjct  93   AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDA  152

Query  560  RVEVEKIIGRGSGFVA  607
            RVEVEKIIGRGSGFVA
Sbjct  153  RVEVEKIIGRGSGFVA  168



>ref|XP_008811697.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4A, chloroplastic-like [Phoenix dactylifera]
Length=916

 Score =   139 bits (350),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 124/169 (73%), Gaps = 5/169 (3%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MA  LV+S   P++ +   I       +G  +  R+  M+C+ +   L+L  FTGLR  N
Sbjct  1    MAGTLVKSATFPAVTSRAHI-----QIQGSRRPSRLTLMMCNVRVSPLRLHGFTGLRQLN  55

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            ALD   +SG+  HS ++A     RGR  R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  56   ALDFPYKSGKDFHSLISALNPASRGRAKRVVPKAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKS+GI+LKDAR+EVEKIIGRGSGFVA
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSLGISLKDARIEVEKIIGRGSGFVA  164



>ref|XP_009149790.1| PREDICTED: LOW QUALITY PROTEIN: chaperone protein ClpC2, chloroplastic 
[Brassica rapa]
Length=930

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 121/170 (71%), Gaps = 6/170 (4%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MAR+L  ST+   L +G          +   K +R V M+ +SQ+  L ++SF+GLR  N
Sbjct  1    MARLLANSTSRSLLGSGRDF-----QSEDYRKPRRCVKMMYTSQTSVLSIQSFSGLRASN  55

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsra-vvKAMFERFTEKAIKVIMLAQEEARRLGH  457
            ALD +AR       KV    S  R   +   V KAMFERFTEKAIKVIML+QEEARRLGH
Sbjct  56   ALDRVARPSHDFFGKVNLQMSSSRREKASRGVTKAMFERFTEKAIKVIMLSQEEARRLGH  115

Query  458  NFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVEVEKIIGRGSGFVA
Sbjct  116  NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVEVEKIIGRGSGFVA  165



>ref|XP_006485108.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like isoform X1 [Citrus sinensis]
 ref|XP_006485109.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like isoform X2 [Citrus sinensis]
Length=923

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 124/169 (73%), Gaps = 4/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MAR+L Q TN P+LV G    Q     +  G+ +R V M+   Q  + ++ SF+GLR  N
Sbjct  1    MARLLAQLTNAPALVPGGRHFQ----SQNAGRSRRNVKMMSYMQPSASRISSFSGLRRSN  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            ALDT      +  +   ++  G+ GR    VVKAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   ALDTFTCDFHSTVAVSLSSRRGKSGRAGGFVVKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  165



>gb|AAL10478.1| AT3g48870/T21J18_140 [Arabidopsis thaliana]
Length=558

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 107/133 (80%), Gaps = 0/133 (0%)
 Frame = +2

Query  209  VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  388
            V M+ S Q+P L ++SF+GLR  +ALD + R       K   A S  R + SR V KAMF
Sbjct  56   VKMMSSLQAPLLTIQSFSGLRAPSALDYLGRPSPGFLVKYKLAKSSGREKASRCVPKAMF  115

Query  389  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  568
            ERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVE
Sbjct  116  ERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVE  175

Query  569  VEKIIGRGSGFVA  607
            VEKIIGRGSGFVA
Sbjct  176  VEKIIGRGSGFVA  188



>ref|XP_009387981.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009387982.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=922

 Score =   136 bits (342),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 123/169 (73%), Gaps = 4/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MA  LVQ T +PS +A     Q +GSGK K    R   M+C  Q   L+L  F GLR  +
Sbjct  1    MAGSLVQLTILPSALANRRQSQLRGSGKAK----RGAKMMCQLQMHPLRLPGFAGLRRAD  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
             L+  +R+    HS V+   S   G+ SR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   NLEFFSRNRHDFHSLVSVYVSYAWGKASRGVAKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  165



>ref|XP_009393873.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=922

 Score =   136 bits (342),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 125/169 (74%), Gaps = 4/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MA  LV S  +PS V   +  Q +GSGK K    R   M+ S +   L+L+SF GLR  +
Sbjct  1    MADSLVHSAILPSAVMTRSQSQLRGSGKAK----RGAKMVRSMRMHPLRLQSFAGLRAAD  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
             LD  +R  Q  HS V+   S  RG+ +R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   NLDFSSRCQQDFHSVVSRYISNPRGKATRGVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  165



>ref|XP_009403788.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=922

 Score =   135 bits (341),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 128/169 (76%), Gaps = 4/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MA  LVQS  +P++    A+ + +   +G GK KR   M+C  +  SL+L+ F GLR  +
Sbjct  1    MAGSLVQSAILPTV----AVNRIQSHLRGSGKVKRGSKMMCQPRKHSLRLQGFAGLRRSD  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
             ++  +R+ +  HS V+   S  RG+ SR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   NVEFSSRNQRDFHSVVSGYISYSRGKASRGVAKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  165



>ref|NP_001190035.1| Clp ATPase [Arabidopsis thaliana]
 gb|AEE78467.1| Clp ATPase [Arabidopsis thaliana]
Length=921

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 107/133 (80%), Gaps = 0/133 (0%)
 Frame = +2

Query  209  VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  388
            V M+ S Q+P L ++SF+GLR  +ALD + R       K   A S  R + SR V KAMF
Sbjct  25   VKMMSSLQAPLLTIQSFSGLRAPSALDYLGRPSPGFLVKYKLAKSSGREKASRCVPKAMF  84

Query  389  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  568
            ERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVE
Sbjct  85   ERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVE  144

Query  569  VEKIIGRGSGFVA  607
            VEKIIGRGSGFVA
Sbjct  145  VEKIIGRGSGFVA  157



>ref|NP_566912.2| Clp ATPase [Arabidopsis thaliana]
 sp|Q9SXJ7.1|CLPC2_ARATH RecName: Full=Chaperone protein ClpC2, chloroplastic; AltName: 
Full=ATP-dependent Clp protease ATP-binding subunit ClpC homolog 
2; AltName: Full=AtClpC; AltName: Full=Casein lytic proteinase 
C2; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAA82062.1| AtClpC [Arabidopsis thaliana]
 gb|AEE78466.1| Clp ATPase [Arabidopsis thaliana]
Length=952

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 107/133 (80%), Gaps = 0/133 (0%)
 Frame = +2

Query  209  VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  388
            V M+ S Q+P L ++SF+GLR  +ALD + R       K   A S  R + SR V KAMF
Sbjct  56   VKMMSSLQAPLLTIQSFSGLRAPSALDYLGRPSPGFLVKYKLAKSSGREKASRCVPKAMF  115

Query  389  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  568
            ERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVE
Sbjct  116  ERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVE  175

Query  569  VEKIIGRGSGFVA  607
            VEKIIGRGSGFVA
Sbjct  176  VEKIIGRGSGFVA  188



>emb|CAB87915.1| AtClpC [Arabidopsis thaliana]
Length=952

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 107/133 (80%), Gaps = 0/133 (0%)
 Frame = +2

Query  209  VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  388
            V M+ S Q+P L ++SF+GLR  +ALD + R       K   A S  R + SR V KAMF
Sbjct  56   VKMMSSLQAPLLTIQSFSGLRAPSALDYLGRPSPGFLVKYKLAKSSGREKASRCVPKAMF  115

Query  389  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  568
            ERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVE
Sbjct  116  ERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVE  175

Query  569  VEKIIGRGSGFVA  607
            VEKIIGRGSGFVA
Sbjct  176  VEKIIGRGSGFVA  188



>ref|XP_010929657.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Elaeis guineensis]
Length=920

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 127/169 (75%), Gaps = 4/169 (2%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MA  LVQS  +P+ V      Q KGSG+ +G       M+ + +  S++L+ F GLRG N
Sbjct  1    MAGALVQSAVLPAQVLSRNHRQLKGSGRTRG----AAKMMYNMRLHSIRLQGFAGLRGSN  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
             LD ++RS +  HS V+A  S  +G+  R V  AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   NLDLLSRSRRDFHSVVSAYISAPQGKACRGVPVAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  165



>ref|XP_006404210.1| hypothetical protein EUTSA_v10010105mg [Eutrema salsugineum]
 gb|ESQ45663.1| hypothetical protein EUTSA_v10010105mg [Eutrema salsugineum]
Length=929

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = +2

Query  209  VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  388
            V M+ S  +P L +R+++GLR  +ALD MA       +KV  + S R+G+ SR V KAMF
Sbjct  32   VKMMSSLHAPVLSIRNYSGLRVNSALDLMASRSPDFFAKVNISISSRKGKASRCVPKAMF  91

Query  389  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  568
            ERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVE
Sbjct  92   ERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVE  151

Query  569  VEKIIGRGSGFVA  607
            VEKIIGRGSGFVA
Sbjct  152  VEKIIGRGSGFVA  164



>ref|XP_010921845.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4A, chloroplastic-like [Elaeis guineensis]
Length=914

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = +2

Query  203  RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  382
            R+  M+C+ +   L+++ FTGLR  NALD   +SG+  H  ++A +   RGR  R V KA
Sbjct  30   RLALMMCNVRVSPLRMQGFTGLRQLNALDFPYKSGRDFHFLISALSPTARGRAKRVVPKA  89

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKS+GI+LKDAR
Sbjct  90   VFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSLGISLKDAR  149

Query  563  VEVEKIIGRGSGFVA  607
             EVEKIIGRGSGFVA
Sbjct  150  AEVEKIIGRGSGFVA  164



>ref|XP_009411804.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Musa acuminata subsp. malaccensis]
 ref|XP_009411805.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=921

 Score =   130 bits (327),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 128/169 (76%), Gaps = 5/169 (3%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MAR L +S+ +P  V+G ++  F+GSGK +    +   M+CS +S  L+   FTGL+G N
Sbjct  1    MARPLFKSSVLPDAVSG-SVPLFQGSGKAR----KPANMMCSRRSSQLRFLGFTGLKGSN  55

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
             L  ++   +     V+A+ S  +G+ SR V  AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  56   DLHLVSGPSKDFRLAVSASVSAPKGKASRGVAVAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR+EVEKIIGRGSGFVA
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARIEVEKIIGRGSGFVA  164



>ref|XP_009404743.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009404744.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=921

 Score =   129 bits (325),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 126/169 (75%), Gaps = 5/169 (3%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MA  LVQS  +P+++   +  Q +GSGK K    R   M+C  Q   L+L+ F GLR  +
Sbjct  1    MAGSLVQSAVLPAVIMNRSHSQLQGSGKAK----RGARMICQLQMHPLRLQGFAGLRVAD  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
             L + +R  Q  HS V+   +  RGR SR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   NLFS-SRHRQDFHSVVSGYITNPRGRPSRLVTKAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGI+LKDARVEVEKIIGRGSGFVA
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGISLKDARVEVEKIIGRGSGFVA  164



>tpg|DAA38057.1| TPA: hypothetical protein ZEAMMB73_563254, partial [Zea mays]
Length=188

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 104/169 (62%), Positives = 121/169 (72%), Gaps = 5/169 (3%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            M   LVQS  +P++    + G+F+   + +        M+ +  + +L L  F GLR  N
Sbjct  1    MEGTLVQSAVVPTVYRSSS-GRFRVRARARTNA----TMVRNMPTRTLTLGGFQGLRQTN  55

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
             LDT +   +   S VA+  +  RG  SR VV+AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  56   FLDTRSVIKRDFGSIVASQIARPRGSASRGVVRAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  164



>emb|CDY05878.1| BnaC08g20550D [Brassica napus]
Length=932

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 106/136 (78%), Gaps = 2/136 (1%)
 Frame = +2

Query  206  VVAMLCSSQSPSLKLRSFTGLRGG-NALDTMARSGQTLHSKvaaatsgrrgrgsra-vvK  379
            V  M+ +SQ+  L ++SF+GLR   NALD +AR       KV    S  R   +   V K
Sbjct  32   VKMMMYTSQTSVLSIQSFSGLRASSNALDRVARPSHDFFGKVNLQISSSRKGKASRGVTK  91

Query  380  AMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDA  559
            AMFERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+
Sbjct  92   AMFERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDS  151

Query  560  RVEVEKIIGRGSGFVA  607
            RVEVEKIIGRGSGFVA
Sbjct  152  RVEVEKIIGRGSGFVA  167



>ref|XP_003575035.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Brachypodium 
distachyon]
Length=921

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = +2

Query  212  AMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFE  391
            A +CS ++ ++ L  F GLR  N LDT +   +   S VA+  +  RG+GSR VV+AMFE
Sbjct  33   ASVCSMRTQTMTLGGFQGLRRANFLDTRSVVRRDFGSIVASQLARPRGKGSRMVVRAMFE  92

Query  392  RFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEV  571
            RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEV
Sbjct  93   RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEV  152

Query  572  EKIIGRGSGFVA  607
            EKIIGRGSGFVA
Sbjct  153  EKIIGRGSGFVA  164



>sp|P46523.1|CLPA_BRANA RecName: Full=ATP-dependent Clp protease ATP-binding subunit 
clpA homolog, chloroplastic; Flags: Precursor, partial [Brassica 
napus]
 emb|CAA53077.1| clpA [Brassica napus]
Length=874

 Score =   124 bits (312),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  272  GGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRL  451
            G N LDT+ RS Q+   KV  A +  +G+GSR VVKAMFERFTEKAIKVIMLAQEEARRL
Sbjct  4    GNNVLDTLGRSRQSFGGKVRQAMNVPKGKGSRGVVKAMFERFTEKAIKVIMLAQEEARRL  63

Query  452  GHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            GHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  64   GHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  115



>ref|XP_003575034.2| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Brachypodium 
distachyon]
Length=921

 Score =   124 bits (311),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 108/132 (82%), Gaps = 0/132 (0%)
 Frame = +2

Query  212  AMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFE  391
            A +CS ++ ++ L  F GLR  N LDT +   +   S VA   +  RG+GSR VV+AMFE
Sbjct  33   ASVCSMRTQTMTLGGFQGLRRANFLDTRSVVRRDFGSIVAHQLARPRGKGSRMVVRAMFE  92

Query  392  RFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEV  571
            RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEV
Sbjct  93   RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEV  152

Query  572  EKIIGRGSGFVA  607
            EKIIGRGSGFVA
Sbjct  153  EKIIGRGSGFVA  164



>emb|CAN78847.1| hypothetical protein VITISV_010724 [Vitis vinifera]
Length=890

 Score =   124 bits (310),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 114/169 (67%), Gaps = 30/169 (18%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MAR LVQSTNI + VA    G+F+GS + K    + V M+C++     + +    +RGG 
Sbjct  1    MARALVQSTNIFASVADGKHGKFQGSERTK----KSVKMMCNAMISIPEWQLLFLVRGGK  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            A   +AR                          AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   ASRCVAR--------------------------AMFERFTEKAIKVIMLAQEEARRLGHN  90

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  91   FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  139



>gb|EMS54417.1| ATP-dependent Clp protease ATP-binding subunit clpA-like protein 
CD4B, chloroplastic [Triticum urartu]
Length=376

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = +2

Query  224  SSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTE  403
            S ++ ++ L  F GLR  N LDT +       S VA+  +  RG+GSR VV+AMFERFTE
Sbjct  32   SMETQTITLGGFQGLRRANFLDTKSVVRHDFGSIVASQLARPRGKGSRMVVRAMFERFTE  91

Query  404  KAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKII  583
            KAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII
Sbjct  92   KAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII  151

Query  584  GRGSGFVA  607
            GRGSGFVA
Sbjct  152  GRGSGFVA  159



>gb|EMT20100.1| ATP-dependent Clp protease ATP-binding subunit clpA-like CD4A 
protein, chloroplastic [Aegilops tauschii]
Length=546

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = +2

Query  224  SSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTE  403
            S ++ ++ L  F GLR  N LDT +       S VA+  +  RG+GSR VV+AMFERFTE
Sbjct  32   SMETQTITLGGFQGLRRANFLDTKSVVRHDFGSIVASQLARPRGKGSRMVVRAMFERFTE  91

Query  404  KAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKII  583
            KAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII
Sbjct  92   KAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII  151

Query  584  GRGSGFVA  607
            GRGSGFVA
Sbjct  152  GRGSGFVA  159



>gb|EMS48250.1| ATP-dependent Clp protease ATP-binding subunit clpA-like protein 
CD4B, chloroplastic [Triticum urartu]
Length=241

 Score =   116 bits (290),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 105/135 (78%), Gaps = 2/135 (1%)
 Frame = +2

Query  203  RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  382
            R  +ML  S +  +++ +F GLR  ++   +  S     S VA+    RRGR +  V +A
Sbjct  80   RTPSMLAMSLNRPVRMAAFVGLRSVHSFSAVRSS--NFRSTVASYRFSRRGRRASFVTRA  137

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQ+LLGL+GEGTGIAAKVLKSMGINLKDAR
Sbjct  138  MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQVLLGLVGEGTGIAAKVLKSMGINLKDAR  197

Query  563  VEVEKIIGRGSGFVA  607
            VEVEKIIGRG+GFVA
Sbjct  198  VEVEKIIGRGNGFVA  212



>ref|XP_004975454.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Setaria 
italica]
Length=921

 Score =   121 bits (303),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 104/169 (62%), Positives = 121/169 (72%), Gaps = 5/169 (3%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            M   LVQS  +P++    + G+F+   + +        M+ +  + +L L  F GLR  N
Sbjct  1    MEGALVQSAIVPTIYRSNS-GRFRVRARARTN----ATMVRNMPTRTLTLGGFQGLRQTN  55

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
             LDT +   +   S VA+  +  RG  SR VV+AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  56   FLDTRSVVKRDFGSIVASQIARPRGSASRGVVRAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  164



>ref|XP_004975455.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Setaria 
italica]
Length=918

 Score =   121 bits (303),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 105/132 (80%), Gaps = 0/132 (0%)
 Frame = +2

Query  212  AMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFE  391
             ML S+ + +L L  F GLR  N LDT +   +     VA+  S  RG  SR VV+AMFE
Sbjct  30   TMLRSTPTRTLTLGGFQGLRQTNFLDTRSVVKRDFGYIVASQISRPRGSASRGVVRAMFE  89

Query  392  RFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEV  571
            RFTEKAIKV+MLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEV
Sbjct  90   RFTEKAIKVVMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEV  149

Query  572  EKIIGRGSGFVA  607
            EKIIGRGSGFVA
Sbjct  150  EKIIGRGSGFVA  161



>gb|KGN63436.1| hypothetical protein Csa_1G000600 [Cucumis sativus]
Length=862

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 92/105 (88%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +2

Query  293  MARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgt  472
            M RS Q  HSKVA A S RR + SR V +AMFERFTEKAIKVIMLAQEEARRLGHNFVGT
Sbjct  1    MLRSRQNFHSKVATAISSRRRKASRCVPRAMFERFTEKAIKVIMLAQEEARRLGHNFVGT  60

Query  473  eqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            EQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  61   EQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  105



>gb|EMS46268.1| ATP-dependent Clp protease ATP-binding subunit clpA-like protein 
CD4B, chloroplastic [Triticum urartu]
Length=887

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 107/132 (81%), Gaps = 0/132 (0%)
 Frame = +2

Query  212  AMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFE  391
             ML S+ + +L L  F GLR  N LDT +   +   S VA+  S  RG GSR VV+AMFE
Sbjct  29   TMLRSTPTRTLTLGGFQGLRQTNFLDTRSVIKRDFGSIVASQISRPRGSGSRMVVRAMFE  88

Query  392  RFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEV  571
            RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGI+LKDARVEV
Sbjct  89   RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGISLKDARVEV  148

Query  572  EKIIGRGSGFVA  607
            EKIIGRGSGFVA
Sbjct  149  EKIIGRGSGFVA  160



>ref|XP_008663153.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Zea mays]
 gb|AFW58112.1| hypothetical protein ZEAMMB73_120778 [Zea mays]
Length=921

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 122/169 (72%), Gaps = 5/169 (3%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            M   LVQS  +P++    + G+F+   + +        M+ ++ + +L L  F GLR  N
Sbjct  1    MEGALVQSAIVPAVYRSSS-GRFRVRARARTN----ATMVRNTPTRTLTLGGFQGLRQTN  55

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
             LDT +   +   S VA+  +  RG  SR VV+AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  56   FLDTRSVIKRDFGSIVASQIARPRGSASRGVVRAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKV+KSMGINLKDARVEVEKIIGRGSGFVA
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVMKSMGINLKDARVEVEKIIGRGSGFVA  164



>ref|XP_001690745.1| hypothetical protein CHLREDRAFT_110360 [Chlamydomonas reinhardtii]
 gb|EDO95778.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=97

 Score =   110 bits (274),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 71/75 (95%), Positives = 74/75 (99%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKV+MLAQEEARRLGHNFVGTEQ+LLGLIGE TGIAAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVVMLAQEEARRLGHNFVGTEQLLLGLIGESTGIAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            VEVEKIIGRGSGFVA
Sbjct  61   VEVEKIIGRGSGFVA  75



>ref|XP_002447724.1| hypothetical protein SORBIDRAFT_06g014590 [Sorghum bicolor]
 gb|EES12052.1| hypothetical protein SORBIDRAFT_06g014590 [Sorghum bicolor]
Length=921

 Score =   119 bits (297),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = +2

Query  239  SLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKV  418
            +L L  F GLR  N LDT +   +   S VA+  +  RG  SR VV+AMFERFTEKAIKV
Sbjct  42   TLTLGGFQGLRQTNFLDTRSVIKRDFVSIVASQIARPRGSASRGVVRAMFERFTEKAIKV  101

Query  419  IMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSG  598
            IMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSG
Sbjct  102  IMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSG  161

Query  599  FVA  607
            FVA
Sbjct  162  FVA  164



>gb|EEC77204.1| hypothetical protein OsI_15716 [Oryza sativa Indica Group]
Length=785

 Score =   118 bits (295),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 106/132 (80%), Gaps = 0/132 (0%)
 Frame = +2

Query  212  AMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFE  391
             M+ +  + +L L  F GLR  N LD+ +   +   S VA+  S  RG GSR VV+AMFE
Sbjct  30   TMMRTMPTRTLTLGGFQGLRQTNFLDSRSVIKRDFGSIVASQISRPRGLGSRGVVRAMFE  89

Query  392  RFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEV  571
            RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEV
Sbjct  90   RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEV  149

Query  572  EKIIGRGSGFVA  607
            EKIIGRGSGFVA
Sbjct  150  EKIIGRGSGFVA  161



>ref|XP_010238595.1| PREDICTED: chaperone protein ClpC2, chloroplastic [Brachypodium 
distachyon]
Length=920

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 118/169 (70%), Gaps = 6/169 (4%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MA  L+    + S  AG A GQ           +R  +ML  S +  +++ +F GLR  +
Sbjct  1    MAGTLLLPVALGSTFAGRASGQ----RWKSHGTRRPASMLAMSLNRPVRMAAFVGLRSAH  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            +    A       S VA+  S RRGR +R V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   SF--TATPASNYRSTVASYRSSRRGRRTRFVTRAMFERFTEKAIKVIMLAQEEARRLGHN  114

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGL+GEGTGIAAKVLKSMGINLKDARVEVEKIIGRG+GFVA
Sbjct  115  FVGTEQILLGLVGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGNGFVA  163



>sp|Q7F9I1.2|CLPC1_ORYSJ RecName: Full=Chaperone protein ClpC1, chloroplastic; AltName: 
Full=ATP-dependent Clp protease ATP-binding subunit ClpC homolog 
1; AltName: Full=Casein lytic proteinase C1; Flags: Precursor 
[Oryza sativa Japonica Group]
Length=918

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 106/132 (80%), Gaps = 0/132 (0%)
 Frame = +2

Query  212  AMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFE  391
             M+ +  + +L L  F GLR  N LD+ +   +   S VA+  S  RG GSR VV+AMFE
Sbjct  30   TMMRTMPTRTLTLGGFQGLRQTNFLDSRSVIKRDFGSIVASQISRPRGLGSRGVVRAMFE  89

Query  392  RFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEV  571
            RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEV
Sbjct  90   RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEV  149

Query  572  EKIIGRGSGFVA  607
            EKIIGRGSGFVA
Sbjct  150  EKIIGRGSGFVA  161



>emb|CAE05148.2| OSJNBa0039C07.4 [Oryza sativa Japonica Group]
Length=888

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = +2

Query  215  MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  394
            M+ +  + +L L  F GLR  N LD+ +   +   S VA+  S  RG GSR VV+AMFER
Sbjct  1    MMRTMPTRTLTLGGFQGLRQTNFLDSRSVIKRDFGSIVASQISRPRGLGSRGVVRAMFER  60

Query  395  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVE  574
            FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE
Sbjct  61   FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE  120

Query  575  KIIGRGSGFVA  607
            KIIGRGSGFVA
Sbjct  121  KIIGRGSGFVA  131



>gb|EAZ30583.1| hypothetical protein OsJ_14634 [Oryza sativa Japonica Group]
Length=1033

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 106/132 (80%), Gaps = 0/132 (0%)
 Frame = +2

Query  212  AMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFE  391
             M+ +  + +L L  F GLR  N LD+ +   +   S VA+  S  RG GSR VV+AMFE
Sbjct  145  TMMRTMPTRTLTLGGFQGLRQTNFLDSRSVIKRDFGSIVASQISRPRGLGSRGVVRAMFE  204

Query  392  RFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEV  571
            RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEV
Sbjct  205  RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEV  264

Query  572  EKIIGRGSGFVA  607
            EKIIGRGSGFVA
Sbjct  265  EKIIGRGSGFVA  276



>ref|XP_006652229.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Oryza 
brachyantha]
Length=888

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = +2

Query  215  MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  394
            M+ +  + +L L  F GLR  N LD+ +   +   + VA+  S  RG  SR VV+AMFER
Sbjct  1    MMRTMPTRTLTLGGFQGLRQTNFLDSRSVVKRDFGAIVASQISRHRGSASRGVVRAMFER  60

Query  395  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVE  574
            FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE
Sbjct  61   FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE  120

Query  575  KIIGRGSGFVA  607
            KIIGRGSGFVA
Sbjct  121  KIIGRGSGFVA  131



>ref|XP_006663917.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like [Oryza 
brachyantha]
Length=919

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 101/169 (60%), Positives = 116/169 (69%), Gaps = 7/169 (4%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MA  L+Q   + +  AG   GQ           +R  +ML  S S  +K+ +F GLR  +
Sbjct  1    MAGTLLQPVALGTTFAGRVSGQ----RWKSHGTRRPPSMLAMSLSRPVKMAAFVGLRSVH  56

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            +   M  S         A+   RRGR +R V ++MFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   SFSVMPVSN---FRSTVASYRSRRGRRTRFVTRSMFERFTEKAIKVIMLAQEEARRLGHN  113

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRG+GFVA
Sbjct  114  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGNGFVA  162



>dbj|BAJ99801.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=920

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 105/135 (78%), Gaps = 2/135 (1%)
 Frame = +2

Query  203  RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  382
            R  +ML  S +  +++ +F GLR  ++   M  S     S VA+    RRGR +  V +A
Sbjct  31   RTPSMLAMSLNRPVRMAAFVGLRSVHSFSAMRSS--NFRSTVASYRFSRRGRRASFVTRA  88

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQ+LLGL+GEGTGIAAKVLKSMGINLKDAR
Sbjct  89   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQVLLGLVGEGTGIAAKVLKSMGINLKDAR  148

Query  563  VEVEKIIGRGSGFVA  607
            VEVEKIIGRG+GFVA
Sbjct  149  VEVEKIIGRGNGFVA  163



>ref|WP_032554674.1| hypothetical protein, partial [Prochlorococcus sp. scB245a_518J7]
Length=91

 Score =   107 bits (266),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 70/75 (93%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKS+G+NLKD+R
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSLGVNLKDSR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|XP_004960741.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like isoform 
X1 [Setaria italica]
 ref|XP_004960742.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like isoform 
X2 [Setaria italica]
Length=921

 Score =   116 bits (290),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 105/135 (78%), Gaps = 1/135 (1%)
 Frame = +2

Query  203  RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  382
            R  +ML  S S  +K+ +F GLR  ++         +  S VA+  S RR R SR V +A
Sbjct  31   RPASMLAMSLSRPVKMSAFVGLRSVHSFSVTPTVSNS-RSAVASYRSSRRTRRSRFVTRA  89

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  90   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  149

Query  563  VEVEKIIGRGSGFVA  607
            VEVEKIIGRG+GFVA
Sbjct  150  VEVEKIIGRGNGFVA  164



>ref|WP_032558761.1| hypothetical protein, partial [Prochlorococcus sp. scB243_498A3]
Length=100

 Score =   107 bits (266),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 70/75 (93%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKS+G+NLKD+R
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSLGVNLKDSR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|NP_001169540.1| uncharacterized protein LOC100383416 [Zea mays]
 gb|ACN34070.1| unknown [Zea mays]
 gb|AFW56690.1| cytokinin inducible protease1 [Zea mays]
Length=921

 Score =   115 bits (289),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 105/135 (78%), Gaps = 1/135 (1%)
 Frame = +2

Query  203  RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  382
            R  +ML  S S  +K+ +F GLR  ++         +  S VA+  S R+ R SR V +A
Sbjct  31   RPASMLAVSLSRPVKMSAFVGLRSVHSFSVTPTVSNS-RSAVASYRSSRQTRRSRFVTQA  89

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  90   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  149

Query  563  VEVEKIIGRGSGFVA  607
            VEVEKIIGRG+GFVA
Sbjct  150  VEVEKIIGRGNGFVA  164



>ref|WP_032553896.1| hypothetical protein, partial [Prochlorococcus sp. scB243_498J20]
Length=123

 Score =   107 bits (267),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 70/75 (93%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKS+G+NLKD+R
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSLGVNLKDSR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>gb|KIY94281.1| ATP-dependent Clp protease ATP-binding subunit ClpC [Monoraphidium 
neglectum]
Length=300

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 74/75 (99%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKV+MLAQEEARRLGHNFVGTEQILLGLIGE TGIAAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVVMLAQEEARRLGHNFVGTEQILLGLIGESTGIAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            VEVEKIIGRGSGFVA
Sbjct  61   VEVEKIIGRGSGFVA  75



>ref|XP_001756645.1| predicted protein [Physcomitrella patens]
 gb|EDQ78599.1| predicted protein [Physcomitrella patens]
Length=933

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 122/173 (71%), Gaps = 9/173 (5%)
 Frame = +2

Query  113  LVQSTNIPSLVAGEAIGQFkgsgkgkgk-gkRVVAM----LCSSQSPSL-KLRSFTGLRG  274
            +  S  IPS V    +GQF GS K K +   R  +M    +  S S S+ + +SF+G+R 
Sbjct  1    MAHSLTIPS-VGASPVGQFNGSRKSKKQGAARAASMGRRNVDKSASMSVARFQSFSGMRK  59

Query  275  GNALDTMA-RSGQTLHSKvaaatsgrrgrgsra-vvKAMFERFTEKAIKVIMLAQEEARR  448
            G+ +D +  + G+   S VA +T+          V  AMFERFTEKAIKVIMLAQEEARR
Sbjct  60   GSVVDALVVKQGKDFKSVVANSTAVTGHSRPSRGVTTAMFERFTEKAIKVIMLAQEEARR  119

Query  449  LGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            LGHNFVGTEQILLGLIGEGTGIAAKVLKSMG+NLK+ARVEVEKIIGRGSGFVA
Sbjct  120  LGHNFVGTEQILLGLIGEGTGIAAKVLKSMGVNLKEARVEVEKIIGRGSGFVA  172



>ref|NP_001066442.1| Os12g0230100 [Oryza sativa Japonica Group]
 sp|Q2QVG9.2|CLPC2_ORYSJ RecName: Full=Chaperone protein ClpC2, chloroplastic; AltName: 
Full=ATP-dependent Clp protease ATP-binding subunit ClpC homolog 
2; AltName: Full=Casein lytic proteinase C2; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|ABA96309.2| ATP-dependent Clp protease ATP-binding subunit clpA CD4B,chloroplast 
precursor, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABG21929.1| ATP-dependent Clp protease ATP-binding subunit clpA CD4B,chloroplast 
precursor, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29461.1| Os12g0230100 [Oryza sativa Japonica Group]
Length=919

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 118/169 (70%), Gaps = 7/169 (4%)
 Frame = +2

Query  101  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  280
            MA  L+Q   + +  AG   GQ           +R  +ML  S S  +K+ +F GLR   
Sbjct  1    MAGTLLQPVALGTTFAGRVSGQ----RWKSHGTRRPPSMLAMSLSRPVKMAAFVGLR---  53

Query  281  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  460
            ++ + + +  T      A+   RRGR +R V ++MFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  54   SVHSFSVTPVTNFRSTVASYRSRRGRRARFVTRSMFERFTEKAIKVIMLAQEEARRLGHN  113

Query  461  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRG+GFVA
Sbjct  114  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGNGFVA  162



>gb|EEC69045.1| hypothetical protein OsI_37876 [Oryza sativa Indica Group]
Length=1412

 Score =   115 bits (287),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 120/175 (69%), Gaps = 7/175 (4%)
 Frame = +2

Query  83   GSLGGIMARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFT  262
            G L   MA  L+Q   + +  AG   GQ           +R  +ML  S S  +K+ +F 
Sbjct  488  GKLLLTMAGTLLQPVALGTTFAGRVSGQ----RWKSHGTRRPPSMLAMSLSRPVKMAAFV  543

Query  263  GLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEA  442
            GLR   ++ + + +  T      A+   RRGR +R V ++MFERFTEKAIKVIMLAQEEA
Sbjct  544  GLR---SVHSFSVTPVTNFRSTVASYRSRRGRRARFVTRSMFERFTEKAIKVIMLAQEEA  600

Query  443  RRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            RRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRG+GFVA
Sbjct  601  RRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGNGFVA  655



>ref|XP_001779162.1| predicted protein [Physcomitrella patens]
 gb|EDQ56008.1| predicted protein [Physcomitrella patens]
Length=922

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 118/176 (67%), Gaps = 15/176 (9%)
 Frame = +2

Query  113  LVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLK---------LRSFTG  265
            +  S  +PS V    +GQ   S K K    R +A   S+   +LK          +SF+G
Sbjct  4    MAHSLTLPS-VGSSLVGQLNDSAKSKR---RTIAQAASTGRKNLKKSASLSVSGFQSFSG  59

Query  266  LRGGNALDTMA-RSGQTLHSKvaaatsgrrgrgsravvK-AMFERFTEKAIKVIMLAQEE  439
            +R  +A+D +  + G+ L S VA + +          V  AMFERFTEKAIKVIMLAQEE
Sbjct  60   MRKASAVDALTVKQGKDLKSVVAKSMAVAGHSRPSRGVTFAMFERFTEKAIKVIMLAQEE  119

Query  440  ARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFVA  607
            ARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMG+NLK+ARVEVEKIIGRGSGFVA
Sbjct  120  ARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGVNLKEARVEVEKIIGRGSGFVA  175



>ref|XP_002977161.1| hypothetical protein SELMODRAFT_176012 [Selaginella moellendorffii]
 gb|EFJ21770.1| hypothetical protein SELMODRAFT_176012 [Selaginella moellendorffii]
Length=901

 Score =   113 bits (283),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 103/121 (85%), Gaps = 1/121 (1%)
 Frame = +2

Query  248  LRSFTGLRGGNALDTMA-RSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIM  424
            L+++ G+R  + LD++A R+ +  +S V++ ++      SR VV AMFERFTEKAIKVIM
Sbjct  21   LQTYVGMRKPSPLDSLATRTCKDWNSVVSSVSTSGGRGASRGVVVAMFERFTEKAIKVIM  80

Query  425  LAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFV  604
            LAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMG+NLK+ARVEVEKIIGRGSGFV
Sbjct  81   LAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGVNLKEARVEVEKIIGRGSGFV  140

Query  605  A  607
            A
Sbjct  141  A  141



>gb|EDZ93048.1| Clp domain protein [Arthrospira maxima CS-328]
Length=402

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|XP_002952540.1| hypothetical protein VOLCADRAFT_75431 [Volvox carteri f. nagariensis]
 gb|EFJ46387.1| hypothetical protein VOLCADRAFT_75431 [Volvox carteri f. nagariensis]
Length=915

 Score =   113 bits (282),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 72/77 (94%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +2

Query  377  KAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  556
            K+MFERFTEKAIKV+MLAQEEARRLGHNFVGTEQ+LLGLIGE TGIAAKVLKSMG+NLKD
Sbjct  73   KSMFERFTEKAIKVVMLAQEEARRLGHNFVGTEQLLLGLIGESTGIAAKVLKSMGVNLKD  132

Query  557  ARVEVEKIIGRGSGFVA  607
            ARVEVEKIIGRGSGFVA
Sbjct  133  ARVEVEKIIGRGSGFVA  149



>gb|AAB67745.1| ClpC [Synechococcus elongatus PCC 7942]
Length=839

 Score =   112 bits (280),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +2

Query  377  KAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  556
            +AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  14   EAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  73

Query  557  ARVEVEKIIGRGSGFVA  607
            AR+EVEKIIGRGSGFVA
Sbjct  74   ARIEVEKIIGRGSGFVA  90



>dbj|BAD79443.1| ATP-dependent Clp protease regulatory subunit ClpC [Synechococcus 
elongatus PCC 6301]
Length=839

 Score =   112 bits (280),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +2

Query  377  KAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  556
            +AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  14   EAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  73

Query  557  ARVEVEKIIGRGSGFVA  607
            AR+EVEKIIGRGSGFVA
Sbjct  74   ARIEVEKIIGRGSGFVA  90



>gb|AFW96628.1| ATP-dependent Clp family protein [Anabaena sp. 90]
Length=838

 Score =   112 bits (280),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 73/76 (96%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +2

Query  380  AMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDA  559
            AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDA
Sbjct  16   AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDA  75

Query  560  RVEVEKIIGRGSGFVA  607
            R+EVEKIIGRGSGFVA
Sbjct  76   RIEVEKIIGRGSGFVA  91



>gb|KIZ07494.1| ATP-dependent Clp protease ATP-binding subunit ClpC [Monoraphidium 
neglectum]
Length=938

 Score =   112 bits (280),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 73/76 (96%), Positives = 75/76 (99%), Gaps = 0/76 (0%)
 Frame = +2

Query  380  AMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDA  559
            AMFERFTEKAIKV+MLAQEEARRLGHNFVGTEQILLGLIGE TGIAAKVLKSMG+NLKDA
Sbjct  78   AMFERFTEKAIKVVMLAQEEARRLGHNFVGTEQILLGLIGESTGIAAKVLKSMGVNLKDA  137

Query  560  RVEVEKIIGRGSGFVA  607
            RVEVEKIIGRGSGFVA
Sbjct  138  RVEVEKIIGRGSGFVA  153



>dbj|BAB74698.1| endopeptidase Clp ATP-binding chain [Nostoc sp. PCC 7120]
Length=839

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 73/76 (96%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +2

Query  380  AMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDA  559
            AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDA
Sbjct  16   AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDA  75

Query  560  RVEVEKIIGRGSGFVA  607
            R+EVEKIIGRGSGFVA
Sbjct  76   RIEVEKIIGRGSGFVA  91



>gb|AFY46028.1| ATPase with chaperone activity, ATP-binding subunit [Nostoc sp. 
PCC 7524]
Length=856

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 73/76 (96%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +2

Query  380  AMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDA  559
            AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDA
Sbjct  33   AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDA  92

Query  560  RVEVEKIIGRGSGFVA  607
            R+EVEKIIGRGSGFVA
Sbjct  93   RIEVEKIIGRGSGFVA  108



>ref|XP_010446016.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Camelina 
sativa]
Length=546

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 74/75 (99%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNF+GTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFMGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            VEVEKIIGRGSGFVA
Sbjct  61   VEVEKIIGRGSGFVA  75



>ref|XP_002965312.1| hypothetical protein SELMODRAFT_439163 [Selaginella moellendorffii]
 gb|EFJ34150.1| hypothetical protein SELMODRAFT_439163 [Selaginella moellendorffii]
Length=937

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = +2

Query  248  LRSFTGLRGGNALDTMARSG-QTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIM  424
            L+++ G+R  + LD++A S  +  +S V++ ++      SR VV AMFERFTEKAIKVIM
Sbjct  57   LQTYVGMRKPSPLDSLATSTCKDWNSVVSSVSTSGGRGASRGVVVAMFERFTEKAIKVIM  116

Query  425  LAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIGRGSGFV  604
            LAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMG+NLK+ARVEVEKIIGRGSGFV
Sbjct  117  LAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGVNLKEARVEVEKIIGRGSGFV  176

Query  605  A  607
            A
Sbjct  177  A  177



>gb|EHC12174.1| ATPase AAA-2 domain protein [Fischerella sp. JSC-11]
Length=851

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 73/76 (96%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +2

Query  380  AMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDA  559
            AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDA
Sbjct  29   AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDA  88

Query  560  RVEVEKIIGRGSGFVA  607
            R+EVEKIIGRGSGFVA
Sbjct  89   RIEVEKIIGRGSGFVA  104



>gb|ABK95905.1| unknown [Populus trichocarpa]
Length=835

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 75/75 (100%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            VEVEKIIGRGSGFVA
Sbjct  61   VEVEKIIGRGSGFVA  75



>ref|XP_006374569.1| hypothetical protein POPTR_0015s11640g [Populus trichocarpa]
 gb|ERP52366.1| hypothetical protein POPTR_0015s11640g [Populus trichocarpa]
Length=835

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 75/75 (100%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            VEVEKIIGRGSGFVA
Sbjct  61   VEVEKIIGRGSGFVA  75



>ref|WP_044105586.1| Clp protease ClpX [cyanobacterium endosymbiont of Epithemia turgida]
 dbj|BAP16974.1| ATP-dependent Clp protease regulatory subunit [cyanobacterium 
endosymbiont of Epithemia turgida isolate EtSB Lake Yunoko]
Length=823

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 74/75 (99%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMGINLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGINLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            VEVEKIIGRGSGFVA
Sbjct  61   VEVEKIIGRGSGFVA  75



>emb|CDX84888.1| BnaA03g13420D [Brassica napus]
Length=827

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 75/75 (100%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            VEVEKIIGRGSGFVA
Sbjct  61   VEVEKIIGRGSGFVA  75



>ref|WP_015162264.1| ATPase with chaperone activity, ATP-binding subunit [Chamaesiphon 
minutus]
 gb|AFY96180.1| ATPase with chaperone activity, ATP-binding subunit [Chamaesiphon 
minutus PCC 6605]
Length=833

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 73/75 (97%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMGINLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGINLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>gb|EMT29575.1| ATP-dependent Clp protease ATP-binding subunit clpA-like CD4B 
protein, chloroplastic [Aegilops tauschii]
Length=1027

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +2

Query  377  KAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  556
            +AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGI+LKD
Sbjct  224  RAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGISLKD  283

Query  557  ARVEVEKIIGRGSGFVA  607
            ARVEVEKIIGRGSGFVA
Sbjct  284  ARVEVEKIIGRGSGFVA  300



>ref|WP_007100194.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. RS9917]
 gb|EAQ68890.1| endopeptidase Clp ATP-binding chain C [Synechococcus sp. RS9917]
Length=860

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 73/75 (97%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            VEVEKIIGRGSGFVA
Sbjct  61   VEVEKIIGRGSGFVA  75



>ref|WP_038544339.1| Clp protease ClpX [Synechococcus sp. KORDI-100]
 gb|AII43210.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. KORDI-100]
Length=862

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 73/75 (97%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            VEVEKIIGRGSGFVA
Sbjct  61   VEVEKIIGRGSGFVA  75



>ref|WP_028951828.1| Clp protease ClpX [Synechococcus sp. CC9616]
Length=856

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 73/75 (97%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            VEVEKIIGRGSGFVA
Sbjct  61   VEVEKIIGRGSGFVA  75



>ref|WP_015107874.1| chaperone ATPase [Cyanobium gracile]
 gb|AFY27415.1| ATPase with chaperone activity, ATP-binding subunit [Cyanobium 
gracile PCC 6307]
Length=849

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 73/75 (97%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            VEVEKIIGRGSGFVA
Sbjct  61   VEVEKIIGRGSGFVA  75



>ref|WP_039899756.1| Clp protease ClpX, partial [Microcystis sp. T1-4]
Length=718

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 73/75 (97%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            VEVEKIIGRGSGFVA
Sbjct  61   VEVEKIIGRGSGFVA  75



>ref|WP_011127803.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. WH 8102]
 emb|CAE07453.1| endopeptidase Clp ATP-binding chain C [Synechococcus sp. WH 8102]
Length=846

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 73/75 (97%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            VEVEKIIGRGSGFVA
Sbjct  61   VEVEKIIGRGSGFVA  75



>ref|WP_010317861.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. CB0205]
Length=850

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 73/75 (97%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            VEVEKIIGRGSGFVA
Sbjct  61   VEVEKIIGRGSGFVA  75



>gb|AHF63374.1| ATPase [Synechococcus sp. WH 8109]
Length=846

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 73/75 (97%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            VEVEKIIGRGSGFVA
Sbjct  61   VEVEKIIGRGSGFVA  75



>ref|WP_041428551.1| Clp protease ClpX [Synechococcus sp. WH 7803]
Length=857

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 73/75 (97%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            VEVEKIIGRGSGFVA
Sbjct  61   VEVEKIIGRGSGFVA  75



>ref|WP_007098208.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. RS9916]
 gb|EAU74102.1| ATPase [Synechococcus sp. RS9916]
Length=859

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 73/75 (97%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            VEVEKIIGRGSGFVA
Sbjct  61   VEVEKIIGRGSGFVA  75



>ref|WP_043691512.1| Clp protease ClpX [Synechococcus sp. KORDI-49]
 gb|AII45534.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. KORDI-49]
Length=843

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 73/75 (97%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            VEVEKIIGRGSGFVA
Sbjct  61   VEVEKIIGRGSGFVA  75



>ref|WP_006852318.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. WH 8016]
 gb|EHA63138.1| ATPase AAA-2 domain protein [Synechococcus sp. WH 8016]
Length=860

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 73/75 (97%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            VEVEKIIGRGSGFVA
Sbjct  61   VEVEKIIGRGSGFVA  75



>ref|WP_012162462.1| ATP-dependent Clp protease ATP-binding protein [Acaryochloris 
marina]
 gb|ABW26964.1| ATP-dependent protease, ATP-binding subunit ClpC [Acaryochloris 
marina MBIC11017]
Length=822

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 73/75 (97%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            VEVEKIIGRGSGFVA
Sbjct  61   VEVEKIIGRGSGFVA  75



>ref|WP_010467511.1| ATP-dependent Clp protease ATP-binding protein [Acaryochloris 
sp. CCMEE 5410]
Length=822

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 73/75 (97%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            VEVEKIIGRGSGFVA
Sbjct  61   VEVEKIIGRGSGFVA  75



>ref|WP_038554285.1| Clp protease ClpX [Synechococcus sp. KORDI-52]
 gb|AII49099.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. KORDI-52]
Length=846

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 73/75 (97%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            VEVEKIIGRGSGFVA
Sbjct  61   VEVEKIIGRGSGFVA  75



>ref|WP_011364587.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. CC9605]
 gb|ABB35376.1| ATPase [Synechococcus sp. CC9605]
Length=846

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 73/75 (97%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            VEVEKIIGRGSGFVA
Sbjct  61   VEVEKIIGRGSGFVA  75



>ref|WP_006170858.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. WH 5701]
 gb|EAQ74030.1| endopeptidase Clp ATP-binding chain C [Synechococcus sp. WH 5701]
Length=856

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 73/75 (97%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            VEVEKIIGRGSGFVA
Sbjct  61   VEVEKIIGRGSGFVA  75



>ref|WP_041555480.1| Clp protease ClpX [Nostoc sp. PCC 7524]
Length=823

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_006041704.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. WH 7805]
 gb|EAR18013.1| ATPase [Synechococcus sp. WH 7805]
Length=857

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 73/75 (97%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            VEVEKIIGRGSGFVA
Sbjct  61   VEVEKIIGRGSGFVA  75



>ref|YP_001293474.1| Clp protease ATP binding subunit [Rhodomonas salina]
 gb|ABO70723.1| Clp protease ATP binding subunit [Rhodomonas salina]
Length=819

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 74/75 (99%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            VEVEKIIGRGSGFVA
Sbjct  61   VEVEKIIGRGSGFVA  75



>ref|WP_008226206.1| ATP-dependent Clp protease, ATP-binding subunit ClpC / Negative 
regulator of genetic competence clcC/mecB [Richelia intracellularis]
 emb|CCH64853.1| ATP-dependent Clp protease, ATP-binding subunit ClpC / Negative 
regulator of genetic competence clcC/mecB [Richelia intracellularis 
HM01]
Length=822

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_002777520.1| ATP-dependent Clp protease ATP-binding protein [Microcystis aeruginosa]
 emb|CCI07823.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 7941]
 gb|EPF22760.1| Negative regulator of genetic competence ClpC/MecB [Microcystis 
aeruginosa SPC777]
Length=821

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 73/75 (97%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            VEVEKIIGRGSGFVA
Sbjct  61   VEVEKIIGRGSGFVA  75



>ref|NP_050661.1| Clp protease ATP binding subunit (chloroplast) [Guillardia theta]
 sp|O78410.1|CLPC_GUITH RecName: Full=ATP-dependent Clp protease ATP-binding subunit 
clpA homolog (chloroplast) [Guillardia theta]
 gb|AAC35595.1| Clp protease ATP binding subunit (chloroplast) [Guillardia theta]
Length=819

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 74/75 (99%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            VEVEKIIGRGSGFVA
Sbjct  61   VEVEKIIGRGSGFVA  75



>ref|WP_004158851.1| ATP-dependent Clp protease ATP-binding protein [Microcystis aeruginosa]
 emb|CCH94083.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 9432]
Length=821

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 73/75 (97%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            VEVEKIIGRGSGFVA
Sbjct  61   VEVEKIIGRGSGFVA  75



>ref|WP_006910091.1| ATP-dependent Clp protease ATP-binding protein [Cyanobium sp. 
PCC 7001]
 gb|EDY38192.1| ATPase, AAA family [Cyanobium sp. PCC 7001]
Length=843

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 73/75 (97%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            VEVEKIIGRGSGFVA
Sbjct  61   VEVEKIIGRGSGFVA  75



>ref|WP_044521582.1| Clp protease ClpX [Nostoc sp. PCC 7120]
Length=823

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_016952177.1| ATP-dependent Clp protease ATP-binding protein [Anabaena sp. 
PCC 7108]
Length=824

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_010303504.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. CB0101]
Length=853

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 73/75 (97%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            VEVEKIIGRGSGFVA
Sbjct  61   VEVEKIIGRGSGFVA  75



>ref|WP_029638478.1| Clp protease ClpX [[Scytonema hofmanni] UTEX B 1581]
Length=823

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_011935205.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. RCC307]
 emb|CAK27691.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Synechococcus 
sp. RCC307]
Length=852

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 73/75 (97%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            VEVEKIIGRGSGFVA
Sbjct  61   VEVEKIIGRGSGFVA  75



>ref|WP_004160623.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa]
 emb|CCI13172.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 9806]
Length=821

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 73/75 (97%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            VEVEKIIGRGSGFVA
Sbjct  61   VEVEKIIGRGSGFVA  75



>ref|WP_002732350.1| ATP-dependent Clp protease ATP-binding protein [Microcystis aeruginosa]
 emb|CAO87778.1| clpC [Microcystis aeruginosa PCC 7806]
 emb|CCH96065.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 9717]
 emb|CCI26165.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 9808]
 emb|CCI35401.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 9701]
 gb|ELP55843.1| clp amino terminal domain protein [Microcystis aeruginosa TAIHU98]
 gb|ELS46866.1| clp amino terminal domain protein [Microcystis aeruginosa DIANCHI905]
 dbj|GAL91758.1| ATP-dependent Clp protease, ATP-binding subunit ClpC [Microcystis 
aeruginosa NIES-44]
Length=821

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 73/75 (97%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            VEVEKIIGRGSGFVA
Sbjct  61   VEVEKIIGRGSGFVA  75



>ref|WP_008231833.1| ATP-dependent Clp protease, ATP-binding subunit ClpC / Negative 
regulator of genetic competence clcC/mecB [Richelia intracellularis]
 emb|CCH66412.1| ATP-dependent Clp protease, ATP-binding subunit ClpC / Negative 
regulator of genetic competence clcC/mecB [Richelia intracellularis 
HH01]
Length=822

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_027404746.1| Clp protease ClpX [Aphanizomenon flos-aquae]
Length=823

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_011317764.1| ATP-dependent Clp protease ATP-binding protein [Anabaena variabilis]
 gb|ABA20534.1| UvrB/UvrC protein [Anabaena variabilis ATCC 29413]
Length=823

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_002765002.1| ATP-dependent Clp protease ATP-binding protein [Microcystis aeruginosa]
 emb|CCI03294.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 9443]
 emb|CCI17774.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 9807]
Length=821

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 73/75 (97%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            VEVEKIIGRGSGFVA
Sbjct  61   VEVEKIIGRGSGFVA  75



>ref|WP_039200429.1| Clp protease ClpX [Aphanizomenon flos-aquae]
 gb|KHG42537.1| Clp protease ClpX [Aphanizomenon flos-aquae 2012/KM1/D3]
Length=823

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_037222416.1| Clp protease ClpX [Richelia intracellularis]
 emb|CDN15062.1| ATP-dependent Clp protease, ATP-binding subunit ClpC / Negative 
regulator of genetic competence clcC/mecB [Richelia intracellularis]
Length=822

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_023074118.1| atp-dependent clp protease atp-binding protein [Leptolyngbya 
sp. Heron Island J]
 gb|ESA35054.1| atp-dependent clp protease atp-binding protein [Leptolyngbya 
sp. Heron Island J]
Length=822

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_015111477.1| ATPase [Nostoc sp. PCC 7107]
 gb|AFY41237.1| ATPase AAA-2 domain protein [Nostoc sp. PCC 7107]
Length=823

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_009626822.1| ATPase AAA-2 domain protein [Pseudanabaena biceps]
 gb|ELS33048.1| ATPase AAA-2 domain protein [Pseudanabaena biceps PCC 7429]
Length=829

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_013192942.1| ATP-dependent Clp protease ATP-binding protein [Trichormus azollae]
 gb|ADI65932.1| ATPase AAA-2 domain protein ['Nostoc azollae' 0708]
Length=824

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_006454749.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. PCC 7335]
 gb|EDX85005.1| ATPase, AAA family [Synechococcus sp. PCC 7335]
Length=826

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_023174246.1| ATPase AAA-2 domain protein [Gloeobacter kilaueensis]
 gb|AGY59031.1| ATPase AAA-2 domain protein [Gloeobacter kilaueensis JS1]
Length=821

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_012412218.1| ATP-dependent Clp protease ATP-binding protein [Nostoc punctiforme]
 gb|ACC84277.1| ATPase AAA-2 domain protein [Nostoc punctiforme PCC 73102]
Length=822

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_006518530.1| ATPase with chaperone activity, ATP-binding subunit [Leptolyngbya 
sp. PCC 7375]
 gb|EKU97345.1| ATPase with chaperone activity, ATP-binding subunit [Leptolyngbya 
sp. PCC 7375]
Length=822

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>gb|KIE07407.1| Clp protease ClpX [Tolypothrix bouteillei VB521301]
Length=823

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_011618961.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. CC9311]
 gb|ABI47413.1| putative Clp protease, ATP-binding subunit ClpC [Synechococcus 
sp. CC9311]
Length=860

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 73/75 (97%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            VEVEKIIGRGSGFVA
Sbjct  61   VEVEKIIGRGSGFVA  75



>ref|WP_039740335.1| Clp protease ClpX [Hassallia byssoidea]
 gb|KIF37306.1| Clp protease ClpX [Hassallia byssoidea VB512170]
Length=822

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_028090149.1| Clp protease ClpX [Dolichospermum circinale]
Length=823

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_028082153.1| Clp protease ClpX [Dolichospermum circinale]
Length=823

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_012630051.1| ATP-dependent Clp protease ATP-binding protein [Cyanothece sp. 
PCC 7425]
 gb|ACL47009.1| ATPase AAA-2 domain protein [Cyanothece sp. PCC 7425]
Length=825

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_019498394.1| ATP-dependent Clp protease ATP-binding protein [Pseudanabaena 
sp. PCC 6802]
Length=828

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_006198453.1| ATP-dependent Clp protease ATP-binding protein [Nodularia spumigena]
 gb|EAW43399.1| endopeptidase Clp ATP-binding chain [Nodularia spumigena CCY9414]
 gb|AHJ31070.1| ATP-dependent Clp protease, ATP-binding subunit ClpC / Negative 
regulator of genetic competence clcC/mecB [Nodularia spumigena 
CCY9414]
Length=823

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_015126250.1| chaperone ATPase [Synechococcus sp. PCC 6312]
 gb|AFY62713.1| ATPase with chaperone activity, ATP-binding subunit [Synechococcus 
sp. PCC 6312]
Length=824

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_015189078.1| ATPase AAA-2 domain protein [Gloeocapsa sp. PCC 7428]
 gb|AFZ31206.1| ATPase AAA-2 domain protein [Gloeocapsa sp. PCC 7428]
Length=825

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_022603946.1| ATPase with chaperone activity, ATP-binding subunit [Rubidibacter 
lacunae]
 gb|ERN42931.1| ATPase with chaperone activity, ATP-binding subunit [Rubidibacter 
lacunae KORDI 51-2]
Length=826

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_041458572.1| Clp protease ClpX [Anabaena sp. 90]
Length=822

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_015128787.1| ATPase [Calothrix sp. PCC 7507]
 gb|AFY32974.1| ATPase AAA-2 domain protein [Calothrix sp. PCC 7507]
Length=822

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>gb|AGW80480.1| Clp protease ATP binding subunit [Planktothrix agardhii NIVA-CYA 
68]
Length=825

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_036485541.1| Clp protease ClpX [Myxosarcina sp. GI1]
Length=822

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_017318713.1| ATP-dependent Clp protease ATP-binding protein [Mastigocladopsis 
repens]
Length=822

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_015166859.1| chaperone ATPase [Synechococcus sp. PCC 7502]
 gb|AFY72200.1| ATPase with chaperone activity, ATP-binding subunit [Synechococcus 
sp. PCC 7502]
Length=828

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_015206692.1| ATPase with chaperone activity, ATP-binding subunit [Cylindrospermum 
stagnale]
 gb|AFZ23436.1| ATPase with chaperone activity, ATP-binding subunit [Cylindrospermum 
stagnale PCC 7417]
Length=823

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_026795885.1| MULTISPECIES: Clp protease ClpX [Planktothrix]
Length=825

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_009342297.1| ATP-dependent Clp protease ATP-binding protein [Raphidiopsis 
brookii]
 gb|EFA73676.1| UvrB/UvrC protein [Raphidiopsis brookii D9]
Length=823

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_006277610.1| ATP-dependent Clp protease ATP-binding protein [Cylindrospermopsis 
raciborskii]
 gb|EFA69311.1| UvrB/UvrC protein [Cylindrospermopsis raciborskii CS-505]
Length=823

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_017712666.1| ATP-dependent Clp protease ATP-binding protein [Prochlorothrix 
hollandica]
Length=824

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_042153862.1| Clp protease ClpX [Planktothrix agardhii]
 gb|KEI66870.1| ClpC [Planktothrix agardhii NIVA-CYA 126/8]
Length=825

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_015185589.1| chaperone ATPase [Microcoleus sp. PCC 7113]
 gb|AFZ21460.1| ATPase with chaperone activity, ATP-binding subunit [Microcoleus 
sp. PCC 7113]
Length=822

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_017293405.1| ATP-dependent Clp protease ATP-binding protein [Geminocystis 
herdmanii]
Length=824

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_015166218.1| ATPase [Pseudanabaena sp. PCC 7367]
 gb|AFY71262.1| ATPase AAA-2 domain protein [Pseudanabaena sp. PCC 7367]
Length=831

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_017717294.1| ATP-dependent Clp protease ATP-binding protein [Oscillatoria 
sp. PCC 10802]
Length=823

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_027250152.1| Clp protease ClpX [Planktothrix agardhii]
Length=825

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_026785489.1| MULTISPECIES: Clp protease ClpX [Planktothrix]
Length=825

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_041035515.1| Clp protease ClpX [Tolypothrix campylonemoides]
 gb|KIJ77734.1| Clp protease ClpX [Tolypothrix campylonemoides VB511288]
Length=822

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_011377512.1| MULTISPECIES: ATP-dependent Clp protease ATP-binding protein 
[Synechococcus]
 gb|ABB56292.1| ATPase [Synechococcus elongatus PCC 7942]
 gb|AJD56659.1| Clp protease ClpX [Synechococcus sp. UTEX 2973]
Length=824

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_015216290.1| ATPase AAA-2 domain protein [Anabaena cylindrica]
 gb|AFZ59673.1| ATPase AAA-2 domain protein [Anabaena cylindrica PCC 7122]
Length=824

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_023066904.1| istB-like ATP binding family protein [Lyngbya aestuarii]
 gb|ERT06867.1| istB-like ATP binding family protein [Lyngbya aestuarii BL J]
Length=825

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_027842712.1| Clp protease ClpX [Mastigocoleus testarum]
Length=822

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_008274497.1| ATP-dependent Clp protease ATP-binding protein [Cyanothece sp. 
CCY0110]
 gb|EAZ92285.1| ATP-dependent Clp protease regulatory subunit [Cyanothece sp. 
CCY0110]
Length=822

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_015117004.1| chaperone ATPase [Rivularia sp. PCC 7116]
 gb|AFY53426.1| ATPase with chaperone activity, ATP-binding subunit [Rivularia 
sp. PCC 7116]
Length=831

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>ref|WP_015201320.1| ATPase [Crinalium epipsammum]
 gb|AFZ11176.1| ATPase AAA-2 domain protein [Crinalium epipsammum PCC 9333]
Length=826

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



>gb|KIJ80614.1| Clp protease ClpX [Scytonema tolypothrichoides VB-61278]
Length=822

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  383  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  562
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  563  VEVEKIIGRGSGFVA  607
            +EVEKIIGRGSGFVA
Sbjct  61   IEVEKIIGRGSGFVA  75



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 829366762230