BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS092C02

Length=612
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009785438.1|  PREDICTED: protein SMG7-like                       210   2e-59   Nicotiana sylvestris
ref|XP_009609495.1|  PREDICTED: protein SMG7-like                       205   2e-57   Nicotiana tomentosiformis
ref|XP_009588718.1|  PREDICTED: protein SMG7-like isoform X2            202   1e-56   Nicotiana tomentosiformis
emb|CDP09550.1|  unnamed protein product                                202   2e-56   Coffea canephora [robusta coffee]
ref|XP_009588685.1|  PREDICTED: protein SMG7-like isoform X1            202   2e-56   Nicotiana tomentosiformis
ref|XP_010312160.1|  PREDICTED: protein SMG7-like                       197   1e-54   
ref|XP_006348036.1|  PREDICTED: protein SMG7-like isoform X4            197   2e-54   
ref|XP_006348033.1|  PREDICTED: protein SMG7-like isoform X1            197   2e-54   
gb|EYU20799.1|  hypothetical protein MIMGU_mgv1a000831mg                193   3e-53   Erythranthe guttata [common monkey flower]
ref|XP_011102111.1|  PREDICTED: protein SMG7-like                       191   3e-52   Sesamum indicum [beniseed]
ref|XP_004252008.1|  PREDICTED: protein SMG7-like                       188   2e-51   Solanum lycopersicum
gb|EPS74174.1|  hypothetical protein M569_00570                         182   2e-50   Genlisea aurea
gb|EYU18634.1|  hypothetical protein MIMGU_mgv1a000866mg                184   6e-50   Erythranthe guttata [common monkey flower]
ref|XP_009771476.1|  PREDICTED: protein SMG7-like isoform X2            183   1e-49   Nicotiana sylvestris
ref|XP_009771471.1|  PREDICTED: protein SMG7-like isoform X1            183   2e-49   Nicotiana sylvestris
ref|XP_010269415.1|  PREDICTED: protein SMG7-like                       182   4e-49   Nelumbo nucifera [Indian lotus]
ref|XP_011075415.1|  PREDICTED: protein SMG7-like                       178   1e-47   
ref|XP_008794961.1|  PREDICTED: protein SMG7-like isoform X1            177   3e-47   Phoenix dactylifera
ref|XP_010276660.1|  PREDICTED: protein SMG7                            176   4e-47   Nelumbo nucifera [Indian lotus]
ref|XP_002307971.2|  hypothetical protein POPTR_0006s03670g             175   1e-46   
emb|CBI30118.3|  unnamed protein product                                174   2e-46   Vitis vinifera
ref|XP_010653966.1|  PREDICTED: protein SMG7-like                       174   2e-46   Vitis vinifera
ref|XP_011027228.1|  PREDICTED: protein SMG7-like                       173   4e-46   Populus euphratica
ref|XP_002526042.1|  smg-7, putative                                    172   9e-46   Ricinus communis
gb|KDP43230.1|  hypothetical protein JCGZ_22782                         170   6e-45   Jatropha curcas
ref|XP_008357242.1|  PREDICTED: protein SMG7-like                       169   2e-44   
ref|XP_003556922.1|  PREDICTED: protein SMG7-like                       168   3e-44   Glycine max [soybeans]
ref|XP_008363383.1|  PREDICTED: protein SMG7-like                       168   4e-44   
ref|XP_006446288.1|  hypothetical protein CICLE_v10014151mg             167   9e-44   
ref|XP_007213738.1|  hypothetical protein PRUPE_ppa000760mg             167   1e-43   Prunus persica
ref|XP_009337058.1|  PREDICTED: protein SMG7-like                       166   2e-43   Pyrus x bretschneideri [bai li]
ref|XP_007015276.1|  Smg-7, putative isoform 1                          164   6e-43   
ref|XP_004513951.1|  PREDICTED: telomerase-binding protein EST1A-...    164   6e-43   Cicer arietinum [garbanzo]
ref|XP_006470548.1|  PREDICTED: protein SMG7-like isoform X1            164   9e-43   Citrus sinensis [apfelsine]
gb|ACJ86223.1|  unknown                                                 151   1e-42   Medicago truncatula
gb|KHG03132.1|  Protein SMG7                                            164   1e-42   Gossypium arboreum [tree cotton]
ref|XP_009348342.1|  PREDICTED: protein SMG7-like                       163   2e-42   Pyrus x bretschneideri [bai li]
gb|KHG16223.1|  Protein SMG7                                            163   2e-42   Gossypium arboreum [tree cotton]
gb|KHN46643.1|  Telomerase-binding protein EST1A                        163   2e-42   Glycine soja [wild soybean]
ref|XP_010906901.1|  PREDICTED: protein SMG7-like                       163   2e-42   Elaeis guineensis
ref|XP_010673012.1|  PREDICTED: protein SMG7-like                       162   3e-42   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006369654.1|  hypothetical protein POPTR_0001s28220g             162   3e-42   Populus trichocarpa [western balsam poplar]
gb|KHN38386.1|  Telomerase-binding protein EST1A                        162   4e-42   Glycine soja [wild soybean]
ref|XP_006470550.1|  PREDICTED: protein SMG7-like isoform X3            161   7e-42   Citrus sinensis [apfelsine]
ref|XP_003529483.1|  PREDICTED: protein SMG7-like                       161   8e-42   Glycine max [soybeans]
gb|KEH16467.1|  telomerase activating protein Est1                      161   1e-41   Medicago truncatula
gb|KJB35694.1|  hypothetical protein B456_006G124400                    160   2e-41   Gossypium raimondii
gb|KJB35696.1|  hypothetical protein B456_006G124400                    160   2e-41   Gossypium raimondii
ref|XP_010519796.1|  PREDICTED: protein SMG7-like                       159   4e-41   Tarenaya hassleriana [spider flower]
ref|XP_011024974.1|  PREDICTED: protein SMG7                            159   5e-41   Populus euphratica
gb|KJB83569.1|  hypothetical protein B456_013G253600                    159   7e-41   Gossypium raimondii
ref|XP_002276189.1|  PREDICTED: protein SMG7                            159   7e-41   Vitis vinifera
ref|XP_008788823.1|  PREDICTED: protein SMG7-like isoform X1            158   9e-41   Phoenix dactylifera
gb|KJB09301.1|  hypothetical protein B456_001G133700                    158   1e-40   Gossypium raimondii
gb|KJB55410.1|  hypothetical protein B456_009G074900                    157   2e-40   Gossypium raimondii
ref|XP_010106599.1|  hypothetical protein L484_002554                   156   6e-40   
emb|CBI24245.3|  unnamed protein product                                155   6e-40   Vitis vinifera
ref|XP_007146121.1|  hypothetical protein PHAVU_006G014200g             156   7e-40   Phaseolus vulgaris [French bean]
ref|XP_007141499.1|  hypothetical protein PHAVU_008G201200g             155   7e-40   Phaseolus vulgaris [French bean]
gb|KJB83570.1|  hypothetical protein B456_013G253600                    155   1e-39   Gossypium raimondii
ref|XP_006400499.1|  hypothetical protein EUTSA_v10012551mg             155   1e-39   Eutrema salsugineum [saltwater cress]
gb|KHG13644.1|  Telomerase-binding EST1A                                155   2e-39   Gossypium arboreum [tree cotton]
ref|XP_010049945.1|  PREDICTED: protein SMG7-like isoform X1            153   8e-39   Eucalyptus grandis [rose gum]
ref|XP_010049946.1|  PREDICTED: protein SMG7-like isoform X2            152   9e-39   Eucalyptus grandis [rose gum]
ref|XP_009126857.1|  PREDICTED: protein SMG7-like                       140   1e-38   Brassica rapa
gb|KEH28378.1|  telomerase activating protein Est1                      151   4e-38   Medicago truncatula
gb|KHG27817.1|  Protein SMG7                                            151   4e-38   Gossypium arboreum [tree cotton]
emb|CDX92534.1|  BnaA10g15730D                                          149   2e-37   
ref|XP_009120890.1|  PREDICTED: protein SMG7                            149   3e-37   Brassica rapa
emb|CDY13995.1|  BnaC09g38310D                                          148   5e-37   Brassica napus [oilseed rape]
ref|XP_008227279.1|  PREDICTED: protein SMG7                            147   5e-37   Prunus mume [ume]
ref|XP_009396563.1|  PREDICTED: protein SMG7-like                       147   6e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010927363.1|  PREDICTED: protein SMG7-like                       146   2e-36   Elaeis guineensis
ref|XP_004491240.1|  PREDICTED: uncharacterized protein LOC101504...    146   2e-36   Cicer arietinum [garbanzo]
ref|XP_010928325.1|  PREDICTED: protein SMG7-like isoform X2            145   2e-36   
ref|XP_010928322.1|  PREDICTED: protein SMG7-like isoform X1            145   2e-36   Elaeis guineensis
ref|XP_003617251.1|  Telomerase-binding protein EST1A                   145   4e-36   
ref|XP_008794962.1|  PREDICTED: protein SMG7-like isoform X2            143   2e-35   
gb|KCW82774.1|  hypothetical protein EUGRSUZ_C04149                     141   6e-35   Eucalyptus grandis [rose gum]
ref|XP_004291734.1|  PREDICTED: protein SMG7                            140   1e-34   Fragaria vesca subsp. vesca
ref|XP_010049944.1|  PREDICTED: LOW QUALITY PROTEIN: protein SMG7...    140   1e-34   
ref|XP_004139063.1|  PREDICTED: uncharacterized protein LOC101220502    140   2e-34   Cucumis sativus [cucumbers]
ref|XP_009126360.1|  PREDICTED: protein SMG7-like                       140   2e-34   Brassica rapa
ref|XP_008450340.1|  PREDICTED: LOW QUALITY PROTEIN: protein SMG7       140   2e-34   
ref|XP_010492997.1|  PREDICTED: protein SMG7 isoform X1                 136   5e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010673759.1|  PREDICTED: protein SMG7                            135   6e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006856550.1|  hypothetical protein AMTR_s00046p00170580          133   5e-32   Amborella trichopoda
ref|XP_010536114.1|  PREDICTED: protein SMG7                            133   5e-32   Tarenaya hassleriana [spider flower]
ref|XP_009390996.1|  PREDICTED: protein SMG7-like                       133   8e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006286976.1|  hypothetical protein CARUB_v10000123mg             132   2e-31   
ref|XP_010493000.1|  PREDICTED: protein SMG7 isoform X2                 131   3e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010424182.1|  PREDICTED: protein SMG7-like                       129   1e-30   
emb|CDY65062.1|  BnaC02g44260D                                          128   3e-30   Brassica napus [oilseed rape]
emb|CDY44916.1|  BnaA02g04210D                                          128   5e-30   Brassica napus [oilseed rape]
gb|EEE68449.1|  hypothetical protein OsJ_26829                          124   8e-29   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001061501.1|  Os08g0305300                                       124   9e-29   
gb|EEC83333.1|  hypothetical protein OsI_28722                          124   9e-29   Oryza sativa Indica Group [Indian rice]
gb|EMS65250.1|  Protein SMG7                                            124   1e-28   Triticum urartu
ref|XP_009409875.1|  PREDICTED: protein SMG7-like                       123   2e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006659291.1|  PREDICTED: protein SMG7-like isoform X3            121   8e-28   Oryza brachyantha
ref|XP_006659289.1|  PREDICTED: protein SMG7-like isoform X1            121   8e-28   Oryza brachyantha
ref|NP_197441.3|  EST1 domain protein SMG7                              120   1e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002871883.1|  hypothetical protein ARALYDRAFT_488829             120   3e-27   
ref|XP_004956332.1|  PREDICTED: protein SMG7-like                       117   2e-26   Setaria italica
ref|XP_010234570.1|  PREDICTED: protein SMG7                            117   2e-26   Brachypodium distachyon [annual false brome]
dbj|BAD30942.1|  putative cig3                                          115   1e-25   Oryza sativa Japonica Group [Japonica rice]
dbj|BAI39673.1|  putative cig3                                          115   1e-25   Oryza sativa Indica Group [Indian rice]
gb|AAQ56453.1|  putative cytokinin inducibl protein                     115   2e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008670096.1|  PREDICTED: protein SMG7                            109   1e-23   Zea mays [maize]
gb|EMT31840.1|  hypothetical protein F775_31931                         109   1e-23   
gb|KDO54816.1|  hypothetical protein CISIN_1g0023802mg                  100   4e-22   Citrus sinensis [apfelsine]
ref|XP_008651785.1|  PREDICTED: uncharacterized protein LOC100384...    103   2e-21   
ref|XP_008652306.1|  PREDICTED: protein SMG7-like                     92.8    4e-19   
ref|XP_008788825.1|  PREDICTED: protein SMG7-like isoform X2          90.9    3e-17   
gb|KEH22140.1|  Smg-7, putative                                       70.1    1e-12   Medicago truncatula
ref|XP_001781790.1|  predicted protein                                75.1    4e-12   
ref|XP_001765874.1|  predicted protein                                73.6    1e-11   
ref|XP_006853551.1|  hypothetical protein AMTR_s00032p00234570        55.1    1e-05   Amborella trichopoda
ref|XP_006594589.1|  PREDICTED: protein SMG7L-like                    54.7    1e-05   Glycine max [soybeans]
ref|XP_003547150.2|  PREDICTED: protein SMG7L-like isoform X1         53.1    5e-05   Glycine max [soybeans]
ref|XP_006597440.1|  PREDICTED: protein SMG7L-like isoform X2         53.1    5e-05   Glycine max [soybeans]
gb|KJB66725.1|  hypothetical protein B456_010G155000                  51.6    2e-04   Gossypium raimondii
ref|XP_004485796.1|  PREDICTED: uncharacterized protein LOC101498...  50.8    3e-04   Cicer arietinum [garbanzo]
ref|XP_004485792.1|  PREDICTED: uncharacterized protein LOC101498...  50.8    3e-04   Cicer arietinum [garbanzo]
ref|XP_002509461.1|  smg-7, putative                                  50.4    4e-04   
gb|KHG19322.1|  Telomerase-binding EST1A                              50.4    4e-04   Gossypium arboreum [tree cotton]
ref|XP_006594316.1|  PREDICTED: protein SMG7L-like isoform X4         50.1    6e-04   
ref|XP_006594315.1|  PREDICTED: protein SMG7L-like isoform X3         49.7    6e-04   Glycine max [soybeans]
ref|XP_006594313.1|  PREDICTED: protein SMG7L-like isoform X1         49.7    6e-04   Glycine max [soybeans]
gb|KHN09994.1|  Protein SMG7                                          49.7    7e-04   Glycine soja [wild soybean]
ref|XP_002305789.2|  hypothetical protein POPTR_0004s04510g           49.7    7e-04   Populus trichocarpa [western balsam poplar]
ref|XP_007159335.1|  hypothetical protein PHAVU_002G229500g           49.3    0.001   Phaseolus vulgaris [French bean]



>ref|XP_009785438.1| PREDICTED: protein SMG7-like [Nicotiana sylvestris]
 ref|XP_009785445.1| PREDICTED: protein SMG7-like [Nicotiana sylvestris]
Length=973

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/115 (84%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +2

Query  266  IMTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILE  445
            +M IPMDNS+DHSSRE VQRLFNKN ELENKRRKAAQAR+ SDPN+WQQMRENYEAIILE
Sbjct  1    MMAIPMDNSLDHSSRECVQRLFNKNAELENKRRKAAQARVSSDPNAWQQMRENYEAIILE  60

Query  446  NHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            +HAFSEQHEIEYALWQLHYRRIEELRA  N AL+++GSTTSQNGKGP R GPD I
Sbjct  61   DHAFSEQHEIEYALWQLHYRRIEELRARFNAALASNGSTTSQNGKGPPRSGPDNI  115



>ref|XP_009609495.1| PREDICTED: protein SMG7-like [Nicotiana tomentosiformis]
 ref|XP_009609497.1| PREDICTED: protein SMG7-like [Nicotiana tomentosiformis]
 ref|XP_009609498.1| PREDICTED: protein SMG7-like [Nicotiana tomentosiformis]
Length=973

 Score =   205 bits (522),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/115 (82%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +2

Query  266  IMTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILE  445
            +M IPMDNS+DHSSRE VQRLFNKN +LENKRRKAAQAR+ SDPN+WQQMRENYEAIILE
Sbjct  1    MMAIPMDNSLDHSSREHVQRLFNKNADLENKRRKAAQARVSSDPNAWQQMRENYEAIILE  60

Query  446  NHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            +HAFSEQHEIEYALWQLHYRRIEELRA  N AL+++GSTTSQNGKGP R G D +
Sbjct  61   DHAFSEQHEIEYALWQLHYRRIEELRARFNAALASNGSTTSQNGKGPPRSGTDSV  115



>ref|XP_009588718.1| PREDICTED: protein SMG7-like isoform X2 [Nicotiana tomentosiformis]
Length=968

 Score =   202 bits (515),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +2

Query  266  IMTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILE  445
            +MTIPMD++VDH SRE+VQRL+NKNVELENKRRKAAQAR+PSDP++WQQMRENYEAIILE
Sbjct  1    MMTIPMDSAVDHLSREQVQRLYNKNVELENKRRKAAQARVPSDPSAWQQMRENYEAIILE  60

Query  446  NHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            ++AFSEQHEIEYALWQLHYRRIEELRAH N A+++S ST SQNGK P R GPDR+
Sbjct  61   DNAFSEQHEIEYALWQLHYRRIEELRAHFNAAVNSSVSTNSQNGKVPHRSGPDRV  115



>emb|CDP09550.1| unnamed protein product [Coffea canephora]
Length=958

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 107/116 (92%), Gaps = 2/116 (2%)
 Frame = +2

Query  269  MTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILEN  448
            MTIPMDN+ D+SSRERVQ+LFNKNVELEN+RRKAAQARIPSDPN+WQQMRENYEAI+LE+
Sbjct  1    MTIPMDNNPDNSSRERVQKLFNKNVELENRRRKAAQARIPSDPNAWQQMRENYEAIVLED  60

Query  449  HAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGST--TSQNGKGPSRGGPDRI  610
            HAFSEQHEIEYALWQLHYRRIEELRAH N A ++  +   TSQNGKGP+RGGPDR+
Sbjct  61   HAFSEQHEIEYALWQLHYRRIEELRAHFNAAAASVSAGSNTSQNGKGPTRGGPDRL  116



>ref|XP_009588685.1| PREDICTED: protein SMG7-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009588692.1| PREDICTED: protein SMG7-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009588698.1| PREDICTED: protein SMG7-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009588706.1| PREDICTED: protein SMG7-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009588712.1| PREDICTED: protein SMG7-like isoform X1 [Nicotiana tomentosiformis]
Length=995

 Score =   202 bits (515),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +2

Query  266  IMTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILE  445
            +MTIPMD++VDH SRE+VQRL+NKNVELENKRRKAAQAR+PSDP++WQQMRENYEAIILE
Sbjct  1    MMTIPMDSAVDHLSREQVQRLYNKNVELENKRRKAAQARVPSDPSAWQQMRENYEAIILE  60

Query  446  NHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            ++AFSEQHEIEYALWQLHYRRIEELRAH N A+++S ST SQNGK P R GPDR+
Sbjct  61   DNAFSEQHEIEYALWQLHYRRIEELRAHFNAAVNSSVSTNSQNGKVPHRSGPDRV  115



>ref|XP_010312160.1| PREDICTED: protein SMG7-like [Solanum lycopersicum]
Length=967

 Score =   197 bits (501),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 102/114 (89%), Gaps = 1/114 (1%)
 Frame = +2

Query  269  MTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILEN  448
            M I MD+S+DHSSRERVQRLFNKNVEL+NKRRKAAQAR+ SDPN+WQQMRENYEAIILEN
Sbjct  1    MAIQMDSSLDHSSRERVQRLFNKNVELDNKRRKAAQARVCSDPNAWQQMRENYEAIILEN  60

Query  449  HAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            HAFSEQHEIEYALWQLHYRRIEELRA  N A+++SGS TSQ GKGP R G D I
Sbjct  61   HAFSEQHEIEYALWQLHYRRIEELRARFNAAIASSGS-TSQTGKGPPRNGSDNI  113



>ref|XP_006348036.1| PREDICTED: protein SMG7-like isoform X4 [Solanum tuberosum]
 ref|XP_006348037.1| PREDICTED: protein SMG7-like isoform X5 [Solanum tuberosum]
Length=965

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 102/114 (89%), Gaps = 3/114 (3%)
 Frame = +2

Query  269  MTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILEN  448
            MTIPMD+++DHSSRERVQRL+NKNVELE KRRKAAQAR+PSDP++WQQMRENYE IILE+
Sbjct  1    MTIPMDSNLDHSSRERVQRLYNKNVELEKKRRKAAQARVPSDPSAWQQMRENYETIILED  60

Query  449  HAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            H FSEQHEIEYALWQ+HYRRIEELRAH N A ++SGST   NGKGP   GPDR+
Sbjct  61   HVFSEQHEIEYALWQMHYRRIEELRAHFNAAANSSGST---NGKGPPTSGPDRV  111



>ref|XP_006348033.1| PREDICTED: protein SMG7-like isoform X1 [Solanum tuberosum]
 ref|XP_006348034.1| PREDICTED: protein SMG7-like isoform X2 [Solanum tuberosum]
 ref|XP_006348035.1| PREDICTED: protein SMG7-like isoform X3 [Solanum tuberosum]
Length=992

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 102/114 (89%), Gaps = 3/114 (3%)
 Frame = +2

Query  269  MTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILEN  448
            MTIPMD+++DHSSRERVQRL+NKNVELE KRRKAAQAR+PSDP++WQQMRENYE IILE+
Sbjct  1    MTIPMDSNLDHSSRERVQRLYNKNVELEKKRRKAAQARVPSDPSAWQQMRENYETIILED  60

Query  449  HAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            H FSEQHEIEYALWQ+HYRRIEELRAH N A ++SGST   NGKGP   GPDR+
Sbjct  61   HVFSEQHEIEYALWQMHYRRIEELRAHFNAAANSSGST---NGKGPPTSGPDRV  111



>gb|EYU20799.1| hypothetical protein MIMGU_mgv1a000831mg [Erythranthe guttata]
Length=970

 Score =   193 bits (491),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  269  MTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILEN  448
            MT+ MDN++++SSRERVQRL +KN ELENKRRKAAQARIPSDPN+WQ MRENYEAI+LE+
Sbjct  1    MTMLMDNNIENSSRERVQRLLDKNTELENKRRKAAQARIPSDPNTWQNMRENYEAIVLED  60

Query  449  HAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            HAFSEQHE+EYALWQLHYRRIEELRA  N ALS++GS  SQNGKG  R GPDR+
Sbjct  61   HAFSEQHEVEYALWQLHYRRIEELRALFNAALSSAGSVASQNGKGSVRTGPDRL  114



>ref|XP_011102111.1| PREDICTED: protein SMG7-like [Sesamum indicum]
 ref|XP_011102112.1| PREDICTED: protein SMG7-like [Sesamum indicum]
Length=984

 Score =   191 bits (484),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +2

Query  269  MTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILEN  448
            MT+PMDN+ ++SSRERVQRLFNKNVELENKRRKAAQ RIPSDPN+WQ MRENYEAI+LE+
Sbjct  1    MTMPMDNNKENSSRERVQRLFNKNVELENKRRKAAQERIPSDPNTWQNMRENYEAIVLED  60

Query  449  HAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            HAFSEQH++EYALWQLHYRRIEELRA  N A++++ S   QNGKGP RGGPDR+
Sbjct  61   HAFSEQHDVEYALWQLHYRRIEELRALFNAAVASAASAAPQNGKGPVRGGPDRL  114



>ref|XP_004252008.1| PREDICTED: protein SMG7-like [Solanum lycopersicum]
 ref|XP_010314013.1| PREDICTED: protein SMG7-like [Solanum lycopersicum]
 ref|XP_010314014.1| PREDICTED: protein SMG7-like [Solanum lycopersicum]
Length=993

 Score =   188 bits (478),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 101/115 (88%), Gaps = 3/115 (3%)
 Frame = +2

Query  266  IMTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILE  445
            +MTIPMD+++DHSSRERVQ L+NKNVELENKRRKAAQAR+PSDP++WQQMRENYE IILE
Sbjct  1    MMTIPMDSNLDHSSRERVQCLYNKNVELENKRRKAAQARVPSDPSAWQQMRENYETIILE  60

Query  446  NHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            +H FSEQHEIEYALWQ+HYRRIEELRAH N A ++SG+T   NGK     GPDRI
Sbjct  61   DHVFSEQHEIEYALWQMHYRRIEELRAHFNAAANSSGTT---NGKVHPTSGPDRI  112



>gb|EPS74174.1| hypothetical protein M569_00570, partial [Genlisea aurea]
Length=589

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  263  WIMTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIIL  442
            W M IPMD++ D+ SRER QRLFN+ VELENKRRKA QAR+PSDPN+WQ++RENYEAI+L
Sbjct  5    WKMAIPMDSNKDNLSRERAQRLFNETVELENKRRKAVQARVPSDPNAWQKIRENYEAIVL  64

Query  443  ENHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            E+H FSE+HEIE+ LWQLHYRRIEELRA  N  +S++GS   QNGKGP R GP+ +
Sbjct  65   EDHDFSEKHEIEFCLWQLHYRRIEELRARFNACVSSAGSDAPQNGKGPVRSGPEVL  120



>gb|EYU18634.1| hypothetical protein MIMGU_mgv1a000866mg [Erythranthe guttata]
Length=955

 Score =   184 bits (467),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = +2

Query  266  IMTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILE  445
            +M IPM+N+ ++SS+E  QRLF+KNVELENKRRKAAQARIPSDP++WQQMRENYEAI+LE
Sbjct  1    MMAIPMENNKENSSKELAQRLFSKNVELENKRRKAAQARIPSDPSTWQQMRENYEAIVLE  60

Query  446  NHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            +HAFSEQHEIEYALWQLHYRRIEELRA  N +L+++ S  +QNGKGP R GPDRI
Sbjct  61   DHAFSEQHEIEYALWQLHYRRIEELRALFNASLASAKSAAAQNGKGPVRSGPDRI  115



>ref|XP_009771476.1| PREDICTED: protein SMG7-like isoform X2 [Nicotiana sylvestris]
Length=969

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = +2

Query  281  MDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILENHAFS  460
            MD++VD  SRE+VQRL+NKNVELENKRRKAAQAR+PSDP++WQQMRENYEAIILE++AFS
Sbjct  7    MDSAVDQLSREQVQRLYNKNVELENKRRKAAQARVPSDPSAWQQMRENYEAIILEDNAFS  66

Query  461  EQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            EQHEIEYALWQLHYRRIEELRAH N A++++ ST S NGK P   GPDR+
Sbjct  67   EQHEIEYALWQLHYRRIEELRAHFNAAVNSNVSTNSLNGKVPHHSGPDRV  116



>ref|XP_009771471.1| PREDICTED: protein SMG7-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009771472.1| PREDICTED: protein SMG7-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009771473.1| PREDICTED: protein SMG7-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009771474.1| PREDICTED: protein SMG7-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009771475.1| PREDICTED: protein SMG7-like isoform X1 [Nicotiana sylvestris]
Length=996

 Score =   183 bits (464),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = +2

Query  281  MDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILENHAFS  460
            MD++VD  SRE+VQRL+NKNVELENKRRKAAQAR+PSDP++WQQMRENYEAIILE++AFS
Sbjct  7    MDSAVDQLSREQVQRLYNKNVELENKRRKAAQARVPSDPSAWQQMRENYEAIILEDNAFS  66

Query  461  EQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            EQHEIEYALWQLHYRRIEELRAH N A++++ ST S NGK P   GPDR+
Sbjct  67   EQHEIEYALWQLHYRRIEELRAHFNAAVNSNVSTNSLNGKVPHHSGPDRV  116



>ref|XP_010269415.1| PREDICTED: protein SMG7-like [Nelumbo nucifera]
 ref|XP_010269416.1| PREDICTED: protein SMG7-like [Nelumbo nucifera]
 ref|XP_010269417.1| PREDICTED: protein SMG7-like [Nelumbo nucifera]
Length=983

 Score =   182 bits (462),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 97/115 (84%), Gaps = 3/115 (3%)
 Frame = +2

Query  266  IMTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILE  445
            +MT+PMDN     SRE VQRL+NKN+ LEN+RRK+AQARIPSDPN+WQQMRENYEAIILE
Sbjct  1    MMTVPMDNLSAPLSREHVQRLYNKNIGLENRRRKSAQARIPSDPNAWQQMRENYEAIILE  60

Query  446  NHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            +H+FSEQHEIEY LWQLHYRRIEELRAHL  AL  SGS TS +GKGP    PDRI
Sbjct  61   DHSFSEQHEIEYKLWQLHYRRIEELRAHLTAALGPSGSATSLSGKGPR---PDRI  112



>ref|XP_011075415.1| PREDICTED: protein SMG7-like [Sesamum indicum]
Length=968

 Score =   178 bits (451),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 96/114 (84%), Gaps = 9/114 (8%)
 Frame = +2

Query  269  MTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILEN  448
            MTIPM+N+ + SSRE VQRLFNKNVELENKRRKAAQ RIPSDPN+WQQMRENYEAIILE+
Sbjct  1    MTIPMENNKESSSRELVQRLFNKNVELENKRRKAAQLRIPSDPNTWQQMRENYEAIILED  60

Query  449  HAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            HAFSEQH+IEYALWQLHYRRIEELRA  N A++++GS          R GPDR+
Sbjct  61   HAFSEQHDIEYALWQLHYRRIEELRALFNAAVASAGSV---------RSGPDRL  105



>ref|XP_008794961.1| PREDICTED: protein SMG7-like isoform X1 [Phoenix dactylifera]
Length=995

 Score =   177 bits (448),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 99/116 (85%), Gaps = 2/116 (2%)
 Frame = +2

Query  263  WIMTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIIL  442
            W+MT+PM+NS   SSRERV  L+NKN+ELEN  RK+A++++PSDPN+W QMRENYEAIIL
Sbjct  3    WMMTVPMNNSSAPSSRERVLSLYNKNIELENGLRKSAKSKVPSDPNAWLQMRENYEAIIL  62

Query  443  ENHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            E+H FSE+HEIEYALWQLHYRRIEE RAH+NTA S+ G+TT Q GK P++  PDRI
Sbjct  63   EDHEFSEKHEIEYALWQLHYRRIEEFRAHINTAASSGGATTLQVGKSPAQ--PDRI  116



>ref|XP_010276660.1| PREDICTED: protein SMG7 [Nelumbo nucifera]
 ref|XP_010276661.1| PREDICTED: protein SMG7 [Nelumbo nucifera]
 ref|XP_010276662.1| PREDICTED: protein SMG7 [Nelumbo nucifera]
Length=968

 Score =   176 bits (447),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 97/115 (84%), Gaps = 10/115 (9%)
 Frame = +2

Query  266  IMTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILE  445
            +MT+ MDN    SSRE VQRL+NKN+ELEN+RRK+AQARIPSDPN+WQQMRENYEAIILE
Sbjct  1    MMTVLMDNLGAPSSRELVQRLYNKNIELENRRRKSAQARIPSDPNAWQQMRENYEAIILE  60

Query  446  NHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            +HAFSEQHEIEYALWQLHYRRIEELRA+L  A        SQNGKGPSR  PDRI
Sbjct  61   DHAFSEQHEIEYALWQLHYRRIEELRAYLTAA--------SQNGKGPSR--PDRI  105



>ref|XP_002307971.2| hypothetical protein POPTR_0006s03670g [Populus trichocarpa]
 gb|EEE91494.2| hypothetical protein POPTR_0006s03670g [Populus trichocarpa]
Length=954

 Score =   175 bits (443),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 96/114 (84%), Gaps = 2/114 (2%)
 Frame = +2

Query  269  MTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILEN  448
            MT+PMDN VD SSR+RVQRL++KNVEL N+ R++AQARIPSD   WQQMRENYEAIILE+
Sbjct  1    MTVPMDNPVDLSSRDRVQRLYDKNVELGNRLRRSAQARIPSDFTVWQQMRENYEAIILED  60

Query  449  HAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            HAFSEQHEIEYALWQLHYRRIEE R H   AL+++GS TSQNG   +R  P+RI
Sbjct  61   HAFSEQHEIEYALWQLHYRRIEEFRTHCKAALASNGSVTSQNGTMIAR--PERI  112



>emb|CBI30118.3| unnamed protein product [Vitis vinifera]
Length=957

 Score =   174 bits (442),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 103/115 (90%), Gaps = 2/115 (2%)
 Frame = +2

Query  266  IMTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILE  445
            +MTIPMDN++D  SRERVQRLFNKNVELE+KRR++AQARI  DPN+WQQMRENYEAIILE
Sbjct  1    MMTIPMDNNLDIQSRERVQRLFNKNVELESKRRRSAQARISFDPNAWQQMRENYEAIILE  60

Query  446  NHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            ++AFSEQHEIEYALWQLHYRRIEELRAH + AL++S S TSQ+ KG +R  PDRI
Sbjct  61   DNAFSEQHEIEYALWQLHYRRIEELRAHFSAALASSASNTSQSLKGSAR--PDRI  113



>ref|XP_010653966.1| PREDICTED: protein SMG7-like [Vitis vinifera]
 ref|XP_010653967.1| PREDICTED: protein SMG7-like [Vitis vinifera]
 ref|XP_010653968.1| PREDICTED: protein SMG7-like [Vitis vinifera]
 ref|XP_002272687.3| PREDICTED: protein SMG7-like [Vitis vinifera]
Length=973

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 103/115 (90%), Gaps = 2/115 (2%)
 Frame = +2

Query  266  IMTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILE  445
            +MTIPMDN++D  SRERVQRLFNKNVELE+KRR++AQARI  DPN+WQQMRENYEAIILE
Sbjct  1    MMTIPMDNNLDIQSRERVQRLFNKNVELESKRRRSAQARISFDPNAWQQMRENYEAIILE  60

Query  446  NHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            ++AFSEQHEIEYALWQLHYRRIEELRAH + AL++S S TSQ+ KG +R  PDRI
Sbjct  61   DNAFSEQHEIEYALWQLHYRRIEELRAHFSAALASSASNTSQSLKGSAR--PDRI  113



>ref|XP_011027228.1| PREDICTED: protein SMG7-like [Populus euphratica]
 ref|XP_011027230.1| PREDICTED: protein SMG7-like [Populus euphratica]
Length=955

 Score =   173 bits (439),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 95/114 (83%), Gaps = 2/114 (2%)
 Frame = +2

Query  269  MTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILEN  448
            MT+PMDN VD SSR+RVQRL++KNVEL N+ R++AQARIPSD   WQQMRENYEAIILE+
Sbjct  1    MTVPMDNPVDLSSRDRVQRLYDKNVELGNRLRRSAQARIPSDFTVWQQMRENYEAIILED  60

Query  449  HAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            H FSEQHEIEYALWQLHYRRIEE R H   AL+++GS TSQNG   +R  P+RI
Sbjct  61   HVFSEQHEIEYALWQLHYRRIEEFRTHCKAALASNGSVTSQNGTMIAR--PERI  112



>ref|XP_002526042.1| smg-7, putative [Ricinus communis]
 gb|EEF36319.1| smg-7, putative [Ricinus communis]
Length=982

 Score =   172 bits (437),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 95/115 (83%), Gaps = 2/115 (2%)
 Frame = +2

Query  266  IMTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILE  445
            +M + MD     SSRER QRL+ KN+ELENKRR++AQARIPSDPN+WQQMRENYEAI+LE
Sbjct  1    MMIVQMDKMSAPSSRERAQRLYEKNIELENKRRRSAQARIPSDPNAWQQMRENYEAIVLE  60

Query  446  NHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            +H FSEQH IEYALWQLHYRRIEELRAH + AL+++ S TSQ  K PSR  PDR+
Sbjct  61   DHGFSEQHNIEYALWQLHYRRIEELRAHFSAALASANSNTSQGAKVPSR--PDRV  113



>gb|KDP43230.1| hypothetical protein JCGZ_22782 [Jatropha curcas]
Length=966

 Score =   170 bits (430),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 92/103 (89%), Gaps = 2/103 (2%)
 Frame = +2

Query  302  SSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILENHAFSEQHEIEY  481
            SSRER QRL+ KN+ELENKRR++AQARIPSDPN+WQQMRENYEAI+LE+H FSEQH IEY
Sbjct  5    SSRERAQRLYEKNIELENKRRRSAQARIPSDPNAWQQMRENYEAIVLEDHGFSEQHNIEY  64

Query  482  ALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            ALWQLHYRRIEELRAH ++AL+++GS TSQ  K P+R  PDRI
Sbjct  65   ALWQLHYRRIEELRAHFSSALASTGSNTSQGAKVPAR--PDRI  105



>ref|XP_008357242.1| PREDICTED: protein SMG7-like [Malus domestica]
 ref|XP_008357243.1| PREDICTED: protein SMG7-like [Malus domestica]
 ref|XP_008357244.1| PREDICTED: protein SMG7-like [Malus domestica]
Length=1003

 Score =   169 bits (428),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 96/115 (83%), Gaps = 3/115 (3%)
 Frame = +2

Query  269  MTIP-MDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILE  445
            M IP MD     SSRER QRL++K +ELEN+RR++AQARIPSDPN+WQQMRENYEAIILE
Sbjct  1    MMIPQMDKMSAPSSRERAQRLYDKILELENRRRRSAQARIPSDPNAWQQMRENYEAIILE  60

Query  446  NHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            +HAFSEQH IEYALWQLHY+RIEELRAH + A +++GS TSQ  KGP R  PDR+
Sbjct  61   DHAFSEQHNIEYALWQLHYKRIEELRAHFSAATASAGSNTSQGVKGPIR--PDRV  113



>ref|XP_003556922.1| PREDICTED: protein SMG7-like [Glycine max]
Length=967

 Score =   168 bits (426),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 97/114 (85%), Gaps = 2/114 (2%)
 Frame = +2

Query  269  MTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILEN  448
            M + MD     SSRER QRL++KN+ELE+KRR++A+AR+PSDPN+WQQ+RENYEAIILE+
Sbjct  1    MIVEMDKMSAPSSRERAQRLYDKNLELESKRRRSAKARVPSDPNAWQQIRENYEAIILED  60

Query  449  HAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            HAFSEQH IEYALWQLHY+RIEE RA+ + ALS++ + +SQ GKGP+R  PDRI
Sbjct  61   HAFSEQHNIEYALWQLHYKRIEEFRAYFSAALSSTNANSSQGGKGPAR--PDRI  112



>ref|XP_008363383.1| PREDICTED: protein SMG7-like [Malus domestica]
 ref|XP_008363384.1| PREDICTED: protein SMG7-like [Malus domestica]
 ref|XP_008363385.1| PREDICTED: protein SMG7-like [Malus domestica]
 ref|XP_008363386.1| PREDICTED: protein SMG7-like [Malus domestica]
Length=1006

 Score =   168 bits (425),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 97/113 (86%), Gaps = 3/113 (3%)
 Frame = +2

Query  275  IP-MDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILENH  451
            IP MDN    SSRER QRL++K +ELEN+RR++AQARIPSDPN+WQQMRENYEAIILE+H
Sbjct  2    IPQMDNMSAPSSRERAQRLYDKILELENRRRRSAQARIPSDPNAWQQMRENYEAIILEDH  61

Query  452  AFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            AFSEQ+ IEYALWQLHY+RIEELRAH + A++++GS TSQ  KGP R  PDR+
Sbjct  62   AFSEQNNIEYALWQLHYKRIEELRAHFSAAMASTGSNTSQGVKGPIR--PDRV  112



>ref|XP_006446288.1| hypothetical protein CICLE_v10014151mg [Citrus clementina]
 ref|XP_006446289.1| hypothetical protein CICLE_v10014151mg [Citrus clementina]
 gb|ESR59528.1| hypothetical protein CICLE_v10014151mg [Citrus clementina]
 gb|ESR59529.1| hypothetical protein CICLE_v10014151mg [Citrus clementina]
Length=983

 Score =   167 bits (422),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 96/116 (83%), Gaps = 4/116 (3%)
 Frame = +2

Query  269  MTIPMDN--SVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIIL  442
            M + MDN  +   S+RER QRL+ KN+ELENKRR++ QARIPSDPN+WQQMRENYEAIIL
Sbjct  1    MIVQMDNMSAPAPSARERAQRLYEKNIELENKRRRSVQARIPSDPNAWQQMRENYEAIIL  60

Query  443  ENHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            E+HAFSEQH +EYALWQLHYRRIEELRAH + A+S++GS TSQ  K PSR   DR+
Sbjct  61   EDHAFSEQHNVEYALWQLHYRRIEELRAHYSAAVSSAGSNTSQATKVPSRS--DRV  114



>ref|XP_007213738.1| hypothetical protein PRUPE_ppa000760mg [Prunus persica]
 gb|EMJ14937.1| hypothetical protein PRUPE_ppa000760mg [Prunus persica]
Length=1013

 Score =   167 bits (422),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 95/114 (83%), Gaps = 2/114 (2%)
 Frame = +2

Query  269  MTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILEN  448
            M   MD     SSRER QRL++K +ELEN+RR++AQARIPSDPN+WQQ+RENYEAIILE+
Sbjct  1    MITRMDKMSAPSSRERAQRLYDKVIELENRRRRSAQARIPSDPNAWQQIRENYEAIILED  60

Query  449  HAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            HAFSEQH IEYALWQLHY+RIEELRAH + A +++GS +SQ  KGP+R  PDRI
Sbjct  61   HAFSEQHNIEYALWQLHYKRIEELRAHFSAATASAGSNSSQAVKGPAR--PDRI  112



>ref|XP_009337058.1| PREDICTED: protein SMG7-like [Pyrus x bretschneideri]
 ref|XP_009337059.1| PREDICTED: protein SMG7-like [Pyrus x bretschneideri]
 ref|XP_009337060.1| PREDICTED: protein SMG7-like [Pyrus x bretschneideri]
Length=1006

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 96/113 (85%), Gaps = 3/113 (3%)
 Frame = +2

Query  275  IP-MDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILENH  451
            IP MD     SSRER QRL++K +ELEN+RR++AQARIPSDPN+WQQMRENYEAIILE+H
Sbjct  2    IPQMDKMSAPSSRERAQRLYDKILELENRRRRSAQARIPSDPNAWQQMRENYEAIILEDH  61

Query  452  AFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            AFSEQ+ IEYALWQLHY+RIEELRAH + A++++GS TSQ  KGP R  PDR+
Sbjct  62   AFSEQNNIEYALWQLHYKRIEELRAHFSAAMASTGSNTSQGVKGPIR--PDRV  112



>ref|XP_007015276.1| Smg-7, putative isoform 1 [Theobroma cacao]
 ref|XP_007015277.1| Smg-7, putative isoform 1 [Theobroma cacao]
 gb|EOY32895.1| Smg-7, putative isoform 1 [Theobroma cacao]
 gb|EOY32896.1| Smg-7, putative isoform 1 [Theobroma cacao]
Length=989

 Score =   164 bits (416),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 92/115 (80%), Gaps = 2/115 (2%)
 Frame = +2

Query  266  IMTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILE  445
            +M   MD     SSRER QRL+ KN+ELEN RR++AQAR+PSDPN+WQQMRENYEAIILE
Sbjct  1    MMIAQMDKMSAPSSRERAQRLYEKNIELENNRRRSAQARVPSDPNAWQQMRENYEAIILE  60

Query  446  NHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            +HAFSEQH IEYALWQLHY+RIEELRAH N AL+++GS  SQ  K   R  PDR+
Sbjct  61   DHAFSEQHNIEYALWQLHYKRIEELRAHYNAALASAGSNASQGVKVAPR--PDRL  113



>ref|XP_004513951.1| PREDICTED: telomerase-binding protein EST1A-like isoform X1 [Cicer 
arietinum]
 ref|XP_004513952.1| PREDICTED: telomerase-binding protein EST1A-like isoform X2 [Cicer 
arietinum]
Length=977

 Score =   164 bits (416),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 94/115 (82%), Gaps = 2/115 (2%)
 Frame = +2

Query  266  IMTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILE  445
            +M + MDN    SSRER QRL++KN+ELENKRR++AQ R+PSDPN+WQQMRENYEAIILE
Sbjct  1    MMIVQMDNMSAPSSRERAQRLYDKNLELENKRRRSAQVRVPSDPNAWQQMRENYEAIILE  60

Query  446  NHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            ++AFSEQ  IEYALWQLHY+RIEE RA+ N  LS+S S  SQ GKGP R  PDRI
Sbjct  61   DYAFSEQKNIEYALWQLHYKRIEEFRAYFNATLSSSSSNPSQGGKGPVR--PDRI  113



>ref|XP_006470548.1| PREDICTED: protein SMG7-like isoform X1 [Citrus sinensis]
 ref|XP_006470549.1| PREDICTED: protein SMG7-like isoform X2 [Citrus sinensis]
Length=984

 Score =   164 bits (415),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 96/121 (79%), Gaps = 8/121 (7%)
 Frame = +2

Query  266  IMTIPMDN------SVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENY  427
            +M + MDN      +   S+RER QRL+ KN+ELENKRR++ QARIPSDPN+WQQMRENY
Sbjct  1    MMIVQMDNMSATAPAPSPSARERAQRLYEKNIELENKRRRSVQARIPSDPNAWQQMRENY  60

Query  428  EAIILENHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDR  607
            EAIILE+HAFSEQH +EYALWQLHYRRIEELRAH + A+S++GS TSQ  K P R   DR
Sbjct  61   EAIILEDHAFSEQHNVEYALWQLHYRRIEELRAHYSAAVSSAGSNTSQATKVPLRS--DR  118

Query  608  I  610
            +
Sbjct  119  V  119



>gb|ACJ86223.1| unknown [Medicago truncatula]
Length=129

 Score =   151 bits (381),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 91/115 (79%), Gaps = 2/115 (2%)
 Frame = +2

Query  266  IMTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILE  445
            +M + MD     SSRER QRL +  +ELE KRRK+AQ ++PSDPN W Q+RENYEAIILE
Sbjct  1    MMIVEMDKMSAPSSRERAQRLLDNVIELEKKRRKSAQTQVPSDPNIWPQLRENYEAIILE  60

Query  446  NHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            ++AFSE+H IE+ALWQLHY+RIEELRA+ + AL+++ S +S+ GKG +R  PDRI
Sbjct  61   DYAFSEKHGIEFALWQLHYKRIEELRAYFSAALTSASSKSSEGGKGSAR--PDRI  113



>gb|KHG03132.1| Protein SMG7 [Gossypium arboreum]
Length=983

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 92/116 (79%), Gaps = 2/116 (2%)
 Frame = +2

Query  263  WIMTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIIL  442
            W+M + MD     SSRER QRL+ KN+ELEN RR++AQAR+ SDPN+WQQMRENYEAIIL
Sbjct  14   WMMIVQMDKMSSPSSRERAQRLYEKNIELENNRRRSAQARVSSDPNAWQQMRENYEAIIL  73

Query  443  ENHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            E+HAFSEQH IEYALWQLHY+RIEELRAH +  L+++GS T Q  K   R  PDR+
Sbjct  74   EDHAFSEQHSIEYALWQLHYKRIEELRAHYSAVLASAGSNTPQGVKVSQR--PDRL  127



>ref|XP_009348342.1| PREDICTED: protein SMG7-like [Pyrus x bretschneideri]
 ref|XP_009348343.1| PREDICTED: protein SMG7-like [Pyrus x bretschneideri]
 ref|XP_009348344.1| PREDICTED: protein SMG7-like [Pyrus x bretschneideri]
Length=1003

 Score =   163 bits (413),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 93/115 (81%), Gaps = 3/115 (3%)
 Frame = +2

Query  269  MTIP-MDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILE  445
            M IP MD     SSRER QRL++K +ELEN+RR++ QARIPSDPN+WQQMRENYEAIILE
Sbjct  1    MMIPQMDKMSAPSSRERAQRLYDKILELENRRRRSTQARIPSDPNAWQQMRENYEAIILE  60

Query  446  NHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            +HAFSEQH IEYALWQLHY+RIEELRAH   A +++ S TSQ  KGP R  PDR+
Sbjct  61   DHAFSEQHNIEYALWQLHYKRIEELRAHFGAATASARSNTSQGVKGPIR--PDRV  113



>gb|KHG16223.1| Protein SMG7 [Gossypium arboreum]
Length=1022

 Score =   163 bits (413),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 93/115 (81%), Gaps = 2/115 (2%)
 Frame = +2

Query  266  IMTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILE  445
            +M + +D     SS ER QRL+ KN+ELE  RR++AQAR+PSDPN+WQQMRENYEAIILE
Sbjct  1    MMIVQIDKMSAPSSTERAQRLYEKNIELEKNRRRSAQARVPSDPNAWQQMRENYEAIILE  60

Query  446  NHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            +HAFSEQH IEYALWQLHY+RIEELRAH + A+S++GS TSQ  K P R  PDR+
Sbjct  61   DHAFSEQHNIEYALWQLHYKRIEELRAHYSAAVSSAGSNTSQGVKVPPR--PDRL  113



>gb|KHN46643.1| Telomerase-binding protein EST1A [Glycine soja]
Length=960

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 93/103 (90%), Gaps = 2/103 (2%)
 Frame = +2

Query  302  SSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILENHAFSEQHEIEY  481
            SSRER QRL++KN+ELE+KRR++A+AR+PSDPN+WQQ+RENYEAIILE+HAFSEQH IEY
Sbjct  5    SSRERAQRLYDKNLELESKRRRSAKARVPSDPNAWQQIRENYEAIILEDHAFSEQHNIEY  64

Query  482  ALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            ALWQLHY+RIEE RA+ + ALS++ + +SQ GKGP+R  PDRI
Sbjct  65   ALWQLHYKRIEEFRAYFSAALSSTNANSSQGGKGPAR--PDRI  105



>ref|XP_010906901.1| PREDICTED: protein SMG7-like [Elaeis guineensis]
 ref|XP_010906902.1| PREDICTED: protein SMG7-like [Elaeis guineensis]
Length=983

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 95/115 (83%), Gaps = 3/115 (3%)
 Frame = +2

Query  266  IMTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILE  445
            +MT+PM++S   SSRERVQ L+NKN+ELEN  RK+A++++PSDPN+W QMRENYEAIILE
Sbjct  1    MMTVPMNSSSAPSSRERVQSLYNKNIELENGLRKSAKSKVPSDPNAWLQMRENYEAIILE  60

Query  446  NHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            +H FSE+HEIEYALWQLHYRRIEE RAH+N A S+ G TT Q  K P +  PDRI
Sbjct  61   DHEFSEKHEIEYALWQLHYRRIEEFRAHINAAASSGGVTTLQV-KSPVQ--PDRI  112



>ref|XP_010673012.1| PREDICTED: protein SMG7-like [Beta vulgaris subsp. vulgaris]
Length=983

 Score =   162 bits (411),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 94/115 (82%), Gaps = 3/115 (3%)
 Frame = +2

Query  269  MTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILEN  448
            M + MD   + SS+ER QRL+NKNVELEN RRK+A ARIPSDPN WQQ+RENYEAIILE+
Sbjct  1    MAVQMDKPSEISSKERAQRLYNKNVELENTRRKSAHARIPSDPNVWQQIRENYEAIILED  60

Query  449  HAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGK-GPSRGGPDRI  610
            H+FSEQHEIE ALWQLHYRRIEELRA  N ALS++ S+ +QN   GP+R  PDR+
Sbjct  61   HSFSEQHEIELALWQLHYRRIEELRALFNAALSSNVSSATQNANGGPAR--PDRL  113



>ref|XP_006369654.1| hypothetical protein POPTR_0001s28220g [Populus trichocarpa]
 ref|XP_006369655.1| hypothetical protein POPTR_0001s28220g [Populus trichocarpa]
 ref|XP_006369656.1| hypothetical protein POPTR_0001s28220g [Populus trichocarpa]
 ref|XP_002298469.2| hypothetical protein POPTR_0001s28220g [Populus trichocarpa]
 gb|ERP66223.1| hypothetical protein POPTR_0001s28220g [Populus trichocarpa]
 gb|ERP66224.1| hypothetical protein POPTR_0001s28220g [Populus trichocarpa]
 gb|ERP66225.1| hypothetical protein POPTR_0001s28220g [Populus trichocarpa]
 gb|EEE83274.2| hypothetical protein POPTR_0001s28220g [Populus trichocarpa]
Length=972

 Score =   162 bits (411),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 91/114 (80%), Gaps = 2/114 (2%)
 Frame = +2

Query  269  MTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILEN  448
            M + MD     SSRER QRL+ KN+ELENKRR++AQAR+PSDPNSWQQMRENYEAIILE+
Sbjct  1    MIVQMDKMSAPSSRERAQRLYEKNLELENKRRRSAQARVPSDPNSWQQMRENYEAIILED  60

Query  449  HAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            H FSEQH IEY+LWQLHYRRIEELR+H +  L+++GS      K P+R  PDRI
Sbjct  61   HGFSEQHNIEYSLWQLHYRRIEELRSHYSAVLASTGSNAPPGPKVPAR--PDRI  112



>gb|KHN38386.1| Telomerase-binding protein EST1A [Glycine soja]
Length=957

 Score =   162 bits (410),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/103 (74%), Positives = 90/103 (87%), Gaps = 2/103 (2%)
 Frame = +2

Query  302  SSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILENHAFSEQHEIEY  481
            SSRER QRL+ KN+ELENKRR++AQA++PSDPN+WQQ+RENYEAIILE+HAFSEQH IEY
Sbjct  6    SSRERAQRLYEKNLELENKRRRSAQAQVPSDPNAWQQIRENYEAIILEDHAFSEQHNIEY  65

Query  482  ALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            ALWQLHY+RIEELRA+ N A ++  S +SQ GKGP R  PDRI
Sbjct  66   ALWQLHYKRIEELRAYFNAAHASVSSKSSQGGKGPVR--PDRI  106



>ref|XP_006470550.1| PREDICTED: protein SMG7-like isoform X3 [Citrus sinensis]
Length=979

 Score =   161 bits (408),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 76/103 (74%), Positives = 89/103 (86%), Gaps = 2/103 (2%)
 Frame = +2

Query  302  SSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILENHAFSEQHEIEY  481
            S+RER QRL+ KN+ELENKRR++ QARIPSDPN+WQQMRENYEAIILE+HAFSEQH +EY
Sbjct  14   SARERAQRLYEKNIELENKRRRSVQARIPSDPNAWQQMRENYEAIILEDHAFSEQHNVEY  73

Query  482  ALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            ALWQLHYRRIEELRAH + A+S++GS TSQ  K P R   DR+
Sbjct  74   ALWQLHYRRIEELRAHYSAAVSSAGSNTSQATKVPLRS--DRV  114



>ref|XP_003529483.1| PREDICTED: protein SMG7-like [Glycine max]
 gb|KHN28156.1| Telomerase-binding protein EST1A [Glycine soja]
Length=974

 Score =   161 bits (408),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 94/115 (82%), Gaps = 2/115 (2%)
 Frame = +2

Query  266  IMTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILE  445
            +M + MD     SSRER QRL+ KN+ELE+KRR++AQ R+PSDPN+WQQMRENYEAIILE
Sbjct  1    MMIVEMDKMSAPSSRERAQRLYEKNLELESKRRRSAQVRVPSDPNAWQQMRENYEAIILE  60

Query  446  NHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            + AFSEQH IEYALWQLHY++IEE RA+ + ALS++ + +SQ  KGP+R  PDRI
Sbjct  61   DQAFSEQHNIEYALWQLHYKQIEEFRAYFSAALSSTNANSSQGVKGPAR--PDRI  113



>gb|KEH16467.1| telomerase activating protein Est1 [Medicago truncatula]
Length=1040

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 93/115 (81%), Gaps = 2/115 (2%)
 Frame = +2

Query  266  IMTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILE  445
            +M + MDN    SSRER + L+ KN+ELE+KRR++AQ R+PSDPN+WQQMRENYEAIILE
Sbjct  1    MMIVKMDNMSAPSSRERAKHLYEKNLELESKRRRSAQVRVPSDPNAWQQMRENYEAIILE  60

Query  446  NHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            +HAFSEQH IE+ALWQLHY+RIEE RA+ N ALS++ S  SQ GK  +R  PDRI
Sbjct  61   DHAFSEQHNIEFALWQLHYKRIEEFRAYFNAALSSAKSNPSQGGKVHAR--PDRI  113



>gb|KJB35694.1| hypothetical protein B456_006G124400 [Gossypium raimondii]
 gb|KJB35695.1| hypothetical protein B456_006G124400 [Gossypium raimondii]
 gb|KJB35697.1| hypothetical protein B456_006G124400 [Gossypium raimondii]
 gb|KJB35698.1| hypothetical protein B456_006G124400 [Gossypium raimondii]
Length=984

 Score =   160 bits (405),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 93/116 (80%), Gaps = 3/116 (3%)
 Frame = +2

Query  266  IMTIPMDN-SVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIIL  442
            +M + MD  S   SSRER Q L+ KN+ELEN RRK+AQAR+PSDPN+WQQMRENYEAIIL
Sbjct  1    MMIVQMDKMSTAPSSRERAQCLYKKNIELENNRRKSAQARVPSDPNTWQQMRENYEAIIL  60

Query  443  ENHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            E+HAFSEQH IEYALWQLHY+RIEELRAH + AL+++ S TSQ  K P R   DR+
Sbjct  61   EDHAFSEQHNIEYALWQLHYKRIEELRAHYSAALTSARSNTSQGVKVPPRS--DRL  114



>gb|KJB35696.1| hypothetical protein B456_006G124400 [Gossypium raimondii]
Length=977

 Score =   160 bits (405),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 93/116 (80%), Gaps = 3/116 (3%)
 Frame = +2

Query  266  IMTIPMDN-SVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIIL  442
            +M + MD  S   SSRER Q L+ KN+ELEN RRK+AQAR+PSDPN+WQQMRENYEAIIL
Sbjct  1    MMIVQMDKMSTAPSSRERAQCLYKKNIELENNRRKSAQARVPSDPNTWQQMRENYEAIIL  60

Query  443  ENHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            E+HAFSEQH IEYALWQLHY+RIEELRAH + AL+++ S TSQ  K P R   DR+
Sbjct  61   EDHAFSEQHNIEYALWQLHYKRIEELRAHYSAALTSARSNTSQGVKVPPRS--DRL  114



>ref|XP_010519796.1| PREDICTED: protein SMG7-like [Tarenaya hassleriana]
 ref|XP_010519797.1| PREDICTED: protein SMG7-like [Tarenaya hassleriana]
 ref|XP_010519798.1| PREDICTED: protein SMG7-like [Tarenaya hassleriana]
Length=995

 Score =   159 bits (403),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 91/115 (79%), Gaps = 3/115 (3%)
 Frame = +2

Query  266  IMTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILE  445
            +M   MD + D SSRER Q + +K V+LE+KRRKAAQAR+PSDPN+WQQ+RENYEAIILE
Sbjct  1    MMIGQMDKTSDLSSRERAQSILDKTVKLESKRRKAAQARLPSDPNAWQQIRENYEAIILE  60

Query  446  NHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            +H FSEQH IEY LWQLHY+RIEE RAH N  LS+  S T+QN KGP R  PDR+
Sbjct  61   DHTFSEQHSIEYNLWQLHYKRIEEFRAHFNV-LSSGSSNTAQNVKGPIR--PDRV  112



>ref|XP_011024974.1| PREDICTED: protein SMG7 [Populus euphratica]
 ref|XP_011024975.1| PREDICTED: protein SMG7 [Populus euphratica]
 ref|XP_011024976.1| PREDICTED: protein SMG7 [Populus euphratica]
Length=971

 Score =   159 bits (402),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 90/114 (79%), Gaps = 2/114 (2%)
 Frame = +2

Query  269  MTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILEN  448
            M + MD     S RER QRL+ KN+ELENKRR++AQAR+PSDPNSWQQMRENYEAIILE+
Sbjct  1    MIVQMDKMSAPSPRERAQRLYEKNLELENKRRRSAQARVPSDPNSWQQMRENYEAIILED  60

Query  449  HAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            H FSEQH IEY+LWQLHYRRIEELRA+ +  L+++GS      K P+R  PDRI
Sbjct  61   HGFSEQHNIEYSLWQLHYRRIEELRANYSAVLASTGSNAPPGPKVPAR--PDRI  112



>gb|KJB83569.1| hypothetical protein B456_013G253600 [Gossypium raimondii]
 gb|KJB83571.1| hypothetical protein B456_013G253600 [Gossypium raimondii]
 gb|KJB83572.1| hypothetical protein B456_013G253600 [Gossypium raimondii]
 gb|KJB83573.1| hypothetical protein B456_013G253600 [Gossypium raimondii]
 gb|KJB83574.1| hypothetical protein B456_013G253600 [Gossypium raimondii]
 gb|KJB83575.1| hypothetical protein B456_013G253600 [Gossypium raimondii]
Length=984

 Score =   159 bits (401),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 91/115 (79%), Gaps = 6/115 (5%)
 Frame = +2

Query  266  IMTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILE  445
            +M + +D     SSRER QRL+ KN+ELE  RR++AQAR+PSDPN+WQQMRENYEAIILE
Sbjct  1    MMIVQIDKMSAPSSRERAQRLYEKNIELEKNRRRSAQARVPSDPNAWQQMRENYEAIILE  60

Query  446  NHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            +HAFSEQH IEYALWQLHY+RIEELRAH     SA+GS TSQ  K P R  PDR+
Sbjct  61   DHAFSEQHNIEYALWQLHYKRIEELRAH----YSAAGSNTSQGVKVPPR--PDRL  109



>ref|XP_002276189.1| PREDICTED: protein SMG7 [Vitis vinifera]
 ref|XP_010651517.1| PREDICTED: protein SMG7 [Vitis vinifera]
 ref|XP_010651518.1| PREDICTED: protein SMG7 [Vitis vinifera]
Length=992

 Score =   159 bits (401),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 96/114 (84%), Gaps = 2/114 (2%)
 Frame = +2

Query  269  MTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILEN  448
            M + MD     SSRE  QRL++KN+ELEN+RRK+AQARIPSDPN+WQ MRENYEAIILE+
Sbjct  1    MIVQMDKMSAPSSRELAQRLYDKNIELENRRRKSAQARIPSDPNAWQLMRENYEAIILED  60

Query  449  HAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            HAFSEQH IEYALWQLHYRRIEELRAH + AL++SGS TSQ+ KGP R  PDR+
Sbjct  61   HAFSEQHNIEYALWQLHYRRIEELRAHFSAALASSGSATSQSAKGPLR--PDRV  112



>ref|XP_008788823.1| PREDICTED: protein SMG7-like isoform X1 [Phoenix dactylifera]
 ref|XP_008788824.1| PREDICTED: protein SMG7-like isoform X1 [Phoenix dactylifera]
Length=995

 Score =   158 bits (400),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 90/115 (78%), Gaps = 6/115 (5%)
 Frame = +2

Query  266  IMTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILE  445
            +MT+PMDNS   SSRE  QRL+ KN+ELEN  RK+AQ+++PSDPN W QMRENYEAIILE
Sbjct  1    MMTVPMDNSFSPSSRELAQRLYKKNIELENGLRKSAQSKVPSDPNIWLQMRENYEAIILE  60

Query  446  NHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            +H FSE+HE+EYALWQLHYRRIEE R H+N A+SA     S  GK  +R  PDRI
Sbjct  61   DHDFSEKHEVEYALWQLHYRRIEEFRTHINAAVSAG----SNAGKSLAR--PDRI  109



>gb|KJB09301.1| hypothetical protein B456_001G133700 [Gossypium raimondii]
 gb|KJB09302.1| hypothetical protein B456_001G133700 [Gossypium raimondii]
 gb|KJB09303.1| hypothetical protein B456_001G133700 [Gossypium raimondii]
Length=971

 Score =   158 bits (399),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 90/115 (78%), Gaps = 2/115 (2%)
 Frame = +2

Query  266  IMTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILE  445
            +M + MD     SSRER QRL+ KN+ELEN RR++AQAR+ SDPN+WQQMRENYEAIILE
Sbjct  1    MMIVQMDKMSSPSSRERTQRLYEKNIELENNRRRSAQARVSSDPNAWQQMRENYEAIILE  60

Query  446  NHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            +HAFSEQH IEYALWQLHY+RIEELRAH +  L+++GS   Q  K   R  PDR+
Sbjct  61   DHAFSEQHSIEYALWQLHYKRIEELRAHYSAVLASAGSNAPQGVKVSQR--PDRL  113



>gb|KJB55410.1| hypothetical protein B456_009G074900 [Gossypium raimondii]
Length=983

 Score =   157 bits (397),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 92/114 (81%), Gaps = 2/114 (2%)
 Frame = +2

Query  269  MTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILEN  448
            M I   + +   SRE  QRL+ KNVELEN RR++AQAR+PSDP++WQQMRENYEAIILE+
Sbjct  1    MMIVQIDKMSAPSREHAQRLYEKNVELENNRRRSAQARVPSDPSAWQQMRENYEAIILED  60

Query  449  HAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            HAFSEQH IEYALWQLHY+RIEELR+H + AL++SGS TSQ  + P R  PDR+
Sbjct  61   HAFSEQHNIEYALWQLHYKRIEELRSHHSAALASSGSNTSQGVQVPPR--PDRL  112



>ref|XP_010106599.1| hypothetical protein L484_002554 [Morus notabilis]
 gb|EXC10890.1| hypothetical protein L484_002554 [Morus notabilis]
Length=1032

 Score =   156 bits (395),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 90/103 (87%), Gaps = 3/103 (3%)
 Frame = +2

Query  302  SSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILENHAFSEQHEIEY  481
            SSRER Q+L++K  ELEN+RR++AQAR+PSDPN+WQQ+RENYEAIILE+HAFSEQH IEY
Sbjct  5    SSRERAQQLYDKINELENRRRRSAQARVPSDPNAWQQIRENYEAIILEDHAFSEQHNIEY  64

Query  482  ALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            ALWQLHYRRIEELRAH N A S SGS  SQ+ KGP+R  PDR+
Sbjct  65   ALWQLHYRRIEELRAHFNAARS-SGSNPSQSVKGPTR--PDRL  104



>emb|CBI24245.3| unnamed protein product [Vitis vinifera]
Length=889

 Score =   155 bits (393),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 94/110 (85%), Gaps = 2/110 (2%)
 Frame = +2

Query  281  MDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILENHAFS  460
            MD     SSRE  QRL++KN+ELEN+RRK+AQARIPSDPN+WQ MRENYEAIILE+HAFS
Sbjct  1    MDKMSAPSSRELAQRLYDKNIELENRRRKSAQARIPSDPNAWQLMRENYEAIILEDHAFS  60

Query  461  EQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            EQH IEYALWQLHYRRIEELRAH + AL++SGS TSQ+ KGP R  PDR+
Sbjct  61   EQHNIEYALWQLHYRRIEELRAHFSAALASSGSATSQSAKGPLR--PDRV  108



>ref|XP_007146121.1| hypothetical protein PHAVU_006G014200g [Phaseolus vulgaris]
 gb|ESW18115.1| hypothetical protein PHAVU_006G014200g [Phaseolus vulgaris]
Length=975

 Score =   156 bits (394),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 93/116 (80%), Gaps = 3/116 (3%)
 Frame = +2

Query  266  IMTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILE  445
            +M I MD     SSRER QRL+ KN+ELENKRR++AQAR+PSDPN+WQQMRENYEAIILE
Sbjct  1    MMLIEMDKMSAPSSRERAQRLYEKNLELENKRRRSAQARVPSDPNAWQQMRENYEAIILE  60

Query  446  NHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTT-SQNGKGPSRGGPDRI  610
            +HAFSEQH IEYALWQLHY+RIEE RA+ + A  +S S   SQ  KGP+R  PDRI
Sbjct  61   DHAFSEQHNIEYALWQLHYKRIEEFRAYFSAASLSSTSANPSQGVKGPAR--PDRI  114



>ref|XP_007141499.1| hypothetical protein PHAVU_008G201200g [Phaseolus vulgaris]
 gb|ESW13493.1| hypothetical protein PHAVU_008G201200g [Phaseolus vulgaris]
Length=943

 Score =   155 bits (393),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 90/110 (82%), Gaps = 2/110 (2%)
 Frame = +2

Query  281  MDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILENHAFS  460
            MD +   SS ER  RL+ KN+ELENK+R++AQA++PSDPN+WQQ+RENYEAIILE+HAFS
Sbjct  1    MDKAFAPSSWERAHRLYEKNLELENKQRRSAQAQVPSDPNAWQQIRENYEAIILEDHAFS  60

Query  461  EQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            E+H IEYALWQLHY+RIEELRA+ N A ++  S +S  GKGP R  PDRI
Sbjct  61   EKHNIEYALWQLHYKRIEELRAYFNAAHTSVSSKSSMGGKGPVR--PDRI  108



>gb|KJB83570.1| hypothetical protein B456_013G253600 [Gossypium raimondii]
Length=976

 Score =   155 bits (392),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/103 (74%), Positives = 86/103 (83%), Gaps = 6/103 (6%)
 Frame = +2

Query  302  SSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILENHAFSEQHEIEY  481
            SSRER QRL+ KN+ELE  RR++AQAR+PSDPN+WQQMRENYEAIILE+HAFSEQH IEY
Sbjct  5    SSRERAQRLYEKNIELEKNRRRSAQARVPSDPNAWQQMRENYEAIILEDHAFSEQHNIEY  64

Query  482  ALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            ALWQLHY+RIEELRAH     SA+GS TSQ  K P R  PDR+
Sbjct  65   ALWQLHYKRIEELRAH----YSAAGSNTSQGVKVPPR--PDRL  101



>ref|XP_006400499.1| hypothetical protein EUTSA_v10012551mg [Eutrema salsugineum]
 ref|XP_006400500.1| hypothetical protein EUTSA_v10012551mg [Eutrema salsugineum]
 gb|ESQ41952.1| hypothetical protein EUTSA_v10012551mg [Eutrema salsugineum]
 gb|ESQ41953.1| hypothetical protein EUTSA_v10012551mg [Eutrema salsugineum]
Length=1022

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 91/117 (78%), Gaps = 2/117 (2%)
 Frame = +2

Query  266  IMTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILE  445
            +M   MD +   S RER Q +F+K VELE KRRKAAQAR PSDPN WQQ+RENYEAIILE
Sbjct  1    MMASQMDKNTASSPRERAQSIFDKTVELEIKRRKAAQARNPSDPNLWQQIRENYEAIILE  60

Query  446  NHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSR--GGPDRI  610
            +HAFSE+H IE  LWQLHY+RIE+ R+H+N  L+++ S+ +QN KGPSR   GP+R+
Sbjct  61   DHAFSEKHGIEVTLWQLHYKRIEDFRSHINAVLASNSSSVAQNAKGPSRPEKGPERV  117



>gb|KHG13644.1| Telomerase-binding EST1A [Gossypium arboreum]
Length=1084

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 89/108 (82%), Gaps = 1/108 (1%)
 Frame = +2

Query  266  IMTIPMDN-SVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIIL  442
            +M + MD  S   SSRE  Q L+ KN+ELEN RRK+AQAR+PSDPN+WQQMRENYEAIIL
Sbjct  1    MMIVQMDKMSTAPSSREGAQCLYKKNIELENNRRKSAQARVPSDPNTWQQMRENYEAIIL  60

Query  443  ENHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGP  586
            E+HAFSEQ+ IEYALWQLHY+RIEELRAH + AL+++ STTSQ  K P
Sbjct  61   EDHAFSEQNNIEYALWQLHYKRIEELRAHYSAALTSARSTTSQGVKVP  108



>ref|XP_010049945.1| PREDICTED: protein SMG7-like isoform X1 [Eucalyptus grandis]
 gb|KCW82776.1| hypothetical protein EUGRSUZ_C04150 [Eucalyptus grandis]
Length=1004

 Score =   153 bits (386),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 90/114 (79%), Gaps = 2/114 (2%)
 Frame = +2

Query  269  MTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILEN  448
            M I  DN +   S ER QRL+ KN+EL+N+RRK+AQARIPSDPN WQQMRENYEAIILE+
Sbjct  1    MIIKTDN-MPAPSWERAQRLYEKNIELDNRRRKSAQARIPSDPNVWQQMRENYEAIILED  59

Query  449  HAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            H FSE+H IE+ALWQLHY++IEELRAH + A +++    S NGKGPS   PDRI
Sbjct  60   HTFSEKHNIEHALWQLHYKKIEELRAHFSAAQASANPNASVNGKGPS-SRPDRI  112



>ref|XP_010049946.1| PREDICTED: protein SMG7-like isoform X2 [Eucalyptus grandis]
Length=966

 Score =   152 bits (385),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 90/114 (79%), Gaps = 2/114 (2%)
 Frame = +2

Query  269  MTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILEN  448
            M I  DN +   S ER QRL+ KN+EL+N+RRK+AQARIPSDPN WQQMRENYEAIILE+
Sbjct  1    MIIKTDN-MPAPSWERAQRLYEKNIELDNRRRKSAQARIPSDPNVWQQMRENYEAIILED  59

Query  449  HAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            H FSE+H IE+ALWQLHY++IEELRAH + A +++    S NGKGPS   PDRI
Sbjct  60   HTFSEKHNIEHALWQLHYKKIEELRAHFSAAQASANPNASVNGKGPS-SRPDRI  112



>ref|XP_009126857.1| PREDICTED: protein SMG7-like [Brassica rapa]
Length=113

 Score =   140 bits (352),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 80/104 (77%), Gaps = 1/104 (1%)
 Frame = +2

Query  281  MDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIP-SDPNSWQQMRENYEAIILENHAF  457
            MD     S  ER Q +F+K +ELE KRRKAAQ+R P SDPN WQQ+RENYEAI+LE+HAF
Sbjct  1    MDKKTASSPWERAQSIFDKTIELEAKRRKAAQSRTPTSDPNLWQQIRENYEAIVLEDHAF  60

Query  458  SEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPS  589
            SEQH IE+ LWQLHY+RIEE R+++N  L++  S  +QN KGPS
Sbjct  61   SEQHTIEFTLWQLHYKRIEEYRSNINAVLASGSSGAAQNAKGPS  104



>gb|KEH28378.1| telomerase activating protein Est1 [Medicago truncatula]
Length=974

 Score =   151 bits (381),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 91/115 (79%), Gaps = 2/115 (2%)
 Frame = +2

Query  266  IMTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILE  445
            +M + MD     SSRER QRL +  +ELE KRRK+AQ ++PSDPN W Q+RENYEAIILE
Sbjct  1    MMIVEMDKMSAPSSRERAQRLLDNVIELEKKRRKSAQTQVPSDPNIWPQLRENYEAIILE  60

Query  446  NHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            ++AFSE+H IE+ALWQLHY+RIEELRA+ + AL+++ S +S+ GKG +R  PDRI
Sbjct  61   DYAFSEKHGIEFALWQLHYKRIEELRAYFSAALTSASSKSSEGGKGSAR--PDRI  113



>gb|KHG27817.1| Protein SMG7 [Gossypium arboreum]
Length=1048

 Score =   151 bits (381),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 90/114 (79%), Gaps = 2/114 (2%)
 Frame = +2

Query  269  MTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILEN  448
            M I   + +   SRE  QRL+ +NVELE  RR++AQAR+PSDP++WQQMRENYEAIILE+
Sbjct  1    MMIVQIDKMSAPSREHAQRLYERNVELEANRRRSAQARVPSDPSAWQQMRENYEAIILED  60

Query  449  HAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
             AFSEQH IEYALWQLHY+RIEELRAH + AL++SGS TSQ  + P R  PDR+
Sbjct  61   RAFSEQHNIEYALWQLHYKRIEELRAHHSAALASSGSNTSQGVQVPPR--PDRL  112



>emb|CDX92534.1| BnaA10g15730D [Brassica napus]
Length=1046

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 90/115 (78%), Gaps = 3/115 (3%)
 Frame = +2

Query  266  IMTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILE  445
            +MT+ MD +   S RER + +F+K VELE KRRKAAQAR PSDPN WQQ+RENYEAI+LE
Sbjct  1    MMTLQMDKNTASSPRERAKSIFDKTVELEIKRRKAAQARNPSDPNLWQQIRENYEAIVLE  60

Query  446  NHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            +H FSE+H IE+ LWQLHY+RIE+ R+H+N AL AS ++ +QN KGPS    DR+
Sbjct  61   DHTFSEEHNIEFTLWQLHYKRIEDFRSHIN-ALLASSNSNAQNSKGPSMA--DRV  112



>ref|XP_009120890.1| PREDICTED: protein SMG7 [Brassica rapa]
Length=1032

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 90/115 (78%), Gaps = 3/115 (3%)
 Frame = +2

Query  266  IMTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILE  445
            +MT+ MD +   S RER + +F+K VELE KRRKAAQAR PSDPN WQQ+RENYEAI+LE
Sbjct  1    MMTLQMDKNTASSPRERAKSIFDKTVELEIKRRKAAQARNPSDPNLWQQIRENYEAIVLE  60

Query  446  NHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            +H FSE+H IE+ LWQLHY+RIE+ R+H+N AL AS ++ +QN KGPS    DR+
Sbjct  61   DHTFSEEHNIEFTLWQLHYKRIEDFRSHIN-ALLASSNSNAQNSKGPSMA--DRV  112



>emb|CDY13995.1| BnaC09g38310D [Brassica napus]
Length=1088

 Score =   148 bits (373),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 89/115 (77%), Gaps = 3/115 (3%)
 Frame = +2

Query  266  IMTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILE  445
            +MT+ MD +   S RER + +F+K VELE KRRKAAQAR PSDPN WQQ+RENYEAI+LE
Sbjct  1    MMTLQMDKNTASSPRERAKSIFDKTVELEIKRRKAAQARNPSDPNLWQQIRENYEAIVLE  60

Query  446  NHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            +H FSE+H IE+ LWQLHY+RIE+ R+H+N  L AS ++ +QN KGPS    DR+
Sbjct  61   DHTFSEEHNIEFTLWQLHYKRIEDFRSHINAVL-ASSNSNAQNSKGPSMA--DRV  112



>ref|XP_008227279.1| PREDICTED: protein SMG7 [Prunus mume]
 ref|XP_008227280.1| PREDICTED: protein SMG7 [Prunus mume]
Length=1012

 Score =   147 bits (372),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 94/114 (82%), Gaps = 2/114 (2%)
 Frame = +2

Query  269  MTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILEN  448
            M   MD     SSRER QRL++K VELEN+RR++AQARIPSDPN+WQQ+RENYEAIILE+
Sbjct  1    MITHMDKMSAPSSRERAQRLYDKVVELENRRRRSAQARIPSDPNAWQQIRENYEAIILED  60

Query  449  HAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            HAFSEQH IEYALWQLHY+RIEELRAH + A +++ S +SQ  KGP+R  PDRI
Sbjct  61   HAFSEQHNIEYALWQLHYKRIEELRAHFSAATASASSNSSQAVKGPAR--PDRI  112



>ref|XP_009396563.1| PREDICTED: protein SMG7-like [Musa acuminata subsp. malaccensis]
Length=979

 Score =   147 bits (372),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 88/115 (77%), Gaps = 3/115 (3%)
 Frame = +2

Query  266  IMTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILE  445
            +MT+PMD S   SSRE  QRL  KN+ELEN  R++A++++PSDPN+W QMRENYE +ILE
Sbjct  1    MMTVPMDRSSAPSSRELAQRLLEKNIELENGLRRSAKSKLPSDPNAWLQMRENYETMILE  60

Query  446  NHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            +H FSE+H+IE+ LWQLHYRRIEE R H+N A+SA GS  S  GK   R  PD+I
Sbjct  61   DHDFSEKHDIEFVLWQLHYRRIEEFRQHINAAVSA-GSNASSGGKVLVR--PDKI  112



>ref|XP_010927363.1| PREDICTED: protein SMG7-like [Elaeis guineensis]
Length=982

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 88/115 (77%), Gaps = 2/115 (2%)
 Frame = +2

Query  266  IMTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILE  445
            +MTIP++NS   S RERVQ L+NKN+ELEN+ RK+A+ + PSD N+W QMREN EAIIL+
Sbjct  1    MMTIPINNSSAPSLRERVQSLYNKNIELENRLRKSAKLKAPSDLNAWLQMRENCEAIILQ  60

Query  446  NHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            +H FSE+HEIE+ LWQLH+RRIEE RAH+N A    G +T Q GK P    PDRI
Sbjct  61   DHEFSEKHEIEHVLWQLHHRRIEEFRAHINNAALRGGVSTLQGGKSPPH--PDRI  113



>ref|XP_004491240.1| PREDICTED: uncharacterized protein LOC101504757 isoform X1 [Cicer 
arietinum]
 ref|XP_004491241.1| PREDICTED: uncharacterized protein LOC101504757 isoform X2 [Cicer 
arietinum]
Length=986

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 89/114 (78%), Gaps = 2/114 (2%)
 Frame = +2

Query  269  MTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILEN  448
            M + MD     S+ ER +RL++KN+ELE +RR++AQ ++PSDPN W Q+RENYEAIILE+
Sbjct  1    MIVEMDKMSAPSTWERAKRLYDKNLELEKRRRRSAQTQVPSDPNIWPQLRENYEAIILED  60

Query  449  HAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            HAFSE+H IEYALW LHY+RIEELRAH + AL+++ S + Q GKG  R  P+RI
Sbjct  61   HAFSEKHGIEYALWLLHYKRIEELRAHYSAALTSASSKSYQGGKGSGR--PERI  112



>ref|XP_010928325.1| PREDICTED: protein SMG7-like isoform X2 [Elaeis guineensis]
Length=956

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +2

Query  266  IMTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILE  445
            +MT+PMDNS+  SSRE  +RL+ KN+ELEN  RK+AQ+++PSDPN W QMRENYEAIILE
Sbjct  1    MMTVPMDNSLSPSSRELAKRLYKKNIELENGLRKSAQSKVPSDPNIWLQMRENYEAIILE  60

Query  446  NHAFSEQHEIEYALWQLHYRRIEELRAHL  532
            +H FSE+HE+EYALWQLHYRRIEE R H+
Sbjct  61   DHDFSEKHEVEYALWQLHYRRIEEFRTHI  89



>ref|XP_010928322.1| PREDICTED: protein SMG7-like isoform X1 [Elaeis guineensis]
 ref|XP_010928323.1| PREDICTED: protein SMG7-like isoform X1 [Elaeis guineensis]
 ref|XP_010928324.1| PREDICTED: protein SMG7-like isoform X1 [Elaeis guineensis]
Length=993

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +2

Query  266  IMTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILE  445
            +MT+PMDNS+  SSRE  +RL+ KN+ELEN  RK+AQ+++PSDPN W QMRENYEAIILE
Sbjct  1    MMTVPMDNSLSPSSRELAKRLYKKNIELENGLRKSAQSKVPSDPNIWLQMRENYEAIILE  60

Query  446  NHAFSEQHEIEYALWQLHYRRIEELRAHL  532
            +H FSE+HE+EYALWQLHYRRIEE R H+
Sbjct  61   DHDFSEKHEVEYALWQLHYRRIEEFRTHI  89



>ref|XP_003617251.1| Telomerase-binding protein EST1A [Medicago truncatula]
 gb|AET00210.1| telomerase activating protein Est1 [Medicago truncatula]
Length=966

 Score =   145 bits (366),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 86/103 (83%), Gaps = 2/103 (2%)
 Frame = +2

Query  302  SSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILENHAFSEQHEIEY  481
            SSRER QRL +  +ELE KRRK+AQ ++PSDPN W Q+RENYEAIILE++AFSE+H IE+
Sbjct  5    SSRERAQRLLDNVIELEKKRRKSAQTQVPSDPNIWPQLRENYEAIILEDYAFSEKHGIEF  64

Query  482  ALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            ALWQLHY+RIEELRA+ + AL+++ S +S+ GKG +R  PDRI
Sbjct  65   ALWQLHYKRIEELRAYFSAALTSASSKSSEGGKGSAR--PDRI  105



>ref|XP_008794962.1| PREDICTED: protein SMG7-like isoform X2 [Phoenix dactylifera]
Length=975

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 81/95 (85%), Gaps = 2/95 (2%)
 Frame = +2

Query  326  LFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILENHAFSEQHEIEYALWQLHYR  505
            L  +N+ELEN  RK+A++++PSDPN+W QMRENYEAIILE+H FSE+HEIEYALWQLHYR
Sbjct  4    LSCQNIELENGLRKSAKSKVPSDPNAWLQMRENYEAIILEDHEFSEKHEIEYALWQLHYR  63

Query  506  RIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            RIEE RAH+NTA S+ G+TT Q GK P++  PDRI
Sbjct  64   RIEEFRAHINTAASSGGATTLQVGKSPAQ--PDRI  96



>gb|KCW82774.1| hypothetical protein EUGRSUZ_C04149 [Eucalyptus grandis]
 gb|KCW82775.1| hypothetical protein EUGRSUZ_C04149 [Eucalyptus grandis]
Length=795

 Score =   141 bits (355),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 90/114 (79%), Gaps = 2/114 (2%)
 Frame = +2

Query  269  MTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILEN  448
            M + MDN +   S E  +RL+ KN+EL+N+RRK+AQARIPSDPN WQQMRENYE IILE+
Sbjct  1    MILEMDN-MPAPSWETARRLYEKNIELDNRRRKSAQARIPSDPNIWQQMRENYEKIILED  59

Query  449  HAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            H+FSE+H IE+ALWQLHY+RIEELRAH   A +++ S  S NGKGPS   PDRI
Sbjct  60   HSFSEKHNIEHALWQLHYKRIEELRAHYTAAQASANSNASSNGKGPS-SRPDRI  112



>ref|XP_004291734.1| PREDICTED: protein SMG7 [Fragaria vesca subsp. vesca]
Length=923

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 94/115 (82%), Gaps = 2/115 (2%)
 Frame = +2

Query  266  IMTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILE  445
            +M    D      S ER QRL++K  ELE++RR++AQAR+PSDPN+WQQ+RENYEAIILE
Sbjct  1    MMITQTDKMSAPPSWERAQRLYDKITELESRRRRSAQARVPSDPNAWQQIRENYEAIILE  60

Query  446  NHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            +HAFSEQH +EYALWQLHY+RI+ELRAH + A++++GS +SQ+ KGP+R  PDRI
Sbjct  61   DHAFSEQHNVEYALWQLHYKRIDELRAHFSAAMASTGSNSSQSLKGPTR--PDRI  113



>ref|XP_010049944.1| PREDICTED: LOW QUALITY PROTEIN: protein SMG7-like [Eucalyptus 
grandis]
Length=974

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 90/114 (79%), Gaps = 2/114 (2%)
 Frame = +2

Query  269  MTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILEN  448
            M + MDN +   S E  +RL+ KN+EL+N+RRK+AQARIPSDPN WQQMRENYE IILE+
Sbjct  1    MILEMDN-MPAPSWETARRLYEKNIELDNRRRKSAQARIPSDPNIWQQMRENYEKIILED  59

Query  449  HAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            H+FSE+H IE+ALWQLHY+RIEELRAH   A +++ S  S NGKGPS   PDRI
Sbjct  60   HSFSEKHNIEHALWQLHYKRIEELRAHYTAAQASANSNASSNGKGPS-SRPDRI  112



>ref|XP_004139063.1| PREDICTED: uncharacterized protein LOC101220502 [Cucumis sativus]
 gb|KGN66550.1| hypothetical protein Csa_1G629070 [Cucumis sativus]
Length=972

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 81/101 (80%), Gaps = 11/101 (11%)
 Frame = +2

Query  311  ERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILENHAFSEQHEIEYALW  490
            ER QRL+ KN+ELEN+RR++AQARIPSDPN+WQQ+RENYEAIILE++AFSEQH IEYALW
Sbjct  13   ERAQRLYEKNIELENRRRRSAQARIPSDPNAWQQIRENYEAIILEDYAFSEQHNIEYALW  72

Query  491  QLHYRRIEELRAHLNTALSASGSTTSQNGKG-PSRGGPDRI  610
            QLHY+RIEELR HL           S N +G P+R  PDRI
Sbjct  73   QLHYKRIEELRGHLTAG--------SNNAQGVPTR--PDRI  103



>ref|XP_009126360.1| PREDICTED: protein SMG7-like [Brassica rapa]
Length=1036

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 80/104 (77%), Gaps = 1/104 (1%)
 Frame = +2

Query  281  MDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIP-SDPNSWQQMRENYEAIILENHAF  457
            MD     S  ER Q +F+K +ELE KRRKAAQ+R P SDPN WQQ+RENYEAI+LE+HAF
Sbjct  1    MDKKTASSPWERAQSIFDKTIELEAKRRKAAQSRTPTSDPNLWQQIRENYEAIVLEDHAF  60

Query  458  SEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPS  589
            SEQH IE+ LWQLHY+RIEE R+++N  L++  S  +QN KGPS
Sbjct  61   SEQHTIEFTLWQLHYKRIEEYRSNINAVLASGSSGAAQNAKGPS  104



>ref|XP_008450340.1| PREDICTED: LOW QUALITY PROTEIN: protein SMG7 [Cucumis melo]
Length=972

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 81/101 (80%), Gaps = 11/101 (11%)
 Frame = +2

Query  311  ERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILENHAFSEQHEIEYALW  490
            ER QRL+ KN+ELEN+RR++AQARIPSDPN+WQQ+RENYEAIILE++AFSEQH IEYALW
Sbjct  13   ERAQRLYEKNIELENRRRRSAQARIPSDPNAWQQIRENYEAIILEDYAFSEQHNIEYALW  72

Query  491  QLHYRRIEELRAHLNTALSASGSTTSQNGKG-PSRGGPDRI  610
            QLHY+RIEELR HL           S N +G P+R  PDRI
Sbjct  73   QLHYKRIEELRGHLTAG--------SNNAQGVPTR--PDRI  103



>ref|XP_010492997.1| PREDICTED: protein SMG7 isoform X1 [Camelina sativa]
 ref|XP_010492998.1| PREDICTED: protein SMG7 isoform X1 [Camelina sativa]
 ref|XP_010492999.1| PREDICTED: protein SMG7 isoform X1 [Camelina sativa]
Length=1029

 Score =   136 bits (343),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 81/109 (74%), Gaps = 0/109 (0%)
 Frame = +2

Query  266  IMTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILE  445
            +MT+ MDN+   SSRER + LF+K +ELENKR KA Q R P D N W Q+RENYEAI+ E
Sbjct  1    MMTLQMDNTTASSSRERAKSLFDKTIELENKRWKAVQDRNPFDLNLWHQIRENYEAILFE  60

Query  446  NHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSR  592
            +HAFSEQH IE  LWQLHY+RIE  R H+N  LS+S S+ + N KGPSR
Sbjct  61   DHAFSEQHNIELILWQLHYKRIENCRGHINAFLSSSSSSAAHNVKGPSR  109



>ref|XP_010673759.1| PREDICTED: protein SMG7 [Beta vulgaris subsp. vulgaris]
 ref|XP_010673760.1| PREDICTED: protein SMG7 [Beta vulgaris subsp. vulgaris]
Length=933

 Score =   135 bits (341),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 89/114 (78%), Gaps = 5/114 (4%)
 Frame = +2

Query  269  MTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILEN  448
            M + M+ + +  S++R Q L+NKN+ELE KR+K+ QA+IPSDPN+W Q+RENYEAIILE+
Sbjct  1    MIVQMEKTPNSKSKDRAQLLYNKNIELEKKRQKSLQAKIPSDPNAWYQIRENYEAIILED  60

Query  449  HAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            +AFSEQ+ +E+ALWQ+HY+RIEE RAH +   +A  S+ + +G+ P +  PDRI
Sbjct  61   YAFSEQYNVEFALWQVHYKRIEEFRAHFS---AAQRSSATNSGRAPLQ--PDRI  109



>ref|XP_006856550.1| hypothetical protein AMTR_s00046p00170580 [Amborella trichopoda]
 gb|ERN18017.1| hypothetical protein AMTR_s00046p00170580 [Amborella trichopoda]
Length=1011

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 83/114 (73%), Gaps = 1/114 (1%)
 Frame = +2

Query  269  MTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILEN  448
            MTIPM+N    SSRE VQRL+ KN+E E   RK+ Q+++PSDPN W+QMRENYEAIILE+
Sbjct  1    MTIPMENVSAPSSRELVQRLYKKNIESEKALRKSIQSKVPSDPNIWRQMRENYEAIILED  60

Query  449  HAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            H FSE H+IEY LWQ+H++RI+E RA L  A +++G+     G G    G D+I
Sbjct  61   HDFSESHDIEYVLWQMHHKRIDEFRARLRVASASTGANLPPPG-GKGLVGRDQI  113



>ref|XP_010536114.1| PREDICTED: protein SMG7 [Tarenaya hassleriana]
Length=994

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 85/114 (75%), Gaps = 3/114 (3%)
 Frame = +2

Query  266  IMTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILE  445
            ++ + M+ +   SSRE  Q + +K VELE+KRRKAAQAR+PSDPN WQQ+RENYEAIIL+
Sbjct  1    MIIVQMNKTSAPSSREHAQSILDKTVELESKRRKAAQARLPSDPNVWQQIRENYEAIILK  60

Query  446  NHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDR  607
            +H FSEQ  IEY LWQLHY+RIEE RAH N   S+S S + QN K P R  PDR
Sbjct  61   DHTFSEQQNIEYTLWQLHYKRIEEFRAHFNLL-SSSSSNSPQNVKAPIR--PDR  111



>ref|XP_009390996.1| PREDICTED: protein SMG7-like [Musa acuminata subsp. malaccensis]
 ref|XP_009390997.1| PREDICTED: protein SMG7-like [Musa acuminata subsp. malaccensis]
 ref|XP_009390998.1| PREDICTED: protein SMG7-like [Musa acuminata subsp. malaccensis]
Length=974

 Score =   133 bits (334),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 84/112 (75%), Gaps = 6/112 (5%)
 Frame = +2

Query  284  DNSVDH---SSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILENHA  454
            D SVD    SS +  QR ++KNVELE + R++A +++PSDPN W QMRENYEAIILE+H 
Sbjct  4    DLSVDGAAPSSWDLAQRRYDKNVELEERLRRSASSKVPSDPNIWLQMRENYEAIILEDHD  63

Query  455  FSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            FS++H++EY LW+LHYRRIEE RAHLN A SA GS  S  GKG  R  PDRI
Sbjct  64   FSQKHDVEYTLWRLHYRRIEEFRAHLNVAASA-GSNASPAGKGHIR--PDRI  112



>ref|XP_006286976.1| hypothetical protein CARUB_v10000123mg [Capsella rubella]
 gb|EOA19874.1| hypothetical protein CARUB_v10000123mg [Capsella rubella]
Length=1026

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 83/110 (75%), Gaps = 2/110 (2%)
 Frame = +2

Query  281  MDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILENHAFS  460
            MD +   S RER + +F+K VELENKR K AQAR  +DPN WQQ+RENYEAI+LE+H FS
Sbjct  1    MDKTTASSPRERAKAIFDKTVELENKRWKDAQARKQADPNLWQQIRENYEAILLEDHTFS  60

Query  461  EQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            EQH IE  LWQLHY+ IEE RA ++ ALS+  S+ +QN KGPSR  PDRI
Sbjct  61   EQHSIELTLWQLHYKFIEEFRARIHAALSSGSSSAAQNVKGPSR--PDRI  108



>ref|XP_010493000.1| PREDICTED: protein SMG7 isoform X2 [Camelina sativa]
 ref|XP_010493001.1| PREDICTED: protein SMG7 isoform X2 [Camelina sativa]
Length=1024

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = +2

Query  281  MDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILENHAFS  460
            MDN+   SSRER + LF+K +ELENKR KA Q R P D N W Q+RENYEAI+ E+HAFS
Sbjct  1    MDNTTASSSRERAKSLFDKTIELENKRWKAVQDRNPFDLNLWHQIRENYEAILFEDHAFS  60

Query  461  EQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSR  592
            EQH IE  LWQLHY+RIE  R H+N  LS+S S+ + N KGPSR
Sbjct  61   EQHNIELILWQLHYKRIENCRGHINAFLSSSSSSAAHNVKGPSR  104



>ref|XP_010424182.1| PREDICTED: protein SMG7-like, partial [Camelina sativa]
Length=778

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = +2

Query  281  MDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILENHAFS  460
            MD +   SSRER + LF+K V LENKR KA Q R P DP+ WQQ+RENYEAI+ E+HAFS
Sbjct  1    MDKTTASSSRERAKSLFDKTVVLENKRWKAVQDRNPFDPDLWQQIRENYEAILFEDHAFS  60

Query  461  EQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSR  592
            EQH IE  LWQLHY+RIE  R H+N  L++S S+ + N KGPSR
Sbjct  61   EQHNIEIILWQLHYKRIENCRGHINAFLNSSSSSAANNVKGPSR  104



>emb|CDY65062.1| BnaC02g44260D [Brassica napus]
Length=1009

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 78/111 (70%), Gaps = 14/111 (13%)
 Frame = +2

Query  281  MDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIP-SDPNSWQQMRENYEAIILENHAF  457
            MD     S  ER Q LF+K +ELE KRRKAAQ+R P SDPN WQQ+RENYEAI+LE+HAF
Sbjct  1    MDKKTASSPWERAQSLFDKTIELEAKRRKAAQSRTPTSDPNLWQQIRENYEAIVLEDHAF  60

Query  458  SEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            SEQH IE+ LWQLHY+RIEE R+++N            N KGPS   P+R+
Sbjct  61   SEQHTIEFTLWQLHYKRIEEYRSNINA-----------NAKGPSI--PERV  98



>emb|CDY44916.1| BnaA02g04210D [Brassica napus]
Length=1025

 Score =   128 bits (321),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 74/104 (71%), Gaps = 12/104 (12%)
 Frame = +2

Query  281  MDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIP-SDPNSWQQMRENYEAIILENHAF  457
            MD     S  ER Q LF+K +ELE KRRKAAQ+R P SDPN WQQ+RENYEAI+LE+HAF
Sbjct  1    MDKKTASSPWERAQSLFDKTIELEAKRRKAAQSRTPTSDPNLWQQIRENYEAIVLEDHAF  60

Query  458  SEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPS  589
            SEQH IE+ LWQLHY+RIEE R+++N            N KGPS
Sbjct  61   SEQHTIEFTLWQLHYKRIEEYRSNINA-----------NAKGPS  93



>gb|EEE68449.1| hypothetical protein OsJ_26829 [Oryza sativa Japonica Group]
Length=1014

 Score =   124 bits (311),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 78/116 (67%), Gaps = 14/116 (12%)
 Frame = +2

Query  266  IMTIPMDN-SVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIIL  442
            +MT+PMD  +   SSRE  QRL  KN E E++ R++AQ+++PSDPN W QMRENYE IIL
Sbjct  1    MMTVPMDKATASPSSRELAQRLLKKNAEHESRLRRSAQSKVPSDPNIWFQMRENYEKIIL  60

Query  443  ENHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
             +H FSE+ EIEY LWQLHY+RIEE RAH+ +A             G +   PDRI
Sbjct  61   ADHDFSEKREIEYLLWQLHYKRIEEFRAHIVSA-------------GKNNANPDRI  103



>ref|NP_001061501.1| Os08g0305300 [Oryza sativa Japonica Group]
 dbj|BAF23415.1| Os08g0305300 [Oryza sativa Japonica Group]
 dbj|BAG94590.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1018

 Score =   124 bits (311),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 78/116 (67%), Gaps = 14/116 (12%)
 Frame = +2

Query  266  IMTIPMDN-SVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIIL  442
            +MT+PMD  +   SSRE  QRL  KN E E++ R++AQ+++PSDPN W QMRENYE IIL
Sbjct  1    MMTVPMDKATASPSSRELAQRLLKKNAEHESRLRRSAQSKVPSDPNIWFQMRENYEKIIL  60

Query  443  ENHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
             +H FSE+ EIEY LWQLHY+RIEE RAH+ +A             G +   PDRI
Sbjct  61   ADHDFSEKREIEYLLWQLHYKRIEEFRAHIVSA-------------GKNNANPDRI  103



>gb|EEC83333.1| hypothetical protein OsI_28722 [Oryza sativa Indica Group]
Length=1014

 Score =   124 bits (311),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 78/116 (67%), Gaps = 14/116 (12%)
 Frame = +2

Query  266  IMTIPMDN-SVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIIL  442
            +MT+PMD  +   SSRE  QRL  KN E E++ R++AQ+++PSDPN W QMRENYE IIL
Sbjct  1    MMTVPMDKATASPSSRELAQRLLKKNAEHESRLRRSAQSKVPSDPNIWFQMRENYEKIIL  60

Query  443  ENHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
             +H FSE+ EIEY LWQLHY+RIEE RAH+ +A             G +   PDRI
Sbjct  61   ADHDFSEKREIEYLLWQLHYKRIEEFRAHIVSA-------------GKNNANPDRI  103



>gb|EMS65250.1| Protein SMG7 [Triticum urartu]
Length=1114

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 75/102 (74%), Gaps = 6/102 (6%)
 Frame = +2

Query  305  SRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILENHAFSEQHEIEYA  484
            SR+ VQRL  KN EL++   K+AQ+++PSDPN W QMREN+E +IL +H F E+HEIEY 
Sbjct  108  SRDLVQRLLKKNAELKSHLEKSAQSKVPSDPNIWLQMRENFEKMILADHDFCEKHEIEYI  167

Query  485  LWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            LWQLHY+RIEE R H+++A    GS  SQNGK  +   PDRI
Sbjct  168  LWQLHYKRIEEFRHHISSA----GSAASQNGK--NNANPDRI  203



>ref|XP_009409875.1| PREDICTED: protein SMG7-like [Musa acuminata subsp. malaccensis]
 ref|XP_009409877.1| PREDICTED: protein SMG7-like [Musa acuminata subsp. malaccensis]
 ref|XP_009409878.1| PREDICTED: protein SMG7-like [Musa acuminata subsp. malaccensis]
 ref|XP_009409879.1| PREDICTED: protein SMG7-like [Musa acuminata subsp. malaccensis]
 ref|XP_009409880.1| PREDICTED: protein SMG7-like [Musa acuminata subsp. malaccensis]
Length=991

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 80/115 (70%), Gaps = 3/115 (3%)
 Frame = +2

Query  266  IMTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILE  445
            +MT PM  S   S  E  QRL  KNVELEN  R++ + ++PSDPN+W QMRENYE IILE
Sbjct  1    MMTAPMVRSSSTSPGELAQRLLEKNVELENGLRRSTKLKLPSDPNAWLQMRENYEIIILE  60

Query  446  NHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            +H FSE+H++E+ LWQLHYRRIEE R H+N A SA  + T   GK   R  PD+I
Sbjct  61   DHDFSEKHDVEFVLWQLHYRRIEEFRQHINAAASAGSNATF-GGKVLVR--PDKI  112



>ref|XP_006659291.1| PREDICTED: protein SMG7-like isoform X3 [Oryza brachyantha]
Length=1024

 Score =   121 bits (304),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 69/93 (74%), Gaps = 1/93 (1%)
 Frame = +2

Query  266  IMTIPMDN-SVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIIL  442
            +MT+PMD  +   S RE  QRL  KN E E++ R++ Q+++PSDPN W QMRENYE I+L
Sbjct  1    MMTVPMDKATASPSPRELAQRLLKKNAEHESRLRRSTQSKVPSDPNIWLQMRENYEKIVL  60

Query  443  ENHAFSEQHEIEYALWQLHYRRIEELRAHLNTA  541
             +H FSE+HEIEY LWQLHY+RIEE R H+  A
Sbjct  61   TDHDFSEKHEIEYLLWQLHYKRIEEFRGHIVAA  93



>ref|XP_006659289.1| PREDICTED: protein SMG7-like isoform X1 [Oryza brachyantha]
 ref|XP_006659290.1| PREDICTED: protein SMG7-like isoform X2 [Oryza brachyantha]
Length=1028

 Score =   121 bits (304),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 69/93 (74%), Gaps = 1/93 (1%)
 Frame = +2

Query  266  IMTIPMDN-SVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIIL  442
            +MT+PMD  +   S RE  QRL  KN E E++ R++ Q+++PSDPN W QMRENYE I+L
Sbjct  1    MMTVPMDKATASPSPRELAQRLLKKNAEHESRLRRSTQSKVPSDPNIWLQMRENYEKIVL  60

Query  443  ENHAFSEQHEIEYALWQLHYRRIEELRAHLNTA  541
             +H FSE+HEIEY LWQLHY+RIEE R H+  A
Sbjct  61   TDHDFSEKHEIEYLLWQLHYKRIEEFRGHIVAA  93



>ref|NP_197441.3| EST1 domain protein SMG7 [Arabidopsis thaliana]
 ref|NP_001190336.1| EST1 domain protein SMG7 [Arabidopsis thaliana]
 ref|NP_001190337.1| EST1 domain protein SMG7 [Arabidopsis thaliana]
 sp|A9QM73.1|SMG7_ARATH RecName: Full=Protein SMG7; AltName: Full=SMG7 homolog [Arabidopsis 
thaliana]
 gb|ABW96769.1| SMG7-like protein [Arabidopsis thaliana]
 gb|AED92699.1| EST1 domain protein SMG7 [Arabidopsis thaliana]
 gb|AED92700.1| EST1 domain protein SMG7 [Arabidopsis thaliana]
 gb|AED92701.1| EST1 domain protein SMG7 [Arabidopsis thaliana]
Length=1059

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 76/110 (69%), Gaps = 3/110 (3%)
 Frame = +2

Query  266  IMTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILE  445
            +MT+ MD +   SS ER + ++++  EL NKR+KA     P DPN  Q +RE YEAIILE
Sbjct  1    MMTLQMDKTTASSSWERAKSIYDEIAELANKRQKAGN---PPDPNLLQLLREKYEAIILE  57

Query  446  NHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRG  595
            +H FSEQH IE  LWQLHY+RIE  R H+N  L++S ST +QN KGPS+ 
Sbjct  58   SHTFSEQHNIEIPLWQLHYKRIEYFRLHINRVLASSTSTAAQNVKGPSKA  107



>ref|XP_002871883.1| hypothetical protein ARALYDRAFT_488829 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48142.1| hypothetical protein ARALYDRAFT_488829 [Arabidopsis lyrata subsp. 
lyrata]
Length=1047

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 72/110 (65%), Gaps = 14/110 (13%)
 Frame = +2

Query  281  MDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILENHAFS  460
            MD +   S RER + + +K   LENKR KAAQ R P D N WQQ+RENYEAIILE+H FS
Sbjct  1    MDKTTACSPRERAKSILDKTFALENKRWKAAQTRNPPDLNLWQQIRENYEAIILEDHTFS  60

Query  461  EQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            EQH IE  LWQLHY+RIE+ R+H+N +            KGPS+  PD I
Sbjct  61   EQHNIELTLWQLHYKRIEDFRSHINAS------------KGPSK--PDVI  96



>ref|XP_004956332.1| PREDICTED: protein SMG7-like [Setaria italica]
Length=1037

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 72/87 (83%), Gaps = 1/87 (1%)
 Frame = +2

Query  266  IMTIPMDNSVD-HSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIIL  442
            +MT+PMD++    SSR+  +RLFNKN ELE++ RK+ Q+++PSDPN+W QMR+N+E IIL
Sbjct  1    MMTVPMDSATSASSSRDLAERLFNKNNELEDQLRKSVQSKLPSDPNTWIQMRDNFEKIIL  60

Query  443  ENHAFSEQHEIEYALWQLHYRRIEELR  523
             ++ FSEQ+E+EY LWQLHY+RIE+ R
Sbjct  61   TDNDFSEQNEVEYLLWQLHYKRIEDFR  87



>ref|XP_010234570.1| PREDICTED: protein SMG7 [Brachypodium distachyon]
Length=1027

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 81/116 (70%), Gaps = 4/116 (3%)
 Frame = +2

Query  266  IMTIPMDN-SVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIIL  442
            +M +PMD  +   S RE  QRL  KN E +++ R+AAQ++IPSDP+ W QMRENYE IIL
Sbjct  1    MMAVPMDKATASLSPRELAQRLLKKNAEHDSRLRRAAQSKIPSDPSIWLQMRENYEKIIL  60

Query  443  ENHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
             +  FSE HEIEY LWQLHY+RIEE R H+N+A ++S +   Q GK  +   PDR+
Sbjct  61   ADPEFSENHEIEYHLWQLHYKRIEEFRGHINSAAASSSAAV-QGGK--NNVNPDRV  113



>dbj|BAD30942.1| putative cig3 [Oryza sativa Japonica Group]
 dbj|BAD30976.1| putative cig3 [Oryza sativa Japonica Group]
Length=1013

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 70/103 (68%), Gaps = 13/103 (13%)
 Frame = +2

Query  302  SSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILENHAFSEQHEIEY  481
            SSRE  QRL  KN E E++ R++AQ+++PSDPN W QMRENYE IIL +H FSE+ EIEY
Sbjct  9    SSRELAQRLLKKNAEHESRLRRSAQSKVPSDPNIWFQMRENYEKIILADHDFSEKREIEY  68

Query  482  ALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
             LWQLHY+RIEE RAH+ +A             G +   PDRI
Sbjct  69   LLWQLHYKRIEEFRAHIVSA-------------GKNNANPDRI  98



>dbj|BAI39673.1| putative cig3 [Oryza sativa Indica Group]
Length=1013

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 70/103 (68%), Gaps = 13/103 (13%)
 Frame = +2

Query  302  SSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILENHAFSEQHEIEY  481
            SSRE  QRL  KN E E++ R++AQ+++PSDPN W QMRENYE IIL +H FSE+ EIEY
Sbjct  9    SSRELAQRLLKKNAEHESRLRRSAQSKVPSDPNIWFQMRENYEKIILADHDFSEKREIEY  68

Query  482  ALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
             LWQLHY+RIEE RAH+ +A             G +   PDRI
Sbjct  69   LLWQLHYKRIEEFRAHIVSA-------------GKNNANPDRI  98



>gb|AAQ56453.1| putative cytokinin inducibl protein [Oryza sativa Japonica Group]
 gb|AAQ56472.1| putative cytokinin inducible protein [Oryza sativa Japonica Group]
Length=1256

 Score =   115 bits (287),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 70/103 (68%), Gaps = 13/103 (13%)
 Frame = +2

Query  302  SSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILENHAFSEQHEIEY  481
            SSRE  QRL  KN E E++ R++AQ+++PSDPN W QMRENYE IIL +H FSE+ EIEY
Sbjct  256  SSRELAQRLLKKNAEHESRLRRSAQSKVPSDPNIWFQMRENYEKIILADHDFSEKREIEY  315

Query  482  ALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
             LWQLHY+RIEE RAH+ +A             G +   PDRI
Sbjct  316  LLWQLHYKRIEEFRAHIVSA-------------GKNNANPDRI  345



>ref|XP_008670096.1| PREDICTED: protein SMG7 [Zea mays]
 ref|XP_008670097.1| PREDICTED: protein SMG7 [Zea mays]
 tpg|DAA39804.1| TPA: hypothetical protein ZEAMMB73_226407 [Zea mays]
Length=1049

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 81/117 (69%), Gaps = 8/117 (7%)
 Frame = +2

Query  266  IMTIPMDNS--VDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAII  439
            +MT+PMD++     S+R+  +RL  +N ELE++ RK+AQ+++PSDPN W QMR+N+E II
Sbjct  1    MMTVPMDSASAAPSSTRDLAERLLTRNNELEDQLRKSAQSKVPSDPNIWLQMRDNFEKII  60

Query  440  LENHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            L +H  SEQ ++EY LWQLHY+RIE+ R +++ A      ++  +  G S   PDR+
Sbjct  61   LIDHDLSEQRDVEYLLWQLHYKRIEDFRRNISAA------SSLASQSGKSNTNPDRV  111



>gb|EMT31840.1| hypothetical protein F775_31931 [Aegilops tauschii]
Length=1131

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 68/92 (74%), Gaps = 6/92 (7%)
 Frame = +2

Query  335  KNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILENHAFSEQHEIEYALWQLHYRRIE  514
            +N EL++   K+AQ+++PSDPN W QMREN+E +IL +H F E+HEIEY LWQLHY+RIE
Sbjct  64   QNAELKSHLEKSAQSKVPSDPNIWLQMRENFEKMILADHDFCEKHEIEYILWQLHYKRIE  123

Query  515  ELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            E R H+++A    G+  SQNGK  +   PDRI
Sbjct  124  EFRHHISSA----GAAASQNGK--NNANPDRI  149



>gb|KDO54816.1| hypothetical protein CISIN_1g0023802mg, partial [Citrus sinensis]
 gb|KDO54817.1| hypothetical protein CISIN_1g0023802mg, partial [Citrus sinensis]
 gb|KDO54818.1| hypothetical protein CISIN_1g0023802mg, partial [Citrus sinensis]
Length=218

 Score =   100 bits (248),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 55/66 (83%), Gaps = 2/66 (3%)
 Frame = +2

Query  413  MRENYEAIILENHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSR  592
            MRENYEAIILE+HAFSEQH +EYALWQLHYRRIEELRAH + A+S++GS TSQ  K P R
Sbjct  1    MRENYEAIILEDHAFSEQHNVEYALWQLHYRRIEELRAHYSAAVSSAGSNTSQATKVPLR  60

Query  593  GGPDRI  610
               DR+
Sbjct  61   S--DRV  64



>ref|XP_008651785.1| PREDICTED: uncharacterized protein LOC100384817 isoform X1 [Zea 
mays]
 tpg|DAA60824.1| TPA: hypothetical protein ZEAMMB73_633643 [Zea mays]
Length=1057

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 67/88 (76%), Gaps = 2/88 (2%)
 Frame = +2

Query  266  IMTIPMDNSVDHSS--RERVQRLFNKNVELENKRRKAAQARIPSDPNSWQQMRENYEAII  439
            +MT+PMD++    S  R+  +RL  +N ELE++ RK+AQ+++PSDP+ W QMR+N+E II
Sbjct  1    MMTVPMDSASAAPSSARDFAERLLTRNNELEDQLRKSAQSKVPSDPSIWLQMRDNFEKII  60

Query  440  LENHAFSEQHEIEYALWQLHYRRIEELR  523
            L +H  SEQ E+EY LW+LHY+RIE+ R
Sbjct  61   LIDHDLSEQKEVEYLLWKLHYKRIEDFR  88



>ref|XP_008652306.1| PREDICTED: protein SMG7-like [Zea mays]
Length=282

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 65/92 (71%), Gaps = 6/92 (7%)
 Frame = +2

Query  335  KNVELENKRRKAAQARIPSDPNSWQQMRENYEAIILENHAFSEQHEIEYALWQLHYRRIE  514
            +N ELE++ RK+AQ+++PSDPN W QMR+N+E IIL +H  SEQ ++EY LWQLHY+RIE
Sbjct  2    QNNELEDQLRKSAQSKVPSDPNIWLQMRDNFEKIILIDHDLSEQRDVEYLLWQLHYKRIE  61

Query  515  ELRAHLNTALSASGSTTSQNGKGPSRGGPDRI  610
            + R +++ A      ++  +  G S   PDR+
Sbjct  62   DFRRNISAA------SSLASQSGKSNTNPDRV  87



>ref|XP_008788825.1| PREDICTED: protein SMG7-like isoform X2 [Phoenix dactylifera]
Length=946

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 51/66 (77%), Gaps = 6/66 (9%)
 Frame = +2

Query  413  MRENYEAIILENHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSR  592
            MRENYEAIILE+H FSE+HE+EYALWQLHYRRIEE R H+N A+SA     S  GK  +R
Sbjct  1    MRENYEAIILEDHDFSEKHEVEYALWQLHYRRIEEFRTHINAAVSAG----SNAGKSLAR  56

Query  593  GGPDRI  610
              PDRI
Sbjct  57   --PDRI  60



>gb|KEH22140.1| Smg-7, putative [Medicago truncatula]
Length=55

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 41/57 (72%), Gaps = 7/57 (12%)
 Frame = +2

Query  434  IILENHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKGPSRGGPD  604
            +ILE+HAFSEQH IE+ALWQLHY+RIEE RA+ N ALS++ S        PS G  D
Sbjct  1    MILEDHAFSEQHNIEFALWQLHYKRIEEFRAYFNVALSSAKSN-------PSHGEED  50



>ref|XP_001781790.1| predicted protein [Physcomitrella patens]
 gb|EDQ53438.1| predicted protein [Physcomitrella patens]
Length=1389

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 58/93 (62%), Gaps = 3/93 (3%)
 Frame = +2

Query  263  WIMTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNS---WQQMRENYEA  433
            W+M++P D +   +     ++ +N+ +ELE + R   Q + P D +       +RE YE+
Sbjct  72   WMMSLPSDTAPVSAPLALAKQHYNQALELEKQLRSLLQVKGPFDSSVRTLQNSLREKYES  131

Query  434  IILENHAFSEQHEIEYALWQLHYRRIEELRAHL  532
            IILE+H  +E HE+E A+W+LHY++I+E RA +
Sbjct  132  IILEDHELAESHEVEQAIWRLHYKQIDEFRAKI  164



>ref|XP_001765874.1| predicted protein [Physcomitrella patens]
 gb|EDQ69195.1| predicted protein [Physcomitrella patens]
Length=1445

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 59/93 (63%), Gaps = 3/93 (3%)
 Frame = +2

Query  263  WIMTIPMDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPN--SWQ-QMRENYEA  433
            W+M++  D +         ++ +NK +ELE + R   QA+ P D N  S Q  +RE YE+
Sbjct  175  WMMSLRSDAASVSLPLALAKQHYNKALELEKQLRTLLQAKGPFDGNVRSLQISLREKYES  234

Query  434  IILENHAFSEQHEIEYALWQLHYRRIEELRAHL  532
            +ILE+H  SE HE+E A+W+LHY++I+E RA +
Sbjct  235  VILEDHELSESHEVEQAIWRLHYKQIDEYRAKI  267



>ref|XP_006853551.1| hypothetical protein AMTR_s00032p00234570 [Amborella trichopoda]
 gb|ERN15018.1| hypothetical protein AMTR_s00032p00234570 [Amborella trichopoda]
Length=979

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 50/90 (56%), Gaps = 3/90 (3%)
 Frame = +2

Query  323  RLFNKNVELENKRRKAAQARIPSDPNSWQ---QMRENYEAIILENHAFSEQHEIEYALWQ  493
            R F + V+ E K       + P DP   +   ++R +YE  IL++H F+   ++E+ALW+
Sbjct  13   RCFAEAVKAEKKLWTMIHLKGPLDPELQELHRKIRISYEGTILKDHEFAAIKDVEHALWR  72

Query  494  LHYRRIEELRAHLNTALSASGSTTSQNGKG  583
            LHY++IEE+R  +  + S +      N +G
Sbjct  73   LHYKQIEEIRNRIQASTSHAECMNPLNSQG  102



>ref|XP_006594589.1| PREDICTED: protein SMG7L-like [Glycine max]
Length=1002

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  404  WQQMRENYEAIILENHAFSEQHEIEYALWQLHYRRIEELR  523
            + ++R +YE IIL NH FSE  ++EY+LW+LHY+ I+E R
Sbjct  46   YHRVRSSYERIILSNHMFSELQDVEYSLWKLHYKHIDEFR  85



>ref|XP_003547150.2| PREDICTED: protein SMG7L-like isoform X1 [Glycine max]
Length=1001

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 38/61 (62%), Gaps = 3/61 (5%)
 Frame = +2

Query  404  WQQMRENYEAIILENHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKG  583
            + ++R +YE IIL NH  SE  ++EY+LW+LHY+ I+E R  +     +SG+  S+    
Sbjct  46   YHKVRSSYERIILSNHMLSELQDVEYSLWKLHYKHIDEFRKIIK---KSSGNVESKKSGM  102

Query  584  P  586
            P
Sbjct  103  P  103



>ref|XP_006597440.1| PREDICTED: protein SMG7L-like isoform X2 [Glycine max]
Length=1002

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 38/61 (62%), Gaps = 3/61 (5%)
 Frame = +2

Query  404  WQQMRENYEAIILENHAFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTSQNGKG  583
            + ++R +YE IIL NH  SE  ++EY+LW+LHY+ I+E R  +     +SG+  S+    
Sbjct  46   YHKVRSSYERIILSNHMLSELQDVEYSLWKLHYKHIDEFRKIIK---KSSGNVESKKSGM  102

Query  584  P  586
            P
Sbjct  103  P  103



>gb|KJB66725.1| hypothetical protein B456_010G155000 [Gossypium raimondii]
 gb|KJB66726.1| hypothetical protein B456_010G155000 [Gossypium raimondii]
 gb|KJB66727.1| hypothetical protein B456_010G155000 [Gossypium raimondii]
 gb|KJB66728.1| hypothetical protein B456_010G155000 [Gossypium raimondii]
Length=1007

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/64 (36%), Positives = 39/64 (61%), Gaps = 7/64 (11%)
 Frame = +2

Query  404  WQQMRENYEAIILENHAFSEQHEIEYALWQLHYRRIEELR-------AHLNTALSASGST  562
            + ++  NYE+  L++H  +E  ++EY+LW+LHY+ I+E R       A+  + +SA GS 
Sbjct  47   YHKVCLNYESFFLDDHELTELQDVEYSLWKLHYKHIDEFRKRTKRSSANSESTMSAMGSI  106

Query  563  TSQN  574
             S N
Sbjct  107  GSDN  110



>ref|XP_004485796.1| PREDICTED: uncharacterized protein LOC101498769 isoform X5 [Cicer 
arietinum]
Length=940

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 45/73 (62%), Gaps = 4/73 (5%)
 Frame = +2

Query  404  WQQMRENYEAIILENHAFSEQHEIEYALWQLHYRRIEELRAHL---NTALSASGSTTSQN  574
            + ++R +YE IIL N+ ++E  ++EY+LW+LHY+ I+E R  +   +  + ++ S   Q 
Sbjct  45   YHKIRASYERIILNNYTYAEIQDVEYSLWKLHYKHIDEFRKIIKKNSGDVESNKSGMLQT  104

Query  575  GKGP-SRGGPDRI  610
            G G  S G P ++
Sbjct  105  GVGKRSNGNPFKL  117



>ref|XP_004485792.1| PREDICTED: uncharacterized protein LOC101498769 isoform X1 [Cicer 
arietinum]
 ref|XP_004485793.1| PREDICTED: uncharacterized protein LOC101498769 isoform X2 [Cicer 
arietinum]
 ref|XP_004485794.1| PREDICTED: uncharacterized protein LOC101498769 isoform X3 [Cicer 
arietinum]
 ref|XP_004485795.1| PREDICTED: uncharacterized protein LOC101498769 isoform X4 [Cicer 
arietinum]
Length=1005

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 45/73 (62%), Gaps = 4/73 (5%)
 Frame = +2

Query  404  WQQMRENYEAIILENHAFSEQHEIEYALWQLHYRRIEELRAHL---NTALSASGSTTSQN  574
            + ++R +YE IIL N+ ++E  ++EY+LW+LHY+ I+E R  +   +  + ++ S   Q 
Sbjct  45   YHKIRASYERIILNNYTYAEIQDVEYSLWKLHYKHIDEFRKIIKKNSGDVESNKSGMLQT  104

Query  575  GKGP-SRGGPDRI  610
            G G  S G P ++
Sbjct  105  GVGKRSNGNPFKL  117



>ref|XP_002509461.1| smg-7, putative [Ricinus communis]
 gb|EEF50848.1| smg-7, putative [Ricinus communis]
Length=1008

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  404  WQQMRENYEAIILENHAFSEQHEIEYALWQLHYRRIEELRAHLNTALS  547
            + ++   YE IIL +H  SE  +IEY+LW+LHYR I+E R  +  + S
Sbjct  56   YHRICSTYEKIILSDHEVSELQDIEYSLWKLHYRHIDEFRKRIKKSAS  103



>gb|KHG19322.1| Telomerase-binding EST1A [Gossypium arboreum]
Length=1082

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 39/64 (61%), Gaps = 7/64 (11%)
 Frame = +2

Query  404  WQQMRENYEAIILENHAFSEQHEIEYALWQLHYRRIEELR-------AHLNTALSASGST  562
            + ++  NYE+  L++H  +E  ++EY+LW+LHY+ I+E R       A+  + + A GS+
Sbjct  122  YHKVCLNYESFFLDDHELTELQDVEYSLWKLHYKHIDEFRKRTKRSSANSESTMCAMGSS  181

Query  563  TSQN  574
             S N
Sbjct  182  GSDN  185



>ref|XP_006594316.1| PREDICTED: protein SMG7L-like isoform X4 [Glycine max]
Length=959

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +2

Query  404  WQQMRENYEAIILENHAFSEQHEIEYALWQLHYRRIEELR  523
            +  +R +YE  IL NH  SE  E+EY+LW+LHY+ I+E R
Sbjct  46   YHNIRSSYERAILNNHTHSELQEVEYSLWKLHYKHIDEFR  85



>ref|XP_006594315.1| PREDICTED: protein SMG7L-like isoform X3 [Glycine max]
Length=999

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +2

Query  404  WQQMRENYEAIILENHAFSEQHEIEYALWQLHYRRIEELR  523
            +  +R +YE  IL NH  SE  E+EY+LW+LHY+ I+E R
Sbjct  46   YHNIRSSYERAILNNHTHSELQEVEYSLWKLHYKHIDEFR  85



>ref|XP_006594313.1| PREDICTED: protein SMG7L-like isoform X1 [Glycine max]
 ref|XP_006594314.1| PREDICTED: protein SMG7L-like isoform X2 [Glycine max]
Length=1000

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +2

Query  404  WQQMRENYEAIILENHAFSEQHEIEYALWQLHYRRIEELR  523
            +  +R +YE  IL NH  SE  E+EY+LW+LHY+ I+E R
Sbjct  46   YHNIRSSYERAILNNHTHSELQEVEYSLWKLHYKHIDEFR  85



>gb|KHN09994.1| Protein SMG7 [Glycine soja]
Length=999

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +2

Query  404  WQQMRENYEAIILENHAFSEQHEIEYALWQLHYRRIEELR  523
            +  +R +YE  IL NH  SE  E+EY+LW+LHY+ I+E R
Sbjct  46   YHNIRSSYERAILNNHTHSELQEVEYSLWKLHYKHIDEFR  85



>ref|XP_002305789.2| hypothetical protein POPTR_0004s04510g [Populus trichocarpa]
 gb|EEE86300.2| hypothetical protein POPTR_0004s04510g [Populus trichocarpa]
Length=1017

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 51/99 (52%), Gaps = 4/99 (4%)
 Frame = +2

Query  281  MDNSVDHSSRERVQRLFNKNVELENKRRKAAQARIPSDPNS---WQQMRENYEAIILENH  451
            MD +   + ++    LF +   LE +       +   DPN    ++++   YE IIL +H
Sbjct  1    MDTNSHLNDQKEKPSLFVEVANLEKQLWALIHTKGLLDPNVQDLYRKICSGYERIILSDH  60

Query  452  AFSEQHEIEYALWQLHYRRIEELRAHLNTALSASGSTTS  568
               +  + EY+LW+LHYR I+E R  +    SA+G TT+
Sbjct  61   KLGDLQDTEYSLWKLHYRHIDEYRKRMKRN-SANGETTT  98



>ref|XP_007159335.1| hypothetical protein PHAVU_002G229500g [Phaseolus vulgaris]
 gb|ESW31329.1| hypothetical protein PHAVU_002G229500g [Phaseolus vulgaris]
Length=995

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +2

Query  404  WQQMRENYEAIILENHAFSEQHEIEYALWQLHYRRIEELR  523
            +  +R +YE  IL NH  SE  E+EY LW+LHY+ I+E R
Sbjct  45   YSNIRSSYEREILSNHTHSELQEVEYCLWKLHYKHIDEFR  84



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 842962938660