BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS092A11

Length=619
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009591416.1|  PREDICTED: lysosomal alpha-mannosidase-like        400   4e-129   Nicotiana tomentosiformis
ref|XP_009775244.1|  PREDICTED: lysosomal alpha-mannosidase-like        399   2e-128   Nicotiana sylvestris
gb|KJB19727.1|  hypothetical protein B456_003G116600                    392   2e-127   Gossypium raimondii
ref|XP_007038135.1|  Glycosyl hydrolase family 38 protein isoform 4     388   3e-127   
gb|KHG03548.1|  Lysosomal alpha-mannosidase                             394   4e-127   Gossypium arboreum [tree cotton]
ref|XP_007038136.1|  Glycosyl hydrolase family 38 protein isoform 5     388   4e-127   
ref|XP_007161620.1|  hypothetical protein PHAVU_001G084700g             393   2e-126   Phaseolus vulgaris [French bean]
ref|XP_007137859.1|  hypothetical protein PHAVU_009G161600g             385   3e-126   Phaseolus vulgaris [French bean]
gb|KJB19726.1|  hypothetical protein B456_003G116600                    392   4e-126   Gossypium raimondii
ref|XP_011468215.1|  PREDICTED: alpha-mannosidase isoform X2            390   1e-125   Fragaria vesca subsp. vesca
ref|XP_007038134.1|  Glycosyl hydrolase family 38 protein isoform 3     390   2e-125   
ref|XP_008379739.1|  PREDICTED: lysosomal alpha-mannosidase-like        383   2e-125   
gb|KJB76312.1|  hypothetical protein B456_012G082700                    387   4e-125   Gossypium raimondii
ref|XP_004304565.1|  PREDICTED: alpha-mannosidase isoform X1            389   4e-125   Fragaria vesca subsp. vesca
ref|XP_007038132.1|  Glycosyl hydrolase family 38 protein isoform 1     389   4e-125   
ref|XP_007038133.1|  Glycosyl hydrolase family 38 protein isoform 2     389   4e-125   
gb|AIX48016.1|  LMann protein                                           389   6e-125   synthetic construct
gb|KEH23493.1|  glycoside hydrolase family 38 amino-terminal doma...    384   7e-125   Medicago truncatula
gb|AGR44468.1|  alpha-mannosidase                                       389   8e-125   Pyrus x bretschneideri [bai li]
gb|KJB76305.1|  hypothetical protein B456_012G082700                    387   8e-125   Gossypium raimondii
gb|KJB76306.1|  hypothetical protein B456_012G082700                    387   8e-125   Gossypium raimondii
ref|XP_007032025.1|  Glycosyl hydrolase family 38 protein               388   1e-124   
gb|KJB76310.1|  hypothetical protein B456_012G082700                    387   1e-124   Gossypium raimondii
ref|NP_001234851.1|  alpha-mannosidase precursor                        388   1e-124   Solanum lycopersicum
gb|KJB76307.1|  hypothetical protein B456_012G082700                    388   1e-124   Gossypium raimondii
gb|KJB76308.1|  hypothetical protein B456_012G082700                    388   1e-124   Gossypium raimondii
gb|KJB76304.1|  hypothetical protein B456_012G082700                    388   2e-124   Gossypium raimondii
gb|KJB76313.1|  hypothetical protein B456_012G082700                    388   2e-124   Gossypium raimondii
gb|KJB76311.1|  hypothetical protein B456_012G082700                    388   2e-124   Gossypium raimondii
ref|XP_008231243.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    384   5e-124   Prunus mume [ume]
emb|CDO98309.1|  unnamed protein product                                386   8e-124   Coffea canephora [robusta coffee]
ref|XP_006365417.1|  PREDICTED: lysosomal alpha-mannosidase-like        386   1e-123   Solanum tuberosum [potatoes]
gb|KHN46850.1|  Lysosomal alpha-mannosidase                             385   1e-123   Glycine soja [wild soybean]
ref|XP_003548858.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    385   2e-123   
ref|XP_002511094.1|  lysosomal alpha-mannosidase, putative              384   3e-123   Ricinus communis
ref|XP_008231241.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    384   3e-123   Prunus mume [ume]
ref|XP_004501751.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    384   3e-123   
ref|XP_010099053.1|  Lysosomal alpha-mannosidase                        383   3e-123   
ref|XP_003523176.1|  PREDICTED: lysosomal alpha-mannosidase-like        384   4e-123   Glycine max [soybeans]
ref|XP_004501750.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    384   4e-123   Cicer arietinum [garbanzo]
gb|KDP41855.1|  hypothetical protein JCGZ_26873                         384   5e-123   Jatropha curcas
gb|KHN31257.1|  Lysosomal alpha-mannosidase                             384   6e-123   Glycine soja [wild soybean]
ref|XP_004297489.1|  PREDICTED: alpha-mannosidase-like                  383   7e-123   Fragaria vesca subsp. vesca
gb|KHN09713.1|  Lysosomal alpha-mannosidase                             383   1e-122   Glycine soja [wild soybean]
gb|AES80719.2|  glycoside hydrolase family 38 amino-terminal doma...    384   1e-122   Medicago truncatula
ref|XP_003526925.1|  PREDICTED: lysosomal alpha-mannosidase-like        383   1e-122   Glycine max [soybeans]
ref|XP_003624501.1|  Lysosomal alpha-mannosidase                        384   1e-122   
ref|XP_011042968.1|  PREDICTED: alpha-mannosidase-like                  382   1e-122   Populus euphratica
emb|CDP17307.1|  unnamed protein product                                383   1e-122   Coffea canephora [robusta coffee]
ref|XP_007214917.1|  hypothetical protein PRUPE_ppa000717mg             383   1e-122   Prunus persica
gb|ADU20406.1|  alpha-mannosidase                                       383   2e-122   Capsicum annuum
ref|XP_011098967.1|  PREDICTED: alpha-mannosidase isoform X2            383   2e-122   Sesamum indicum [beniseed]
ref|XP_011098968.1|  PREDICTED: alpha-mannosidase isoform X3            382   2e-122   
ref|XP_011098966.1|  PREDICTED: alpha-mannosidase isoform X1            382   2e-122   Sesamum indicum [beniseed]
ref|XP_002318770.1|  hypothetical protein POPTR_0012s10830g             382   3e-122   
ref|XP_002276092.2|  PREDICTED: alpha-mannosidase isoform X2            382   4e-122   Vitis vinifera
ref|XP_006289410.1|  hypothetical protein CARUB_v10002909mg             381   4e-122   Capsella rubella
ref|XP_010660680.1|  PREDICTED: alpha-mannosidase isoform X1            381   5e-122   
ref|XP_008239561.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    380   8e-122   Prunus mume [ume]
gb|KDO43587.1|  hypothetical protein CISIN_1g0020361mg                  369   8e-122   Citrus sinensis [apfelsine]
ref|XP_008239559.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    380   8e-122   Prunus mume [ume]
emb|CDX78550.1|  BnaA03g04620D                                          380   1e-121   
ref|XP_009378044.1|  PREDICTED: lysosomal alpha-mannosidase-like        380   1e-121   Pyrus x bretschneideri [bai li]
emb|CDX70531.1|  BnaC03g06150D                                          380   1e-121   
ref|XP_007210406.1|  hypothetical protein PRUPE_ppa000755mg             379   2e-121   Prunus persica
gb|AGX24942.1|  a-mannosidase                                           379   2e-121   Cucumis melo [Oriental melon]
ref|XP_008465523.1|  PREDICTED: lysosomal alpha-mannosidase             379   2e-121   
ref|XP_010453503.1|  PREDICTED: lysosomal alpha-mannosidase-like        379   4e-121   Camelina sativa [gold-of-pleasure]
ref|XP_011033761.1|  PREDICTED: alpha-mannosidase-like isoform X2       376   4e-121   Populus euphratica
gb|KDP22539.1|  hypothetical protein JCGZ_26370                         378   6e-121   Jatropha curcas
ref|XP_009131373.1|  PREDICTED: lysosomal alpha-mannosidase             378   8e-121   Brassica rapa
ref|XP_002321075.2|  glycosyl hydrolase family 38 family protein        378   9e-121   
ref|XP_006399901.1|  hypothetical protein EUTSA_v10012546mg             375   1e-120   
ref|XP_010492186.1|  PREDICTED: lysosomal alpha-mannosidase-like        378   1e-120   Camelina sativa [gold-of-pleasure]
gb|KDO43582.1|  hypothetical protein CISIN_1g0020361mg                  370   1e-120   Citrus sinensis [apfelsine]
ref|XP_009339044.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    378   1e-120   Pyrus x bretschneideri [bai li]
ref|XP_010420018.1|  PREDICTED: lysosomal alpha-mannosidase-like        377   1e-120   Camelina sativa [gold-of-pleasure]
ref|XP_004143760.1|  PREDICTED: lysosomal alpha-mannosidase-like        377   1e-120   Cucumis sativus [cucumbers]
gb|KDO51271.1|  hypothetical protein CISIN_1g001813mg                   374   2e-120   Citrus sinensis [apfelsine]
gb|KFK25632.1|  hypothetical protein AALP_AA8G139900                    377   3e-120   Arabis alpina [alpine rockcress]
ref|XP_011083026.1|  PREDICTED: alpha-mannosidase-like                  376   4e-120   Sesamum indicum [beniseed]
ref|XP_008374165.1|  PREDICTED: lysosomal alpha-mannosidase-like        375   4e-120   
ref|XP_006399902.1|  hypothetical protein EUTSA_v10012546mg             376   5e-120   Eutrema salsugineum [saltwater cress]
ref|XP_002871594.1|  glycosyl hydrolase family 38 protein               376   5e-120   
ref|XP_002512840.1|  lysosomal alpha-mannosidase, putative              375   6e-120   
ref|XP_011033760.1|  PREDICTED: alpha-mannosidase-like isoform X1       375   7e-120   Populus euphratica
gb|KDO51270.1|  hypothetical protein CISIN_1g001813mg                   374   1e-119   Citrus sinensis [apfelsine]
gb|KDO51269.1|  hypothetical protein CISIN_1g001813mg                   374   1e-119   Citrus sinensis [apfelsine]
ref|XP_010249227.1|  PREDICTED: lysosomal alpha-mannosidase-like        375   1e-119   
ref|XP_009368805.1|  PREDICTED: lysosomal alpha-mannosidase-like        378   1e-119   Pyrus x bretschneideri [bai li]
ref|XP_006485097.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    374   2e-119   Citrus sinensis [apfelsine]
gb|KDO51267.1|  hypothetical protein CISIN_1g001813mg                   374   2e-119   Citrus sinensis [apfelsine]
ref|XP_002280858.1|  PREDICTED: alpha-mannosidase                       374   2e-119   Vitis vinifera
gb|KDO51268.1|  hypothetical protein CISIN_1g001813mg                   372   2e-119   Citrus sinensis [apfelsine]
ref|XP_010550227.1|  PREDICTED: lysosomal alpha-mannosidase             374   3e-119   Tarenaya hassleriana [spider flower]
ref|XP_006468892.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    372   3e-119   Citrus sinensis [apfelsine]
ref|XP_006436953.1|  hypothetical protein CICLE_v10030627mg             373   3e-119   
ref|XP_006485096.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    374   4e-119   Citrus sinensis [apfelsine]
gb|KDO51266.1|  hypothetical protein CISIN_1g001813mg                   373   4e-119   Citrus sinensis [apfelsine]
ref|XP_010028936.1|  PREDICTED: lysosomal alpha-mannosidase             372   1e-118   Eucalyptus grandis [rose gum]
ref|XP_006446932.1|  hypothetical protein CICLE_v10014123mg             372   1e-118   
ref|XP_003602752.1|  Lysosomal alpha-mannosidase                        372   1e-118   Medicago truncatula
ref|XP_003602753.1|  Lysosomal alpha-mannosidase                        372   1e-118   
ref|XP_006446934.1|  hypothetical protein CICLE_v10014123mg             371   2e-118   
ref|XP_006468891.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    372   2e-118   Citrus sinensis [apfelsine]
ref|XP_006446933.1|  hypothetical protein CICLE_v10014123mg             371   3e-118   Citrus clementina [clementine]
ref|NP_001031878.1|  Glycosyl hydrolase family 38 protein               369   4e-118   Arabidopsis thaliana [mouse-ear cress]
ref|NP_196902.2|  Glycosyl hydrolase family 38 protein                  370   1e-117   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB11126.1|  alpha-mannosidase                                      369   2e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010039003.1|  PREDICTED: lysosomal alpha-mannosidase-like        367   5e-117   
gb|KCW48512.1|  hypothetical protein EUGRSUZ_K02195                     366   3e-116   Eucalyptus grandis [rose gum]
ref|XP_010682967.1|  PREDICTED: alpha-mannosidase-like                  365   7e-116   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB33198.1|  hypothetical protein B456_006G000300                    355   2e-115   Gossypium raimondii
ref|XP_006446930.1|  hypothetical protein CICLE_v10017635mg             353   5e-114   
gb|EPS72042.1|  alpha-mannosidase                                       358   6e-114   Genlisea aurea
ref|XP_007161616.1|  hypothetical protein PHAVU_001G084400g             345   3e-113   Phaseolus vulgaris [French bean]
gb|KJB33199.1|  hypothetical protein B456_006G000300                    355   5e-113   Gossypium raimondii
ref|XP_006844480.1|  hypothetical protein AMTR_s00016p00106660          357   5e-113   Amborella trichopoda
ref|XP_009412777.1|  PREDICTED: lysosomal alpha-mannosidase             357   6e-113   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010682958.1|  PREDICTED: alpha-mannosidase                       357   1e-112   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007032026.1|  Glycosyl hydrolase family 38 protein               357   1e-112   
gb|KJB33197.1|  hypothetical protein B456_006G000300                    356   2e-112   Gossypium raimondii
ref|XP_008670747.1|  PREDICTED: lysosomal alpha-mannosidase             356   2e-112   
ref|XP_010929675.1|  PREDICTED: alpha-mannosidase                       356   2e-112   Elaeis guineensis
ref|XP_002449583.1|  hypothetical protein SORBIDRAFT_05g019600          355   3e-112   Sorghum bicolor [broomcorn]
ref|XP_010663638.1|  PREDICTED: alpha-mannosidase                       356   3e-112   Vitis vinifera
ref|XP_009415849.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    355   4e-112   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK33593.1|  hypothetical protein AALP_AA5G034100                    355   4e-112   Arabis alpina [alpine rockcress]
ref|XP_009415848.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    355   5e-112   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008791035.1|  PREDICTED: lysosomal alpha-mannosidase             355   5e-112   Phoenix dactylifera
ref|XP_006468893.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    354   6e-112   Citrus sinensis [apfelsine]
ref|XP_010942369.1|  PREDICTED: alpha-mannosidase-like                  354   7e-112   Elaeis guineensis
ref|XP_003577519.1|  PREDICTED: lysosomal alpha-mannosidase-like        354   7e-112   Brachypodium distachyon [annual false brome]
gb|KHG00745.1|  Lysosomal alpha-mannosidase                             354   8e-112   Gossypium arboreum [tree cotton]
ref|XP_004979371.1|  PREDICTED: lysosomal alpha-mannosidase-like        354   1e-111   Setaria italica
emb|CBI15496.3|  unnamed protein product                                355   1e-111   Vitis vinifera
ref|XP_006468894.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    354   1e-111   
ref|XP_010660681.1|  PREDICTED: alpha-mannosidase                       353   2e-111   Vitis vinifera
ref|XP_010528132.1|  PREDICTED: lysosomal alpha-mannosidase             352   5e-111   Tarenaya hassleriana [spider flower]
tpg|DAA42034.1|  TPA: alpha-mannosidase                                 343   6e-111   
ref|XP_002512839.1|  lysosomal alpha-mannosidase, putative              352   7e-111   
ref|XP_010249229.1|  PREDICTED: lysosomal alpha-mannosidase-like        351   1e-110   Nelumbo nucifera [Indian lotus]
ref|XP_010514332.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    348   3e-110   Camelina sativa [gold-of-pleasure]
ref|XP_006604197.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    347   3e-110   
ref|XP_009152026.1|  PREDICTED: lysosomal alpha-mannosidase             350   4e-110   Brassica rapa
ref|XP_002875335.1|  glycosyl hydrolase family 38 protein               350   4e-110   
ref|XP_008379047.1|  PREDICTED: lysosomal alpha-mannosidase             349   6e-110   
ref|XP_011463212.1|  PREDICTED: alpha-mannosidase-like isoform X2       349   9e-110   Fragaria vesca subsp. vesca
dbj|BAH56863.1|  AT3G26720                                              347   9e-110   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001118706.1|  glycosyl hydrolase family 38 protein               347   9e-110   Arabidopsis thaliana [mouse-ear cress]
emb|CDX83641.1|  BnaC07g23810D                                          349   1e-109   
gb|EYU31875.1|  hypothetical protein MIMGU_mgv1a000658mg                349   1e-109   Erythranthe guttata [common monkey flower]
ref|XP_011463211.1|  PREDICTED: alpha-mannosidase-like isoform X1       349   1e-109   Fragaria vesca subsp. vesca
gb|AAL73068.1|AC090873_14  Putative alpha-mannosidase                   339   2e-109   Oryza sativa [red rice]
gb|AIX48006.1|  LMann protein                                           348   2e-109   synthetic construct
ref|NP_189306.1|  glycosyl hydrolase family 38 protein                  348   2e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010502611.1|  PREDICTED: lysosomal alpha-mannosidase-like        348   2e-109   Camelina sativa [gold-of-pleasure]
ref|XP_003624502.1|  Lysosomal alpha-mannosidase                        348   3e-109   Medicago truncatula
ref|XP_003553307.2|  PREDICTED: lysosomal alpha-mannosidase-like ...    348   3e-109   Glycine max [soybeans]
ref|XP_010425390.1|  PREDICTED: lysosomal alpha-mannosidase-like        348   3e-109   Camelina sativa [gold-of-pleasure]
ref|XP_010514333.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    348   3e-109   Camelina sativa [gold-of-pleasure]
dbj|BAJ95309.1|  predicted protein                                      347   4e-109   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006395530.1|  hypothetical protein EUTSA_v10003577mg             347   6e-109   Eutrema salsugineum [saltwater cress]
ref|XP_006290539.1|  hypothetical protein CARUB_v10016625mg             346   9e-109   Capsella rubella
ref|XP_008242061.1|  PREDICTED: lysosomal alpha-mannosidase             346   1e-108   Prunus mume [ume]
gb|EMS63584.1|  Lysosomal alpha-mannosidase                             349   1e-108   Triticum urartu
ref|XP_007214915.1|  hypothetical protein PRUPE_ppa000707mg             345   2e-108   Prunus persica
gb|KDP41856.1|  hypothetical protein JCGZ_26874                         345   2e-108   Jatropha curcas
ref|XP_004306319.1|  PREDICTED: alpha-mannosidase                       345   2e-108   Fragaria vesca subsp. vesca
ref|XP_009591889.1|  PREDICTED: lysosomal alpha-mannosidase-like        337   3e-108   Nicotiana tomentosiformis
gb|EPS72012.1|  hypothetical protein M569_02745                         345   3e-108   Genlisea aurea
ref|XP_004493076.1|  PREDICTED: lysosomal alpha-mannosidase-like        345   3e-108   Cicer arietinum [garbanzo]
ref|XP_011462234.1|  PREDICTED: alpha-mannosidase isoform X1            344   4e-108   Fragaria vesca subsp. vesca
ref|XP_011462239.1|  PREDICTED: alpha-mannosidase isoform X2            344   4e-108   Fragaria vesca subsp. vesca
ref|XP_003573734.1|  PREDICTED: lysosomal alpha-mannosidase             344   5e-108   Brachypodium distachyon [annual false brome]
ref|XP_010040832.1|  PREDICTED: lysosomal alpha-mannosidase-like        333   5e-108   Eucalyptus grandis [rose gum]
tpg|DAA42033.1|  TPA: alpha-mannosidase                                 344   7e-108   
ref|XP_008231240.1|  PREDICTED: lysosomal alpha-mannosidase             344   7e-108   Prunus mume [ume]
ref|XP_006665027.1|  PREDICTED: lysosomal alpha-mannosidase-like        343   7e-108   Oryza brachyantha
ref|XP_010246823.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    343   9e-108   Nelumbo nucifera [Indian lotus]
ref|XP_004983404.1|  PREDICTED: lysosomal alpha-mannosidase-like        343   1e-107   Setaria italica
gb|ABG65906.1|  glycosyl hydrolase family 38 protein, putative, e...    340   1e-107   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010246825.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    343   1e-107   Nelumbo nucifera [Indian lotus]
gb|EYU30803.1|  hypothetical protein MIMGU_mgv1a000690mg                343   1e-107   Erythranthe guttata [common monkey flower]
ref|XP_007203420.1|  hypothetical protein PRUPE_ppa021513mg             342   2e-107   
gb|ABG22500.1|  Glycosyl hydrolases family 38 protein, expressed        342   2e-107   Oryza sativa Japonica Group [Japonica rice]
gb|EEC68272.1|  hypothetical protein OsI_36309                          342   3e-107   Oryza sativa Indica Group [Indian rice]
ref|NP_001067993.1|  Os11g0525600                                       342   3e-107   
gb|AIX48013.1|  LMann protein                                           339   3e-107   synthetic construct
ref|XP_006830303.1|  hypothetical protein AMTR_s00121p00111530          341   4e-107   
ref|XP_006573549.1|  PREDICTED: lysosomal alpha-mannosidase-like        342   4e-107   Glycine max [soybeans]
ref|XP_009759741.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    341   5e-107   Nicotiana sylvestris
gb|KJB17633.1|  hypothetical protein B456_003G008600                    339   6e-107   Gossypium raimondii
ref|XP_002530831.1|  lysosomal alpha-mannosidase, putative              338   7e-107   
ref|XP_009759740.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    341   7e-107   Nicotiana sylvestris
gb|KHN36022.1|  Lysosomal alpha-mannosidase                             342   7e-107   Glycine soja [wild soybean]
ref|XP_006661627.1|  PREDICTED: lysosomal alpha-mannosidase-like        339   1e-106   
gb|EEC66555.1|  hypothetical protein OsI_32713                          340   1e-106   Oryza sativa Indica Group [Indian rice]
ref|NP_001064140.1|  Os10g0140200                                       340   1e-106   
gb|KHG14504.1|  Lysosomal alpha-mannosidase                             340   1e-106   Gossypium arboreum [tree cotton]
gb|KJB17632.1|  hypothetical protein B456_003G008600                    340   2e-106   Gossypium raimondii
ref|XP_008440841.1|  PREDICTED: lysosomal alpha-mannosidase             339   3e-106   Cucumis melo [Oriental melon]
gb|KCW64296.1|  hypothetical protein EUGRSUZ_G01931                     337   6e-106   Eucalyptus grandis [rose gum]
ref|XP_008788433.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    338   7e-106   
gb|KCW53179.1|  hypothetical protein EUGRSUZ_J024562                    335   8e-106   Eucalyptus grandis [rose gum]
ref|XP_011099865.1|  PREDICTED: alpha-mannosidase                       338   8e-106   Sesamum indicum [beniseed]
ref|XP_010034700.1|  PREDICTED: lysosomal alpha-mannosidase-like        335   1e-105   
ref|XP_004135022.1|  PREDICTED: lysosomal alpha-mannosidase-like        338   1e-105   Cucumis sativus [cucumbers]
ref|XP_008354644.1|  PREDICTED: lysosomal alpha-mannosidase-like        338   1e-105   
ref|XP_004158902.1|  PREDICTED: lysosomal alpha-mannosidase-like        337   1e-105   
gb|KDP43185.1|  hypothetical protein JCGZ_22737                         337   2e-105   Jatropha curcas
ref|XP_011008830.1|  PREDICTED: alpha-mannosidase isoform X2            336   2e-105   Populus euphratica
ref|XP_006380603.1|  hypothetical protein POPTR_0007s09730g             337   3e-105   Populus trichocarpa [western balsam poplar]
ref|XP_010066409.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal al...    337   3e-105   
ref|XP_011008829.1|  PREDICTED: alpha-mannosidase isoform X1            336   4e-105   Populus euphratica
gb|KCW53178.1|  hypothetical protein EUGRSUZ_J02455                     331   5e-105   Eucalyptus grandis [rose gum]
ref|XP_007157901.1|  hypothetical protein PHAVU_002G1073000g            329   5e-105   Phaseolus vulgaris [French bean]
ref|XP_007046660.1|  Fatty acid hydroxylase superfamily isoform 2       335   7e-105   
ref|XP_007046659.1|  Glycosyl hydrolase family 38 protein isoform 1     336   7e-105   
ref|XP_008788432.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    335   1e-104   
emb|CDP01879.1|  unnamed protein product                                335   1e-104   Coffea canephora [robusta coffee]
ref|XP_008337530.1|  PREDICTED: lysosomal alpha-mannosidase             333   2e-104   
ref|XP_009379376.1|  PREDICTED: lysosomal alpha-mannosidase-like        335   2e-104   
ref|XP_010920133.1|  PREDICTED: alpha-mannosidase-like                  334   2e-104   Elaeis guineensis
ref|XP_010113332.1|  Lysosomal alpha-mannosidase                        334   2e-104   Morus notabilis
ref|XP_009379379.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    334   3e-104   
gb|AIX48017.1|  LMann protein                                           333   3e-104   synthetic construct
ref|XP_009379378.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    334   3e-104   Pyrus x bretschneideri [bai li]
ref|XP_011024751.1|  PREDICTED: alpha-mannosidase isoform X1            334   3e-104   Populus euphratica
ref|XP_008354624.1|  PREDICTED: lysosomal alpha-mannosidase-like        334   3e-104   
dbj|BAJ94660.1|  predicted protein                                      333   4e-104   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002265360.1|  PREDICTED: alpha-mannosidase                       333   4e-104   Vitis vinifera
ref|XP_007156173.1|  hypothetical protein PHAVU_003G264400g             333   4e-104   Phaseolus vulgaris [French bean]
ref|XP_010920132.1|  PREDICTED: alpha-mannosidase-like                  333   5e-104   
gb|EMS46456.1|  Lysosomal alpha-mannosidase                             334   5e-104   Triticum urartu
gb|EMT01931.1|  Lysosomal alpha-mannosidase                             334   6e-104   
ref|XP_008659412.1|  PREDICTED: lysosomal alpha-mannosidase-like        333   7e-104   Zea mays [maize]
ref|XP_003577518.1|  PREDICTED: lysosomal alpha-mannosidase-like        333   7e-104   
gb|KCW53177.1|  hypothetical protein EUGRSUZ_J02455                     332   1e-103   Eucalyptus grandis [rose gum]
ref|XP_010033509.1|  PREDICTED: lysosomal alpha-mannosidase-like        332   1e-103   
ref|XP_010040831.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal al...    332   1e-103   
ref|XP_011098969.1|  PREDICTED: alpha-mannosidase                       332   2e-103   Sesamum indicum [beniseed]
ref|XP_004232502.1|  PREDICTED: lysosomal alpha-mannosidase             332   2e-103   Solanum lycopersicum
ref|XP_010034699.1|  PREDICTED: lysosomal alpha-mannosidase-like        332   2e-103   
ref|XP_002464752.1|  hypothetical protein SORBIDRAFT_01g026390          332   2e-103   Sorghum bicolor [broomcorn]
emb|CDP16739.1|  unnamed protein product                                330   3e-103   Coffea canephora [robusta coffee]
ref|XP_006340752.1|  PREDICTED: lysosomal alpha-mannosidase-like        330   6e-103   Solanum tuberosum [potatoes]
gb|ABY83271.1|  alpha-mannosidase                                       330   8e-103   Solanum lycopersicum
tpg|DAA46691.1|  TPA: hypothetical protein ZEAMMB73_463862              323   9e-103   
ref|XP_002464754.1|  hypothetical protein SORBIDRAFT_01g026405          326   4e-102   
emb|CAN65410.1|  hypothetical protein VITISV_040416                     336   4e-102   Vitis vinifera
gb|EMT01827.1|  Lysosomal alpha-mannosidase                             327   2e-101   
gb|AIX48008.1|  LMann protein                                           326   2e-101   synthetic construct
ref|XP_003629280.1|  Lysosomal alpha-mannosidase                        327   2e-101   
gb|AIX48011.1|  LMann protein                                           326   2e-101   synthetic construct
ref|XP_004289082.1|  PREDICTED: alpha-mannosidase-like isoform X2       326   2e-101   Fragaria vesca subsp. vesca
ref|XP_003548841.1|  PREDICTED: lysosomal alpha-mannosidase-like        326   3e-101   Glycine max [soybeans]
ref|XP_011462206.1|  PREDICTED: alpha-mannosidase-like isoform X1       326   4e-101   Fragaria vesca subsp. vesca
ref|XP_008659401.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    323   5e-101   
ref|XP_002301760.2|  glycosyl hydrolase family 38 family protein        325   5e-101   Populus trichocarpa [western balsam poplar]
gb|KDO71257.1|  hypothetical protein CISIN_1g001850mg                   320   7e-101   Citrus sinensis [apfelsine]
ref|XP_010033508.1|  PREDICTED: lysosomal alpha-mannosidase-like        324   1e-100   
ref|XP_010679912.1|  PREDICTED: alpha-mannosidase isoform X2            324   1e-100   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010679911.1|  PREDICTED: alpha-mannosidase isoform X1            324   2e-100   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009386958.1|  PREDICTED: lysosomal alpha-mannosidase             323   2e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008659396.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    323   3e-100   
ref|XP_008659385.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    323   4e-100   Zea mays [maize]
ref|XP_006466975.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    322   4e-100   Citrus sinensis [apfelsine]
gb|KDO71258.1|  hypothetical protein CISIN_1g001850mg                   322   4e-100   Citrus sinensis [apfelsine]
ref|XP_008659379.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    323   5e-100   Zea mays [maize]
tpg|DAA46680.1|  TPA: hypothetical protein ZEAMMB73_299553              317   8e-100   
gb|KDO71256.1|  hypothetical protein CISIN_1g001850mg                   322   8e-100   Citrus sinensis [apfelsine]
gb|KDO71255.1|  hypothetical protein CISIN_1g001850mg                   322   9e-100   Citrus sinensis [apfelsine]
ref|XP_006466974.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    322   1e-99    Citrus sinensis [apfelsine]
ref|XP_006425430.1|  hypothetical protein CICLE_v10024800mg             320   1e-99    
ref|XP_004509374.1|  PREDICTED: lysosomal alpha-mannosidase-like        322   1e-99    Cicer arietinum [garbanzo]
sp|C0HJB3.1|MANA_CANEN  RecName: Full=Alpha-mannosidase; Short=JB...    321   1e-99    Canavalia ensiformis [horse bean]
ref|XP_006425431.1|  hypothetical protein CICLE_v10024800mg             320   3e-99    
ref|XP_009339045.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    320   4e-99    
ref|XP_010096029.1|  Lysosomal alpha-mannosidase                        301   6e-99    
gb|KDO43590.1|  hypothetical protein CISIN_1g0150282mg                  298   7e-99    
ref|XP_003520192.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    318   2e-98    
gb|KHN00464.1|  Lysosomal alpha-mannosidase                             318   2e-98    
ref|XP_008658145.1|  PREDICTED: uncharacterized protein LOC100193...    317   6e-98    
gb|KCW53175.1|  hypothetical protein EUGRSUZ_J02454                     317   8e-98    
gb|KCW44883.1|  hypothetical protein EUGRSUZ_L01537                     309   5e-96    
ref|XP_008348155.1|  PREDICTED: lysosomal alpha-mannosidase-like        297   4e-95    
gb|KCW53184.1|  hypothetical protein EUGRSUZ_J02460                     308   7e-95    
ref|XP_010478748.1|  PREDICTED: lysosomal alpha-mannosidase-like        305   3e-93    
ref|NP_201416.1|  Glycosyl hydrolase family protein                     304   6e-93    
ref|XP_006279760.1|  hypothetical protein CARUB_v10027738mg             304   6e-93    
ref|XP_002975348.1|  hypothetical protein SELMODRAFT_103066             302   1e-92    
gb|KFK28275.1|  hypothetical protein AALP_AA8G495400                    303   2e-92    
emb|CDX81409.1|  BnaC09g08200D                                          303   3e-92    
ref|XP_002964449.1|  hypothetical protein SELMODRAFT_266756             302   3e-92    
ref|XP_009112282.1|  PREDICTED: lysosomal alpha-mannosidase             302   4e-92    
ref|XP_010444832.1|  PREDICTED: lysosomal alpha-mannosidase-like        301   6e-92    
ref|XP_008788431.1|  PREDICTED: lysosomal alpha-mannosidase-like        300   8e-92    
ref|XP_002865084.1|  glycosyl hydrolase family 38 protein               300   1e-91    
emb|CDY18591.1|  BnaA09g08040D                                          301   2e-91    
ref|XP_006393801.1|  hypothetical protein EUTSA_v10003575mg             297   2e-90    
ref|XP_008790936.1|  PREDICTED: uncharacterized protein LOC103707976    283   6e-89    
ref|XP_011024752.1|  PREDICTED: alpha-mannosidase isoform X2            286   2e-87    
gb|ABG65905.1|  glycosyl hydrolase family 38 protein, putative, e...    279   5e-85    
ref|XP_001770740.1|  predicted protein                                  277   3e-83    
ref|XP_002984653.1|  hypothetical protein SELMODRAFT_120549             275   4e-82    
ref|XP_002980507.1|  hypothetical protein SELMODRAFT_178241             273   1e-81    
ref|XP_010096026.1|  Lysosomal alpha-mannosidase                        265   3e-79    
ref|XP_008367098.1|  PREDICTED: lysosomal alpha-mannosidase-like        250   2e-77    
ref|XP_002973911.1|  hypothetical protein SELMODRAFT_100184             259   8e-77    
ref|XP_002969151.1|  hypothetical protein SELMODRAFT_410022             258   1e-76    
gb|KCW53182.1|  hypothetical protein EUGRSUZ_J02459                     250   1e-73    
gb|KCW53183.1|  hypothetical protein EUGRSUZ_J02459                     249   2e-73    
ref|XP_001765541.1|  predicted protein                                  250   3e-73    
ref|XP_004364138.2|  lysosomal alpha-mannosidase                        245   1e-71    
gb|KCW53181.1|  hypothetical protein EUGRSUZ_J02457                     232   3e-69    
ref|XP_002154447.2|  PREDICTED: lysosomal alpha-mannosidase-like        230   4e-68    
ref|XP_009841571.1|  hypothetical protein H257_15245                    233   2e-67    
gb|AIG56315.1|  secreted protein                                        231   9e-67    
ref|XP_005647297.1|  glycosyl hydrolase family 38 protein               229   3e-66    
ref|XP_008619219.1|  hypothetical protein SDRG_14840                    229   5e-66    
emb|CAN60239.1|  hypothetical protein VITISV_032907                     228   6e-66    
ref|XP_009524399.1|  hypothetical protein PHYSODRAFT_360129             228   2e-65    
gb|ETM47126.1|  hypothetical protein L914_08112                         226   6e-65    
gb|ETL40750.1|  hypothetical protein L916_08150                         226   6e-65    
gb|ETP45208.1|  hypothetical protein F442_08332                         226   6e-65    
gb|ETK87322.1|  hypothetical protein L915_08226                         226   6e-65    
ref|XP_008905169.1|  hypothetical protein PPTG_11759                    226   6e-65    
gb|ETI47384.1|  hypothetical protein F443_08394                         226   7e-65    
gb|ETL93896.1|  hypothetical protein L917_08049                         226   8e-65    
ref|XP_002902567.1|  lysosomal alpha-mannosidase, putative              225   1e-64    
gb|KFM58675.1|  Lysosomal alpha-mannosidase                             219   3e-64    
ref|XP_011410225.1|  PREDICTED: lysosomal alpha-mannosidase-like        222   5e-64    
ref|XP_009841570.1|  hypothetical protein H257_15244                    223   7e-64    
ref|XP_005826181.1|  hypothetical protein GUITHDRAFT_39786              220   5e-63    
ref|XP_008619476.1|  hypothetical protein SDRG_15092                    220   8e-63    
ref|XP_009841572.1|  hypothetical protein H257_15246                    219   1e-62    
emb|CCA13903.1|  lysosomal alphamannosidase putative                    219   1e-62    
gb|EFN69105.1|  Lysosomal alpha-mannosidase                             220   5e-62    
ref|XP_005952948.1|  PREDICTED: lysosomal alpha-mannosidase-like        209   5e-62    
gb|KDO22316.1|  hypothetical protein SPRG_12778                         217   1e-61    
gb|KDD73762.1|  glycosyl hydrolase                                      207   1e-61    
ref|XP_002112124.1|  hypothetical protein TRIADDRAFT_63890              217   1e-61    
ref|XP_011410223.1|  PREDICTED: lysosomal alpha-mannosidase-like        218   3e-61    
ref|XP_001629647.1|  predicted protein                                  216   3e-61    
emb|CCI41300.1|  unnamed protein product                                216   5e-61    
gb|EFN88812.1|  Lysosomal alpha-mannosidase                             215   6e-61    
ref|XP_011151273.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    215   7e-61    
ref|XP_008863300.1|  hypothetical protein H310_01796                    214   1e-60    
ref|XP_011402718.1|  PREDICTED: lysosomal alpha-mannosidase-like        213   2e-60    
ref|XP_011406170.1|  PREDICTED: lysosomal alpha-mannosidase-like        213   2e-60    
ref|XP_011348312.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    213   2e-60    
ref|XP_011398636.1|  Lysosomal alpha-mannosidase                        213   3e-60    
ref|XP_005458747.1|  PREDICTED: lysosomal alpha-mannosidase-like        213   4e-60    
ref|XP_011151265.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    212   7e-60    
ref|XP_007230057.1|  PREDICTED: lysosomal alpha-mannosidase-like        210   3e-59    
ref|XP_009841568.1|  hypothetical protein H257_15242                    210   3e-59    
ref|XP_007549783.1|  PREDICTED: lysosomal alpha-mannosidase             210   3e-59    
ref|XP_008434162.1|  PREDICTED: lysosomal alpha-mannosidase             210   4e-59    
ref|XP_002613686.1|  hypothetical protein BRAFLDRAFT_287967             208   6e-59    
gb|KDO19426.1|  hypothetical protein SPRG_15416                         209   7e-59    
emb|CBJ29183.1|  Alpha-mannosidase, family GH38                         211   7e-59    
ref|XP_006809006.1|  PREDICTED: lysosomal alpha-mannosidase-like        208   1e-58    
ref|WP_028833383.1|  hypothetical protein                               209   1e-58    
ref|XP_011348313.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    208   2e-58    
ref|XP_003972325.1|  PREDICTED: lysosomal alpha-mannosidase-like        207   4e-58    
ref|XP_008863299.1|  hypothetical protein H310_01795                    206   9e-58    
ref|XP_011068620.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    206   1e-57    
ref|XP_003704456.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal al...    207   2e-57    
ref|XP_011454670.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    203   1e-56    
ref|XP_011176166.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    203   1e-56    
ref|XP_011454669.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    202   2e-56    
ref|XP_006631611.1|  PREDICTED: lysosomal alpha-mannosidase-like        201   2e-56    
ref|NP_001014354.1|  lysosomal alpha-mannosidase precursor              202   2e-56    
ref|XP_005169420.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    202   3e-56    
ref|XP_004084261.1|  PREDICTED: lysosomal alpha-mannosidase             202   3e-56    
ref|XP_010765760.1|  PREDICTED: lysosomal alpha-mannosidase             188   5e-56    
ref|XP_009858813.1|  PREDICTED: lysosomal alpha-mannosidase-like        201   5e-56    
gb|EFX61897.1|  hypothetical protein DAPPUDRAFT_337859                  199   5e-56    
ref|XP_011181146.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    202   5e-56    
gb|EFX74109.1|  hypothetical protein DAPPUDRAFT_324591                  200   1e-55    
ref|XP_006567380.1|  PREDICTED: lysosomal alpha-mannosidase-like        202   1e-55    
gb|ELT89240.1|  hypothetical protein CAPTEDRAFT_151096                  201   1e-55    
gb|EYU24519.1|  hypothetical protein MIMGU_mgv1a0008522mg               198   1e-55    
gb|EFX74192.1|  hypothetical protein DAPPUDRAFT_324586                  199   2e-55    
ref|XP_003694691.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal al...    201   2e-55    
gb|EMS68466.1|  Lysosomal alpha-mannosidase                             186   5e-55    
ref|XP_011212265.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal al...    199   5e-55    
ref|XP_011068619.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    198   6e-55    
ref|XP_006619768.1|  PREDICTED: lysosomal alpha-mannosidase-like        200   6e-55    
ref|XP_005002974.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    198   7e-55    
gb|KDO33515.1|  hypothetical protein SPRG_19152                         197   9e-55    
gb|EKC30993.1|  Lysosomal alpha-mannosidase                             198   9e-55    
ref|XP_005189989.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    198   1e-54    
gb|AIX48009.1|  LMann protein                                           197   1e-54    
ref|XP_005002973.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    197   1e-54    
ref|NP_001244175.1|  lysosomal alpha-mannosidase precursor              197   1e-54    
sp|Q8VHC8.1|MA2B1_CAVPO  RecName: Full=Lysosomal alpha-mannosidas...    197   1e-54    
ref|XP_011181145.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    198   2e-54    
ref|XP_008197048.1|  PREDICTED: lysosomal alpha-mannosidase-like        197   3e-54    
ref|XP_004534401.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    197   4e-54    
ref|XP_002065049.1|  GK14884                                            196   5e-54    
gb|EFA84943.1|  alpha-mannosidase                                       196   5e-54    
ref|XP_005994396.1|  PREDICTED: lysosomal alpha-mannosidase-like        196   5e-54    
ref|XP_005815985.1|  PREDICTED: lysosomal alpha-mannosidase-like        195   8e-54    
ref|XP_011300933.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    195   9e-54    
ref|XP_011176167.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    195   9e-54    
gb|EFZ21090.1|  hypothetical protein SINV_11995                         195   9e-54    
ref|XP_011255119.1|  PREDICTED: lysosomal alpha-mannosidase-like        195   1e-53    
ref|XP_004534400.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    196   1e-53    
ref|XP_002088231.1|  GE18464                                            194   1e-53    
ref|XP_008550968.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    194   1e-53    
ref|XP_005381071.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    194   2e-53    
ref|XP_001603702.2|  PREDICTED: lysosomal alpha-mannosidase-like ...    194   2e-53    
dbj|GAM19522.1|  hypothetical protein SAMD00019534_026970               194   2e-53    
ref|XP_008251421.1|  PREDICTED: lysosomal alpha-mannosidase             190   2e-53    
ref|XP_001747563.1|  hypothetical protein                               196   3e-53    
ref|XP_005381070.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    194   3e-53    
gb|AAL58983.1|  lysosomal alpha-mannosidase                             194   3e-53    
ref|XP_004339151.1|  lysosomal alphamannosidase                         193   5e-53    
ref|XP_009459998.1|  PREDICTED: lysosomal alpha-mannosidase             192   6e-53    
gb|EFX74108.1|  hypothetical protein DAPPUDRAFT_252189                  192   6e-53    
ref|XP_795985.3|  PREDICTED: lysosomal alpha-mannosidase-like           194   7e-53    
gb|ENN79713.1|  hypothetical protein YQE_03769                          191   8e-53    
ref|XP_011402719.1|  PREDICTED: lysosomal alpha-mannosidase-like        189   9e-53    
ref|XP_001963136.1|  GF15795                                            192   9e-53    
ref|XP_010871017.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    191   1e-52    
ref|XP_005189988.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    192   1e-52    
ref|NP_001072469.1|  lysosomal alpha-mannosidase precursor              192   1e-52    
ref|XP_001993059.1|  GH13617                                            192   1e-52    
ref|XP_005095526.1|  PREDICTED: lysosomal alpha-mannosidase-like        192   1e-52    
gb|ERL83857.1|  hypothetical protein D910_01124                         191   2e-52    
gb|ERL84262.1|  hypothetical protein D910_01643                         191   2e-52    
ref|XP_010737172.1|  PREDICTED: lysosomal alpha-mannosidase             191   2e-52    
emb|CDQ91797.1|  unnamed protein product                                189   2e-52    
gb|ENN79712.1|  hypothetical protein YQE_03769                          191   2e-52    
emb|CAG12505.1|  unnamed protein product                                191   2e-52    
ref|XP_010871016.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    191   2e-52    
ref|NP_609408.1|  lysosomal alpha-mannosidase, isoform A                191   3e-52    
ref|XP_004635625.1|  PREDICTED: lysosomal alpha-mannosidase             191   3e-52    
ref|NP_723591.1|  lysosomal alpha-mannosidase, isoform B                191   3e-52    
ref|XP_004903043.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    191   3e-52    
ref|XP_011409910.1|  PREDICTED: lysosomal alpha-mannosidase-like        190   4e-52    
gb|AFU74027.1|  lysosomal alpha-mannosidase                             190   4e-52    
gb|EFX83792.1|  hypothetical protein DAPPUDRAFT_315529                  190   4e-52    
ref|XP_004872425.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    191   4e-52    
ref|XP_004574500.1|  PREDICTED: lysosomal alpha-mannosidase-like        189   4e-52    
gb|EKC30994.1|  Lysosomal alpha-mannosidase                             190   4e-52    
dbj|GAM29188.1|  hypothetical protein SAMD00019534_123640               190   5e-52    
ref|XP_002078969.1|  GD23708                                            191   5e-52    
ref|XP_011454672.1|  PREDICTED: lysosomal alpha-mannosidase-like        190   5e-52    
gb|KDR11229.1|  Lysosomal alpha-mannosidase                             190   6e-52    
gb|ETN75226.1|  glycosyl hydrolase family 38 protein                    184   6e-52    
ref|XP_004903042.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    190   6e-52    
ref|XP_011498322.1|  PREDICTED: lysosomal alpha-mannosidase             190   6e-52    
ref|XP_004872424.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    190   6e-52    
ref|XP_004595785.1|  PREDICTED: lysosomal alpha-mannosidase-like        190   7e-52    
ref|XP_004993041.1|  hypothetical protein PTSG_06149                    190   1e-51    
ref|XP_004872421.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    190   1e-51    
ref|XP_008287607.1|  PREDICTED: lysosomal alpha-mannosidase             189   1e-51    
ref|XP_011300932.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    189   1e-51    
ref|XP_007667532.1|  PREDICTED: lysosomal alpha-mannosidase             188   1e-51    
ref|XP_003798074.1|  PREDICTED: lysosomal alpha-mannosidase             189   1e-51    
ref|XP_003426403.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    189   1e-51    
ref|XP_009009340.1|  hypothetical protein HELRODRAFT_187930             187   2e-51    
ref|XP_008471080.1|  PREDICTED: lysosomal alpha-mannosidase-like        182   3e-51    
ref|XP_003291027.1|  hypothetical protein DICPUDRAFT_49593              188   3e-51    
ref|XP_009035858.1|  hypothetical protein AURANDRAFT_53176              187   3e-51    
ref|XP_008664616.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    178   4e-51    
ref|XP_002014313.1|  GL19134                                            187   5e-51    
ref|XP_006262828.1|  PREDICTED: lysosomal alpha-mannosidase             187   5e-51    
gb|KFO19493.1|  Lysosomal alpha-mannosidase                             187   6e-51    
ref|XP_008664617.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    177   6e-51    
ref|XP_010611649.1|  PREDICTED: lysosomal alpha-mannosidase             187   8e-51    
ref|XP_629747.1|  hypothetical protein DDB_G0292206                     187   1e-50    
gb|AIX48007.1|  LMann protein                                           186   1e-50    
gb|AAA33224.1|  alpha-mannosidase                                       186   1e-50    
ref|XP_008550966.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    186   1e-50    
ref|XP_005768184.1|  alpha mannosidase                                  185   1e-50    
ref|XP_005761183.1|  glycosyl hydrolase                                 185   2e-50    
ref|XP_004358367.1|  alpha-mannosidase                                  186   2e-50    
ref|XP_968596.1|  PREDICTED: lysosomal alpha-mannosidase                186   2e-50    
ref|XP_002051141.1|  GJ13861                                            186   2e-50    
ref|XP_008047242.1|  PREDICTED: lysosomal alpha-mannosidase             185   3e-50    
ref|XP_002065051.1|  GK14881                                            185   3e-50    
ref|XP_010591811.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal al...    185   3e-50    
ref|XP_009064562.1|  hypothetical protein LOTGIDRAFT_207233             185   3e-50    
gb|KHJ99633.1|  glycosyl hydrolase family 38 protein                    182   4e-50    
gb|EHB14492.1|  Lysosomal alpha-mannosidase                             185   4e-50    
ref|XP_004616845.1|  PREDICTED: lysosomal alpha-mannosidase             185   5e-50    
ref|XP_004672474.1|  PREDICTED: lysosomal alpha-mannosidase             179   8e-50    
ref|XP_006812780.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal al...    183   8e-50    
ref|XP_007421016.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    184   8e-50    
ref|XP_007421015.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    184   1e-49    
ref|XP_005900576.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    184   1e-49    
ref|XP_003225254.1|  PREDICTED: lysosomal alpha-mannosidase             184   1e-49    
ref|XP_006819382.1|  PREDICTED: lysosomal alpha-mannosidase-like        171   2e-49    
ref|XP_006041660.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    183   2e-49    
ref|XP_001962608.1|  GF14351                                            183   2e-49    
gb|EPQ17228.1|  Lysosomal alpha-mannosidase                             182   2e-49    



>ref|XP_009591416.1| PREDICTED: lysosomal alpha-mannosidase-like [Nicotiana tomentosiformis]
Length=1029

 Score =   400 bits (1027),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFNVTPRIGWQIDPFGHSAVQAYLLG EVGFDSL+FGRIDYQDRAKRK EKSLEV+WR 
Sbjct  158  EQFNVTPRIGWQIDPFGHSAVQAYLLGTEVGFDSLFFGRIDYQDRAKRKIEKSLEVIWRG  217

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSLG+S+QIFAGAFPENYEPPS FYFEVNDDSP VQDD +LFDYNV ERVNDFVAAALS
Sbjct  218  SKSLGSSTQIFAGAFPENYEPPSRFYFEVNDDSPPVQDDVNLFDYNVQERVNDFVAAALS  277

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDFKYQYAH+WFRN+DKLIHYVNQDGRVNALYSTPSIYTDAK+A 
Sbjct  278  QANITRTNHIMWTMGTDFKYQYAHTWFRNMDKLIHYVNQDGRVNALYSTPSIYTDAKHAL  337

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            D+SWPLKT+DYFPYADR NAYWTGYF
Sbjct  338  DKSWPLKTDDYFPYADRINAYWTGYF  363



>ref|XP_009775244.1| PREDICTED: lysosomal alpha-mannosidase-like [Nicotiana sylvestris]
Length=1029

 Score =   399 bits (1024),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFNVTPRIGWQIDPFGHSAVQAYLLG EVGFDSL+FGRIDYQDRAKRK EKSLEV+WR 
Sbjct  158  EQFNVTPRIGWQIDPFGHSAVQAYLLGTEVGFDSLFFGRIDYQDRAKRKIEKSLEVIWRG  217

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSLG+S+QIFAGAFPENYEPPS FYFEVNDDSP VQDD +LFDYNV ERVNDFVAAALS
Sbjct  218  SKSLGSSTQIFAGAFPENYEPPSRFYFEVNDDSPPVQDDVNLFDYNVQERVNDFVAAALS  277

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDFKYQYAH+WFRN+DKLIHYVNQDGRVNALYS+PSIYTDAK+A 
Sbjct  278  QANITRTNHIMWTMGTDFKYQYAHTWFRNMDKLIHYVNQDGRVNALYSSPSIYTDAKHAL  337

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            D+SWPLKT+DYFPYADR NAYWTGYF
Sbjct  338  DESWPLKTDDYFPYADRINAYWTGYF  363



>gb|KJB19727.1| hypothetical protein B456_003G116600 [Gossypium raimondii]
Length=879

 Score =   392 bits (1006),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 177/206 (86%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++FN+TPRIGWQIDPFGHSAVQAYLL AEVGFDSL+F RIDYQDRAKRK +KSLEVVWR 
Sbjct  27   REFNITPRIGWQIDPFGHSAVQAYLLSAEVGFDSLFFARIDYQDRAKRKDQKSLEVVWRG  86

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSLG+SSQIFAGAFPENYEPPS FY+EVNDDSP+VQD+ +LFDYNVP+RVN+FVAAA S
Sbjct  87   SKSLGSSSQIFAGAFPENYEPPSNFYYEVNDDSPIVQDNMELFDYNVPQRVNEFVAAAFS  146

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNHVMWTMGTDFKYQYAH+WFR +DK IHYVNQDGRVNALYSTPSIYTDAKYA+
Sbjct  147  QANITRTNHVMWTMGTDFKYQYAHTWFRQMDKFIHYVNQDGRVNALYSTPSIYTDAKYAT  206

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            +++WPLKT+DYFPYADR NAYWTGYF
Sbjct  207  NEAWPLKTDDYFPYADRINAYWTGYF  232



>ref|XP_007038135.1| Glycosyl hydrolase family 38 protein isoform 4 [Theobroma cacao]
 gb|EOY22636.1| Glycosyl hydrolase family 38 protein isoform 4 [Theobroma cacao]
Length=756

 Score =   388 bits (997),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 178/205 (87%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +FNVTPRIGWQIDPFGHSAVQAYLL AEVGFDSL+F RIDYQDRAKRK EKSLEVVWR S
Sbjct  156  EFNVTPRIGWQIDPFGHSAVQAYLLSAEVGFDSLFFARIDYQDRAKRKDEKSLEVVWRGS  215

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            KSLG+SSQIFAG FPENY+PPS F +EVNDDSP+VQD+ +LFDYNVPERVN+FVAAALSQ
Sbjct  216  KSLGSSSQIFAGVFPENYDPPSNFNYEVNDDSPIVQDNMELFDYNVPERVNEFVAAALSQ  275

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            ANITRTNHVMWTMGTDFKYQYAH+WFR +DK IHYVNQDGRVNALYSTPSIYTDAKYA++
Sbjct  276  ANITRTNHVMWTMGTDFKYQYAHTWFRQMDKFIHYVNQDGRVNALYSTPSIYTDAKYATN  335

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            ++WPLKT+DYFPYADR NAYWTGYF
Sbjct  336  KAWPLKTDDYFPYADRINAYWTGYF  360



>gb|KHG03548.1| Lysosomal alpha-mannosidase [Gossypium arboreum]
Length=997

 Score =   394 bits (1012),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 179/206 (87%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++FN+TPRIGWQIDPFGHSAVQAYLL AEVGFDSL+F RIDYQDRAKRK EKSLEVVWR 
Sbjct  153  REFNITPRIGWQIDPFGHSAVQAYLLSAEVGFDSLFFARIDYQDRAKRKDEKSLEVVWRG  212

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSLG+SSQIFAGAFPENYEPPS FY+EVNDDSP+VQD+ +LFDYNVP+RVN+FVAAALS
Sbjct  213  SKSLGSSSQIFAGAFPENYEPPSNFYYEVNDDSPIVQDNMELFDYNVPQRVNEFVAAALS  272

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNHVMWTMGTDFKYQYAH+WFR +DK IHYVNQDGRVNALYSTPSIYTDAKYA+
Sbjct  273  QANITRTNHVMWTMGTDFKYQYAHTWFRQMDKFIHYVNQDGRVNALYSTPSIYTDAKYAT  332

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            +++WPLKT+DYFPYADR NAYWTGYF
Sbjct  333  NEAWPLKTDDYFPYADRINAYWTGYF  358



>ref|XP_007038136.1| Glycosyl hydrolase family 38 protein isoform 5 [Theobroma cacao]
 gb|EOY22637.1| Glycosyl hydrolase family 38 protein isoform 5 [Theobroma cacao]
Length=765

 Score =   388 bits (997),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 178/205 (87%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +FNVTPRIGWQIDPFGHSAVQAYLL AEVGFDSL+F RIDYQDRAKRK EKSLEVVWR S
Sbjct  156  EFNVTPRIGWQIDPFGHSAVQAYLLSAEVGFDSLFFARIDYQDRAKRKDEKSLEVVWRGS  215

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            KSLG+SSQIFAG FPENY+PPS F +EVNDDSP+VQD+ +LFDYNVPERVN+FVAAALSQ
Sbjct  216  KSLGSSSQIFAGVFPENYDPPSNFNYEVNDDSPIVQDNMELFDYNVPERVNEFVAAALSQ  275

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            ANITRTNHVMWTMGTDFKYQYAH+WFR +DK IHYVNQDGRVNALYSTPSIYTDAKYA++
Sbjct  276  ANITRTNHVMWTMGTDFKYQYAHTWFRQMDKFIHYVNQDGRVNALYSTPSIYTDAKYATN  335

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            ++WPLKT+DYFPYADR NAYWTGYF
Sbjct  336  KAWPLKTDDYFPYADRINAYWTGYF  360



>ref|XP_007161620.1| hypothetical protein PHAVU_001G084700g [Phaseolus vulgaris]
 gb|ESW33614.1| hypothetical protein PHAVU_001G084700g [Phaseolus vulgaris]
Length=1029

 Score =   393 bits (1010),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 178/206 (86%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F VTPRIGWQIDPFGHSAVQAYLLGAEVGFDSL+FGRIDYQDRAKRK EKSLEV+W+ 
Sbjct  166  EEFGVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLFFGRIDYQDRAKRKKEKSLEVIWQG  225

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSLG+SSQIFAGAFPENYEPPSGFYFEVND+SP+VQD+ +LFDYNV ERVNDFVAAALS
Sbjct  226  SKSLGSSSQIFAGAFPENYEPPSGFYFEVNDNSPIVQDNMELFDYNVQERVNDFVAAALS  285

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDFKYQYAH+WFR LDKLIHYVN+DGRVNALYSTPSIYTDAKYA+
Sbjct  286  QANITRTNHIMWTMGTDFKYQYAHTWFRQLDKLIHYVNKDGRVNALYSTPSIYTDAKYAT  345

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++ WP+KT+D+FPYADR N YWTGYF
Sbjct  346  NEYWPIKTDDFFPYADRANGYWTGYF  371



>ref|XP_007137859.1| hypothetical protein PHAVU_009G161600g [Phaseolus vulgaris]
 gb|ESW09853.1| hypothetical protein PHAVU_009G161600g [Phaseolus vulgaris]
Length=730

 Score =   385 bits (989),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F VTPRIGWQIDPFGHSAVQAYLLGAEVGFDSL+FGRIDYQDRAKRK EK+LEVVWR 
Sbjct  158  EEFGVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLFFGRIDYQDRAKRKDEKTLEVVWRG  217

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKS G+SSQIF+GAFPENYEPPS FY+EVND+SP+VQDD  LFDYNVPERVN+FVAAA+S
Sbjct  218  SKSFGSSSQIFSGAFPENYEPPSNFYYEVNDNSPIVQDDVSLFDYNVPERVNEFVAAAIS  277

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNHVMWTMGTDFKYQYA SWFR +DK IHYVNQDGRV+ALYSTPSIYTDAK+A+
Sbjct  278  QANITRTNHVMWTMGTDFKYQYAQSWFRQMDKFIHYVNQDGRVHALYSTPSIYTDAKHAT  337

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            +++WP+KT+DYFPYADR NAYWTGYF
Sbjct  338  NEAWPIKTDDYFPYADRVNAYWTGYF  363



>gb|KJB19726.1| hypothetical protein B456_003G116600 [Gossypium raimondii]
Length=1008

 Score =   392 bits (1006),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 177/206 (86%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++FN+TPRIGWQIDPFGHSAVQAYLL AEVGFDSL+F RIDYQDRAKRK +KSLEVVWR 
Sbjct  156  REFNITPRIGWQIDPFGHSAVQAYLLSAEVGFDSLFFARIDYQDRAKRKDQKSLEVVWRG  215

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSLG+SSQIFAGAFPENYEPPS FY+EVNDDSP+VQD+ +LFDYNVP+RVN+FVAAA S
Sbjct  216  SKSLGSSSQIFAGAFPENYEPPSNFYYEVNDDSPIVQDNMELFDYNVPQRVNEFVAAAFS  275

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNHVMWTMGTDFKYQYAH+WFR +DK IHYVNQDGRVNALYSTPSIYTDAKYA+
Sbjct  276  QANITRTNHVMWTMGTDFKYQYAHTWFRQMDKFIHYVNQDGRVNALYSTPSIYTDAKYAT  335

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            +++WPLKT+DYFPYADR NAYWTGYF
Sbjct  336  NEAWPLKTDDYFPYADRINAYWTGYF  361



>ref|XP_011468215.1| PREDICTED: alpha-mannosidase isoform X2 [Fragaria vesca subsp. 
vesca]
Length=1000

 Score =   390 bits (1003),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 176/206 (85%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++FNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSL+FGRIDYQDR KRK EKSLE VWR 
Sbjct  155  REFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLFFGRIDYQDREKRKNEKSLEFVWRG  214

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSLG+S++IF+GAFPENYEPPSGFYFEVND SP+VQDD  LFDYNV ERVNDF+AAA+ 
Sbjct  215  SKSLGSSAEIFSGAFPENYEPPSGFYFEVNDPSPIVQDDITLFDYNVQERVNDFIAAAVK  274

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDFKYQYAH+WFR +DKLIHYVN+DGRVNALYSTPSIYTDAKYAS
Sbjct  275  QANITRTNHIMWTMGTDFKYQYAHTWFRQMDKLIHYVNKDGRVNALYSTPSIYTDAKYAS  334

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWP+KT+D+FPYADR NAYWTGYF
Sbjct  335  NESWPIKTDDFFPYADRINAYWTGYF  360



>ref|XP_007038134.1| Glycosyl hydrolase family 38 protein isoform 3 [Theobroma cacao]
 gb|EOY22635.1| Glycosyl hydrolase family 38 protein isoform 3 [Theobroma cacao]
Length=988

 Score =   390 bits (1001),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 178/205 (87%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +FNVTPRIGWQIDPFGHSAVQAYLL AEVGFDSL+F RIDYQDRAKRK EKSLEVVWR S
Sbjct  156  EFNVTPRIGWQIDPFGHSAVQAYLLSAEVGFDSLFFARIDYQDRAKRKDEKSLEVVWRGS  215

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            KSLG+SSQIFAG FPENY+PPS F +EVNDDSP+VQD+ +LFDYNVPERVN+FVAAALSQ
Sbjct  216  KSLGSSSQIFAGVFPENYDPPSNFNYEVNDDSPIVQDNMELFDYNVPERVNEFVAAALSQ  275

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            ANITRTNHVMWTMGTDFKYQYAH+WFR +DK IHYVNQDGRVNALYSTPSIYTDAKYA++
Sbjct  276  ANITRTNHVMWTMGTDFKYQYAHTWFRQMDKFIHYVNQDGRVNALYSTPSIYTDAKYATN  335

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            ++WPLKT+DYFPYADR NAYWTGYF
Sbjct  336  KAWPLKTDDYFPYADRINAYWTGYF  360



>ref|XP_008379739.1| PREDICTED: lysosomal alpha-mannosidase-like [Malus domestica]
Length=755

 Score =   383 bits (984),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 174/206 (84%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F+VTPRIGWQIDPFGHSAVQAYLLGAEVGFDSL+FGRIDYQDRAKRK EKSLE VWR 
Sbjct  156  REFDVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLFFGRIDYQDRAKRKIEKSLEFVWRG  215

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSL +S+QIF+GAFPENYEPPSGFYFEVND+SP+VQDD  LFDYNV +RVNDFVAAA++
Sbjct  216  SKSLSSSAQIFSGAFPENYEPPSGFYFEVNDNSPIVQDDITLFDYNVQDRVNDFVAAAVA  275

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDFKYQYA +WFR +DKLIHYVN+DGRVNALYSTPSIYTDAKYA+
Sbjct  276  QANITRTNHIMWTMGTDFKYQYAXTWFRQMDKLIHYVNKDGRVNALYSTPSIYTDAKYAT  335

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWP+KT+D+FPYADR NAYWTGYF
Sbjct  336  NESWPIKTDDFFPYADRTNAYWTGYF  361



>gb|KJB76312.1| hypothetical protein B456_012G082700 [Gossypium raimondii]
Length=907

 Score =   387 bits (993),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F VTPRIGWQIDPFGHSAVQAYLLGAEVGFDS +FGRIDYQDR KRK EKSLEV+WR 
Sbjct  154  EEFGVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSFFFGRIDYQDRIKRKKEKSLEVIWRG  213

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSLG+S+QIFAGAFPENYEPP GFYFEVN DSPVVQD+ +LFDYNV +RVNDFVAAA++
Sbjct  214  SKSLGSSAQIFAGAFPENYEPPPGFYFEVNADSPVVQDNVNLFDYNVQDRVNDFVAAAIA  273

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDF+YQYAH+W+RN+DKLIHYVN+DGRVNALYSTPSIYTDAKYA+
Sbjct  274  QANITRTNHIMWTMGTDFRYQYAHTWYRNMDKLIHYVNKDGRVNALYSTPSIYTDAKYAT  333

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
             +SWPLK EDYFPYADR NAYWTGYF
Sbjct  334  SKSWPLKIEDYFPYADRANAYWTGYF  359



>ref|XP_004304565.1| PREDICTED: alpha-mannosidase isoform X1 [Fragaria vesca subsp. 
vesca]
Length=1022

 Score =   389 bits (1000),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 176/206 (85%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++FNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSL+FGRIDYQDR KRK EKSLE VWR 
Sbjct  155  REFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLFFGRIDYQDREKRKNEKSLEFVWRG  214

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSLG+S++IF+GAFPENYEPPSGFYFEVND SP+VQDD  LFDYNV ERVNDF+AAA+ 
Sbjct  215  SKSLGSSAEIFSGAFPENYEPPSGFYFEVNDPSPIVQDDITLFDYNVQERVNDFIAAAVK  274

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDFKYQYAH+WFR +DKLIHYVN+DGRVNALYSTPSIYTDAKYAS
Sbjct  275  QANITRTNHIMWTMGTDFKYQYAHTWFRQMDKLIHYVNKDGRVNALYSTPSIYTDAKYAS  334

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWP+KT+D+FPYADR NAYWTGYF
Sbjct  335  NESWPIKTDDFFPYADRINAYWTGYF  360



>ref|XP_007038132.1| Glycosyl hydrolase family 38 protein isoform 1 [Theobroma cacao]
 gb|EOY22633.1| Glycosyl hydrolase family 38 protein isoform 1 [Theobroma cacao]
Length=1010

 Score =   389 bits (999),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 178/205 (87%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +FNVTPRIGWQIDPFGHSAVQAYLL AEVGFDSL+F RIDYQDRAKRK EKSLEVVWR S
Sbjct  156  EFNVTPRIGWQIDPFGHSAVQAYLLSAEVGFDSLFFARIDYQDRAKRKDEKSLEVVWRGS  215

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            KSLG+SSQIFAG FPENY+PPS F +EVNDDSP+VQD+ +LFDYNVPERVN+FVAAALSQ
Sbjct  216  KSLGSSSQIFAGVFPENYDPPSNFNYEVNDDSPIVQDNMELFDYNVPERVNEFVAAALSQ  275

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            ANITRTNHVMWTMGTDFKYQYAH+WFR +DK IHYVNQDGRVNALYSTPSIYTDAKYA++
Sbjct  276  ANITRTNHVMWTMGTDFKYQYAHTWFRQMDKFIHYVNQDGRVNALYSTPSIYTDAKYATN  335

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            ++WPLKT+DYFPYADR NAYWTGYF
Sbjct  336  KAWPLKTDDYFPYADRINAYWTGYF  360



>ref|XP_007038133.1| Glycosyl hydrolase family 38 protein isoform 2 [Theobroma cacao]
 gb|EOY22634.1| Glycosyl hydrolase family 38 protein isoform 2 [Theobroma cacao]
Length=994

 Score =   389 bits (998),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 178/205 (87%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +FNVTPRIGWQIDPFGHSAVQAYLL AEVGFDSL+F RIDYQDRAKRK EKSLEVVWR S
Sbjct  156  EFNVTPRIGWQIDPFGHSAVQAYLLSAEVGFDSLFFARIDYQDRAKRKDEKSLEVVWRGS  215

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            KSLG+SSQIFAG FPENY+PPS F +EVNDDSP+VQD+ +LFDYNVPERVN+FVAAALSQ
Sbjct  216  KSLGSSSQIFAGVFPENYDPPSNFNYEVNDDSPIVQDNMELFDYNVPERVNEFVAAALSQ  275

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            ANITRTNHVMWTMGTDFKYQYAH+WFR +DK IHYVNQDGRVNALYSTPSIYTDAKYA++
Sbjct  276  ANITRTNHVMWTMGTDFKYQYAHTWFRQMDKFIHYVNQDGRVNALYSTPSIYTDAKYATN  335

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            ++WPLKT+DYFPYADR NAYWTGYF
Sbjct  336  KAWPLKTDDYFPYADRINAYWTGYF  360



>gb|AIX48016.1| LMann protein, partial [synthetic construct]
Length=1003

 Score =   389 bits (998),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 181/207 (87%), Positives = 196/207 (95%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSL+FGRIDYQDR KRK EKSLEV+WR 
Sbjct  133  QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLFFGRIDYQDREKRKIEKSLEVIWRG  192

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPV-VQDDTDLFDYNVPERVNDFVAAAL  358
            SKSL +S+QIF+GAFP+NYEPPS FYFEVNDD+ + VQDD +LFDYNV ERVNDFVAAAL
Sbjct  193  SKSLSSSTQIFSGAFPQNYEPPSKFYFEVNDDNSLPVQDDVNLFDYNVQERVNDFVAAAL  252

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            SQANITRTNH+MWTMGTDFKYQYAH+WFRN+DKLIHYVNQDGRVNALYS+PSIYTDAKYA
Sbjct  253  SQANITRTNHIMWTMGTDFKYQYAHTWFRNMDKLIHYVNQDGRVNALYSSPSIYTDAKYA  312

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
             D+SWPLKT+DYFPYADR NAYWTGYF
Sbjct  313  LDESWPLKTDDYFPYADRINAYWTGYF  339



>gb|KEH23493.1| glycoside hydrolase family 38 amino-terminal domain protein [Medicago 
truncatula]
Length=815

 Score =   384 bits (985),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F++TPRIGWQIDPFGHSAVQAYLLGAEVGFDSL+FGRIDYQDR KRK EKSLEV+W+ 
Sbjct  155  EEFDLTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLFFGRIDYQDRNKRKKEKSLEVIWQG  214

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSLG+S+QIFAGAFPENYEPPSGFYFEVNDDS +VQD+ +LFDYNV +RVNDFVAAALS
Sbjct  215  SKSLGSSAQIFAGAFPENYEPPSGFYFEVNDDSQIVQDNMNLFDYNVQDRVNDFVAAALS  274

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDFKYQYAH+W+R LDKLIHYVN+DGRVNALYSTPSIYTDAKYA+
Sbjct  275  QANITRTNHIMWTMGTDFKYQYAHTWYRQLDKLIHYVNKDGRVNALYSTPSIYTDAKYAA  334

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWP+KT+D+FPY+DR N +WTGYF
Sbjct  335  NESWPIKTDDFFPYSDRANGFWTGYF  360



>gb|AGR44468.1| alpha-mannosidase [Pyrus x bretschneideri]
Length=1024

 Score =   389 bits (998),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 176/206 (85%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F+VTPRIGWQIDPFGHSAVQAY+LGAEVGFDSL+FGRIDYQDRAKRK EKSLE VWR 
Sbjct  156  REFDVTPRIGWQIDPFGHSAVQAYMLGAEVGFDSLFFGRIDYQDRAKRKIEKSLEFVWRG  215

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSL +S+QIF+GAFPENYEPPSGFYFEVNDDSPVVQDD  LFDYNV +RVNDFVAAA++
Sbjct  216  SKSLSSSAQIFSGAFPENYEPPSGFYFEVNDDSPVVQDDITLFDYNVQDRVNDFVAAAVA  275

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDFKYQYAH+WFR +DKLIHYVN+DGRVNALYSTPSIYTDAKYA+
Sbjct  276  QANITRTNHIMWTMGTDFKYQYAHTWFRQMDKLIHYVNKDGRVNALYSTPSIYTDAKYAT  335

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWP+KT+D+FPYADR NAYWTGYF
Sbjct  336  NESWPIKTDDFFPYADRTNAYWTGYF  361



>gb|KJB76305.1| hypothetical protein B456_012G082700 [Gossypium raimondii]
 gb|KJB76309.1| hypothetical protein B456_012G082700 [Gossypium raimondii]
Length=944

 Score =   387 bits (994),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F VTPRIGWQIDPFGHSAVQAYLLGAEVGFDS +FGRIDYQDR KRK EKSLEV+WR 
Sbjct  154  EEFGVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSFFFGRIDYQDRIKRKKEKSLEVIWRG  213

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSLG+S+QIFAGAFPENYEPP GFYFEVN DSPVVQD+ +LFDYNV +RVNDFVAAA++
Sbjct  214  SKSLGSSAQIFAGAFPENYEPPPGFYFEVNADSPVVQDNVNLFDYNVQDRVNDFVAAAIA  273

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDF+YQYAH+W+RN+DKLIHYVN+DGRVNALYSTPSIYTDAKYA+
Sbjct  274  QANITRTNHIMWTMGTDFRYQYAHTWYRNMDKLIHYVNKDGRVNALYSTPSIYTDAKYAT  333

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
             +SWPLK EDYFPYADR NAYWTGYF
Sbjct  334  SKSWPLKIEDYFPYADRANAYWTGYF  359



>gb|KJB76306.1| hypothetical protein B456_012G082700 [Gossypium raimondii]
Length=945

 Score =   387 bits (994),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F VTPRIGWQIDPFGHSAVQAYLLGAEVGFDS +FGRIDYQDR KRK EKSLEV+WR 
Sbjct  154  EEFGVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSFFFGRIDYQDRIKRKKEKSLEVIWRG  213

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSLG+S+QIFAGAFPENYEPP GFYFEVN DSPVVQD+ +LFDYNV +RVNDFVAAA++
Sbjct  214  SKSLGSSAQIFAGAFPENYEPPPGFYFEVNADSPVVQDNVNLFDYNVQDRVNDFVAAAIA  273

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDF+YQYAH+W+RN+DKLIHYVN+DGRVNALYSTPSIYTDAKYA+
Sbjct  274  QANITRTNHIMWTMGTDFRYQYAHTWYRNMDKLIHYVNKDGRVNALYSTPSIYTDAKYAT  333

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
             +SWPLK EDYFPYADR NAYWTGYF
Sbjct  334  SKSWPLKIEDYFPYADRANAYWTGYF  359



>ref|XP_007032025.1| Glycosyl hydrolase family 38 protein [Theobroma cacao]
 gb|EOY02951.1| Glycosyl hydrolase family 38 protein [Theobroma cacao]
Length=1018

 Score =   388 bits (997),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 176/206 (85%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F VTPRIGWQIDPFGHSAVQAYLLGAEVGFDS +FGRIDYQDR KRK EKSLEV+WR 
Sbjct  154  EEFGVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSFFFGRIDYQDRIKRKKEKSLEVIWRG  213

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSLG+S+QIFAGAFP+NYEPP GFYFEVNDDSP+VQDD  LFDYNV +RVNDFVAAA+S
Sbjct  214  SKSLGSSAQIFAGAFPKNYEPPPGFYFEVNDDSPIVQDDISLFDYNVQDRVNDFVAAAIS  273

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDFKYQYAH+WFR +DKLIHYVN+DGRVNA YSTPSIYTDAKYA 
Sbjct  274  QANITRTNHIMWTMGTDFKYQYAHTWFRQMDKLIHYVNKDGRVNAFYSTPSIYTDAKYAM  333

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
             +SWPLKT+DYFPYADR NAYWTGYF
Sbjct  334  SKSWPLKTDDYFPYADRVNAYWTGYF  359



>gb|KJB76310.1| hypothetical protein B456_012G082700 [Gossypium raimondii]
Length=997

 Score =   387 bits (995),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F VTPRIGWQIDPFGHSAVQAYLLGAEVGFDS +FGRIDYQDR KRK EKSLEV+WR 
Sbjct  126  EEFGVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSFFFGRIDYQDRIKRKKEKSLEVIWRG  185

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSLG+S+QIFAGAFPENYEPP GFYFEVN DSPVVQD+ +LFDYNV +RVNDFVAAA++
Sbjct  186  SKSLGSSAQIFAGAFPENYEPPPGFYFEVNADSPVVQDNVNLFDYNVQDRVNDFVAAAIA  245

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDF+YQYAH+W+RN+DKLIHYVN+DGRVNALYSTPSIYTDAKYA+
Sbjct  246  QANITRTNHIMWTMGTDFRYQYAHTWYRNMDKLIHYVNKDGRVNALYSTPSIYTDAKYAT  305

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
             +SWPLK EDYFPYADR NAYWTGYF
Sbjct  306  SKSWPLKIEDYFPYADRANAYWTGYF  331



>ref|NP_001234851.1| alpha-mannosidase precursor [Solanum lycopersicum]
 gb|ADK66339.1| alpha-mannosidase [Solanum lycopersicum]
Length=1028

 Score =   388 bits (997),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 181/207 (87%), Positives = 196/207 (95%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSL+FGRIDYQDR KRK EKSLEV+WR 
Sbjct  158  QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLFFGRIDYQDREKRKIEKSLEVIWRG  217

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPV-VQDDTDLFDYNVPERVNDFVAAAL  358
            SKSL +S+QIF+GAFP+NYEPPS FYFEVNDD+ + VQDD +LFDYNV ERVNDFVAAAL
Sbjct  218  SKSLSSSTQIFSGAFPQNYEPPSKFYFEVNDDNSLPVQDDVNLFDYNVQERVNDFVAAAL  277

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            SQANITRTNH+MWTMGTDFKYQYAH+WFRN+DKLIHYVNQDGRVNALYS+PSIYTDAKYA
Sbjct  278  SQANITRTNHIMWTMGTDFKYQYAHTWFRNMDKLIHYVNQDGRVNALYSSPSIYTDAKYA  337

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
             D+SWPLKT+DYFPYADR NAYWTGYF
Sbjct  338  LDESWPLKTDDYFPYADRINAYWTGYF  364



>gb|KJB76307.1| hypothetical protein B456_012G082700 [Gossypium raimondii]
Length=1024

 Score =   388 bits (996),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F VTPRIGWQIDPFGHSAVQAYLLGAEVGFDS +FGRIDYQDR KRK EKSLEV+WR 
Sbjct  154  EEFGVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSFFFGRIDYQDRIKRKKEKSLEVIWRG  213

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSLG+S+QIFAGAFPENYEPP GFYFEVN DSPVVQD+ +LFDYNV +RVNDFVAAA++
Sbjct  214  SKSLGSSAQIFAGAFPENYEPPPGFYFEVNADSPVVQDNVNLFDYNVQDRVNDFVAAAIA  273

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDF+YQYAH+W+RN+DKLIHYVN+DGRVNALYSTPSIYTDAKYA+
Sbjct  274  QANITRTNHIMWTMGTDFRYQYAHTWYRNMDKLIHYVNKDGRVNALYSTPSIYTDAKYAT  333

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
             +SWPLK EDYFPYADR NAYWTGYF
Sbjct  334  SKSWPLKIEDYFPYADRANAYWTGYF  359



>gb|KJB76308.1| hypothetical protein B456_012G082700 [Gossypium raimondii]
Length=1024

 Score =   388 bits (996),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F VTPRIGWQIDPFGHSAVQAYLLGAEVGFDS +FGRIDYQDR KRK EKSLEV+WR 
Sbjct  154  EEFGVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSFFFGRIDYQDRIKRKKEKSLEVIWRG  213

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSLG+S+QIFAGAFPENYEPP GFYFEVN DSPVVQD+ +LFDYNV +RVNDFVAAA++
Sbjct  214  SKSLGSSAQIFAGAFPENYEPPPGFYFEVNADSPVVQDNVNLFDYNVQDRVNDFVAAAIA  273

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDF+YQYAH+W+RN+DKLIHYVN+DGRVNALYSTPSIYTDAKYA+
Sbjct  274  QANITRTNHIMWTMGTDFRYQYAHTWYRNMDKLIHYVNKDGRVNALYSTPSIYTDAKYAT  333

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
             +SWPLK EDYFPYADR NAYWTGYF
Sbjct  334  SKSWPLKIEDYFPYADRANAYWTGYF  359



>gb|KJB76304.1| hypothetical protein B456_012G082700 [Gossypium raimondii]
Length=1025

 Score =   388 bits (996),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F VTPRIGWQIDPFGHSAVQAYLLGAEVGFDS +FGRIDYQDR KRK EKSLEV+WR 
Sbjct  154  EEFGVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSFFFGRIDYQDRIKRKKEKSLEVIWRG  213

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSLG+S+QIFAGAFPENYEPP GFYFEVN DSPVVQD+ +LFDYNV +RVNDFVAAA++
Sbjct  214  SKSLGSSAQIFAGAFPENYEPPPGFYFEVNADSPVVQDNVNLFDYNVQDRVNDFVAAAIA  273

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDF+YQYAH+W+RN+DKLIHYVN+DGRVNALYSTPSIYTDAKYA+
Sbjct  274  QANITRTNHIMWTMGTDFRYQYAHTWYRNMDKLIHYVNKDGRVNALYSTPSIYTDAKYAT  333

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
             +SWPLK EDYFPYADR NAYWTGYF
Sbjct  334  SKSWPLKIEDYFPYADRANAYWTGYF  359



>gb|KJB76313.1| hypothetical protein B456_012G082700 [Gossypium raimondii]
Length=1027

 Score =   388 bits (996),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F VTPRIGWQIDPFGHSAVQAYLLGAEVGFDS +FGRIDYQDR KRK EKSLEV+WR 
Sbjct  154  EEFGVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSFFFGRIDYQDRIKRKKEKSLEVIWRG  213

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSLG+S+QIFAGAFPENYEPP GFYFEVN DSPVVQD+ +LFDYNV +RVNDFVAAA++
Sbjct  214  SKSLGSSAQIFAGAFPENYEPPPGFYFEVNADSPVVQDNVNLFDYNVQDRVNDFVAAAIA  273

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDF+YQYAH+W+RN+DKLIHYVN+DGRVNALYSTPSIYTDAKYA+
Sbjct  274  QANITRTNHIMWTMGTDFRYQYAHTWYRNMDKLIHYVNKDGRVNALYSTPSIYTDAKYAT  333

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
             +SWPLK EDYFPYADR NAYWTGYF
Sbjct  334  SKSWPLKIEDYFPYADRANAYWTGYF  359



>gb|KJB76311.1| hypothetical protein B456_012G082700 [Gossypium raimondii]
Length=1027

 Score =   388 bits (996),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F VTPRIGWQIDPFGHSAVQAYLLGAEVGFDS +FGRIDYQDR KRK EKSLEV+WR 
Sbjct  154  EEFGVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSFFFGRIDYQDRIKRKKEKSLEVIWRG  213

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSLG+S+QIFAGAFPENYEPP GFYFEVN DSPVVQD+ +LFDYNV +RVNDFVAAA++
Sbjct  214  SKSLGSSAQIFAGAFPENYEPPPGFYFEVNADSPVVQDNVNLFDYNVQDRVNDFVAAAIA  273

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDF+YQYAH+W+RN+DKLIHYVN+DGRVNALYSTPSIYTDAKYA+
Sbjct  274  QANITRTNHIMWTMGTDFRYQYAHTWYRNMDKLIHYVNKDGRVNALYSTPSIYTDAKYAT  333

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
             +SWPLK EDYFPYADR NAYWTGYF
Sbjct  334  SKSWPLKIEDYFPYADRANAYWTGYF  359



>ref|XP_008231243.1| PREDICTED: lysosomal alpha-mannosidase isoform X2 [Prunus mume]
Length=933

 Score =   384 bits (987),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F+VTPRIGWQIDPFGHSAVQAYLLGAEVGFDSL+FGRIDYQDR KRK +KSLE VW+ 
Sbjct  65   KEFDVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLFFGRIDYQDRDKRKNDKSLEFVWQG  124

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSLG+S+QIF+GAFP+NYEPPSGFYFEVNDDSP+VQDD  LFDYNV +RVNDFVAAA+S
Sbjct  125  SKSLGSSAQIFSGAFPKNYEPPSGFYFEVNDDSPIVQDDITLFDYNVQDRVNDFVAAAVS  184

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRT+H+MWTMGTDFKYQYAH+WFR +DKLIHYVN+DGRVNALYSTPSIYTDAKYA+
Sbjct  185  QANITRTDHIMWTMGTDFKYQYAHTWFRQMDKLIHYVNKDGRVNALYSTPSIYTDAKYAT  244

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWP+KT+D+FPYADR NAYWTGYF
Sbjct  245  NESWPIKTDDFFPYADRTNAYWTGYF  270



>emb|CDO98309.1| unnamed protein product [Coffea canephora]
Length=1018

 Score =   386 bits (991),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 196/211 (93%), Gaps = 5/211 (2%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFNVTPRIGWQIDPFGHSAVQAYLLGAE+GFDS +FGRIDYQDRAKRK EK+LEVVW+ 
Sbjct  154  EQFNVTPRIGWQIDPFGHSAVQAYLLGAELGFDSFFFGRIDYQDRAKRKAEKALEVVWQG  213

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSLG+S+QIFAGAFPENYEPPSGFYFEVNDDS +VQDD +LFDYNV +RVNDFVAAA S
Sbjct  214  SKSLGSSAQIFAGAFPENYEPPSGFYFEVNDDSDIVQDDMNLFDYNVQDRVNDFVAAAFS  273

Query  362  Q-----ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTD  526
            Q     ANITRTNHVMWTMGTDFKYQYA +WFRN+DKLIHYVN+DGRVNALYSTPSIYT+
Sbjct  274  QASHILANITRTNHVMWTMGTDFKYQYARTWFRNMDKLIHYVNEDGRVNALYSTPSIYTE  333

Query  527  AKYASDQSWPLKTEDYFPYADRENAYWTGYF  619
            AKYAS +SWPLKT+DYFPYADR NAYWTGYF
Sbjct  334  AKYASKESWPLKTDDYFPYADRINAYWTGYF  364



>ref|XP_006365417.1| PREDICTED: lysosomal alpha-mannosidase-like [Solanum tuberosum]
Length=1028

 Score =   386 bits (991),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 180/207 (87%), Positives = 195/207 (94%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSL+FGRIDYQDR KRK +KSLEV+WR 
Sbjct  158  QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLFFGRIDYQDREKRKIDKSLEVIWRG  217

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPV-VQDDTDLFDYNVPERVNDFVAAAL  358
            SKSL +S+QIF+GAFP+NYEPPS FYFEVNDD  + VQDD +LFDYNV ERVNDFVAAAL
Sbjct  218  SKSLSSSTQIFSGAFPKNYEPPSKFYFEVNDDDSLPVQDDVNLFDYNVQERVNDFVAAAL  277

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            SQANITRTNH+MWTMGTDFKYQYAH+WFRN+DKLIHYVNQDGRVNALYS+PSIYTDAKYA
Sbjct  278  SQANITRTNHIMWTMGTDFKYQYAHTWFRNMDKLIHYVNQDGRVNALYSSPSIYTDAKYA  337

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
             D+SWPLKT+DYFPYADR NAYWTGYF
Sbjct  338  LDESWPLKTDDYFPYADRINAYWTGYF  364



>gb|KHN46850.1| Lysosomal alpha-mannosidase [Glycine soja]
Length=1007

 Score =   385 bits (989),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F VTPRIGWQIDPFGHSAVQAYLLGAEVGFDS +FGRIDYQDRAKRK EKSLEV+W+ 
Sbjct  132  EEFGVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSFFFGRIDYQDRAKRKKEKSLEVIWQG  191

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSLG S+QIFAGAFPENYEPPSGFYFEVND SP+VQD+  LFDYNV +RVNDFVAAAL 
Sbjct  192  SKSLGPSAQIFAGAFPENYEPPSGFYFEVNDASPIVQDNMQLFDYNVQDRVNDFVAAALL  251

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDFKYQYAH+WFR LDKLIHYVN DGRVNALYSTPSIYTDAKYA+
Sbjct  252  QANITRTNHIMWTMGTDFKYQYAHTWFRQLDKLIHYVNMDGRVNALYSTPSIYTDAKYAT  311

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWP+KT+D+FPYADR N YWTGYF
Sbjct  312  NESWPIKTDDFFPYADRANGYWTGYF  337



>ref|XP_003548858.1| PREDICTED: lysosomal alpha-mannosidase-like isoform 1 [Glycine 
max]
Length=1030

 Score =   385 bits (989),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F VTPRIGWQIDPFGHSAVQAYLLGAEVGFDS +FGRIDYQDRAKRK EKSLEV+W+ 
Sbjct  167  EEFGVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSFFFGRIDYQDRAKRKKEKSLEVIWQG  226

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSLG S+QIFAGAFPENYEPPSGFYFEVND SP+VQD+  LFDYNV +RVNDFVAAAL 
Sbjct  227  SKSLGPSAQIFAGAFPENYEPPSGFYFEVNDASPIVQDNMQLFDYNVQDRVNDFVAAALL  286

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDFKYQYAH+WFR LDKLIHYVN DGRVNALYSTPSIYTDAKYA+
Sbjct  287  QANITRTNHIMWTMGTDFKYQYAHTWFRQLDKLIHYVNMDGRVNALYSTPSIYTDAKYAT  346

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWP+KT+D+FPYADR N YWTGYF
Sbjct  347  NESWPIKTDDFFPYADRANGYWTGYF  372



>ref|XP_002511094.1| lysosomal alpha-mannosidase, putative [Ricinus communis]
 gb|EEF51696.1| lysosomal alpha-mannosidase, putative [Ricinus communis]
Length=1012

 Score =   384 bits (987),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 174/207 (84%), Positives = 195/207 (94%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            Q+FN+TPRIGWQIDPFGHSAVQ YLLGAEVGFDS++F RIDYQDR+KRK EKSLEVVWR 
Sbjct  155  QEFNLTPRIGWQIDPFGHSAVQGYLLGAEVGFDSIFFARIDYQDRSKRKDEKSLEVVWRG  214

Query  182  SKSLGTSSQIFAGAFPENYEPPS-GFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKSLG+S+QIFAGAFP+NYEPPS  FYFEVND+SP+VQDD +LFDYNVP+RVNDFV+AA+
Sbjct  215  SKSLGSSAQIFAGAFPKNYEPPSDNFYFEVNDESPIVQDDINLFDYNVPDRVNDFVSAAM  274

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            SQANITRTNH+MWTMGTDFKYQYAHSWF+ +DK IHYVNQDGRVNA YSTPSIYTDAKYA
Sbjct  275  SQANITRTNHIMWTMGTDFKYQYAHSWFKQMDKFIHYVNQDGRVNAFYSTPSIYTDAKYA  334

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            +++SWPLKT+DYFPYAD  NAYWTGYF
Sbjct  335  ANESWPLKTDDYFPYADDVNAYWTGYF  361



>ref|XP_008231241.1| PREDICTED: lysosomal alpha-mannosidase isoform X1 [Prunus mume]
 ref|XP_008231242.1| PREDICTED: lysosomal alpha-mannosidase isoform X1 [Prunus mume]
Length=1024

 Score =   384 bits (987),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F+VTPRIGWQIDPFGHSAVQAYLLGAEVGFDSL+FGRIDYQDR KRK +KSLE VW+ 
Sbjct  156  KEFDVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLFFGRIDYQDRDKRKNDKSLEFVWQG  215

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSLG+S+QIF+GAFP+NYEPPSGFYFEVNDDSP+VQDD  LFDYNV +RVNDFVAAA+S
Sbjct  216  SKSLGSSAQIFSGAFPKNYEPPSGFYFEVNDDSPIVQDDITLFDYNVQDRVNDFVAAAVS  275

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRT+H+MWTMGTDFKYQYAH+WFR +DKLIHYVN+DGRVNALYSTPSIYTDAKYA+
Sbjct  276  QANITRTDHIMWTMGTDFKYQYAHTWFRQMDKLIHYVNKDGRVNALYSTPSIYTDAKYAT  335

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWP+KT+D+FPYADR NAYWTGYF
Sbjct  336  NESWPIKTDDFFPYADRTNAYWTGYF  361



>ref|XP_004501751.1| PREDICTED: lysosomal alpha-mannosidase-like isoform X2 [Cicer 
arietinum]
Length=1004

 Score =   384 bits (986),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 174/206 (84%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F VTPRIGWQIDPFGHSAVQAYLLGAEVGFDSL+F RIDYQDRAKRK EKSLEVVW+ 
Sbjct  158  EEFGVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLFFARIDYQDRAKRKDEKSLEVVWQG  217

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKS G+SSQIF+GAFPENYEPPS FYFEVNDDSP+VQDD +LFDYNVPERVN+FV+AALS
Sbjct  218  SKSFGSSSQIFSGAFPENYEPPSNFYFEVNDDSPIVQDDINLFDYNVPERVNEFVSAALS  277

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDFKYQYA +WFR LDK IHYVNQDGRV+ALYSTPSIYTDAK+A+
Sbjct  278  QANITRTNHIMWTMGTDFKYQYAETWFRQLDKFIHYVNQDGRVHALYSTPSIYTDAKHAA  337

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            +++WP+KT+DYFPYADR N YWTGYF
Sbjct  338  NEAWPIKTDDYFPYADRVNGYWTGYF  363



>ref|XP_010099053.1| Lysosomal alpha-mannosidase [Morus notabilis]
 gb|EXB76513.1| Lysosomal alpha-mannosidase [Morus notabilis]
Length=953

 Score =   383 bits (983),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 174/207 (84%), Positives = 196/207 (95%), Gaps = 2/207 (1%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +FNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDS +FGRIDYQDRAKRK EKSLEVVWR S
Sbjct  130  EFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSFFFGRIDYQDRAKRKNEKSLEVVWRGS  189

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVN--DDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            K+LG+SSQIFAGAFPENYEPPS FY+EVN  +DSP++QD+T+LFDYNV ERVN+FVAAA+
Sbjct  190  KTLGSSSQIFAGAFPENYEPPSNFYYEVNANEDSPIIQDNTNLFDYNVAERVNEFVAAAI  249

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            SQANITRTNHVMWTMGTDFKYQYAH+WF+ +DK IHYVNQDGRVNALYSTPSIYTDAK+A
Sbjct  250  SQANITRTNHVMWTMGTDFKYQYAHTWFKQMDKFIHYVNQDGRVNALYSTPSIYTDAKHA  309

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            ++++WP+K +DYFPYADR NAYWTGYF
Sbjct  310  TNEAWPIKNDDYFPYADRVNAYWTGYF  336



>ref|XP_003523176.1| PREDICTED: lysosomal alpha-mannosidase-like [Glycine max]
Length=1011

 Score =   384 bits (986),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F VTPRIGWQIDPFGHSAVQAYLLGAEVGFDSL+F RIDYQDRAKRK EK+LEVVWR 
Sbjct  158  EEFGVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLFFARIDYQDRAKRKDEKTLEVVWRG  217

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSLG+S+QIF+GAFPENYEPPS FY+EVNDDSP+VQDD  LFDYNVPERVN+FVAAA+S
Sbjct  218  SKSLGSSAQIFSGAFPENYEPPSNFYYEVNDDSPIVQDDVSLFDYNVPERVNEFVAAAIS  277

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDFKYQYA +WFR LDK IHYVNQDGRV+ALYSTPSIYTDAK+A+
Sbjct  278  QANITRTNHIMWTMGTDFKYQYAQTWFRQLDKFIHYVNQDGRVHALYSTPSIYTDAKHAA  337

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            +++WP+KT+D+FPYADR NAYWTGYF
Sbjct  338  NEAWPIKTDDFFPYADRVNAYWTGYF  363



>ref|XP_004501750.1| PREDICTED: lysosomal alpha-mannosidase-like isoform X1 [Cicer 
arietinum]
Length=1012

 Score =   384 bits (986),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 174/206 (84%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F VTPRIGWQIDPFGHSAVQAYLLGAEVGFDSL+F RIDYQDRAKRK EKSLEVVW+ 
Sbjct  158  EEFGVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLFFARIDYQDRAKRKDEKSLEVVWQG  217

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKS G+SSQIF+GAFPENYEPPS FYFEVNDDSP+VQDD +LFDYNVPERVN+FV+AALS
Sbjct  218  SKSFGSSSQIFSGAFPENYEPPSNFYFEVNDDSPIVQDDINLFDYNVPERVNEFVSAALS  277

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDFKYQYA +WFR LDK IHYVNQDGRV+ALYSTPSIYTDAK+A+
Sbjct  278  QANITRTNHIMWTMGTDFKYQYAETWFRQLDKFIHYVNQDGRVHALYSTPSIYTDAKHAA  337

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            +++WP+KT+DYFPYADR N YWTGYF
Sbjct  338  NEAWPIKTDDYFPYADRVNGYWTGYF  363



>gb|KDP41855.1| hypothetical protein JCGZ_26873 [Jatropha curcas]
Length=1026

 Score =   384 bits (986),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 178/207 (86%), Positives = 195/207 (94%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F++TPRIGWQIDPFGHSAVQAYLLGAEVGFDSL+FGRIDYQDRAKRK EKSLEVVW+ 
Sbjct  156  KEFDMTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLFFGRIDYQDRAKRKNEKSLEVVWQG  215

Query  182  SKSLGTSSQIFAGAFPENYEPP-SGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKSLG+S++IFAGAFPENYEPP  GFYFEVND  PVVQDD +LFDYNVPERVNDFVAAA+
Sbjct  216  SKSLGSSAEIFAGAFPENYEPPPGGFYFEVNDPYPVVQDDINLFDYNVPERVNDFVAAAI  275

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            SQANITRTNH+MWTMGTDFKYQYA SWFR +DKLIHYVN DGRVNALYSTPSIYTDAK+A
Sbjct  276  SQANITRTNHIMWTMGTDFKYQYAESWFRQMDKLIHYVNIDGRVNALYSTPSIYTDAKHA  335

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            +++SWP KTEDYFPYADR NAYWTGYF
Sbjct  336  TNESWPAKTEDYFPYADRANAYWTGYF  362



>gb|KHN31257.1| Lysosomal alpha-mannosidase [Glycine soja]
Length=1015

 Score =   384 bits (985),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F VTPRIGWQIDPFGHSAVQAYLLGAEVGFDSL+F RIDYQDRAKRK EK+LEVVWR 
Sbjct  158  EEFGVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLFFARIDYQDRAKRKDEKTLEVVWRG  217

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSLG+S+QIF+GAFPENYEPPS FY+EVNDDSP+VQDD  LFDYNVPERVN+FVAAA+S
Sbjct  218  SKSLGSSAQIFSGAFPENYEPPSNFYYEVNDDSPIVQDDVSLFDYNVPERVNEFVAAAIS  277

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDFKYQYA +WFR LDK IHYVNQDGRV+ALYSTPSIYTDAK+A+
Sbjct  278  QANITRTNHIMWTMGTDFKYQYAQTWFRQLDKFIHYVNQDGRVHALYSTPSIYTDAKHAA  337

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            +++WP+KT+D+FPYADR NAYWTGYF
Sbjct  338  NEAWPIKTDDFFPYADRVNAYWTGYF  363



>ref|XP_004297489.1| PREDICTED: alpha-mannosidase-like [Fragaria vesca subsp. vesca]
 ref|XP_011463213.1| PREDICTED: alpha-mannosidase-like [Fragaria vesca subsp. vesca]
 ref|XP_011463214.1| PREDICTED: alpha-mannosidase-like [Fragaria vesca subsp. vesca]
 ref|XP_011463215.1| PREDICTED: alpha-mannosidase-like [Fragaria vesca subsp. vesca]
 ref|XP_011463216.1| PREDICTED: alpha-mannosidase-like [Fragaria vesca subsp. vesca]
Length=1010

 Score =   383 bits (984),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 176/207 (85%), Positives = 195/207 (94%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            Q+FNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSL+FGRIDYQDRAKRK +KSLEVVWR 
Sbjct  156  QEFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLFFGRIDYQDRAKRKVDKSLEVVWRG  215

Query  182  SKSLGTSSQIFAGAFPENYEPPS-GFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKSLG+S+QIFAGAFP NYEPPS  FYFEVND SP+VQDD DLFDYNVP+RVNDFV+AA+
Sbjct  216  SKSLGSSAQIFAGAFPANYEPPSDNFYFEVNDASPIVQDDMDLFDYNVPDRVNDFVSAAM  275

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
             QANITRTNH+MWTMGTDFKYQYAH+WFR +DK I+YVNQDGRVNALYSTPSIYTDAKYA
Sbjct  276  LQANITRTNHIMWTMGTDFKYQYAHTWFRQMDKFINYVNQDGRVNALYSTPSIYTDAKYA  335

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            +D+SWP+K++D+FPYAD  NAYWTGYF
Sbjct  336  ADESWPIKSDDFFPYADNINAYWTGYF  362



>gb|KHN09713.1| Lysosomal alpha-mannosidase [Glycine soja]
Length=1016

 Score =   383 bits (983),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F VTPRIGWQIDPFGHSAVQAYLLGAEVGFDSL+F RIDYQDRAKRK EK+LEVVWR 
Sbjct  158  EEFGVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLFFARIDYQDRAKRKDEKTLEVVWRG  217

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKS G+SSQIF+GAFPENYEPPS FY+EVNDDSP+VQDD  LFDYNVPERVN+FVAAA+S
Sbjct  218  SKSFGSSSQIFSGAFPENYEPPSSFYYEVNDDSPIVQDDVSLFDYNVPERVNEFVAAAIS  277

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDFKYQYA +WFR LDK IHYVNQDGRV+ALYSTPSIYTDAK+A+
Sbjct  278  QANITRTNHIMWTMGTDFKYQYAQTWFRQLDKFIHYVNQDGRVHALYSTPSIYTDAKHAA  337

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
             ++WP+KT+D+FPYADR NAYWTGYF
Sbjct  338  KEAWPIKTDDFFPYADRVNAYWTGYF  363



>gb|AES80719.2| glycoside hydrolase family 38 amino-terminal domain protein [Medicago 
truncatula]
Length=1061

 Score =   384 bits (986),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F++TPRIGWQIDPFGHSAVQAYLLGAEVGFDSL+FGRIDYQDR KRK EKSLEV+W+ 
Sbjct  200  EEFDLTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLFFGRIDYQDRNKRKKEKSLEVIWQG  259

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSLG+S+QIFAGAFPENYEPPSGFYFEVNDDS +VQD+ +LFDYNV +RVNDFVAAALS
Sbjct  260  SKSLGSSAQIFAGAFPENYEPPSGFYFEVNDDSQIVQDNMNLFDYNVQDRVNDFVAAALS  319

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDFKYQYAH+W+R LDKLIHYVN+DGRVNALYSTPSIYTDAKYA+
Sbjct  320  QANITRTNHIMWTMGTDFKYQYAHTWYRQLDKLIHYVNKDGRVNALYSTPSIYTDAKYAA  379

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWP+KT+D+FPY+DR N +WTGYF
Sbjct  380  NESWPIKTDDFFPYSDRANGFWTGYF  405



>ref|XP_003526925.1| PREDICTED: lysosomal alpha-mannosidase-like [Glycine max]
Length=1012

 Score =   383 bits (983),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F VTPRIGWQIDPFGHSAVQAYLLGAEVGFDSL+F RIDYQDRAKRK EK+LEVVWR 
Sbjct  158  EEFGVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLFFARIDYQDRAKRKDEKTLEVVWRG  217

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKS G+SSQIF+GAFPENYEPPS FY+EVNDDSP+VQDD  LFDYNVPERVN+FVAAA+S
Sbjct  218  SKSFGSSSQIFSGAFPENYEPPSSFYYEVNDDSPIVQDDVSLFDYNVPERVNEFVAAAIS  277

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDFKYQYA +WFR LDK IHYVNQDGRV+ALYSTPSIYTDAK+A+
Sbjct  278  QANITRTNHIMWTMGTDFKYQYAQTWFRQLDKFIHYVNQDGRVHALYSTPSIYTDAKHAA  337

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
             ++WP+KT+D+FPYADR NAYWTGYF
Sbjct  338  KEAWPIKTDDFFPYADRVNAYWTGYF  363



>ref|XP_003624501.1| Lysosomal alpha-mannosidase [Medicago truncatula]
Length=1082

 Score =   384 bits (987),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F++TPRIGWQIDPFGHSAVQAYLLGAEVGFDSL+FGRIDYQDR KRK EKSLEV+W+ 
Sbjct  200  EEFDLTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLFFGRIDYQDRNKRKKEKSLEVIWQG  259

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSLG+S+QIFAGAFPENYEPPSGFYFEVNDDS +VQD+ +LFDYNV +RVNDFVAAALS
Sbjct  260  SKSLGSSAQIFAGAFPENYEPPSGFYFEVNDDSQIVQDNMNLFDYNVQDRVNDFVAAALS  319

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDFKYQYAH+W+R LDKLIHYVN+DGRVNALYSTPSIYTDAKYA+
Sbjct  320  QANITRTNHIMWTMGTDFKYQYAHTWYRQLDKLIHYVNKDGRVNALYSTPSIYTDAKYAA  379

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWP+KT+D+FPY+DR N +WTGYF
Sbjct  380  NESWPIKTDDFFPYSDRANGFWTGYF  405



>ref|XP_011042968.1| PREDICTED: alpha-mannosidase-like [Populus euphratica]
Length=1008

 Score =   382 bits (982),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++FNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDS +FGRIDYQDR KRKG+KSLEVVWR 
Sbjct  154  EEFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSFFFGRIDYQDRTKRKGDKSLEVVWRG  213

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSLG+S+QIFAGAFP+NYEPPS  Y+EVNDDSP++QD+ DLFDYNV ERVN+FV+AA+ 
Sbjct  214  SKSLGSSAQIFAGAFPQNYEPPSNLYYEVNDDSPILQDNPDLFDYNVAERVNEFVSAAMD  273

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDFKYQYAH+W++ +DK IHYVNQDGRVNALYSTPSIYTDAKYA+
Sbjct  274  QANITRTNHLMWTMGTDFKYQYAHTWYKQMDKFIHYVNQDGRVNALYSTPSIYTDAKYAT  333

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWPLKT+D+FPYAD  NAYWTGYF
Sbjct  334  NESWPLKTDDFFPYADIANAYWTGYF  359



>emb|CDP17307.1| unnamed protein product [Coffea canephora]
Length=1018

 Score =   383 bits (983),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 179/211 (85%), Positives = 195/211 (92%), Gaps = 5/211 (2%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFNVTPRIGWQIDPFGHSAVQAYLLGAE+GFDS +FGRIDYQDRAKRK EK+LEVVW+ 
Sbjct  154  EQFNVTPRIGWQIDPFGHSAVQAYLLGAELGFDSFFFGRIDYQDRAKRKAEKALEVVWQG  213

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSLG+S+QIFAGAFPENYEPPSGFYFEVNDDS +VQDD +LFDYNV +RVNDFVAAA S
Sbjct  214  SKSLGSSAQIFAGAFPENYEPPSGFYFEVNDDSDIVQDDMNLFDYNVQDRVNDFVAAAFS  273

Query  362  Q-----ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTD  526
            Q     ANITRTNHVMWTMGTDFKYQYA +WFRN+DKLIHYVN+DGRVNALYSTPSIYT+
Sbjct  274  QASHILANITRTNHVMWTMGTDFKYQYARTWFRNMDKLIHYVNEDGRVNALYSTPSIYTE  333

Query  527  AKYASDQSWPLKTEDYFPYADRENAYWTGYF  619
            AKYAS +SWPLKT+DYFPYAD  NAYWTGYF
Sbjct  334  AKYASKESWPLKTDDYFPYADCINAYWTGYF  364



>ref|XP_007214917.1| hypothetical protein PRUPE_ppa000717mg [Prunus persica]
 gb|AGC10269.1| alpha-mannosidase [Prunus persica]
 gb|EMJ16116.1| hypothetical protein PRUPE_ppa000717mg [Prunus persica]
Length=1024

 Score =   383 bits (983),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F+VTPRIGWQIDPFGHSAVQAYLLGAEVGFDSL+FGRIDYQDR KRK +KSLE VW+ 
Sbjct  156  KEFDVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLFFGRIDYQDRDKRKNDKSLEFVWQG  215

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSLG+S+QIF+GAFP+NYEPPSGFYFEVNDDSP+VQDD  LFDYNV +RVN+FVAAA+S
Sbjct  216  SKSLGSSAQIFSGAFPKNYEPPSGFYFEVNDDSPIVQDDITLFDYNVQDRVNNFVAAAVS  275

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRT+H+MWTMGTDFKYQYAH+WFR +DKLIHYVN+DGRVNALYSTPSIYTDAKYA+
Sbjct  276  QANITRTDHIMWTMGTDFKYQYAHTWFRQMDKLIHYVNKDGRVNALYSTPSIYTDAKYAT  335

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWP+KT+D+FPYADR NAYWTGYF
Sbjct  336  NESWPIKTDDFFPYADRTNAYWTGYF  361



>gb|ADU20406.1| alpha-mannosidase [Capsicum annuum]
Length=1030

 Score =   383 bits (983),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 178/207 (86%), Positives = 193/207 (93%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            QQFN+ PRIGWQIDPFGHSAVQAYLLGAEVGFDSL+FGRIDYQDR KRK EKSLEV+WR 
Sbjct  157  QQFNIAPRIGWQIDPFGHSAVQAYLLGAEVGFDSLFFGRIDYQDREKRKIEKSLEVIWRG  216

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPV-VQDDTDLFDYNVPERVNDFVAAAL  358
            SKSL +S+QIF+GAFP+NYEPPS FYFEVNDD+ + VQDD +LFDYNV ERVNDFVAAAL
Sbjct  217  SKSLSSSTQIFSGAFPQNYEPPSKFYFEVNDDNSLPVQDDVNLFDYNVQERVNDFVAAAL  276

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            SQANITRTNH+MWTMGTDFKYQYAH+WFRN+DK IHYVNQDGRVNALYS+PSIYTDAKYA
Sbjct  277  SQANITRTNHIMWTMGTDFKYQYAHTWFRNMDKFIHYVNQDGRVNALYSSPSIYTDAKYA  336

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
             D+SWPLKT DYFPYADR NAYWTGYF
Sbjct  337  LDESWPLKTGDYFPYADRINAYWTGYF  363



>ref|XP_011098967.1| PREDICTED: alpha-mannosidase isoform X2 [Sesamum indicum]
Length=1034

 Score =   383 bits (983),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QF VTPR+GWQIDPFGHSA QAYLLGAE+GFDSL+FGRIDYQDR KRK EKSLEV+W+ 
Sbjct  163  EQFGVTPRVGWQIDPFGHSAAQAYLLGAELGFDSLFFGRIDYQDRTKRKTEKSLEVIWQG  222

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSLG+S+QIFAGAFPENYEPPSGFYFEVND SP+VQDD  LFDYNV ERV DFVAAALS
Sbjct  223  SKSLGSSAQIFAGAFPENYEPPSGFYFEVNDASPIVQDDITLFDYNVQERVEDFVAAALS  282

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDFKYQYAH+WFR +DKLIHYVN DGRVNALYSTPSIYT+AK+A+
Sbjct  283  QANITRTNHIMWTMGTDFKYQYAHTWFRQMDKLIHYVNIDGRVNALYSTPSIYTNAKHAT  342

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            +Q WPLKT+D+FPYADR N YWTGYF
Sbjct  343  EQIWPLKTDDFFPYADRVNGYWTGYF  368



>ref|XP_011098968.1| PREDICTED: alpha-mannosidase isoform X3 [Sesamum indicum]
Length=1027

 Score =   382 bits (982),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QF VTPR+GWQIDPFGHSA QAYLLGAE+GFDSL+FGRIDYQDR KRK EKSLEV+W+ 
Sbjct  163  EQFGVTPRVGWQIDPFGHSAAQAYLLGAELGFDSLFFGRIDYQDRTKRKTEKSLEVIWQG  222

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSLG+S+QIFAGAFPENYEPPSGFYFEVND SP+VQDD  LFDYNV ERV DFVAAALS
Sbjct  223  SKSLGSSAQIFAGAFPENYEPPSGFYFEVNDASPIVQDDITLFDYNVQERVEDFVAAALS  282

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDFKYQYAH+WFR +DKLIHYVN DGRVNALYSTPSIYT+AK+A+
Sbjct  283  QANITRTNHIMWTMGTDFKYQYAHTWFRQMDKLIHYVNIDGRVNALYSTPSIYTNAKHAT  342

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            +Q WPLKT+D+FPYADR N YWTGYF
Sbjct  343  EQIWPLKTDDFFPYADRVNGYWTGYF  368



>ref|XP_011098966.1| PREDICTED: alpha-mannosidase isoform X1 [Sesamum indicum]
Length=1038

 Score =   382 bits (982),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QF VTPR+GWQIDPFGHSA QAYLLGAE+GFDSL+FGRIDYQDR KRK EKSLEV+W+ 
Sbjct  163  EQFGVTPRVGWQIDPFGHSAAQAYLLGAELGFDSLFFGRIDYQDRTKRKTEKSLEVIWQG  222

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSLG+S+QIFAGAFPENYEPPSGFYFEVND SP+VQDD  LFDYNV ERV DFVAAALS
Sbjct  223  SKSLGSSAQIFAGAFPENYEPPSGFYFEVNDASPIVQDDITLFDYNVQERVEDFVAAALS  282

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDFKYQYAH+WFR +DKLIHYVN DGRVNALYSTPSIYT+AK+A+
Sbjct  283  QANITRTNHIMWTMGTDFKYQYAHTWFRQMDKLIHYVNIDGRVNALYSTPSIYTNAKHAT  342

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            +Q WPLKT+D+FPYADR N YWTGYF
Sbjct  343  EQIWPLKTDDFFPYADRVNGYWTGYF  368



>ref|XP_002318770.1| hypothetical protein POPTR_0012s10830g [Populus trichocarpa]
 gb|EEE96990.1| hypothetical protein POPTR_0012s10830g [Populus trichocarpa]
Length=1012

 Score =   382 bits (980),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++FNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDS +FGRIDYQDR KRKG+KSLEVVWR 
Sbjct  154  EEFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSFFFGRIDYQDRTKRKGDKSLEVVWRG  213

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSLG+S+QIFAGAFP+NYEPPS  Y+EVNDDSP++QD+ +LFDYNV ERVN+FV+AA+ 
Sbjct  214  SKSLGSSAQIFAGAFPQNYEPPSNLYYEVNDDSPILQDNPNLFDYNVAERVNEFVSAAMD  273

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNHVMWTMGTDFKYQYAH+W++ +DK IHYVNQDGRVNALYSTPSIYTDAKYA+
Sbjct  274  QANITRTNHVMWTMGTDFKYQYAHTWYKQMDKFIHYVNQDGRVNALYSTPSIYTDAKYAT  333

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWPLKT+D+FPYAD  NAYWTGYF
Sbjct  334  NESWPLKTDDFFPYADSANAYWTGYF  359



>ref|XP_002276092.2| PREDICTED: alpha-mannosidase isoform X2 [Vitis vinifera]
 emb|CBI21276.3| unnamed protein product [Vitis vinifera]
Length=1025

 Score =   382 bits (980),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 174/207 (84%), Positives = 195/207 (94%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F VTPRIGWQIDPFGHSAVQAYLLGAEVGFD+LYFGRIDYQDR KRKGEKSLEVVWRA
Sbjct  153  KEFGVTPRIGWQIDPFGHSAVQAYLLGAEVGFDALYFGRIDYQDRDKRKGEKSLEVVWRA  212

Query  182  SKSLGTSSQIFAGAFPENYEPP-SGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            S++   S+QIFAGAFPENYEPP  GFYFEVNDDSP+VQDD +LFDYNV +RVNDFVAAA+
Sbjct  213  SRNFDASAQIFAGAFPENYEPPPGGFYFEVNDDSPIVQDDINLFDYNVQDRVNDFVAAAV  272

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            SQANITRTNH+MWTMGTDFKYQYAH+WFR +DKLIHYVN+DGRVNALYSTPSIYTDAK+A
Sbjct  273  SQANITRTNHIMWTMGTDFKYQYAHTWFRQMDKLIHYVNKDGRVNALYSTPSIYTDAKFA  332

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            +++SWP+KT+D+FPYAD  NAYWTGYF
Sbjct  333  TNESWPIKTDDFFPYADSANAYWTGYF  359



>ref|XP_006289410.1| hypothetical protein CARUB_v10002909mg [Capsella rubella]
 gb|EOA22308.1| hypothetical protein CARUB_v10002909mg [Capsella rubella]
Length=1024

 Score =   381 bits (979),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 176/207 (85%), Positives = 194/207 (94%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++FNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDS++FGRIDYQDR KRK EKSLEV+WR 
Sbjct  155  REFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSVFFGRIDYQDREKRKKEKSLEVIWRG  214

Query  182  SKSLGTSSQIFAGAFPENYEPP-SGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKSLG+SSQIFAGAFPENYEPP  GFY+E+NDDSPVVQDD DLFDYNV ERVN FVAAAL
Sbjct  215  SKSLGSSSQIFAGAFPENYEPPPGGFYYEINDDSPVVQDDPDLFDYNVQERVNAFVAAAL  274

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
             QANITRTNH+M+TMGTDF+YQYAH+WFR +DKLIHYVN DGRVNA YSTPSIYTDAK+A
Sbjct  275  GQANITRTNHIMFTMGTDFRYQYAHTWFRQMDKLIHYVNLDGRVNAFYSTPSIYTDAKHA  334

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            ++++WPLKTEDYFPYADR NAYWTGYF
Sbjct  335  ANEAWPLKTEDYFPYADRINAYWTGYF  361



>ref|XP_010660680.1| PREDICTED: alpha-mannosidase isoform X1 [Vitis vinifera]
Length=1027

 Score =   381 bits (979),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 174/207 (84%), Positives = 195/207 (94%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F VTPRIGWQIDPFGHSAVQAYLLGAEVGFD+LYFGRIDYQDR KRKGEKSLEVVWRA
Sbjct  153  KEFGVTPRIGWQIDPFGHSAVQAYLLGAEVGFDALYFGRIDYQDRDKRKGEKSLEVVWRA  212

Query  182  SKSLGTSSQIFAGAFPENYEPP-SGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            S++   S+QIFAGAFPENYEPP  GFYFEVNDDSP+VQDD +LFDYNV +RVNDFVAAA+
Sbjct  213  SRNFDASAQIFAGAFPENYEPPPGGFYFEVNDDSPIVQDDINLFDYNVQDRVNDFVAAAV  272

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            SQANITRTNH+MWTMGTDFKYQYAH+WFR +DKLIHYVN+DGRVNALYSTPSIYTDAK+A
Sbjct  273  SQANITRTNHIMWTMGTDFKYQYAHTWFRQMDKLIHYVNKDGRVNALYSTPSIYTDAKFA  332

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            +++SWP+KT+D+FPYAD  NAYWTGYF
Sbjct  333  TNESWPIKTDDFFPYADSANAYWTGYF  359



>ref|XP_008239561.1| PREDICTED: lysosomal alpha-mannosidase-like isoform X2 [Prunus 
mume]
Length=1014

 Score =   380 bits (977),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 172/207 (83%), Positives = 196/207 (95%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++FNVTPRIGWQIDPFGHSAVQAYLLGAE GFDSL+F RIDYQDR KRK EKSLEVVWR 
Sbjct  155  EEFNVTPRIGWQIDPFGHSAVQAYLLGAEAGFDSLFFARIDYQDREKRKNEKSLEVVWRG  214

Query  182  SKSLGTSSQIFAGAFPENYEPPS-GFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKSLG+S+QIFAGAFP+NYEPP+  FYFEVND+SP+VQDD DLFDYNVP+RVN+FV+AA+
Sbjct  215  SKSLGSSAQIFAGAFPKNYEPPTDNFYFEVNDESPIVQDDMDLFDYNVPDRVNEFVSAAI  274

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            SQANITRTNH+MWTMGTDFKYQYA+SWFR +DK IHYVNQDGRVNALYSTPSIYTDAKYA
Sbjct  275  SQANITRTNHIMWTMGTDFKYQYANSWFRQMDKFIHYVNQDGRVNALYSTPSIYTDAKYA  334

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            +++SWP+K++D+FPYAD+ NAYWTGYF
Sbjct  335  ANESWPIKSDDFFPYADKVNAYWTGYF  361



>gb|KDO43587.1| hypothetical protein CISIN_1g0020361mg, partial [Citrus sinensis]
Length=586

 Score =   369 bits (948),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 190/206 (92%), Gaps = 1/206 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +F VTPRIGWQIDPFGHSAVQAYLLG+EVGFDS ++GRIDYQDRAKRK EKSLEVVW+ S
Sbjct  48   EFGVTPRIGWQIDPFGHSAVQAYLLGSEVGFDSFFYGRIDYQDRAKRKNEKSLEVVWQGS  107

Query  185  KSLGTSSQIFAGAFPENYEPP-SGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            +SLG+S+QIFAGAFPENYEPP  GFYFEVND  P++QD+  LFDYNV +RVNDFVAAA+S
Sbjct  108  RSLGSSAQIFAGAFPENYEPPPGGFYFEVNDKYPIIQDNIKLFDYNVQDRVNDFVAAAIS  167

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDFKYQYA +WFR LDK IHYVN DGRVNALYSTPSIYTDAKYAS
Sbjct  168  QANITRTNHIMWTMGTDFKYQYARTWFRQLDKFIHYVNMDGRVNALYSTPSIYTDAKYAS  227

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWPLKT+D+FPYADR +AYWTGYF
Sbjct  228  NESWPLKTDDFFPYADRAHAYWTGYF  253



>ref|XP_008239559.1| PREDICTED: lysosomal alpha-mannosidase-like isoform X1 [Prunus 
mume]
Length=1017

 Score =   380 bits (977),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 172/207 (83%), Positives = 196/207 (95%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++FNVTPRIGWQIDPFGHSAVQAYLLGAE GFDSL+F RIDYQDR KRK EKSLEVVWR 
Sbjct  155  EEFNVTPRIGWQIDPFGHSAVQAYLLGAEAGFDSLFFARIDYQDREKRKNEKSLEVVWRG  214

Query  182  SKSLGTSSQIFAGAFPENYEPPS-GFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKSLG+S+QIFAGAFP+NYEPP+  FYFEVND+SP+VQDD DLFDYNVP+RVN+FV+AA+
Sbjct  215  SKSLGSSAQIFAGAFPKNYEPPTDNFYFEVNDESPIVQDDMDLFDYNVPDRVNEFVSAAI  274

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            SQANITRTNH+MWTMGTDFKYQYA+SWFR +DK IHYVNQDGRVNALYSTPSIYTDAKYA
Sbjct  275  SQANITRTNHIMWTMGTDFKYQYANSWFRQMDKFIHYVNQDGRVNALYSTPSIYTDAKYA  334

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            +++SWP+K++D+FPYAD+ NAYWTGYF
Sbjct  335  ANESWPIKSDDFFPYADKVNAYWTGYF  361



>emb|CDX78550.1| BnaA03g04620D [Brassica napus]
Length=1020

 Score =   380 bits (976),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 174/207 (84%), Positives = 195/207 (94%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++FNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDS++FGRIDYQDR KRKG+KSLEVVWR 
Sbjct  157  REFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSVFFGRIDYQDREKRKGDKSLEVVWRG  216

Query  182  SKSLGTSSQIFAGAFPENYEPP-SGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKSLG+SSQIFAGAFP+NYEPP  GFY+E+ DDSPVVQDD DLFDYNV ERVN FVAAAL
Sbjct  217  SKSLGSSSQIFAGAFPKNYEPPPGGFYYEITDDSPVVQDDPDLFDYNVQERVNAFVAAAL  276

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
             QANITRTNH+M+TMGTDF+YQYAH+WFR +DKL+HYVN DGR+NALYSTPSIYTDAK+A
Sbjct  277  DQANITRTNHIMFTMGTDFRYQYAHTWFRQMDKLLHYVNLDGRINALYSTPSIYTDAKHA  336

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            ++++WPLKTEDYFPYADR NAYWTGYF
Sbjct  337  ANEAWPLKTEDYFPYADRINAYWTGYF  363



>ref|XP_009378044.1| PREDICTED: lysosomal alpha-mannosidase-like [Pyrus x bretschneideri]
Length=1027

 Score =   380 bits (976),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F+VTPRIGWQIDPFGHSAVQAYLLGAE GFDSL+FGRIDYQDRAKRK +KSLE +W+ 
Sbjct  156  KEFDVTPRIGWQIDPFGHSAVQAYLLGAEAGFDSLFFGRIDYQDRAKRKNDKSLEFIWQG  215

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSLG+S+QIF+GAFPE YEPPSGFYFEVNDDSP+VQDD  LFDYNV +RVNDFVA A+S
Sbjct  216  SKSLGSSAQIFSGAFPEAYEPPSGFYFEVNDDSPIVQDDITLFDYNVHDRVNDFVATAVS  275

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDF YQYAH+WFR +DKLIHYVN DGRVNALYSTPSIYTDAKYA+
Sbjct  276  QANITRTNHIMWTMGTDFMYQYAHTWFRQMDKLIHYVNMDGRVNALYSTPSIYTDAKYAT  335

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWP+KT D+FPYADR NAYWTGYF
Sbjct  336  NESWPIKTGDFFPYADRTNAYWTGYF  361



>emb|CDX70531.1| BnaC03g06150D [Brassica napus]
Length=1020

 Score =   380 bits (976),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 174/207 (84%), Positives = 195/207 (94%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++FNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDS++FGRIDYQDR KRKG+KSLEVVWR 
Sbjct  157  REFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSVFFGRIDYQDREKRKGDKSLEVVWRG  216

Query  182  SKSLGTSSQIFAGAFPENYEPP-SGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKSLG+SSQIFAGAFP+NYEPP  GFY+E+ DDSPVVQDD DLFDYNV ERVN FVAAAL
Sbjct  217  SKSLGSSSQIFAGAFPKNYEPPPGGFYYEITDDSPVVQDDPDLFDYNVQERVNAFVAAAL  276

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
             QANITRTNH+M+TMGTDF+YQYAH+WFR +DKL+HYVN DGR+NALYSTPSIYTDAK+A
Sbjct  277  DQANITRTNHIMFTMGTDFRYQYAHTWFRQMDKLLHYVNLDGRINALYSTPSIYTDAKHA  336

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            ++++WPLKTEDYFPYADR NAYWTGYF
Sbjct  337  ANEAWPLKTEDYFPYADRINAYWTGYF  363



>ref|XP_007210406.1| hypothetical protein PRUPE_ppa000755mg [Prunus persica]
 gb|EMJ11605.1| hypothetical protein PRUPE_ppa000755mg [Prunus persica]
Length=1014

 Score =   379 bits (974),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 171/207 (83%), Positives = 196/207 (95%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++FN+TPRIGWQIDPFGHSAVQAYLLGAE GFDSL+F RIDYQDR KRK EKSLEVVWR 
Sbjct  155  EEFNMTPRIGWQIDPFGHSAVQAYLLGAEAGFDSLFFARIDYQDREKRKNEKSLEVVWRG  214

Query  182  SKSLGTSSQIFAGAFPENYEPPS-GFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKSLG+S+QIFAGAFP+NYEPP+  FYFEVND+SP+VQDD DLFDYNVP+RVN+FV+AA+
Sbjct  215  SKSLGSSAQIFAGAFPKNYEPPTDNFYFEVNDESPIVQDDMDLFDYNVPDRVNEFVSAAI  274

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            SQANITRTNH+MWTMGTDFKYQYA+SWFR +DK IHYVNQDGRVNALYSTPSIYTDAKYA
Sbjct  275  SQANITRTNHIMWTMGTDFKYQYANSWFRQMDKFIHYVNQDGRVNALYSTPSIYTDAKYA  334

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            +++SWP+K++D+FPYAD+ NAYWTGYF
Sbjct  335  ANESWPIKSDDFFPYADKVNAYWTGYF  361



>gb|AGX24942.1| a-mannosidase [Cucumis melo]
Length=1020

 Score =   379 bits (974),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F+VTP +GWQIDPFGHSAVQAYLLGAEVGFDS +FGRIDYQDRAKRK EKSLEVVW+ 
Sbjct  156  EEFDVTPTVGWQIDPFGHSAVQAYLLGAEVGFDSFFFGRIDYQDRAKRKIEKSLEVVWQG  215

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSLG+S+QIFAGAFPENYEPPSGFYFEVND SP+VQDD +LFDYNV +RVNDFVAAA++
Sbjct  216  SKSLGSSAQIFAGAFPENYEPPSGFYFEVNDASPIVQDDINLFDYNVQDRVNDFVAAAVA  275

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDFKYQYAH+WFR LDKLIHYVN+DGRVNALYSTPS+YT AKYA+
Sbjct  276  QANITRTNHIMWTMGTDFKYQYAHTWFRQLDKLIHYVNKDGRVNALYSTPSVYTSAKYAT  335

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            +  WP+KT+D+FPYADR NAYWTGYF
Sbjct  336  NSYWPVKTDDFFPYADRVNAYWTGYF  361



>ref|XP_008465523.1| PREDICTED: lysosomal alpha-mannosidase [Cucumis melo]
Length=1020

 Score =   379 bits (974),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F+VTP +GWQIDPFGHSAVQAYLLGAEVGFDS +FGRIDYQDRAKRK EKSLEVVW+ 
Sbjct  156  EEFDVTPTVGWQIDPFGHSAVQAYLLGAEVGFDSFFFGRIDYQDRAKRKIEKSLEVVWQG  215

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSLG+S+QIFAGAFPENYEPPSGFYFEVND SP+VQDD +LFDYNV +RVNDFVAAA++
Sbjct  216  SKSLGSSAQIFAGAFPENYEPPSGFYFEVNDASPIVQDDINLFDYNVQDRVNDFVAAAVA  275

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDFKYQYAH+WFR LDKLIHYVN+DGRVNALYSTPS+YT AKYA+
Sbjct  276  QANITRTNHIMWTMGTDFKYQYAHTWFRQLDKLIHYVNKDGRVNALYSTPSVYTSAKYAT  335

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            +  WP+KT+D+FPYADR NAYWTGYF
Sbjct  336  NSYWPVKTDDFFPYADRVNAYWTGYF  361



>ref|XP_010453503.1| PREDICTED: lysosomal alpha-mannosidase-like [Camelina sativa]
Length=1024

 Score =   379 bits (973),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 175/207 (85%), Positives = 194/207 (94%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++FNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDS++FGRIDYQDR KRK EKSLEV+WR 
Sbjct  155  REFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSVFFGRIDYQDREKRKKEKSLEVIWRG  214

Query  182  SKSLGTSSQIFAGAFPENYEPP-SGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKSLG+SSQIFAGAFP+NYEPP  GFY+E+NDDSPVVQDD DLFDYNV ERVN FVAAAL
Sbjct  215  SKSLGSSSQIFAGAFPKNYEPPPGGFYYEINDDSPVVQDDPDLFDYNVQERVNAFVAAAL  274

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
             QANITRT+H+M+TMGTDF+YQYAHSWFR +DKLIHYVN DGRVNA YSTPSIYTDAK+A
Sbjct  275  DQANITRTDHIMFTMGTDFRYQYAHSWFRQMDKLIHYVNLDGRVNAFYSTPSIYTDAKHA  334

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            ++++WPLKTEDYFPYADR NAYWTGYF
Sbjct  335  ANEAWPLKTEDYFPYADRINAYWTGYF  361



>ref|XP_011033761.1| PREDICTED: alpha-mannosidase-like isoform X2 [Populus euphratica]
Length=891

 Score =   376 bits (965),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 172/207 (83%), Positives = 191/207 (92%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            + F VTPR+GWQIDPFGHSAVQAYLLG E+GFDSL+FGRIDYQDRAKRK EKSLEVVW+A
Sbjct  27   KDFGVTPRVGWQIDPFGHSAVQAYLLGVEIGFDSLFFGRIDYQDRAKRKNEKSLEVVWQA  86

Query  182  SKSLGTSSQIFAGAFPENYEPP-SGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKS G+S+QIFAGAFPENYEPP  GFYFEVND SPVVQDD +LFDYNV ERV+DFV+AA+
Sbjct  87   SKSFGSSAQIFAGAFPENYEPPPGGFYFEVNDPSPVVQDDINLFDYNVQERVDDFVSAAV  146

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            SQANITRTNH+MWTMGTDFKYQYAHSWFR +DKLIHYVN DGRVNALYSTPSIYTDAK+A
Sbjct  147  SQANITRTNHIMWTMGTDFKYQYAHSWFRQMDKLIHYVNMDGRVNALYSTPSIYTDAKHA  206

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            +++ WP+KT D+FPYADR N YWTGYF
Sbjct  207  TNEHWPVKTGDFFPYADRANGYWTGYF  233



>gb|KDP22539.1| hypothetical protein JCGZ_26370 [Jatropha curcas]
Length=1011

 Score =   378 bits (971),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 172/207 (83%), Positives = 195/207 (94%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            Q+FNVTPRIGWQIDPFGHSAVQ+YLLGAEVGFDSL+F RIDYQDRAKRK +KSLEVVW+ 
Sbjct  153  QEFNVTPRIGWQIDPFGHSAVQSYLLGAEVGFDSLFFARIDYQDRAKRKDKKSLEVVWQG  212

Query  182  SKSLGTSSQIFAGAFPENYEPPS-GFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKSLG+S+QIFAGAFP+NYEPPS  FYFEV+D+SP+VQDD +LFDYNVP+RVN+FV+AA+
Sbjct  213  SKSLGSSAQIFAGAFPKNYEPPSDNFYFEVDDESPIVQDDVNLFDYNVPDRVNEFVSAAM  272

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            +QANITRTNH+MWTMGTDFKYQYAH+WF+ +DK IHYVNQDGRVNALYSTPSIYTDAKYA
Sbjct  273  TQANITRTNHIMWTMGTDFKYQYAHTWFKQMDKFIHYVNQDGRVNALYSTPSIYTDAKYA  332

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            +  SWPLKT+DYFPYAD  NAYWTGYF
Sbjct  333  TKDSWPLKTDDYFPYADDVNAYWTGYF  359



>ref|XP_009131373.1| PREDICTED: lysosomal alpha-mannosidase [Brassica rapa]
Length=1020

 Score =   378 bits (971),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 174/207 (84%), Positives = 194/207 (94%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++FNVTPRIGWQIDPFGHSAVQAYLLGA VGFDS++FGRIDYQDR KRKG+KSLEVVWR 
Sbjct  157  REFNVTPRIGWQIDPFGHSAVQAYLLGAGVGFDSVFFGRIDYQDREKRKGDKSLEVVWRG  216

Query  182  SKSLGTSSQIFAGAFPENYEPP-SGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKSLG+SSQIFAGAFP+NYEPP  GFY+E+ DDSPVVQDD DLFDYNV ERVN FVAAAL
Sbjct  217  SKSLGSSSQIFAGAFPKNYEPPPGGFYYEITDDSPVVQDDPDLFDYNVQERVNAFVAAAL  276

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
             QANITRTNH+M+TMGTDF+YQYAH+WFR +DKL+HYVN DGRVNALYSTPSIYTDAK+A
Sbjct  277  DQANITRTNHIMFTMGTDFRYQYAHTWFRQMDKLLHYVNLDGRVNALYSTPSIYTDAKHA  336

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            ++++WPLKTEDYFPYADR NAYWTGYF
Sbjct  337  ANEAWPLKTEDYFPYADRINAYWTGYF  363



>ref|XP_002321075.2| glycosyl hydrolase family 38 family protein [Populus trichocarpa]
 gb|EEE99390.2| glycosyl hydrolase family 38 family protein [Populus trichocarpa]
Length=1009

 Score =   378 bits (970),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 173/207 (84%), Positives = 192/207 (93%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            + F VTPR+GWQIDPFGHSAVQAY+LGAE+GFDSL+FGRIDYQDRAKRK EKSLEVVW+A
Sbjct  154  KDFGVTPRVGWQIDPFGHSAVQAYMLGAEIGFDSLFFGRIDYQDRAKRKNEKSLEVVWQA  213

Query  182  SKSLGTSSQIFAGAFPENYEPP-SGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKS G+S+QIFAGAFPENYEPP  GFYFEVND SPVVQDD +LFDYNV ERV+DFVAAA+
Sbjct  214  SKSFGSSAQIFAGAFPENYEPPPGGFYFEVNDPSPVVQDDINLFDYNVQERVDDFVAAAV  273

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            SQANITRTNH+MWTMGTDFKYQYAHSWFR +DKLIHYVN DGRVNALYSTPSIYTDAK+A
Sbjct  274  SQANITRTNHIMWTMGTDFKYQYAHSWFRQMDKLIHYVNMDGRVNALYSTPSIYTDAKHA  333

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            +++ WP+KT D+FPYADR N YWTGYF
Sbjct  334  TNEHWPVKTGDFFPYADRANGYWTGYF  360



>ref|XP_006399901.1| hypothetical protein EUTSA_v10012546mg [Eutrema salsugineum]
 gb|ESQ41354.1| hypothetical protein EUTSA_v10012546mg [Eutrema salsugineum]
Length=914

 Score =   375 bits (964),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 172/207 (83%), Positives = 194/207 (94%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++FNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDS++FGRIDYQDR KRK EKSLEV+WR 
Sbjct  161  REFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSVFFGRIDYQDREKRKKEKSLEVIWRG  220

Query  182  SKSLGTSSQIFAGAFPENYEPP-SGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKSLG+SSQIFAGAFP+NYEPP  GFY+E+ DDSPVVQDD DLFDYNV ERVN FVAAAL
Sbjct  221  SKSLGSSSQIFAGAFPKNYEPPPGGFYYEITDDSPVVQDDPDLFDYNVQERVNAFVAAAL  280

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
             QANITRT+H+M+TMGTDF+YQYAH+WFR +DKL+HYVN DGR+NALYSTPSIYTDAK+A
Sbjct  281  DQANITRTDHIMFTMGTDFRYQYAHTWFRQMDKLLHYVNLDGRINALYSTPSIYTDAKHA  340

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            ++++WPLKTEDYFPYADR NAYWTGYF
Sbjct  341  ANKAWPLKTEDYFPYADRINAYWTGYF  367



>ref|XP_010492186.1| PREDICTED: lysosomal alpha-mannosidase-like [Camelina sativa]
Length=1024

 Score =   378 bits (970),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 174/207 (84%), Positives = 194/207 (94%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++FNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDS++FGRIDYQDR KRK EKSLEV+WR 
Sbjct  155  REFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSVFFGRIDYQDREKRKKEKSLEVIWRG  214

Query  182  SKSLGTSSQIFAGAFPENYEPP-SGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKSLG+SSQIFAGAFP+NYEPP  GFY+E+NDDSPVVQDD DLFDYNV ERVN FVAAAL
Sbjct  215  SKSLGSSSQIFAGAFPKNYEPPPGGFYYEINDDSPVVQDDPDLFDYNVQERVNAFVAAAL  274

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
             QANITRT+H+M+TMGTDF+YQYAH+WFR +DKLIHYVN DGRVNA YSTPSIYTDAK+A
Sbjct  275  DQANITRTDHIMFTMGTDFRYQYAHTWFRQMDKLIHYVNLDGRVNAFYSTPSIYTDAKHA  334

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            ++++WPLKTEDYFPYADR NAYWTGYF
Sbjct  335  ANEAWPLKTEDYFPYADRINAYWTGYF  361



>gb|KDO43582.1| hypothetical protein CISIN_1g0020361mg, partial [Citrus sinensis]
 gb|KDO43583.1| hypothetical protein CISIN_1g0020361mg, partial [Citrus sinensis]
 gb|KDO43584.1| hypothetical protein CISIN_1g0020361mg, partial [Citrus sinensis]
 gb|KDO43585.1| hypothetical protein CISIN_1g0020361mg, partial [Citrus sinensis]
 gb|KDO43586.1| hypothetical protein CISIN_1g0020361mg, partial [Citrus sinensis]
Length=697

 Score =   370 bits (949),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 190/206 (92%), Gaps = 1/206 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +F VTPRIGWQIDPFGHSAVQAYLLG+EVGFDS ++GRIDYQDRAKRK EKSLEVVW+ S
Sbjct  159  EFGVTPRIGWQIDPFGHSAVQAYLLGSEVGFDSFFYGRIDYQDRAKRKNEKSLEVVWQGS  218

Query  185  KSLGTSSQIFAGAFPENYEPP-SGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            +SLG+S+QIFAGAFPENYEPP  GFYFEVND  P++QD+  LFDYNV +RVNDFVAAA+S
Sbjct  219  RSLGSSAQIFAGAFPENYEPPPGGFYFEVNDKYPIIQDNIKLFDYNVQDRVNDFVAAAIS  278

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDFKYQYA +WFR LDK IHYVN DGRVNALYSTPSIYTDAKYAS
Sbjct  279  QANITRTNHIMWTMGTDFKYQYARTWFRQLDKFIHYVNMDGRVNALYSTPSIYTDAKYAS  338

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWPLKT+D+FPYADR +AYWTGYF
Sbjct  339  NESWPLKTDDFFPYADRAHAYWTGYF  364



>ref|XP_009339044.1| PREDICTED: lysosomal alpha-mannosidase-like isoform X1 [Pyrus 
x bretschneideri]
Length=1022

 Score =   378 bits (970),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 174/207 (84%), Positives = 195/207 (94%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            Q+FNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSL+F RIDYQDRAKR G+KSLEVVWR 
Sbjct  166  QEFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLFFARIDYQDRAKRMGDKSLEVVWRG  225

Query  182  SKSLGTSSQIFAGAFPENYEPPS-GFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKSLG+S+QIFA AFP+NYEPPS  FYFEV+D SP+VQDDT LFDYNVP+RVNDFV+AA+
Sbjct  226  SKSLGSSAQIFADAFPKNYEPPSDNFYFEVDDPSPIVQDDTFLFDYNVPDRVNDFVSAAM  285

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            SQANITRTNH+MWTMGTDFKYQYA++WFR +DK IHYVNQDGRVNALYSTPSIYTDAKYA
Sbjct  286  SQANITRTNHIMWTMGTDFKYQYANTWFRQMDKFIHYVNQDGRVNALYSTPSIYTDAKYA  345

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            +++SWP+KT+D+FPYAD  NAYWTGYF
Sbjct  346  ANESWPIKTDDFFPYADIVNAYWTGYF  372



>ref|XP_010420018.1| PREDICTED: lysosomal alpha-mannosidase-like [Camelina sativa]
Length=1024

 Score =   377 bits (969),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 174/207 (84%), Positives = 194/207 (94%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++FNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDS++FGRIDYQDR KRK EKSLEV+WR 
Sbjct  155  REFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSVFFGRIDYQDREKRKKEKSLEVIWRG  214

Query  182  SKSLGTSSQIFAGAFPENYEPP-SGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKSLG+SSQIFAGAFP+NYEPP  GFY+E+NDDSPVVQDD DLFDYNV ERVN FV+AAL
Sbjct  215  SKSLGSSSQIFAGAFPKNYEPPPGGFYYEINDDSPVVQDDPDLFDYNVQERVNAFVSAAL  274

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
             QANITRT+H+M+TMGTDF+YQYAHSWFR +DKLIHYVN DGRVNA YSTPSIYTDAK+A
Sbjct  275  DQANITRTDHIMFTMGTDFRYQYAHSWFRQMDKLIHYVNLDGRVNAFYSTPSIYTDAKHA  334

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            ++++WPLKTEDYFPYADR NAYWTGYF
Sbjct  335  ANEAWPLKTEDYFPYADRINAYWTGYF  361



>ref|XP_004143760.1| PREDICTED: lysosomal alpha-mannosidase-like [Cucumis sativus]
 gb|KGN51129.1| hypothetical protein Csa_5G458290 [Cucumis sativus]
Length=1020

 Score =   377 bits (969),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F+VTP +GWQIDPFGHSAVQAYLLGAEVGFDS +FGRIDYQDRAKRK EKSLEVVW+ 
Sbjct  156  EEFDVTPTVGWQIDPFGHSAVQAYLLGAEVGFDSFFFGRIDYQDRAKRKIEKSLEVVWQG  215

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSLG+S+QIFAGAFPENYEPPSGFYFEVND SP+VQDD +LFDYNV +RVNDFVAAA++
Sbjct  216  SKSLGSSAQIFAGAFPENYEPPSGFYFEVNDASPIVQDDINLFDYNVQDRVNDFVAAAVA  275

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QA ITRTNH+MWTMGTDFKYQYAH+WFR LDKLIHYVN+DGRVNALYSTPS+YT AKYA+
Sbjct  276  QAKITRTNHIMWTMGTDFKYQYAHTWFRQLDKLIHYVNKDGRVNALYSTPSVYTSAKYAT  335

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            +  WP+KT+D+FPYADR NAYWTGYF
Sbjct  336  NSFWPVKTDDFFPYADRVNAYWTGYF  361



>gb|KDO51271.1| hypothetical protein CISIN_1g001813mg [Citrus sinensis]
Length=883

 Score =   374 bits (959),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 170/207 (82%), Positives = 190/207 (92%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFNVTPRIGWQIDPFGHSAVQAYLL AEVGFD L+F RIDYQDRAKR  EK+LEVVWRA
Sbjct  27   EQFNVTPRIGWQIDPFGHSAVQAYLLSAEVGFDFLFFARIDYQDRAKRINEKTLEVVWRA  86

Query  182  SKSLGTSSQIFAGAFPENYEPPS-GFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKSLG+S+QI  G  P+NYEPPS  FYFEV D SP+VQDD +LFDYNVPERVNDFV+AA+
Sbjct  87   SKSLGSSAQIMTGISPKNYEPPSDNFYFEVGDTSPIVQDDMNLFDYNVPERVNDFVSAAI  146

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            +QANITRTNH+MWTMGTDFKYQYAH+WFR +DK IHYVNQDGRVNALYSTPS+Y DAKYA
Sbjct  147  AQANITRTNHIMWTMGTDFKYQYAHTWFRQMDKFIHYVNQDGRVNALYSTPSMYIDAKYA  206

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            +++SWPLKT+D+FPYADRENAYWTGYF
Sbjct  207  ANESWPLKTDDFFPYADRENAYWTGYF  233



>gb|KFK25632.1| hypothetical protein AALP_AA8G139900 [Arabis alpina]
Length=1021

 Score =   377 bits (967),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 173/207 (84%), Positives = 194/207 (94%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++FNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDS++FGRIDYQDR KRK EKSLEV+WR 
Sbjct  155  REFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSVFFGRIDYQDRVKRKIEKSLEVIWRG  214

Query  182  SKSLGTSSQIFAGAFPENYEPP-SGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKSLG+SSQIFAGAFP+NYEPP  GFY+E+ DDSPVVQD+ DLFDYNV ERVN FVAAAL
Sbjct  215  SKSLGSSSQIFAGAFPKNYEPPPGGFYYEITDDSPVVQDNPDLFDYNVQERVNAFVAAAL  274

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
             QANITRTNH+M+TMGTDF+YQYAH+WFR +DKL+HYVN DGRVNALYSTPSIYTDAK+A
Sbjct  275  DQANITRTNHIMFTMGTDFRYQYAHTWFRQMDKLLHYVNLDGRVNALYSTPSIYTDAKHA  334

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            ++++WPLKTEDYFPYADR NAYWTGYF
Sbjct  335  ANEAWPLKTEDYFPYADRINAYWTGYF  361



>ref|XP_011083026.1| PREDICTED: alpha-mannosidase-like [Sesamum indicum]
Length=1014

 Score =   376 bits (966),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 174/207 (84%), Positives = 193/207 (93%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFD+L+FGRIDYQDRAKR+ +K LEV+W+ 
Sbjct  156  EQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDALFFGRIDYQDRAKRRDDKKLEVIWQG  215

Query  182  SKSLGTSSQIFAGAF-PENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKS G+SSQIFAGAF   NYEPP+GFYFEVNDDSPVVQDD +LFDYNV ERVNDFVAAA 
Sbjct  216  SKSHGSSSQIFAGAFYAGNYEPPTGFYFEVNDDSPVVQDDINLFDYNVQERVNDFVAAAF  275

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            SQAN+TR+NHVMWTMGTDFKYQYA +WFRN+DKLIHYVNQDGRVNALYSTPS+YTD K+A
Sbjct  276  SQANVTRSNHVMWTMGTDFKYQYAETWFRNMDKLIHYVNQDGRVNALYSTPSLYTDTKHA  335

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
             ++SWPLKT+DYFPYADR NAYWTGYF
Sbjct  336  LNESWPLKTDDYFPYADRINAYWTGYF  362



>ref|XP_008374165.1| PREDICTED: lysosomal alpha-mannosidase-like [Malus domestica]
Length=1000

 Score =   375 bits (964),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 173/207 (84%), Positives = 192/207 (93%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            Q+FNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSL+F RIDYQDRAKRK EKSLEVVWR 
Sbjct  160  QEFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLFFARIDYQDRAKRKNEKSLEVVWRG  219

Query  182  SKSLGTSSQIFAGAFPENYEPPSG-FYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKSLG+S+QIFAGAFPENY PP+  FYFEV+D SP+VQDDTDL DYNV ERVNDFV+AA+
Sbjct  220  SKSLGSSAQIFAGAFPENYGPPTNDFYFEVDDISPIVQDDTDLSDYNVLERVNDFVSAAI  279

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            SQANITRTNH+MWTMG+DFKYQYAHSWF  +DK IHYVNQDGRVNALYSTPSIYTDAK+A
Sbjct  280  SQANITRTNHIMWTMGSDFKYQYAHSWFLQMDKFIHYVNQDGRVNALYSTPSIYTDAKHA  339

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            +++ WP+KT D+FPYAD+EN YWTGYF
Sbjct  340  TNEPWPIKTGDFFPYADKENIYWTGYF  366



>ref|XP_006399902.1| hypothetical protein EUTSA_v10012546mg [Eutrema salsugineum]
 gb|ESQ41355.1| hypothetical protein EUTSA_v10012546mg [Eutrema salsugineum]
Length=1026

 Score =   376 bits (966),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 172/207 (83%), Positives = 194/207 (94%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++FNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDS++FGRIDYQDR KRK EKSLEV+WR 
Sbjct  161  REFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSVFFGRIDYQDREKRKKEKSLEVIWRG  220

Query  182  SKSLGTSSQIFAGAFPENYEPP-SGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKSLG+SSQIFAGAFP+NYEPP  GFY+E+ DDSPVVQDD DLFDYNV ERVN FVAAAL
Sbjct  221  SKSLGSSSQIFAGAFPKNYEPPPGGFYYEITDDSPVVQDDPDLFDYNVQERVNAFVAAAL  280

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
             QANITRT+H+M+TMGTDF+YQYAH+WFR +DKL+HYVN DGR+NALYSTPSIYTDAK+A
Sbjct  281  DQANITRTDHIMFTMGTDFRYQYAHTWFRQMDKLLHYVNLDGRINALYSTPSIYTDAKHA  340

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            ++++WPLKTEDYFPYADR NAYWTGYF
Sbjct  341  ANKAWPLKTEDYFPYADRINAYWTGYF  367



>ref|XP_002871594.1| glycosyl hydrolase family 38 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47853.1| glycosyl hydrolase family 38 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=1024

 Score =   376 bits (965),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 173/207 (84%), Positives = 193/207 (93%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++FNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDS++FGRIDYQDR KRK EKSLEV+WR 
Sbjct  155  REFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSVFFGRIDYQDREKRKNEKSLEVIWRG  214

Query  182  SKSLGTSSQIFAGAFPENYEPP-SGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKSLG+SSQIFAGAFP+NYEPP  GFY+E+NDDSPVVQDD DLFDYNV ERVN FVAAAL
Sbjct  215  SKSLGSSSQIFAGAFPKNYEPPPGGFYYEINDDSPVVQDDPDLFDYNVQERVNAFVAAAL  274

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
             QANITRTNH+M+TMGTDF+YQYAH+W+R +DKLIHYVN DGRVNA YSTPS YTDAK+A
Sbjct  275  DQANITRTNHIMFTMGTDFRYQYAHTWYRQMDKLIHYVNLDGRVNAFYSTPSTYTDAKHA  334

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            ++++WPLKTEDYFPYADR NAYWTGYF
Sbjct  335  ANEAWPLKTEDYFPYADRINAYWTGYF  361



>ref|XP_002512840.1| lysosomal alpha-mannosidase, putative [Ricinus communis]
 gb|EEF49343.1| lysosomal alpha-mannosidase, putative [Ricinus communis]
Length=977

 Score =   375 bits (962),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 174/206 (84%), Positives = 191/206 (93%), Gaps = 1/206 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +F V PRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRK +KSLEVVW+ S
Sbjct  157  EFGVIPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKIQKSLEVVWQGS  216

Query  185  KSLGTSSQIFAGAFPENYEPP-SGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            KSLG+S+QIFAGAFP+NYEPP  GFYFEVND SPVVQDD +LFDYNV ERV+DFVAAALS
Sbjct  217  KSLGSSAQIFAGAFPQNYEPPPGGFYFEVNDPSPVVQDDINLFDYNVQERVDDFVAAALS  276

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDFK+QYA +WFR +DKLIHYVN DGRVNALYSTPSIYTDAK+A+
Sbjct  277  QANITRTNHIMWTMGTDFKFQYAETWFRQMDKLIHYVNMDGRVNALYSTPSIYTDAKHAT  336

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWP KT D+FPYADR NAYWTGYF
Sbjct  337  NESWPAKTGDFFPYADRANAYWTGYF  362



>ref|XP_011033760.1| PREDICTED: alpha-mannosidase-like isoform X1 [Populus euphratica]
Length=1021

 Score =   375 bits (964),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 172/207 (83%), Positives = 191/207 (92%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            + F VTPR+GWQIDPFGHSAVQAYLLG E+GFDSL+FGRIDYQDRAKRK EKSLEVVW+A
Sbjct  157  KDFGVTPRVGWQIDPFGHSAVQAYLLGVEIGFDSLFFGRIDYQDRAKRKNEKSLEVVWQA  216

Query  182  SKSLGTSSQIFAGAFPENYEPP-SGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKS G+S+QIFAGAFPENYEPP  GFYFEVND SPVVQDD +LFDYNV ERV+DFV+AA+
Sbjct  217  SKSFGSSAQIFAGAFPENYEPPPGGFYFEVNDPSPVVQDDINLFDYNVQERVDDFVSAAV  276

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            SQANITRTNH+MWTMGTDFKYQYAHSWFR +DKLIHYVN DGRVNALYSTPSIYTDAK+A
Sbjct  277  SQANITRTNHIMWTMGTDFKYQYAHSWFRQMDKLIHYVNMDGRVNALYSTPSIYTDAKHA  336

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            +++ WP+KT D+FPYADR N YWTGYF
Sbjct  337  TNEHWPVKTGDFFPYADRANGYWTGYF  363



>gb|KDO51270.1| hypothetical protein CISIN_1g001813mg [Citrus sinensis]
Length=958

 Score =   374 bits (959),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 170/207 (82%), Positives = 190/207 (92%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFNVTPRIGWQIDPFGHSAVQAYLL AEVGFD L+F RIDYQDRAKR  EK+LEVVWRA
Sbjct  102  EQFNVTPRIGWQIDPFGHSAVQAYLLSAEVGFDFLFFARIDYQDRAKRINEKTLEVVWRA  161

Query  182  SKSLGTSSQIFAGAFPENYEPPS-GFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKSLG+S+QI  G  P+NYEPPS  FYFEV D SP+VQDD +LFDYNVPERVNDFV+AA+
Sbjct  162  SKSLGSSAQIMTGISPKNYEPPSDNFYFEVGDTSPIVQDDMNLFDYNVPERVNDFVSAAI  221

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            +QANITRTNH+MWTMGTDFKYQYAH+WFR +DK IHYVNQDGRVNALYSTPS+Y DAKYA
Sbjct  222  AQANITRTNHIMWTMGTDFKYQYAHTWFRQMDKFIHYVNQDGRVNALYSTPSMYIDAKYA  281

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            +++SWPLKT+D+FPYADRENAYWTGYF
Sbjct  282  ANESWPLKTDDFFPYADRENAYWTGYF  308



>gb|KDO51269.1| hypothetical protein CISIN_1g001813mg [Citrus sinensis]
Length=957

 Score =   374 bits (959),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 170/207 (82%), Positives = 190/207 (92%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFNVTPRIGWQIDPFGHSAVQAYLL AEVGFD L+F RIDYQDRAKR  EK+LEVVWRA
Sbjct  101  EQFNVTPRIGWQIDPFGHSAVQAYLLSAEVGFDFLFFARIDYQDRAKRINEKTLEVVWRA  160

Query  182  SKSLGTSSQIFAGAFPENYEPPS-GFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKSLG+S+QI  G  P+NYEPPS  FYFEV D SP+VQDD +LFDYNVPERVNDFV+AA+
Sbjct  161  SKSLGSSAQIMTGISPKNYEPPSDNFYFEVGDTSPIVQDDMNLFDYNVPERVNDFVSAAI  220

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            +QANITRTNH+MWTMGTDFKYQYAH+WFR +DK IHYVNQDGRVNALYSTPS+Y DAKYA
Sbjct  221  AQANITRTNHIMWTMGTDFKYQYAHTWFRQMDKFIHYVNQDGRVNALYSTPSMYIDAKYA  280

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            +++SWPLKT+D+FPYADRENAYWTGYF
Sbjct  281  ANESWPLKTDDFFPYADRENAYWTGYF  307



>ref|XP_010249227.1| PREDICTED: lysosomal alpha-mannosidase-like [Nelumbo nucifera]
 ref|XP_010249228.1| PREDICTED: lysosomal alpha-mannosidase-like [Nelumbo nucifera]
Length=1018

 Score =   375 bits (962),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 171/207 (83%), Positives = 192/207 (93%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            Q+F VTPRIGWQIDPFGHSAVQAYLLGAEVGFDSL+F RIDYQDR+KR  EKSLE VW+ 
Sbjct  154  QEFGVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLFFARIDYQDRSKRSNEKSLEFVWQG  213

Query  182  SKSLGTSSQIFAGAF-PENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SK+LG+S+QIFAGAF   NYEPPSGFYFE+NDDSP+VQDD +LFDYNV ERVNDFVAAA+
Sbjct  214  SKTLGSSAQIFAGAFHAGNYEPPSGFYFEINDDSPIVQDDINLFDYNVQERVNDFVAAAI  273

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
             QAN TRTNH+MWTMGTDFKYQYAH+WFR +DKLIHYVN+DGRVNALYSTPSIYTDAKYA
Sbjct  274  VQANKTRTNHIMWTMGTDFKYQYAHTWFRQMDKLIHYVNKDGRVNALYSTPSIYTDAKYA  333

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            +++SWP+KT+D+FPYADR NAYWTGYF
Sbjct  334  TNESWPIKTDDFFPYADRANAYWTGYF  360



>ref|XP_009368805.1| PREDICTED: lysosomal alpha-mannosidase-like [Pyrus x bretschneideri]
 ref|XP_009368806.1| PREDICTED: lysosomal alpha-mannosidase-like [Pyrus x bretschneideri]
Length=1207

 Score =   378 bits (971),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 174/207 (84%), Positives = 195/207 (94%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            Q+FNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSL+F RIDYQDRAKR G+KSLEVVWR 
Sbjct  351  QEFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLFFARIDYQDRAKRMGDKSLEVVWRG  410

Query  182  SKSLGTSSQIFAGAFPENYEPPS-GFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKSLG+S+QIFA AFP+NYEPPS  FYFEV+D SP+VQDDT LFDYNVP+RVNDFV+AA+
Sbjct  411  SKSLGSSAQIFADAFPKNYEPPSDNFYFEVDDPSPIVQDDTFLFDYNVPDRVNDFVSAAM  470

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            SQANITRTNH+MWTMGTDFKYQYA++WFR +DK IHYVNQDGRVNALYSTPSIYTDAKYA
Sbjct  471  SQANITRTNHIMWTMGTDFKYQYANTWFRQMDKFIHYVNQDGRVNALYSTPSIYTDAKYA  530

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            +++SWP+KT+D+FPYAD  NAYWTGYF
Sbjct  531  ANESWPIKTDDFFPYADIVNAYWTGYF  557



>ref|XP_006485097.1| PREDICTED: lysosomal alpha-mannosidase-like isoform X2 [Citrus 
sinensis]
Length=990

 Score =   374 bits (960),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 170/207 (82%), Positives = 190/207 (92%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFNVTPRIGWQIDPFGHSAVQAYLL AEVGFD L+F RIDYQDRAKR  EK+LEVVWRA
Sbjct  154  EQFNVTPRIGWQIDPFGHSAVQAYLLSAEVGFDFLFFARIDYQDRAKRINEKTLEVVWRA  213

Query  182  SKSLGTSSQIFAGAFPENYEPPS-GFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKSLG+S+QI  G  P+NYEPPS  FYFEV D SP+VQDD +LFDYNVPERVNDFV+AA+
Sbjct  214  SKSLGSSAQIMTGISPKNYEPPSDNFYFEVGDTSPIVQDDMNLFDYNVPERVNDFVSAAI  273

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            +QANITRTNH+MWTMGTDFKYQYAH+WFR +DK IHYVNQDGRVNALYSTPS+Y DAKYA
Sbjct  274  AQANITRTNHIMWTMGTDFKYQYAHTWFRQMDKFIHYVNQDGRVNALYSTPSMYIDAKYA  333

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            +++SWPLKT+D+FPYADRENAYWTGYF
Sbjct  334  ANESWPLKTDDFFPYADRENAYWTGYF  360



>gb|KDO51267.1| hypothetical protein CISIN_1g001813mg [Citrus sinensis]
Length=990

 Score =   374 bits (960),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 170/207 (82%), Positives = 190/207 (92%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFNVTPRIGWQIDPFGHSAVQAYLL AEVGFD L+F RIDYQDRAKR  EK+LEVVWRA
Sbjct  154  EQFNVTPRIGWQIDPFGHSAVQAYLLSAEVGFDFLFFARIDYQDRAKRINEKTLEVVWRA  213

Query  182  SKSLGTSSQIFAGAFPENYEPPS-GFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKSLG+S+QI  G  P+NYEPPS  FYFEV D SP+VQDD +LFDYNVPERVNDFV+AA+
Sbjct  214  SKSLGSSAQIMTGISPKNYEPPSDNFYFEVGDTSPIVQDDMNLFDYNVPERVNDFVSAAI  273

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            +QANITRTNH+MWTMGTDFKYQYAH+WFR +DK IHYVNQDGRVNALYSTPS+Y DAKYA
Sbjct  274  AQANITRTNHIMWTMGTDFKYQYAHTWFRQMDKFIHYVNQDGRVNALYSTPSMYIDAKYA  333

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            +++SWPLKT+D+FPYADRENAYWTGYF
Sbjct  334  ANESWPLKTDDFFPYADRENAYWTGYF  360



>ref|XP_002280858.1| PREDICTED: alpha-mannosidase [Vitis vinifera]
 emb|CBI15752.3| unnamed protein product [Vitis vinifera]
Length=1009

 Score =   374 bits (961),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 192/206 (93%), Gaps = 1/206 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +FN+TPRIGWQIDPFGHSAVQAYLLGAEVGFDS++F RIDYQDRAKRK EKSLEV+W+ S
Sbjct  158  EFNLTPRIGWQIDPFGHSAVQAYLLGAEVGFDSIFFARIDYQDRAKRKDEKSLEVIWQGS  217

Query  185  KSLGTSSQIFAGAFPENYEPP-SGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            ++ G+SSQIFAGAFPENYEPP  GFY+EVNDDSP+VQD+  LFDYNVP+RVN FV AA++
Sbjct  218  RTFGSSSQIFAGAFPENYEPPPGGFYYEVNDDSPIVQDNIKLFDYNVPDRVNAFVEAAIA  277

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDFKYQYA+SWFR +DKLIHYVN DGRVNALYSTPSIYTDAK+A+
Sbjct  278  QANITRTNHIMWTMGTDFKYQYANSWFRQMDKLIHYVNLDGRVNALYSTPSIYTDAKHAA  337

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
             +SWPLKT+DYFPYADR NAYWTGYF
Sbjct  338  SESWPLKTDDYFPYADRINAYWTGYF  363



>gb|KDO51268.1| hypothetical protein CISIN_1g001813mg [Citrus sinensis]
Length=929

 Score =   372 bits (956),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 170/207 (82%), Positives = 190/207 (92%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFNVTPRIGWQIDPFGHSAVQAYLL AEVGFD L+F RIDYQDRAKR  EK+LEVVWRA
Sbjct  154  EQFNVTPRIGWQIDPFGHSAVQAYLLSAEVGFDFLFFARIDYQDRAKRINEKTLEVVWRA  213

Query  182  SKSLGTSSQIFAGAFPENYEPPS-GFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKSLG+S+QI  G  P+NYEPPS  FYFEV D SP+VQDD +LFDYNVPERVNDFV+AA+
Sbjct  214  SKSLGSSAQIMTGISPKNYEPPSDNFYFEVGDTSPIVQDDMNLFDYNVPERVNDFVSAAI  273

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            +QANITRTNH+MWTMGTDFKYQYAH+WFR +DK IHYVNQDGRVNALYSTPS+Y DAKYA
Sbjct  274  AQANITRTNHIMWTMGTDFKYQYAHTWFRQMDKFIHYVNQDGRVNALYSTPSMYIDAKYA  333

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            +++SWPLKT+D+FPYADRENAYWTGYF
Sbjct  334  ANESWPLKTDDFFPYADRENAYWTGYF  360



>ref|XP_010550227.1| PREDICTED: lysosomal alpha-mannosidase [Tarenaya hassleriana]
Length=1016

 Score =   374 bits (960),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 172/207 (83%), Positives = 191/207 (92%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++FNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDS+YFGRIDYQDR KRK EKSLEV+WR 
Sbjct  155  REFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSVYFGRIDYQDRDKRKKEKSLEVIWRG  214

Query  182  SKSLGTSSQIFAGAFPENYEPP-SGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKSLG+S+QIFAGAFP NYEPP  GFYFE+NDDSP+ QDD DLFDYNV ERVN FV+AAL
Sbjct  215  SKSLGSSAQIFAGAFPANYEPPPGGFYFEINDDSPIFQDDPDLFDYNVQERVNAFVSAAL  274

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
             QANITRTNH+M+TMGTDFKYQYAH+WFR +DK IHYVN DGRVN LYSTPSIYTDAK+A
Sbjct  275  DQANITRTNHIMFTMGTDFKYQYAHTWFRQMDKFIHYVNIDGRVNVLYSTPSIYTDAKHA  334

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            ++++WPLKTEDYFPYADR +AYWTGYF
Sbjct  335  ANEAWPLKTEDYFPYADRVDAYWTGYF  361



>ref|XP_006468892.1| PREDICTED: lysosomal alpha-mannosidase-like isoform X2 [Citrus 
sinensis]
Length=915

 Score =   372 bits (954),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 190/206 (92%), Gaps = 1/206 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +F VTPRIGWQIDPFGHSAVQAYLLGAEVGFDS ++GRIDYQDRAKRK EKSLEVVW+ S
Sbjct  48   EFGVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSFFYGRIDYQDRAKRKNEKSLEVVWQGS  107

Query  185  KSLGTSSQIFAGAFPENYEPP-SGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            +SLG+S+QIFAGAFPENYEPP  GFYFEVND  P++QD+  LFDYNV +RVNDFVAAA+S
Sbjct  108  RSLGSSAQIFAGAFPENYEPPPGGFYFEVNDKYPIIQDNIKLFDYNVQDRVNDFVAAAIS  167

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDFKYQYA +WFR LDK IHYVN DGRVNALYSTPSIYTDAKYAS
Sbjct  168  QANITRTNHIMWTMGTDFKYQYARTWFRQLDKFIHYVNMDGRVNALYSTPSIYTDAKYAS  227

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWPLKT+D+FPYADR +AYWTGYF
Sbjct  228  NESWPLKTDDFFPYADRAHAYWTGYF  253



>ref|XP_006436953.1| hypothetical protein CICLE_v10030627mg [Citrus clementina]
 gb|ESR50193.1| hypothetical protein CICLE_v10030627mg [Citrus clementina]
Length=988

 Score =   373 bits (958),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 170/207 (82%), Positives = 190/207 (92%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFNVTPRIGWQIDPFGHSAVQAYLL AEVGFD L+F RIDYQDRAKR  EK+LEVVWRA
Sbjct  132  EQFNVTPRIGWQIDPFGHSAVQAYLLSAEVGFDFLFFARIDYQDRAKRINEKTLEVVWRA  191

Query  182  SKSLGTSSQIFAGAFPENYEPPS-GFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKSLG+S+QI  G  P+NYEPPS  FYFEV D SP+VQDD +LFDYNVPERVNDFV+AA+
Sbjct  192  SKSLGSSAQIMTGISPKNYEPPSDNFYFEVGDTSPIVQDDMNLFDYNVPERVNDFVSAAI  251

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            +QANITRTNH+MWTMGTDFKYQYAH+WFR +DK IHYVNQDGRVNALYSTPS+Y DAKYA
Sbjct  252  AQANITRTNHIMWTMGTDFKYQYAHTWFRQMDKFIHYVNQDGRVNALYSTPSMYIDAKYA  311

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            +++SWPLKT+D+FPYADRENAYWTGYF
Sbjct  312  ANESWPLKTDDFFPYADRENAYWTGYF  338



>ref|XP_006485096.1| PREDICTED: lysosomal alpha-mannosidase-like isoform X1 [Citrus 
sinensis]
Length=1010

 Score =   374 bits (959),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 170/207 (82%), Positives = 190/207 (92%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFNVTPRIGWQIDPFGHSAVQAYLL AEVGFD L+F RIDYQDRAKR  EK+LEVVWRA
Sbjct  154  EQFNVTPRIGWQIDPFGHSAVQAYLLSAEVGFDFLFFARIDYQDRAKRINEKTLEVVWRA  213

Query  182  SKSLGTSSQIFAGAFPENYEPPS-GFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKSLG+S+QI  G  P+NYEPPS  FYFEV D SP+VQDD +LFDYNVPERVNDFV+AA+
Sbjct  214  SKSLGSSAQIMTGISPKNYEPPSDNFYFEVGDTSPIVQDDMNLFDYNVPERVNDFVSAAI  273

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            +QANITRTNH+MWTMGTDFKYQYAH+WFR +DK IHYVNQDGRVNALYSTPS+Y DAKYA
Sbjct  274  AQANITRTNHIMWTMGTDFKYQYAHTWFRQMDKFIHYVNQDGRVNALYSTPSMYIDAKYA  333

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            +++SWPLKT+D+FPYADRENAYWTGYF
Sbjct  334  ANESWPLKTDDFFPYADRENAYWTGYF  360



>gb|KDO51266.1| hypothetical protein CISIN_1g001813mg [Citrus sinensis]
Length=1010

 Score =   373 bits (958),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 170/207 (82%), Positives = 190/207 (92%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFNVTPRIGWQIDPFGHSAVQAYLL AEVGFD L+F RIDYQDRAKR  EK+LEVVWRA
Sbjct  154  EQFNVTPRIGWQIDPFGHSAVQAYLLSAEVGFDFLFFARIDYQDRAKRINEKTLEVVWRA  213

Query  182  SKSLGTSSQIFAGAFPENYEPPS-GFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKSLG+S+QI  G  P+NYEPPS  FYFEV D SP+VQDD +LFDYNVPERVNDFV+AA+
Sbjct  214  SKSLGSSAQIMTGISPKNYEPPSDNFYFEVGDTSPIVQDDMNLFDYNVPERVNDFVSAAI  273

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            +QANITRTNH+MWTMGTDFKYQYAH+WFR +DK IHYVNQDGRVNALYSTPS+Y DAKYA
Sbjct  274  AQANITRTNHIMWTMGTDFKYQYAHTWFRQMDKFIHYVNQDGRVNALYSTPSMYIDAKYA  333

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            +++SWPLKT+D+FPYADRENAYWTGYF
Sbjct  334  ANESWPLKTDDFFPYADRENAYWTGYF  360



>ref|XP_010028936.1| PREDICTED: lysosomal alpha-mannosidase [Eucalyptus grandis]
 gb|KCW55767.1| hypothetical protein EUGRSUZ_I01600 [Eucalyptus grandis]
Length=1016

 Score =   372 bits (956),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F VTPRIGWQIDPFGHSAVQAYLLGAEVGFDS ++GRIDYQDRAKRK EKSLEV+WR 
Sbjct  154  EEFGVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSFFYGRIDYQDRAKRKDEKSLEVIWRG  213

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSLG+SSQIFAGAFP+NYEPPSGFY+EVNDDSP+VQDD  LFDYNV ERVN FVAAA++
Sbjct  214  SKSLGSSSQIFAGAFPQNYEPPSGFYYEVNDDSPIVQDDISLFDYNVEERVNAFVAAAIA  273

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANIT+TNHVMWTMGTDFKYQYAH+W+RN+DKLIHYVN+DGRVNALYSTPSIYTDAKYA+
Sbjct  274  QANITQTNHVMWTMGTDFKYQYAHTWYRNMDKLIHYVNKDGRVNALYSTPSIYTDAKYAA  333

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
             ++WPLKT+D+FPYADR NAYWTGYF
Sbjct  334  KKAWPLKTDDFFPYADRANAYWTGYF  359



>ref|XP_006446932.1| hypothetical protein CICLE_v10014123mg [Citrus clementina]
 gb|ESR60172.1| hypothetical protein CICLE_v10014123mg [Citrus clementina]
Length=973

 Score =   372 bits (954),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 190/206 (92%), Gaps = 1/206 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +F VTPRIGWQIDPFGHSAVQAYLLGAEVGFDS ++GRIDYQDRAKRK EKSLEVVW+ S
Sbjct  159  EFGVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSFFYGRIDYQDRAKRKNEKSLEVVWQGS  218

Query  185  KSLGTSSQIFAGAFPENYEPP-SGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            +SLG+S+QIFAGAFPENYEPP  GFYFEVND  P++QD+  LFDYNV +RVNDFVAAA+S
Sbjct  219  RSLGSSAQIFAGAFPENYEPPPGGFYFEVNDKYPIIQDNIKLFDYNVQDRVNDFVAAAIS  278

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDFKYQYA +WFR LDK IHYVN DGRVNALYSTPSIYTDAKYAS
Sbjct  279  QANITRTNHIMWTMGTDFKYQYARTWFRQLDKFIHYVNMDGRVNALYSTPSIYTDAKYAS  338

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWPLKT+D+FPYADR +AYWTGYF
Sbjct  339  NESWPLKTDDFFPYADRAHAYWTGYF  364



>ref|XP_003602752.1| Lysosomal alpha-mannosidase [Medicago truncatula]
 gb|AES73003.1| glycoside hydrolase family 38 amino-terminal domain protein [Medicago 
truncatula]
Length=1016

 Score =   372 bits (956),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 169/207 (82%), Positives = 191/207 (92%), Gaps = 3/207 (1%)
 Frame = +2

Query  8    FNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRASK  187
            F +TPRIGWQIDPFGHSAVQAYLLGAEVGFDSL+F RIDYQDRAKRK EKSLEVVW+ SK
Sbjct  161  FGITPRIGWQIDPFGHSAVQAYLLGAEVGFDSLFFARIDYQDRAKRKDEKSLEVVWQGSK  220

Query  188  SLGTSSQIFAGAFPENYEPPSGFYFEVNDDS---PVVQDDTDLFDYNVPERVNDFVAAAL  358
            S G+S+QIF+GAFPENYEPP  FY+EVNDDS   P VQDD +LFDYNVP+RVN+FVAAA+
Sbjct  221  SFGSSAQIFSGAFPENYEPPGNFYYEVNDDSEDSPTVQDDINLFDYNVPQRVNEFVAAAM  280

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            SQANITRTNH+MWTMGTDFKYQYAH+W+R LDK IHYVNQDGRV+ALYSTPSIYTDAK+A
Sbjct  281  SQANITRTNHIMWTMGTDFKYQYAHTWYRQLDKFIHYVNQDGRVHALYSTPSIYTDAKHA  340

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            ++++WP+KT+DYFPYADR N YWTGYF
Sbjct  341  ANEAWPIKTDDYFPYADRLNGYWTGYF  367



>ref|XP_003602753.1| Lysosomal alpha-mannosidase [Medicago truncatula]
Length=1023

 Score =   372 bits (956),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 169/207 (82%), Positives = 191/207 (92%), Gaps = 3/207 (1%)
 Frame = +2

Query  8    FNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRASK  187
            F +TPRIGWQIDPFGHSAVQAYLLGAEVGFDSL+F RIDYQDRAKRK EKSLEVVW+ SK
Sbjct  161  FGITPRIGWQIDPFGHSAVQAYLLGAEVGFDSLFFARIDYQDRAKRKDEKSLEVVWQGSK  220

Query  188  SLGTSSQIFAGAFPENYEPPSGFYFEVNDDS---PVVQDDTDLFDYNVPERVNDFVAAAL  358
            S G+S+QIF+GAFPENYEPP  FY+EVNDDS   P VQDD +LFDYNVP+RVN+FVAAA+
Sbjct  221  SFGSSAQIFSGAFPENYEPPGNFYYEVNDDSEDSPTVQDDINLFDYNVPQRVNEFVAAAM  280

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            SQANITRTNH+MWTMGTDFKYQYAH+W+R LDK IHYVNQDGRV+ALYSTPSIYTDAK+A
Sbjct  281  SQANITRTNHIMWTMGTDFKYQYAHTWYRQLDKFIHYVNQDGRVHALYSTPSIYTDAKHA  340

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            ++++WP+KT+DYFPYADR N YWTGYF
Sbjct  341  ANEAWPIKTDDYFPYADRLNGYWTGYF  367



>ref|XP_006446934.1| hypothetical protein CICLE_v10014123mg [Citrus clementina]
 gb|ESR60174.1| hypothetical protein CICLE_v10014123mg [Citrus clementina]
Length=979

 Score =   371 bits (952),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 190/206 (92%), Gaps = 1/206 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +F VTPRIGWQIDPFGHSAVQAYLLGAEVGFDS ++GRIDYQDRAKRK EKSLEVVW+ S
Sbjct  112  EFGVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSFFYGRIDYQDRAKRKNEKSLEVVWQGS  171

Query  185  KSLGTSSQIFAGAFPENYEPP-SGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            +SLG+S+QIFAGAFPENYEPP  GFYFEVND  P++QD+  LFDYNV +RVNDFVAAA+S
Sbjct  172  RSLGSSAQIFAGAFPENYEPPPGGFYFEVNDKYPIIQDNIKLFDYNVQDRVNDFVAAAIS  231

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDFKYQYA +WFR LDK IHYVN DGRVNALYSTPSIYTDAKYAS
Sbjct  232  QANITRTNHIMWTMGTDFKYQYARTWFRQLDKFIHYVNMDGRVNALYSTPSIYTDAKYAS  291

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWPLKT+D+FPYADR +AYWTGYF
Sbjct  292  NESWPLKTDDFFPYADRAHAYWTGYF  317



>ref|XP_006468891.1| PREDICTED: lysosomal alpha-mannosidase-like isoform X1 [Citrus 
sinensis]
Length=1026

 Score =   372 bits (954),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 190/206 (92%), Gaps = 1/206 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +F VTPRIGWQIDPFGHSAVQAYLLGAEVGFDS ++GRIDYQDRAKRK EKSLEVVW+ S
Sbjct  159  EFGVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSFFYGRIDYQDRAKRKNEKSLEVVWQGS  218

Query  185  KSLGTSSQIFAGAFPENYEPP-SGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            +SLG+S+QIFAGAFPENYEPP  GFYFEVND  P++QD+  LFDYNV +RVNDFVAAA+S
Sbjct  219  RSLGSSAQIFAGAFPENYEPPPGGFYFEVNDKYPIIQDNIKLFDYNVQDRVNDFVAAAIS  278

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDFKYQYA +WFR LDK IHYVN DGRVNALYSTPSIYTDAKYAS
Sbjct  279  QANITRTNHIMWTMGTDFKYQYARTWFRQLDKFIHYVNMDGRVNALYSTPSIYTDAKYAS  338

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWPLKT+D+FPYADR +AYWTGYF
Sbjct  339  NESWPLKTDDFFPYADRAHAYWTGYF  364



>ref|XP_006446933.1| hypothetical protein CICLE_v10014123mg [Citrus clementina]
 gb|ESR60173.1| hypothetical protein CICLE_v10014123mg [Citrus clementina]
Length=1026

 Score =   371 bits (953),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 190/206 (92%), Gaps = 1/206 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +F VTPRIGWQIDPFGHSAVQAYLLGAEVGFDS ++GRIDYQDRAKRK EKSLEVVW+ S
Sbjct  159  EFGVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSFFYGRIDYQDRAKRKNEKSLEVVWQGS  218

Query  185  KSLGTSSQIFAGAFPENYEPP-SGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            +SLG+S+QIFAGAFPENYEPP  GFYFEVND  P++QD+  LFDYNV +RVNDFVAAA+S
Sbjct  219  RSLGSSAQIFAGAFPENYEPPPGGFYFEVNDKYPIIQDNIKLFDYNVQDRVNDFVAAAIS  278

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMGTDFKYQYA +WFR LDK IHYVN DGRVNALYSTPSIYTDAKYAS
Sbjct  279  QANITRTNHIMWTMGTDFKYQYARTWFRQLDKFIHYVNMDGRVNALYSTPSIYTDAKYAS  338

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWPLKT+D+FPYADR +AYWTGYF
Sbjct  339  NESWPLKTDDFFPYADRAHAYWTGYF  364



>ref|NP_001031878.1| Glycosyl hydrolase family 38 protein [Arabidopsis thaliana]
 gb|AED91970.1| Glycosyl hydrolase family 38 protein [Arabidopsis thaliana]
Length=921

 Score =   369 bits (946),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 170/207 (82%), Positives = 190/207 (92%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++FNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDS++FGRIDYQDR KR  EK+LEV+WR 
Sbjct  155  REFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSVFFGRIDYQDREKRYKEKTLEVIWRG  214

Query  182  SKSLGTSSQIFAGAFPENYEPP-SGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKSLG+SSQIFAGAFP NYEPP  GFY+E+ DDSPVVQDD DLFDYNV ERVN FVAAAL
Sbjct  215  SKSLGSSSQIFAGAFPTNYEPPPGGFYYEITDDSPVVQDDPDLFDYNVQERVNAFVAAAL  274

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
             QANITR NH+M+TMGTDF+YQYAH+W+R +DKLIHYVN DGRVNA YSTPSIYTDAK+A
Sbjct  275  DQANITRINHIMFTMGTDFRYQYAHTWYRQMDKLIHYVNLDGRVNAFYSTPSIYTDAKHA  334

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            ++++WPLKTEDYFPYADR NAYWTGYF
Sbjct  335  ANEAWPLKTEDYFPYADRINAYWTGYF  361



>ref|NP_196902.2| Glycosyl hydrolase family 38 protein [Arabidopsis thaliana]
 ref|NP_851037.2| Glycosyl hydrolase family 38 protein [Arabidopsis thaliana]
 gb|AAM20555.1| alpha-mannosidase [Arabidopsis thaliana]
 gb|AAN15620.1| alpha-mannosidase [Arabidopsis thaliana]
 gb|AED91968.1| Glycosyl hydrolase family 38 protein [Arabidopsis thaliana]
 gb|AED91969.1| Glycosyl hydrolase family 38 protein [Arabidopsis thaliana]
Length=1024

 Score =   370 bits (949),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 170/207 (82%), Positives = 190/207 (92%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++FNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDS++FGRIDYQDR KR  EK+LEV+WR 
Sbjct  155  REFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSVFFGRIDYQDREKRYKEKTLEVIWRG  214

Query  182  SKSLGTSSQIFAGAFPENYEPP-SGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKSLG+SSQIFAGAFP NYEPP  GFY+E+ DDSPVVQDD DLFDYNV ERVN FVAAAL
Sbjct  215  SKSLGSSSQIFAGAFPTNYEPPPGGFYYEITDDSPVVQDDPDLFDYNVQERVNAFVAAAL  274

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
             QANITR NH+M+TMGTDF+YQYAH+W+R +DKLIHYVN DGRVNA YSTPSIYTDAK+A
Sbjct  275  DQANITRINHIMFTMGTDFRYQYAHTWYRQMDKLIHYVNLDGRVNAFYSTPSIYTDAKHA  334

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            ++++WPLKTEDYFPYADR NAYWTGYF
Sbjct  335  ANEAWPLKTEDYFPYADRINAYWTGYF  361



>dbj|BAB11126.1| alpha-mannosidase [Arabidopsis thaliana]
Length=1030

 Score =   369 bits (948),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 170/207 (82%), Positives = 190/207 (92%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++FNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDS++FGRIDYQDR KR  EK+LEV+WR 
Sbjct  155  REFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSVFFGRIDYQDREKRYKEKTLEVIWRG  214

Query  182  SKSLGTSSQIFAGAFPENYEPP-SGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKSLG+SSQIFAGAFP NYEPP  GFY+E+ DDSPVVQDD DLFDYNV ERVN FVAAAL
Sbjct  215  SKSLGSSSQIFAGAFPTNYEPPPGGFYYEITDDSPVVQDDPDLFDYNVQERVNAFVAAAL  274

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
             QANITR NH+M+TMGTDF+YQYAH+W+R +DKLIHYVN DGRVNA YSTPSIYTDAK+A
Sbjct  275  DQANITRINHIMFTMGTDFRYQYAHTWYRQMDKLIHYVNLDGRVNAFYSTPSIYTDAKHA  334

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            ++++WPLKTEDYFPYADR NAYWTGYF
Sbjct  335  ANEAWPLKTEDYFPYADRINAYWTGYF  361



>ref|XP_010039003.1| PREDICTED: lysosomal alpha-mannosidase-like [Eucalyptus grandis]
Length=948

 Score =   367 bits (941),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 188/206 (91%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F VTPRIGWQID FGHS+VQAYLLGAEVGFDS++F RIDYQDRAKRK EK+LEVVWRA
Sbjct  155  EEFGVTPRIGWQIDSFGHSSVQAYLLGAEVGFDSVFFARIDYQDRAKRKAEKTLEVVWRA  214

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            S SL +S+QIFAGAFPENY PP+ F++EVNDDSP+VQDD +LFDYNV ERVNDFV+AA+S
Sbjct  215  SNSLASSAQIFAGAFPENYGPPNNFHYEVNDDSPIVQDDYNLFDYNVQERVNDFVSAAIS  274

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNHVMWTMG DF+YQYAH+WFR LDK IHYVNQDGRVNALYSTPSIYTDAK+AS
Sbjct  275  QANITRTNHVMWTMGNDFQYQYAHTWFRQLDKFIHYVNQDGRVNALYSTPSIYTDAKHAS  334

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            +  WPLKT D+FPYAD+ N YWTGYF
Sbjct  335  NDQWPLKTGDFFPYADQINVYWTGYF  360



>gb|KCW48512.1| hypothetical protein EUGRSUZ_K02195 [Eucalyptus grandis]
Length=1013

 Score =   366 bits (939),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 188/206 (91%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F VTPRIGWQID FGHS+VQAYLLGAEVGFDS++F RIDYQDRAKRK EK+LEVVWRA
Sbjct  152  EEFGVTPRIGWQIDSFGHSSVQAYLLGAEVGFDSVFFARIDYQDRAKRKAEKTLEVVWRA  211

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            S SL +S+QIFAGAFPENY PP+ F++EVNDDSP+VQDD +LFDYNV ERVNDFV+AA+S
Sbjct  212  SNSLASSAQIFAGAFPENYGPPNNFHYEVNDDSPIVQDDYNLFDYNVQERVNDFVSAAIS  271

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNHVMWTMG DF+YQYAH+WFR LDK IHYVNQDGRVNALYSTPSIYTDAK+AS
Sbjct  272  QANITRTNHVMWTMGNDFQYQYAHTWFRQLDKFIHYVNQDGRVNALYSTPSIYTDAKHAS  331

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            +  WPLKT D+FPYAD+ N YWTGYF
Sbjct  332  NDQWPLKTGDFFPYADQINVYWTGYF  357



>ref|XP_010682967.1| PREDICTED: alpha-mannosidase-like [Beta vulgaris subsp. vulgaris]
Length=1028

 Score =   365 bits (937),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 187/207 (90%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F VTPRIGWQIDPFGHSAVQAYLLGAEVGFDSL+F RIDYQD  KRK EKSLEVVW+ 
Sbjct  166  KEFGVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLFFARIDYQDLEKRKSEKSLEVVWQG  225

Query  182  SKSLGTSSQIFAGAFPE-NYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKSLG ++QIFAGAF + NYEPP GF+FEVNDDSP+VQDD  LFDYNV  RVNDFVAAA+
Sbjct  226  SKSLGATAQIFAGAFCQGNYEPPDGFHFEVNDDSPIVQDDPTLFDYNVQHRVNDFVAAAI  285

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            SQAN+TRTNH+MWTMGTDFKYQYAH+WFR ++KLIHYVN DGRVNALYSTPSIYTDAK+A
Sbjct  286  SQANVTRTNHIMWTMGTDFKYQYAHTWFRQMEKLIHYVNLDGRVNALYSTPSIYTDAKHA  345

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            + +SWP+K +D+FPYADR N YWTGYF
Sbjct  346  TQESWPMKADDFFPYADRINGYWTGYF  372



>gb|KJB33198.1| hypothetical protein B456_006G000300 [Gossypium raimondii]
Length=680

 Score =   355 bits (912),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 159/205 (78%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +FN  PR+GWQIDPFGHSAVQAYLLGAE+GFDSL+F RIDYQDRAKR  EK+LEVVW+ S
Sbjct  162  EFNQIPRVGWQIDPFGHSAVQAYLLGAELGFDSLFFARIDYQDRAKRLKEKTLEVVWQGS  221

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            KSLG+SSQIF G FP +Y+PP GF FE+ND SP +QDD  LFDYNV ERVNDF+AAAL+Q
Sbjct  222  KSLGSSSQIFTGIFPRHYDPPDGFTFEINDVSPPIQDDVLLFDYNVQERVNDFIAAALAQ  281

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            AN+TRTNH+MW MGTDF+YQYA+SWFR +DK IHYVNQDGR+NALYSTPSIYTDAKYA +
Sbjct  282  ANVTRTNHIMWAMGTDFRYQYANSWFRQMDKFIHYVNQDGRINALYSTPSIYTDAKYAEN  341

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
              WPLKT+D+FPYAD+ NAYWTGYF
Sbjct  342  VQWPLKTDDFFPYADKPNAYWTGYF  366



>ref|XP_006446930.1| hypothetical protein CICLE_v10017635mg, partial [Citrus clementina]
 gb|ESR60170.1| hypothetical protein CICLE_v10017635mg, partial [Citrus clementina]
Length=749

 Score =   353 bits (907),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 180/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  8    FNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRASK  187
            F   PR+GWQIDPFGHSAVQAYLLGAE+GFDSLYF RIDYQDRAKR  EK+LEVVWR SK
Sbjct  158  FGKLPRVGWQIDPFGHSAVQAYLLGAELGFDSLYFARIDYQDRAKRLKEKNLEVVWRGSK  217

Query  188  SLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQA  367
            SLG+SSQIF G FP +Y+PP GF FE+ND SP +QDD  LFDYNV ERVNDFVAAAL+QA
Sbjct  218  SLGSSSQIFTGIFPRHYDPPDGFTFEINDVSPPIQDDVLLFDYNVEERVNDFVAAALAQA  277

Query  368  NITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASDQ  547
            N+TRTNH+MW MGTDF+YQYA+SWFR +DK IHYVN+DGRVNALYSTPSIYTDAK A+++
Sbjct  278  NVTRTNHIMWLMGTDFRYQYANSWFRQMDKFIHYVNKDGRVNALYSTPSIYTDAKNAANE  337

Query  548  SWPLKTEDYFPYADRENAYWTGYF  619
             WPLKTED+FPYAD  NAYWTGYF
Sbjct  338  EWPLKTEDFFPYADHPNAYWTGYF  361



>gb|EPS72042.1| alpha-mannosidase, partial [Genlisea aurea]
Length=953

 Score =   358 bits (920),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 188/206 (91%), Gaps = 1/206 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +F VTPRIGWQIDPFGHSAVQAYLLGAEVGFD+L+FGRIDYQDRAKRKG+K+LEVVWR S
Sbjct  132  EFGVTPRIGWQIDPFGHSAVQAYLLGAEVGFDALFFGRIDYQDRAKRKGDKTLEVVWRGS  191

Query  185  KSLGTSSQIFAGAF-PENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            KS G+ SQIFAGAF   NYEPP GFYFEVNDDSP+VQD+ +LFD+NV +RV DFVAAAL 
Sbjct  192  KSRGSLSQIFAGAFYAGNYEPPDGFYFEVNDDSPIVQDNVNLFDFNVHQRVEDFVAAALF  251

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QAN+TR+NH+MWTMGTDFKYQYA SWFRN+DKLI+YVN DGRVNALYSTPS Y DAK+A 
Sbjct  252  QANVTRSNHIMWTMGTDFKYQYAQSWFRNIDKLINYVNLDGRVNALYSTPSFYADAKHAL  311

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            +++WPLKT+D+FPYADR NAYWTGYF
Sbjct  312  NEAWPLKTDDFFPYADRINAYWTGYF  337



>ref|XP_007161616.1| hypothetical protein PHAVU_001G084400g [Phaseolus vulgaris]
 gb|ESW33610.1| hypothetical protein PHAVU_001G084400g [Phaseolus vulgaris]
Length=511

 Score =   345 bits (884),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 156/206 (76%), Positives = 180/206 (87%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F   PR+GWQIDPFGHSAVQAYLLGAE+GFDSL+F RIDYQDRAKR  EK+LEV+W+ 
Sbjct  154  EEFGKVPRVGWQIDPFGHSAVQAYLLGAELGFDSLFFARIDYQDRAKRLKEKTLEVIWQG  213

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
             KSLG+SSQIF G FP +Y+PP GF FE+ND SP +QDD  LFDYNV ERVNDFV AAL+
Sbjct  214  CKSLGSSSQIFTGIFPRHYDPPDGFTFEINDVSPPIQDDILLFDYNVQERVNDFVYAALA  273

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QAN+T+TNH+MWTMGTDF+YQYA+SWFR +DK IHYVNQDGRVNALYSTPSIYTDAKYA+
Sbjct  274  QANVTKTNHMMWTMGTDFRYQYANSWFRQMDKFIHYVNQDGRVNALYSTPSIYTDAKYAA  333

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++ WPLK  D+FPYAD  NAYWTGYF
Sbjct  334  NEYWPLKVGDFFPYADHPNAYWTGYF  359



>gb|KJB33199.1| hypothetical protein B456_006G000300 [Gossypium raimondii]
Length=919

 Score =   355 bits (912),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 159/205 (78%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +FN  PR+GWQIDPFGHSAVQAYLLGAE+GFDSL+F RIDYQDRAKR  EK+LEVVW+ S
Sbjct  162  EFNQIPRVGWQIDPFGHSAVQAYLLGAELGFDSLFFARIDYQDRAKRLKEKTLEVVWQGS  221

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            KSLG+SSQIF G FP +Y+PP GF FE+ND SP +QDD  LFDYNV ERVNDF+AAAL+Q
Sbjct  222  KSLGSSSQIFTGIFPRHYDPPDGFTFEINDVSPPIQDDVLLFDYNVQERVNDFIAAALAQ  281

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            AN+TRTNH+MW MGTDF+YQYA+SWFR +DK IHYVNQDGR+NALYSTPSIYTDAKYA +
Sbjct  282  ANVTRTNHIMWAMGTDFRYQYANSWFRQMDKFIHYVNQDGRINALYSTPSIYTDAKYAEN  341

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
              WPLKT+D+FPYAD+ NAYWTGYF
Sbjct  342  VQWPLKTDDFFPYADKPNAYWTGYF  366



>ref|XP_006844480.1| hypothetical protein AMTR_s00016p00106660 [Amborella trichopoda]
 gb|ERN06155.1| hypothetical protein AMTR_s00016p00106660 [Amborella trichopoda]
Length=1020

 Score =   357 bits (917),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 187/206 (91%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            Q+F  TPRIGWQIDPFGHSAVQAYLLGAE+GFDSL+F RIDYQDR KRK +K+LEVVW+ 
Sbjct  156  QEFGKTPRIGWQIDPFGHSAVQAYLLGAELGFDSLFFARIDYQDRQKRKDQKTLEVVWQG  215

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            S++LG+S+QIF   FP++Y+PP  FYFEVND+SP+VQDD  LFDYNVPERV+DFV AA+ 
Sbjct  216  SRTLGSSAQIFTSIFPKHYDPPESFYFEVNDESPLVQDDILLFDYNVPERVDDFVNAAIE  275

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QAN+TRTNH+MWTMGTDF+YQYA++WFR +DK IHYVN+DGRVNALYSTPS+YTDAK+A 
Sbjct  276  QANVTRTNHIMWTMGTDFRYQYANTWFRQMDKFIHYVNKDGRVNALYSTPSMYTDAKHAE  335

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWPLKTED+FPYADR NAYWTGYF
Sbjct  336  NESWPLKTEDFFPYADRANAYWTGYF  361



>ref|XP_009412777.1| PREDICTED: lysosomal alpha-mannosidase [Musa acuminata subsp. 
malaccensis]
Length=1024

 Score =   357 bits (917),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 165/207 (80%), Positives = 188/207 (91%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            Q+F+  PRIGWQIDPFGHSAVQAYLLGAE+GFD+LYF RIDYQDR KRK  KSLEVVWR 
Sbjct  162  QEFDQLPRIGWQIDPFGHSAVQAYLLGAELGFDALYFSRIDYQDREKRKDTKSLEVVWRG  221

Query  182  SKSLGTSSQIFAGAFPENYEPP-SGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SK+LG+S  IF G FP+NYEPP  GFYFEVND+SPV+QDD  LFDYNV ERV+DFVAAAL
Sbjct  222  SKTLGSSVDIFTGIFPKNYEPPPGGFYFEVNDESPVIQDDPLLFDYNVQERVDDFVAAAL  281

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            SQANITRT+H+M+TMGTDFKYQYA+SWFR +DK IHYVN+DGRVNALYSTPSIYT+AK+A
Sbjct  282  SQANITRTDHIMFTMGTDFKYQYANSWFRQMDKFIHYVNKDGRVNALYSTPSIYTNAKHA  341

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            +++SWPLKT+D+FPYADR NAYWTGYF
Sbjct  342  ANESWPLKTDDFFPYADRANAYWTGYF  368



>ref|XP_010682958.1| PREDICTED: alpha-mannosidase [Beta vulgaris subsp. vulgaris]
Length=1012

 Score =   357 bits (915),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/205 (79%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +FN  PR+GWQIDPFGHSAVQAYLLGAEVGFDSLYF RID+QDRAKRK EK+LEV+WR S
Sbjct  158  EFNQIPRVGWQIDPFGHSAVQAYLLGAEVGFDSLYFARIDFQDRAKRKDEKTLEVIWRGS  217

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            +SLG++SQIF G FP +Y PP GF FEVND SP +QDD  LFDYNV ERVNDFVAAA+SQ
Sbjct  218  RSLGSTSQIFTGIFPVHYNPPDGFQFEVNDVSPPIQDDPLLFDYNVQERVNDFVAAAISQ  277

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            AN+TRTNH+MWTMG DF+YQYA+SWFR +DK IHYVN DGRVNALYSTPSIYT+AKYA +
Sbjct  278  ANVTRTNHIMWTMGEDFRYQYANSWFRQMDKFIHYVNLDGRVNALYSTPSIYTNAKYALN  337

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            +SWP+KT D+FPYADR NAYWTGYF
Sbjct  338  ESWPVKTNDFFPYADRANAYWTGYF  362



>ref|XP_007032026.1| Glycosyl hydrolase family 38 protein [Theobroma cacao]
 gb|EOY02952.1| Glycosyl hydrolase family 38 protein [Theobroma cacao]
Length=1015

 Score =   357 bits (915),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/205 (78%), Positives = 183/205 (89%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +F   PR+GWQIDPFGHSAVQAYLLGAE+GFDSL+F RIDYQDRAKR  EK+LEV+W+ S
Sbjct  155  EFGQIPRVGWQIDPFGHSAVQAYLLGAELGFDSLFFARIDYQDRAKRLKEKTLEVIWQGS  214

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            KSLG+SSQIF G FP +Y+PP GF FE+ND SP +QDD  LFDYNV ERVNDFVAA L+Q
Sbjct  215  KSLGSSSQIFTGIFPRHYDPPDGFTFEINDVSPPIQDDVLLFDYNVQERVNDFVAAGLAQ  274

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            AN+TRTNH+MWTMGTDF+YQYA+SWFR +DK IHYVNQDGRVNALYSTPSIYTDAKYA++
Sbjct  275  ANVTRTNHIMWTMGTDFRYQYANSWFRQMDKFIHYVNQDGRVNALYSTPSIYTDAKYAAN  334

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            + WPLKT+D+FPYAD+ NAYWTGYF
Sbjct  335  EQWPLKTDDFFPYADKLNAYWTGYF  359



>gb|KJB33197.1| hypothetical protein B456_006G000300 [Gossypium raimondii]
Length=1022

 Score =   356 bits (914),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/205 (78%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +FN  PR+GWQIDPFGHSAVQAYLLGAE+GFDSL+F RIDYQDRAKR  EK+LEVVW+ S
Sbjct  162  EFNQIPRVGWQIDPFGHSAVQAYLLGAELGFDSLFFARIDYQDRAKRLKEKTLEVVWQGS  221

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            KSLG+SSQIF G FP +Y+PP GF FE+ND SP +QDD  LFDYNV ERVNDF+AAAL+Q
Sbjct  222  KSLGSSSQIFTGIFPRHYDPPDGFTFEINDVSPPIQDDVLLFDYNVQERVNDFIAAALAQ  281

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            AN+TRTNH+MW MGTDF+YQYA+SWFR +DK IHYVNQDGR+NALYSTPSIYTDAKYA +
Sbjct  282  ANVTRTNHIMWAMGTDFRYQYANSWFRQMDKFIHYVNQDGRINALYSTPSIYTDAKYAEN  341

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
              WPLKT+D+FPYAD+ NAYWTGYF
Sbjct  342  VQWPLKTDDFFPYADKPNAYWTGYF  366



>ref|XP_008670747.1| PREDICTED: lysosomal alpha-mannosidase [Zea mays]
 tpg|DAA42032.1| TPA: alpha-mannosidase [Zea mays]
Length=1016

 Score =   356 bits (913),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 165/207 (80%), Positives = 185/207 (89%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F   PRIGWQIDPFGHSAVQAYLLGAEVGFD+ YF RIDYQDR  RKG K LEVVWR 
Sbjct  155  EEFGQIPRIGWQIDPFGHSAVQAYLLGAEVGFDAFYFFRIDYQDRDTRKGTKELEVVWRG  214

Query  182  SKSLGTSSQIFAGAFPENYEPPSG-FYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SK+LG+S+ IFAG FP+NYEPP G FYFEV+D+SPVVQDD  LFDYNV ERVNDFVAAA+
Sbjct  215  SKTLGSSADIFAGIFPKNYEPPPGDFYFEVDDNSPVVQDDPLLFDYNVEERVNDFVAAAV  274

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            +QANITRTNH+M+TMGTDFKYQYA SWFRN+DKLIHYVN+DGR+NALYSTPSIYTDAKYA
Sbjct  275  AQANITRTNHIMFTMGTDFKYQYAESWFRNMDKLIHYVNKDGRINALYSTPSIYTDAKYA  334

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            +++ WPLKT D+FPYAD  NAYWTGYF
Sbjct  335  ANEQWPLKTNDFFPYADNPNAYWTGYF  361



>ref|XP_010929675.1| PREDICTED: alpha-mannosidase [Elaeis guineensis]
Length=1024

 Score =   356 bits (914),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 185/207 (89%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F  TPRIGWQIDPFGHSAVQAYLL AEVGFD+LYF RIDYQDR KRK  KSLEVVWR 
Sbjct  163  KEFGQTPRIGWQIDPFGHSAVQAYLLSAEVGFDALYFSRIDYQDREKRKDLKSLEVVWRG  222

Query  182  SKSLGTSSQIFAGAFPENYEPPSG-FYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SK+LG+S+ IF G FP+NYEPP G FYFEVND SPV+QDD  LFDYNV ERVNDFVAAA+
Sbjct  223  SKTLGSSADIFTGIFPKNYEPPPGDFYFEVNDKSPVIQDDVLLFDYNVEERVNDFVAAAI  282

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            +QAN+TRTNH+M+TMGTDFKYQYA SWFR LDK IHYVN+DGRVNALYSTPSIYTDAKYA
Sbjct  283  AQANVTRTNHIMFTMGTDFKYQYATSWFRQLDKFIHYVNKDGRVNALYSTPSIYTDAKYA  342

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            +++SWPLKT+D+FPYAD  NAYWTGYF
Sbjct  343  ANESWPLKTDDFFPYADDPNAYWTGYF  369



>ref|XP_002449583.1| hypothetical protein SORBIDRAFT_05g019600 [Sorghum bicolor]
 gb|EES08571.1| hypothetical protein SORBIDRAFT_05g019600 [Sorghum bicolor]
Length=1019

 Score =   355 bits (912),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 185/207 (89%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F   PRIGWQIDPFGHSAVQAYLLGAEVGFD+ YF RIDYQDR  RKG K LEVVWR 
Sbjct  157  EEFGQIPRIGWQIDPFGHSAVQAYLLGAEVGFDAFYFFRIDYQDRDTRKGTKELEVVWRG  216

Query  182  SKSLGTSSQIFAGAFPENYEPPSG-FYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SK+LG+S+ IFAG FP+NYEPP G FYFEV+D+SPVVQDD  LFDYNV ERVNDFVAAA+
Sbjct  217  SKTLGSSADIFAGIFPKNYEPPPGEFYFEVDDNSPVVQDDPLLFDYNVEERVNDFVAAAV  276

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            +QANITRTNH+M+TMGTDFKYQYA SWFRN+DKLIHYVN+DGRVNALYSTPSIYTDAKYA
Sbjct  277  AQANITRTNHIMFTMGTDFKYQYAESWFRNMDKLIHYVNKDGRVNALYSTPSIYTDAKYA  336

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            +++ WPLKT D+FPYAD  NAYWTGYF
Sbjct  337  ANELWPLKTNDFFPYADNPNAYWTGYF  363



>ref|XP_010663638.1| PREDICTED: alpha-mannosidase [Vitis vinifera]
Length=1060

 Score =   356 bits (914),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 163/205 (80%), Positives = 184/205 (90%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +F VTPRIGWQIDPFGHSAVQAYLLGAEVGFDSL+F RIDYQD AKRK EKSLEVVW+ S
Sbjct  192  EFGVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLFFWRIDYQDVAKRKKEKSLEVVWQGS  251

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            KS G+S+QIFA  FPE+Y PP+GF FE+N  SP+VQDD +LFDYNV ERVNDFV+AA+SQ
Sbjct  252  KSFGSSAQIFASVFPESYAPPTGFNFEINYGSPIVQDDINLFDYNVQERVNDFVSAAISQ  311

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            ANITRTNH+MWTMG DF YQYA +WFR +DKLIHYVNQDGRVNALYSTPSIYTDAKYA++
Sbjct  312  ANITRTNHIMWTMGMDFMYQYATTWFRQMDKLIHYVNQDGRVNALYSTPSIYTDAKYAAN  371

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            +SWPLKT+D+FPYA+  N YWTGYF
Sbjct  372  ESWPLKTDDFFPYANTLNTYWTGYF  396



>ref|XP_009415849.1| PREDICTED: lysosomal alpha-mannosidase-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=1023

 Score =   355 bits (911),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 167/207 (81%), Positives = 183/207 (88%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            Q+F + PRIGWQIDPFGHSAVQAYLL AEVGFD+LYF RIDYQD AKRK  KSLEV+WRA
Sbjct  160  QEFGIIPRIGWQIDPFGHSAVQAYLLSAEVGFDALYFFRIDYQDLAKRKDLKSLEVIWRA  219

Query  182  SKSLGTSSQIFAGAFPENYEPP-SGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKS G S+ +F G FP+NYEPP  GFYFEVNDDSPV+QDD  LFDYNV ERV+DFVAAAL
Sbjct  220  SKSRGLSADVFTGIFPKNYEPPPGGFYFEVNDDSPVIQDDPLLFDYNVQERVDDFVAAAL  279

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            SQANITR NH+M+TMGTDFKYQYA+SWFR LDK IHYVN+DGRVNALYSTPSIYTDAKYA
Sbjct  280  SQANITRANHIMFTMGTDFKYQYANSWFRQLDKFIHYVNKDGRVNALYSTPSIYTDAKYA  339

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
             ++SWPLKT D+FPYAD  NAYWTGYF
Sbjct  340  LEESWPLKTGDFFPYADNPNAYWTGYF  366



>gb|KFK33593.1| hypothetical protein AALP_AA5G034100 [Arabis alpina]
Length=1022

 Score =   355 bits (911),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 183/205 (89%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +F   PR+GWQIDPFGHSAVQAYLLGAE GFDSL+F RIDYQDRAKR  EK+LEV+W+ S
Sbjct  162  EFGQVPRVGWQIDPFGHSAVQAYLLGAEFGFDSLFFARIDYQDRAKRLREKTLEVIWQGS  221

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            KSLG+SSQIF G FP++Y+PP GF FE+ND SP +QDD  LFDYNV ERVNDFVAAAL+Q
Sbjct  222  KSLGSSSQIFTGVFPKHYDPPEGFVFEINDVSPPIQDDPLLFDYNVQERVNDFVAAALAQ  281

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
             N+TRTNH+MW MGTDF+YQYA+SW+R +DKLIHYVN+DGRVN LYSTPSIYTDAKYA++
Sbjct  282  VNVTRTNHIMWLMGTDFRYQYAYSWYRQMDKLIHYVNKDGRVNVLYSTPSIYTDAKYAAN  341

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            +SWPLKTED+FPYAD+ NAYWTGYF
Sbjct  342  ESWPLKTEDFFPYADKPNAYWTGYF  366



>ref|XP_009415848.1| PREDICTED: lysosomal alpha-mannosidase-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=1025

 Score =   355 bits (911),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 167/207 (81%), Positives = 183/207 (88%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            Q+F + PRIGWQIDPFGHSAVQAYLL AEVGFD+LYF RIDYQD AKRK  KSLEV+WRA
Sbjct  160  QEFGIIPRIGWQIDPFGHSAVQAYLLSAEVGFDALYFFRIDYQDLAKRKDLKSLEVIWRA  219

Query  182  SKSLGTSSQIFAGAFPENYEPP-SGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKS G S+ +F G FP+NYEPP  GFYFEVNDDSPV+QDD  LFDYNV ERV+DFVAAAL
Sbjct  220  SKSRGLSADVFTGIFPKNYEPPPGGFYFEVNDDSPVIQDDPLLFDYNVQERVDDFVAAAL  279

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            SQANITR NH+M+TMGTDFKYQYA+SWFR LDK IHYVN+DGRVNALYSTPSIYTDAKYA
Sbjct  280  SQANITRANHIMFTMGTDFKYQYANSWFRQLDKFIHYVNKDGRVNALYSTPSIYTDAKYA  339

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
             ++SWPLKT D+FPYAD  NAYWTGYF
Sbjct  340  LEESWPLKTGDFFPYADNPNAYWTGYF  366



>ref|XP_008791035.1| PREDICTED: lysosomal alpha-mannosidase [Phoenix dactylifera]
Length=1024

 Score =   355 bits (910),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 165/207 (80%), Positives = 185/207 (89%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            Q+F  TPRIGWQIDPFGHS+VQAYLL AEVGFD+LYF RIDYQDR KRK  KSLEVVWR 
Sbjct  163  QEFGQTPRIGWQIDPFGHSSVQAYLLSAEVGFDALYFSRIDYQDREKRKDLKSLEVVWRG  222

Query  182  SKSLGTSSQIFAGAFPENYEPPSG-FYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SK+LG+S+ IF G FP+NYEPP G FYFEVN +SPV+QDD  LFDYNV ERVNDFVAAA+
Sbjct  223  SKTLGSSADIFTGIFPKNYEPPPGDFYFEVNAESPVIQDDVLLFDYNVEERVNDFVAAAI  282

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            +QAN+TRTNH+M+TMGTDFKYQYA SWFR LDK IHYVN+DGRVNALYSTPSIYTDAKYA
Sbjct  283  AQANVTRTNHIMFTMGTDFKYQYATSWFRQLDKFIHYVNKDGRVNALYSTPSIYTDAKYA  342

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            +++SWPLKT+D+FPYAD  NAYWTGYF
Sbjct  343  ANESWPLKTDDFFPYADNPNAYWTGYF  369



>ref|XP_006468893.1| PREDICTED: lysosomal alpha-mannosidase-like isoform X1 [Citrus 
sinensis]
Length=1017

 Score =   354 bits (909),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 180/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  8    FNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRASK  187
            F   PR+GWQIDPFGHSAVQAYLLGAE+GFDSLYF RIDYQDRAKR  EK+LEVVWR SK
Sbjct  158  FGKLPRVGWQIDPFGHSAVQAYLLGAELGFDSLYFARIDYQDRAKRLKEKNLEVVWRGSK  217

Query  188  SLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQA  367
            SLG+SSQIF G FP +Y+PP GF FE+ND SP +QDD  LFDYNV ERVNDFVAAAL+QA
Sbjct  218  SLGSSSQIFTGIFPRHYDPPDGFTFEINDVSPPIQDDVLLFDYNVEERVNDFVAAALAQA  277

Query  368  NITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASDQ  547
            N+TRTNH+MW MGTDF+YQYA+SWFR +DK IHYVN+DGRVNALYSTPSIYTDAK A+++
Sbjct  278  NVTRTNHIMWLMGTDFRYQYANSWFRQMDKFIHYVNKDGRVNALYSTPSIYTDAKNAANE  337

Query  548  SWPLKTEDYFPYADRENAYWTGYF  619
             WPLKTED+FPYAD  NAYWTGYF
Sbjct  338  EWPLKTEDFFPYADHPNAYWTGYF  361



>ref|XP_010942369.1| PREDICTED: alpha-mannosidase-like [Elaeis guineensis]
Length=1022

 Score =   354 bits (909),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 165/207 (80%), Positives = 184/207 (89%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            Q+F  TPRIGWQIDPFGHSAV AYLL AEVGFD+LYF RIDYQDR KRK  KSLEVVW+ 
Sbjct  162  QEFGQTPRIGWQIDPFGHSAVNAYLLSAEVGFDALYFARIDYQDREKRKDLKSLEVVWQG  221

Query  182  SKSLGTSSQIFAGAFPENYEPPSG-FYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SK+LG+S+ IF G FP+NYEPP G FYFEVND SPV+QDD  LFDYNV ERVNDFVAAA+
Sbjct  222  SKTLGSSADIFTGIFPKNYEPPPGDFYFEVNDVSPVIQDDVLLFDYNVEERVNDFVAAAI  281

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            +QAN+TRTNH+M+TMGTDFKYQYA SWFR LDK IHYVN+DGRVNALYSTPSIYTDAKYA
Sbjct  282  AQANVTRTNHIMFTMGTDFKYQYATSWFRQLDKFIHYVNKDGRVNALYSTPSIYTDAKYA  341

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            +++SWPLKT+D+FPYAD  NAYWTGYF
Sbjct  342  ANESWPLKTDDFFPYADNPNAYWTGYF  368



>ref|XP_003577519.1| PREDICTED: lysosomal alpha-mannosidase-like [Brachypodium distachyon]
Length=1019

 Score =   354 bits (909),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 163/207 (79%), Positives = 186/207 (90%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F + PRIGWQIDPFGHSAVQAYLLGAEVGFD+ YF RIDYQDR  RKG K LEV+WR 
Sbjct  159  EEFGLIPRIGWQIDPFGHSAVQAYLLGAEVGFDAFYFFRIDYQDRDTRKGTKELEVIWRG  218

Query  182  SKSLGTSSQIFAGAFPENYEPPSG-FYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SK+ G+S+ IFAG FP+NYEPP G FYFEV+DDSPVVQDD  LFDYNV +RVNDFVAAA+
Sbjct  219  SKTFGSSADIFAGIFPKNYEPPPGEFYFEVDDDSPVVQDDPLLFDYNVEQRVNDFVAAAV  278

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            +QANITRTNH+M+TMGTDFKYQYA SWFR +DKLIHYVN+DGRVNALYSTPSIYTDAK+A
Sbjct  279  AQANITRTNHIMFTMGTDFKYQYAESWFRQMDKLIHYVNKDGRVNALYSTPSIYTDAKFA  338

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            S+++WPLKT D+FPYAD+ NAYWTGYF
Sbjct  339  SNEAWPLKTNDFFPYADKPNAYWTGYF  365



>gb|KHG00745.1| Lysosomal alpha-mannosidase [Gossypium arboreum]
Length=1022

 Score =   354 bits (909),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 181/205 (88%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +FN  PR+GWQIDPFGHSAVQAYLLGAE+GFDSL+F RIDYQDRAKR  EK+LEVVW+ S
Sbjct  162  EFNQIPRVGWQIDPFGHSAVQAYLLGAELGFDSLFFARIDYQDRAKRLKEKTLEVVWQGS  221

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            KSLG+SSQIF G FP +Y+PP GF FE+ND SP +QDD  LFDYNV ERVNDF+AAAL+Q
Sbjct  222  KSLGSSSQIFTGIFPRHYDPPDGFTFEINDVSPPIQDDVLLFDYNVQERVNDFIAAALAQ  281

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            AN+TRTNH+MW MGTDF+YQYA+SWFR +DK IHYVNQDGR+NALYSTPSIYTDAKY  +
Sbjct  282  ANVTRTNHIMWAMGTDFRYQYANSWFRQMDKFIHYVNQDGRINALYSTPSIYTDAKYTEN  341

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
              WPLKT+D+FPYAD+ NAYWTGYF
Sbjct  342  VQWPLKTDDFFPYADKPNAYWTGYF  366



>ref|XP_004979371.1| PREDICTED: lysosomal alpha-mannosidase-like [Setaria italica]
Length=1016

 Score =   354 bits (908),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 182/207 (88%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F   PRIGWQIDPFGHSAVQAYLLGAEVGFD+ YF RIDYQDR  RKG K LEVVWR 
Sbjct  156  EEFGQIPRIGWQIDPFGHSAVQAYLLGAEVGFDAFYFFRIDYQDRDTRKGTKELEVVWRG  215

Query  182  SKSLGTSSQIFAGAFPENYEPP-SGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKS G+S+ IFAG FP+NYEPP  GFYFEVNDDSPVVQDD  LFDYNV ERVNDFVAAAL
Sbjct  216  SKSFGSSADIFAGIFPKNYEPPPGGFYFEVNDDSPVVQDDPLLFDYNVEERVNDFVAAAL  275

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            +QANITRTNH+M+TMGTDFKYQYA SWFRN+DKLIHYVN+ G +NALYSTPSIYTDAKYA
Sbjct  276  AQANITRTNHIMFTMGTDFKYQYAESWFRNMDKLIHYVNKHGLINALYSTPSIYTDAKYA  335

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            +++ WPLKT D+FPYAD  NAYWTGYF
Sbjct  336  ANEQWPLKTNDFFPYADNPNAYWTGYF  362



>emb|CBI15496.3| unnamed protein product [Vitis vinifera]
Length=1048

 Score =   355 bits (910),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 163/205 (80%), Positives = 184/205 (90%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +F VTPRIGWQIDPFGHSAVQAYLLGAEVGFDSL+F RIDYQD AKRK EKSLEVVW+ S
Sbjct  175  EFGVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLFFWRIDYQDVAKRKKEKSLEVVWQGS  234

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            KS G+S+QIFA  FPE+Y PP+GF FE+N  SP+VQDD +LFDYNV ERVNDFV+AA+SQ
Sbjct  235  KSFGSSAQIFASVFPESYAPPTGFNFEINYGSPIVQDDINLFDYNVQERVNDFVSAAISQ  294

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            ANITRTNH+MWTMG DF YQYA +WFR +DKLIHYVNQDGRVNALYSTPSIYTDAKYA++
Sbjct  295  ANITRTNHIMWTMGMDFMYQYATTWFRQMDKLIHYVNQDGRVNALYSTPSIYTDAKYAAN  354

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            +SWPLKT+D+FPYA+  N YWTGYF
Sbjct  355  ESWPLKTDDFFPYANTLNTYWTGYF  379



>ref|XP_006468894.1| PREDICTED: lysosomal alpha-mannosidase-like isoform X2 [Citrus 
sinensis]
Length=1019

 Score =   354 bits (908),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 180/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  8    FNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRASK  187
            F   PR+GWQIDPFGHSAVQAYLLGAE+GFDSLYF RIDYQDRAKR  EK+LEVVWR SK
Sbjct  158  FGKLPRVGWQIDPFGHSAVQAYLLGAELGFDSLYFARIDYQDRAKRLKEKNLEVVWRGSK  217

Query  188  SLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQA  367
            SLG+SSQIF G FP +Y+PP GF FE+ND SP +QDD  LFDYNV ERVNDFVAAAL+QA
Sbjct  218  SLGSSSQIFTGIFPRHYDPPDGFTFEINDVSPPIQDDVLLFDYNVEERVNDFVAAALAQA  277

Query  368  NITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASDQ  547
            N+TRTNH+MW MGTDF+YQYA+SWFR +DK IHYVN+DGRVNALYSTPSIYTDAK A+++
Sbjct  278  NVTRTNHIMWLMGTDFRYQYANSWFRQMDKFIHYVNKDGRVNALYSTPSIYTDAKNAANE  337

Query  548  SWPLKTEDYFPYADRENAYWTGYF  619
             WPLKTED+FPYAD  NAYWTGYF
Sbjct  338  EWPLKTEDFFPYADHPNAYWTGYF  361



>ref|XP_010660681.1| PREDICTED: alpha-mannosidase [Vitis vinifera]
 emb|CBI21275.3| unnamed protein product [Vitis vinifera]
Length=1013

 Score =   353 bits (907),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 160/205 (78%), Positives = 183/205 (89%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +F  TPR+GWQIDPFGHSAVQAYLLGAE+GFDSL+F RIDYQDRA+RK EK+LEVVW+ S
Sbjct  154  EFGQTPRVGWQIDPFGHSAVQAYLLGAELGFDSLFFARIDYQDRARRKDEKTLEVVWQGS  213

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            KSL +SSQIF G FP +Y+PP GF FE+ND SP +QDD  LFDYNV ERVNDFVAAA+SQ
Sbjct  214  KSLLSSSQIFTGIFPRHYDPPDGFVFEINDISPPIQDDVLLFDYNVEERVNDFVAAAVSQ  273

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            AN+TRTNH+MWTMGTDF+YQYA+SWFR +DKLIHYVN+DGRVNALYSTPSIYTDAKYA +
Sbjct  274  ANVTRTNHIMWTMGTDFRYQYANSWFRQMDKLIHYVNKDGRVNALYSTPSIYTDAKYAVN  333

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            + WPLK +D+FPYAD  NAYWTGYF
Sbjct  334  KMWPLKKDDFFPYADHPNAYWTGYF  358



>ref|XP_010528132.1| PREDICTED: lysosomal alpha-mannosidase [Tarenaya hassleriana]
Length=1017

 Score =   352 bits (903),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 159/205 (78%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +F   PR+GWQIDPFGHSAVQAYLLGAE+GFDSL+F RIDYQDRAKR  +K+LEVVW+  
Sbjct  156  EFGQVPRVGWQIDPFGHSAVQAYLLGAELGFDSLFFARIDYQDRAKRLRDKTLEVVWQGC  215

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            KSLG+SSQIF G FP +Y+PP GF FE+ND SP +QDDT LFDYNV ERVNDFVAAALSQ
Sbjct  216  KSLGSSSQIFTGIFPRHYDPPDGFTFEINDVSPPIQDDTLLFDYNVQERVNDFVAAALSQ  275

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            AN+TRTNH+MW MGTDF+YQYA+SWFR +DK IHYVN DGRVNALYSTPSIYTDAKYA++
Sbjct  276  ANVTRTNHIMWLMGTDFRYQYANSWFRQMDKFIHYVNLDGRVNALYSTPSIYTDAKYAAN  335

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            + WPLKT+D+FPYAD+ NAYWTGYF
Sbjct  336  ELWPLKTDDFFPYADKSNAYWTGYF  360



>tpg|DAA42034.1| TPA: alpha-mannosidase, partial [Zea mays]
Length=664

 Score =   343 bits (881),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 165/227 (73%), Positives = 185/227 (81%), Gaps = 21/227 (9%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F   PRIGWQIDPFGHSAVQAYLLGAEVGFD+ YF RIDYQDR  RKG K LEVVWR 
Sbjct  155  EEFGQIPRIGWQIDPFGHSAVQAYLLGAEVGFDAFYFFRIDYQDRDTRKGTKELEVVWRG  214

Query  182  SKSLGTSSQ--------------------IFAGAFPENYEPPSG-FYFEVNDDSPVVQDD  298
            SK+LG+S+                     IFAG FP+NYEPP G FYFEV+D+SPVVQDD
Sbjct  215  SKTLGSSADVSGLFLFQKYTMHLVICSIYIFAGIFPKNYEPPPGDFYFEVDDNSPVVQDD  274

Query  299  TDLFDYNVPERVNDFVAAALSQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQ  478
              LFDYNV ERVNDFVAAA++QANITRTNH+M+TMGTDFKYQYA SWFRN+DKLIHYVN+
Sbjct  275  PLLFDYNVEERVNDFVAAAVAQANITRTNHIMFTMGTDFKYQYAESWFRNMDKLIHYVNK  334

Query  479  DGRVNALYSTPSIYTDAKYASDQSWPLKTEDYFPYADRENAYWTGYF  619
            DGR+NALYSTPSIYTDAKYA+++ WPLKT D+FPYAD  NAYWTGYF
Sbjct  335  DGRINALYSTPSIYTDAKYAANEQWPLKTNDFFPYADNPNAYWTGYF  381



>ref|XP_002512839.1| lysosomal alpha-mannosidase, putative [Ricinus communis]
 gb|EEF49342.1| lysosomal alpha-mannosidase, putative [Ricinus communis]
Length=1016

 Score =   352 bits (902),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 181/205 (88%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +F   PR+GWQIDPFGHSAVQAYLLG+E+GFDSL+F RIDYQDRAKR  EK+LEV+W+ S
Sbjct  157  EFGQLPRVGWQIDPFGHSAVQAYLLGSELGFDSLFFARIDYQDRAKRLKEKTLEVIWQGS  216

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
             SLG+SSQIF G FP +Y+PP GF FEVND SP +QDD  LFDYNV ERVNDFVAAAL+Q
Sbjct  217  TSLGSSSQIFTGIFPRHYDPPDGFTFEVNDVSPPIQDDVLLFDYNVQERVNDFVAAALAQ  276

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            AN+TRTNH+MW MGTDF+YQYA+SWFR +DK IHYVN+DGRVNALYSTPSIYTDAKYA+D
Sbjct  277  ANVTRTNHIMWLMGTDFRYQYANSWFRQIDKFIHYVNEDGRVNALYSTPSIYTDAKYAAD  336

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            + WP+KTED+FPYAD  NAYWTGYF
Sbjct  337  EQWPIKTEDFFPYADHPNAYWTGYF  361



>ref|XP_010249229.1| PREDICTED: lysosomal alpha-mannosidase-like [Nelumbo nucifera]
Length=1017

 Score =   351 bits (901),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            Q+F+  PR+GWQIDPFGHSAVQAYLLGAE+GFDSL+F RIDYQDRAKRK EK+LEVVWR 
Sbjct  154  QEFDQIPRVGWQIDPFGHSAVQAYLLGAELGFDSLFFARIDYQDRAKRKDEKNLEVVWRG  213

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSLG+SSQIF G FP++Y+ P GF FE NDDSP VQDD  LFDYNV ERV+DFV AA+ 
Sbjct  214  SKSLGSSSQIFTGIFPKHYDTPIGFAFEFNDDSPPVQDDVLLFDYNVQERVDDFVNAAIQ  273

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QAN+TRTNH+MWTMGTDF+YQYA++WF+ +DKLIHYVN+DGRVNALYSTPSIYTDAK+ +
Sbjct  274  QANMTRTNHIMWTMGTDFRYQYANTWFKQMDKLIHYVNKDGRVNALYSTPSIYTDAKHEA  333

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWP+K +D+FPYADR NAYWTGYF
Sbjct  334  NESWPIKIDDFFPYADRPNAYWTGYF  359



>ref|XP_010514332.1| PREDICTED: lysosomal alpha-mannosidase-like isoform X1 [Camelina 
sativa]
Length=894

 Score =   348 bits (892),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 180/205 (88%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +F   PR+GWQIDPFGHSAVQAYLLGAE GFDSL+F RIDYQDRAKR  EK+LEV+W+ S
Sbjct  28   EFGQVPRVGWQIDPFGHSAVQAYLLGAEFGFDSLFFARIDYQDRAKRLREKTLEVIWQGS  87

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            KSLG+SSQIF G FP +Y+PP GF FE+ND S  VQDD  LFDYNV ERVNDFVAAAL+Q
Sbjct  88   KSLGSSSQIFTGVFPRHYDPPDGFTFEINDVSAPVQDDPLLFDYNVQERVNDFVAAALAQ  147

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
             N+TRTNH+MW MGTDF+YQYA+SWFR +DK IHYVN+DGR+N LYSTPSIYTDAKYA++
Sbjct  148  VNVTRTNHIMWLMGTDFRYQYAYSWFRQMDKFIHYVNKDGRLNVLYSTPSIYTDAKYAAN  207

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            +SWPLKT+D+FPYAD+ NAYWTGYF
Sbjct  208  ESWPLKTDDFFPYADKPNAYWTGYF  232



>ref|XP_006604197.1| PREDICTED: lysosomal alpha-mannosidase-like isoform X2 [Glycine 
max]
Length=895

 Score =   347 bits (891),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 182/206 (88%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F+  PR+GWQIDPFGHSAVQAYLLGAE+GFDS +F RIDYQDRAKR  EK+LEV+W+ 
Sbjct  27   EEFDKVPRVGWQIDPFGHSAVQAYLLGAELGFDSHFFARIDYQDRAKRLKEKTLEVIWQG  86

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            S+SLG+SSQIF G FP +Y+PP GF FE+ND SP +QDD  LFDYNV ERVNDFV+AAL+
Sbjct  87   SRSLGSSSQIFTGIFPRHYDPPDGFTFEINDVSPPIQDDILLFDYNVQERVNDFVSAALA  146

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QAN+T+TNH+MW MGTDF+YQYA+SWFR +DK IHYVNQDGRVNALYSTPSIYTDAKYA+
Sbjct  147  QANVTKTNHIMWAMGTDFRYQYANSWFRQMDKFIHYVNQDGRVNALYSTPSIYTDAKYAA  206

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            D+ WPLK +D+FPYAD  NAYWTGYF
Sbjct  207  DEYWPLKVDDFFPYADHPNAYWTGYF  232



>ref|XP_009152026.1| PREDICTED: lysosomal alpha-mannosidase [Brassica rapa]
 emb|CDY13654.1| BnaA06g32690D [Brassica napus]
Length=1021

 Score =   350 bits (897),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +F   PR+GWQIDPFGHSAVQAYLLGAE+GFDSL+F RIDYQDRAKR  EK+LEV+W+ S
Sbjct  160  EFGQVPRVGWQIDPFGHSAVQAYLLGAELGFDSLFFARIDYQDRAKRLREKTLEVIWQGS  219

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            KSLG+SSQIF G FP +Y+PP GF FE+ND SP +QDD  LFD+NV ERVNDFVAAAL+Q
Sbjct  220  KSLGSSSQIFTGVFPRHYDPPDGFTFEINDVSPPIQDDPSLFDFNVQERVNDFVAAALAQ  279

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
             N+TRTNH+MW MGTDF+YQYA+SW+R +DK IHYVN+DGR+N LYSTPSIYTDAKYA++
Sbjct  280  VNVTRTNHIMWLMGTDFRYQYAYSWYRQMDKFIHYVNKDGRLNVLYSTPSIYTDAKYAAN  339

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            +SWPLKT+D+FPYAD+ NAYWTGYF
Sbjct  340  ESWPLKTDDFFPYADKPNAYWTGYF  364



>ref|XP_002875335.1| glycosyl hydrolase family 38 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51594.1| glycosyl hydrolase family 38 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=1018

 Score =   350 bits (897),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 181/205 (88%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +F   PR+GWQIDPFGHSAVQAYLLGAE GFDSL+F RIDYQDRAKR  EK+LEV+W+ S
Sbjct  157  EFGQVPRVGWQIDPFGHSAVQAYLLGAEFGFDSLFFARIDYQDRAKRLREKTLEVIWQGS  216

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            KSLG+SSQIF G FP +Y+PP GF FE+ND S  +QDD+ LFDYNV ERVNDFVAAAL+Q
Sbjct  217  KSLGSSSQIFTGVFPRHYDPPEGFVFEINDVSAPIQDDSLLFDYNVQERVNDFVAAALAQ  276

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
             N+TRTNH+MW MGTDF+YQYA+SWFR +DK IHYVN+DGR+N LYSTPSIYTDAKYA++
Sbjct  277  VNVTRTNHIMWLMGTDFRYQYAYSWFRQMDKFIHYVNKDGRLNVLYSTPSIYTDAKYAAN  336

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            +SWPLKT+D+FPYAD+ NAYWTGYF
Sbjct  337  ESWPLKTDDFFPYADKPNAYWTGYF  361



>ref|XP_008379047.1| PREDICTED: lysosomal alpha-mannosidase [Malus domestica]
Length=1021

 Score =   349 bits (896),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 182/206 (88%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F   PRIGWQIDPFGHSAVQAYLLGAE+GFDSL+F RIDYQDRAKR  +K+LE +W+ 
Sbjct  161  KEFGQVPRIGWQIDPFGHSAVQAYLLGAELGFDSLFFARIDYQDRAKRLRDKTLEFIWQG  220

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            S+SL +SSQIF G FP +Y+PP GF FE+ND SP +QDD  +FDYNV ERVNDFVAAAL+
Sbjct  221  SRSLASSSQIFTGIFPRHYDPPDGFVFEINDVSPPIQDDVLMFDYNVQERVNDFVAAALA  280

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QAN+TRTNH+MW MGTDF+YQYA+SWFR +DK IHYVNQDGRVNALYSTPSIYTDAKYA+
Sbjct  281  QANVTRTNHIMWNMGTDFRYQYAYSWFRQMDKFIHYVNQDGRVNALYSTPSIYTDAKYAT  340

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++ WPLKT+D+FPYAD+ NAYWTGYF
Sbjct  341  NEQWPLKTDDFFPYADKPNAYWTGYF  366



>ref|XP_011463212.1| PREDICTED: alpha-mannosidase-like isoform X2 [Fragaria vesca 
subsp. vesca]
Length=1021

 Score =   349 bits (895),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 159/207 (77%), Positives = 187/207 (90%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            Q+FNVTPR+GWQID FGHS+VQAYLLGAEVGFDSL+FGRIDYQD+AKRK +KSLEVVWR 
Sbjct  158  QEFNVTPRVGWQIDTFGHSSVQAYLLGAEVGFDSLFFGRIDYQDKAKRKDDKSLEVVWRG  217

Query  182  SKSLGTSSQIFAGAFPENYEPPS-GFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKSLG+S+QIFAGAFP  Y PPS  FYFE +D +P+VQDD +L DYN+PERVNDFV+ A+
Sbjct  218  SKSLGSSAQIFAGAFPGLYVPPSDNFYFETDDPAPLVQDDMNLGDYNMPERVNDFVSEAI  277

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            SQANITRTNH+MWTMG DF YQYA+SWFR +DK IH+VNQDGRVNALYSTPS+YT+AKYA
Sbjct  278  SQANITRTNHIMWTMGKDFAYQYANSWFRQMDKFIHHVNQDGRVNALYSTPSMYTNAKYA  337

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            +++SWP+K++D+FPYA   NAYWTGYF
Sbjct  338  TNESWPIKSDDFFPYASDVNAYWTGYF  364



>dbj|BAH56863.1| AT3G26720 [Arabidopsis thaliana]
Length=947

 Score =   347 bits (891),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 180/205 (88%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +F   PR+GWQIDPFGHSAVQAYLLGAE GFDSL+F RIDYQDRAKR  EK+LEV+W+ S
Sbjct  157  EFGQVPRVGWQIDPFGHSAVQAYLLGAEFGFDSLFFARIDYQDRAKRLREKTLEVIWQGS  216

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            KSLG+SSQIF G FP +Y+PP GF FE+ND S  +QDD  LFDYNV ERVNDFVAAAL+Q
Sbjct  217  KSLGSSSQIFTGVFPRHYDPPEGFTFEINDVSAPIQDDPLLFDYNVQERVNDFVAAALAQ  276

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
             N+TRTNH+MW MGTDF+YQYA+SWFR +DK IHYVN+DGR+N LYSTPSIYTDAKYA++
Sbjct  277  VNVTRTNHIMWLMGTDFRYQYAYSWFRQIDKFIHYVNKDGRLNVLYSTPSIYTDAKYAAN  336

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            +SWPLKT+D+FPYAD+ NAYWTGYF
Sbjct  337  ESWPLKTDDFFPYADKPNAYWTGYF  361



>ref|NP_001118706.1| glycosyl hydrolase family 38 protein [Arabidopsis thaliana]
 gb|AEE77204.1| glycosyl hydrolase family 38 protein [Arabidopsis thaliana]
Length=943

 Score =   347 bits (891),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 180/205 (88%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +F   PR+GWQIDPFGHSAVQAYLLGAE GFDSL+F RIDYQDRAKR  EK+LEV+W+ S
Sbjct  157  EFGQVPRVGWQIDPFGHSAVQAYLLGAEFGFDSLFFARIDYQDRAKRLREKTLEVIWQGS  216

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            KSLG+SSQIF G FP +Y+PP GF FE+ND S  +QDD  LFDYNV ERVNDFVAAAL+Q
Sbjct  217  KSLGSSSQIFTGVFPRHYDPPEGFTFEINDVSAPIQDDPLLFDYNVQERVNDFVAAALAQ  276

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
             N+TRTNH+MW MGTDF+YQYA+SWFR +DK IHYVN+DGR+N LYSTPSIYTDAKYA++
Sbjct  277  VNVTRTNHIMWLMGTDFRYQYAYSWFRQIDKFIHYVNKDGRLNVLYSTPSIYTDAKYAAN  336

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            +SWPLKT+D+FPYAD+ NAYWTGYF
Sbjct  337  ESWPLKTDDFFPYADKPNAYWTGYF  361



>emb|CDX83641.1| BnaC07g23810D [Brassica napus]
Length=1022

 Score =   349 bits (895),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 181/205 (88%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +F   PR+GWQIDPFGHSA QAYLLGAE+GFDSL+F RIDYQDRAKR  EK+LEV+W+ S
Sbjct  160  EFGQVPRVGWQIDPFGHSAAQAYLLGAELGFDSLFFARIDYQDRAKRLREKTLEVIWQGS  219

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            KSLG+SSQIF G FP +Y+PP GF FE+ND SP +QDD  LFDYNV ERVNDFVAAAL+Q
Sbjct  220  KSLGSSSQIFTGIFPRHYDPPDGFTFEINDVSPPIQDDPSLFDYNVQERVNDFVAAALAQ  279

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
             N+TRTNH+MW MGTDF+YQYA+SW+R +DK IHYVN+DGR+N LYSTPSIYTDAKYA++
Sbjct  280  VNVTRTNHIMWLMGTDFRYQYAYSWYRQMDKFIHYVNKDGRLNVLYSTPSIYTDAKYAAN  339

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            +SWPLKT+D+FPYAD+ NAYWTGYF
Sbjct  340  ESWPLKTDDFFPYADKPNAYWTGYF  364



>gb|EYU31875.1| hypothetical protein MIMGU_mgv1a000658mg [Erythranthe guttata]
Length=1029

 Score =   349 bits (895),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 159/205 (78%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +F  TPR+GWQIDPFGHSAVQAYLLGAE+GFDSL+F RIDYQDRAKR+ +K+LEVVWR S
Sbjct  156  EFGKTPRVGWQIDPFGHSAVQAYLLGAELGFDSLFFARIDYQDRAKRRDDKTLEVVWRGS  215

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
             SLG+SSQIF G FP +YEPP GF FE+ND S  +QDD  LFDYNV +RV+DFVAAA++Q
Sbjct  216  VSLGSSSQIFTGIFPIHYEPPDGFTFEINDVSAPIQDDDLLFDYNVEQRVDDFVAAAVAQ  275

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            AN+TRTNH+MWTMGTDF+YQYA SWFR +DK IHYVN DGRVNALYSTPSIYTDAKYA++
Sbjct  276  ANLTRTNHIMWTMGTDFRYQYAVSWFRQMDKFIHYVNLDGRVNALYSTPSIYTDAKYAAN  335

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            + WPLKT D+FPYADRENAYWTGYF
Sbjct  336  EKWPLKTGDFFPYADRENAYWTGYF  360



>ref|XP_011463211.1| PREDICTED: alpha-mannosidase-like isoform X1 [Fragaria vesca 
subsp. vesca]
Length=1063

 Score =   349 bits (896),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 159/207 (77%), Positives = 187/207 (90%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            Q+FNVTPR+GWQID FGHS+VQAYLLGAEVGFDSL+FGRIDYQD+AKRK +KSLEVVWR 
Sbjct  158  QEFNVTPRVGWQIDTFGHSSVQAYLLGAEVGFDSLFFGRIDYQDKAKRKDDKSLEVVWRG  217

Query  182  SKSLGTSSQIFAGAFPENYEPPS-GFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SKSLG+S+QIFAGAFP  Y PPS  FYFE +D +P+VQDD +L DYN+PERVNDFV+ A+
Sbjct  218  SKSLGSSAQIFAGAFPGLYVPPSDNFYFETDDPAPLVQDDMNLGDYNMPERVNDFVSEAI  277

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            SQANITRTNH+MWTMG DF YQYA+SWFR +DK IH+VNQDGRVNALYSTPS+YT+AKYA
Sbjct  278  SQANITRTNHIMWTMGKDFAYQYANSWFRQMDKFIHHVNQDGRVNALYSTPSMYTNAKYA  337

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            +++SWP+K++D+FPYA   NAYWTGYF
Sbjct  338  TNESWPIKSDDFFPYASDVNAYWTGYF  364



>gb|AAL73068.1|AC090873_14 Putative alpha-mannosidase [Oryza sativa]
 gb|AAM08418.1|AC112513_4 Putative alpha-mannosidase [Oryza sativa]
Length=640

 Score =   339 bits (870),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 179/206 (87%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFN  PR GWQIDPFGHSAVQ YLLGAE+GFDS++F RIDYQDRAKRKG+K LEV+WR 
Sbjct  167  KQFNKIPRAGWQIDPFGHSAVQGYLLGAELGFDSMHFARIDYQDRAKRKGDKGLEVIWRG  226

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            S++ G+SSQIF  AFP +Y PP GF FE+ DD   VQDD  LFDYN+ ERVNDFVAAAL 
Sbjct  227  SRTFGSSSQIFTNAFPVHYSPPDGFGFEIFDDFVPVQDDMLLFDYNLKERVNDFVAAALK  286

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QAN+TRTNH+MWTMG DF YQYA SWFRN+D+LI+YVN+DGRV+ALYSTPSIYTDAK+AS
Sbjct  287  QANVTRTNHIMWTMGDDFNYQYAESWFRNMDRLINYVNKDGRVHALYSTPSIYTDAKHAS  346

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWPLK +DYFPYAD +NAYWTGYF
Sbjct  347  NESWPLKYDDYFPYADAKNAYWTGYF  372



>gb|AIX48006.1| LMann protein, partial [synthetic construct]
Length=997

 Score =   348 bits (892),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 180/205 (88%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +F   PR+GWQIDPFGHSAVQAYLLGAE GFDSL+F RIDYQDRAKR  EK+LEV+W+ S
Sbjct  135  EFGQVPRVGWQIDPFGHSAVQAYLLGAEFGFDSLFFARIDYQDRAKRLREKTLEVIWQGS  194

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            KSLG+SSQIF G FP +Y+PP GF FE+ND S  +QDD  LFDYNV ERVNDFVAAAL+Q
Sbjct  195  KSLGSSSQIFTGVFPRHYDPPEGFTFEINDVSAPIQDDPLLFDYNVQERVNDFVAAALAQ  254

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
             N+TRTNH+MW MGTDF+YQYA+SWFR +DK IHYVN+DGR+N LYSTPSIYTDAKYA++
Sbjct  255  VNVTRTNHIMWLMGTDFRYQYAYSWFRQIDKFIHYVNKDGRLNVLYSTPSIYTDAKYAAN  314

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            +SWPLKT+D+FPYAD+ NAYWTGYF
Sbjct  315  ESWPLKTDDFFPYADKPNAYWTGYF  339



>ref|NP_189306.1| glycosyl hydrolase family 38 protein [Arabidopsis thaliana]
 emb|CAA66821.1| alpha-mannosidase [Arabidopsis thaliana]
 emb|CAA72432.1| alpha-mannosidase precursor [Arabidopsis thaliana]
 dbj|BAB01735.1| alpha-mannosidase [Arabidopsis thaliana]
 gb|AAK62592.1| AT3g26720/MLJ15_12 [Arabidopsis thaliana]
 gb|AAM47314.1| AT3g26720/MLJ15_12 [Arabidopsis thaliana]
 gb|AEE77203.1| glycosyl hydrolase family 38 protein [Arabidopsis thaliana]
Length=1019

 Score =   348 bits (893),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 180/205 (88%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +F   PR+GWQIDPFGHSAVQAYLLGAE GFDSL+F RIDYQDRAKR  EK+LEV+W+ S
Sbjct  157  EFGQVPRVGWQIDPFGHSAVQAYLLGAEFGFDSLFFARIDYQDRAKRLREKTLEVIWQGS  216

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            KSLG+SSQIF G FP +Y+PP GF FE+ND S  +QDD  LFDYNV ERVNDFVAAAL+Q
Sbjct  217  KSLGSSSQIFTGVFPRHYDPPEGFTFEINDVSAPIQDDPLLFDYNVQERVNDFVAAALAQ  276

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
             N+TRTNH+MW MGTDF+YQYA+SWFR +DK IHYVN+DGR+N LYSTPSIYTDAKYA++
Sbjct  277  VNVTRTNHIMWLMGTDFRYQYAYSWFRQIDKFIHYVNKDGRLNVLYSTPSIYTDAKYAAN  336

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            +SWPLKT+D+FPYAD+ NAYWTGYF
Sbjct  337  ESWPLKTDDFFPYADKPNAYWTGYF  361



>ref|XP_010502611.1| PREDICTED: lysosomal alpha-mannosidase-like [Camelina sativa]
Length=1023

 Score =   348 bits (892),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 180/205 (88%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +F   PR+GWQIDPFGHSAVQAYLLGAE GFDSL+F RIDYQDRAKR  EK+LEV+W+ S
Sbjct  157  EFGQVPRVGWQIDPFGHSAVQAYLLGAEFGFDSLFFARIDYQDRAKRLKEKTLEVIWQGS  216

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            KSLG+SSQIF G FP +Y+PP GF FE+ND S  VQDD  LFDYNV ERVNDFVAAAL+Q
Sbjct  217  KSLGSSSQIFTGVFPRHYDPPDGFTFEINDVSAPVQDDPLLFDYNVQERVNDFVAAALAQ  276

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
             N+TRTNH+MW MGTDF+YQYA+SWFR +DK IHYVN+DGR+N LYSTPSIYTDAKYA++
Sbjct  277  VNVTRTNHIMWLMGTDFRYQYAYSWFRQMDKFIHYVNKDGRLNVLYSTPSIYTDAKYAAN  336

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            +SWPLKT+D+FPYAD+ NAYWTGYF
Sbjct  337  ESWPLKTDDFFPYADKPNAYWTGYF  361



>ref|XP_003624502.1| Lysosomal alpha-mannosidase [Medicago truncatula]
 gb|AES80720.1| glycoside hydrolase family 38 amino-terminal domain protein [Medicago 
truncatula]
Length=1022

 Score =   348 bits (892),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 180/205 (88%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +F   PR+GWQIDPFGHSAVQAYLLGAE+GFDSL+F RIDYQDRAKR  EK+LEVVW+ S
Sbjct  156  EFGKNPRVGWQIDPFGHSAVQAYLLGAELGFDSLFFARIDYQDRAKRLKEKTLEVVWQGS  215

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            +SLG+SSQIF G FP +Y+PP GF FE+ND S  +QDD  LFDYNV ERVNDFV+AAL+Q
Sbjct  216  RSLGSSSQIFTGIFPRHYDPPDGFTFEINDVSQPIQDDVLLFDYNVEERVNDFVSAALAQ  275

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            AN+TRTNH+MW MGTDF+YQYA+SWFR +DK IHYVNQDGRVNALYSTPSIYTDAKYA++
Sbjct  276  ANVTRTNHIMWAMGTDFRYQYANSWFRQMDKFIHYVNQDGRVNALYSTPSIYTDAKYAAN  335

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            + WPLK +D+FPYAD  NAYWTGYF
Sbjct  336  EQWPLKIDDFFPYADHPNAYWTGYF  360



>ref|XP_003553307.2| PREDICTED: lysosomal alpha-mannosidase-like isoform X1 [Glycine 
max]
 gb|KHN28589.1| Lysosomal alpha-mannosidase [Glycine soja]
Length=1024

 Score =   348 bits (892),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 182/206 (88%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F+  PR+GWQIDPFGHSAVQAYLLGAE+GFDS +F RIDYQDRAKR  EK+LEV+W+ 
Sbjct  156  EEFDKVPRVGWQIDPFGHSAVQAYLLGAELGFDSHFFARIDYQDRAKRLKEKTLEVIWQG  215

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            S+SLG+SSQIF G FP +Y+PP GF FE+ND SP +QDD  LFDYNV ERVNDFV+AAL+
Sbjct  216  SRSLGSSSQIFTGIFPRHYDPPDGFTFEINDVSPPIQDDILLFDYNVQERVNDFVSAALA  275

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QAN+T+TNH+MW MGTDF+YQYA+SWFR +DK IHYVNQDGRVNALYSTPSIYTDAKYA+
Sbjct  276  QANVTKTNHIMWAMGTDFRYQYANSWFRQMDKFIHYVNQDGRVNALYSTPSIYTDAKYAA  335

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            D+ WPLK +D+FPYAD  NAYWTGYF
Sbjct  336  DEYWPLKVDDFFPYADHPNAYWTGYF  361



>ref|XP_010425390.1| PREDICTED: lysosomal alpha-mannosidase-like [Camelina sativa]
Length=1023

 Score =   348 bits (892),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 180/205 (88%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +F   PR+GWQIDPFGHSAVQAYLLGAE GFDSL+F RIDYQDRAKR  EK+LEV+W+ S
Sbjct  158  EFGQVPRVGWQIDPFGHSAVQAYLLGAEFGFDSLFFARIDYQDRAKRLREKTLEVIWQGS  217

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            KSLG+SSQIF G FP +Y+PP GF FE+ND S  VQDD  LFDYNV ERVNDFVAAAL+Q
Sbjct  218  KSLGSSSQIFTGVFPRHYDPPDGFTFEINDVSAPVQDDPLLFDYNVQERVNDFVAAALAQ  277

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
             N+TRTNH+MW MGTDF+YQYA+SWFR +DK IHYVN+DGR+N LYSTPSIYTDAKYA++
Sbjct  278  VNVTRTNHIMWLMGTDFRYQYAYSWFRQMDKFIHYVNKDGRLNVLYSTPSIYTDAKYAAN  337

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            +SWPLKT+D+FPYAD+ NAYWTGYF
Sbjct  338  ESWPLKTDDFFPYADKPNAYWTGYF  362



>ref|XP_010514333.1| PREDICTED: lysosomal alpha-mannosidase-like isoform X2 [Camelina 
sativa]
Length=1026

 Score =   348 bits (892),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 180/205 (88%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +F   PR+GWQIDPFGHSAVQAYLLGAE GFDSL+F RIDYQDRAKR  EK+LEV+W+ S
Sbjct  160  EFGQVPRVGWQIDPFGHSAVQAYLLGAEFGFDSLFFARIDYQDRAKRLREKTLEVIWQGS  219

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            KSLG+SSQIF G FP +Y+PP GF FE+ND S  VQDD  LFDYNV ERVNDFVAAAL+Q
Sbjct  220  KSLGSSSQIFTGVFPRHYDPPDGFTFEINDVSAPVQDDPLLFDYNVQERVNDFVAAALAQ  279

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
             N+TRTNH+MW MGTDF+YQYA+SWFR +DK IHYVN+DGR+N LYSTPSIYTDAKYA++
Sbjct  280  VNVTRTNHIMWLMGTDFRYQYAYSWFRQMDKFIHYVNKDGRLNVLYSTPSIYTDAKYAAN  339

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            +SWPLKT+D+FPYAD+ NAYWTGYF
Sbjct  340  ESWPLKTDDFFPYADKPNAYWTGYF  364



>dbj|BAJ95309.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1010

 Score =   347 bits (890),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 162/207 (78%), Positives = 182/207 (88%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F   PRIGWQIDPFGHSAVQAYLLGAEVGFD+LYF RIDYQDR  RKG K LEVVWR 
Sbjct  150  EEFGQIPRIGWQIDPFGHSAVQAYLLGAEVGFDALYFFRIDYQDRDTRKGTKELEVVWRG  209

Query  182  SKSLGTSSQIFAGAFPENYEPPSG-FYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SK+ G+S+ IFAG FP+NYEPP G FYFEV+  SPVVQDD  LFDYNV +RVNDFVAAAL
Sbjct  210  SKTFGSSADIFAGIFPKNYEPPPGDFYFEVDATSPVVQDDPLLFDYNVEQRVNDFVAAAL  269

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            +QAN+TRTNHVM+TMGTDFKYQYA SWFR +DKLIHYVN+DGRVNALYSTPSIYTDAK++
Sbjct  270  AQANVTRTNHVMFTMGTDFKYQYAESWFRQMDKLIHYVNKDGRVNALYSTPSIYTDAKFS  329

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            +++ WPLKT D+FPYAD  NAYWTGYF
Sbjct  330  ANEPWPLKTNDFFPYADNPNAYWTGYF  356



>ref|XP_006395530.1| hypothetical protein EUTSA_v10003577mg [Eutrema salsugineum]
 gb|ESQ32816.1| hypothetical protein EUTSA_v10003577mg [Eutrema salsugineum]
Length=1020

 Score =   347 bits (889),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 179/205 (87%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +F   PR+GWQIDPFGHSA QAYLLGAE+GFDSL+F RIDYQDRAKR  EK+LEV+W+ S
Sbjct  160  EFGQVPRVGWQIDPFGHSAAQAYLLGAELGFDSLFFARIDYQDRAKRLREKTLEVIWQGS  219

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            KSLG+SSQIF G FP +Y+PP GF FE+ND SP +QDD  LFDYNV ERVNDFVAAAL+Q
Sbjct  220  KSLGSSSQIFTGVFPRHYDPPDGFTFEINDVSPPIQDDLLLFDYNVQERVNDFVAAALAQ  279

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
             N+TRTNH+MW MGTDF+YQYA+SWFR +DK IHYVN+DGRVN LYSTPSIYTDAKYA++
Sbjct  280  VNVTRTNHIMWLMGTDFRYQYAYSWFRQMDKFIHYVNKDGRVNVLYSTPSIYTDAKYAAN  339

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            +SWPLK +D+FPYAD+ NA WTGYF
Sbjct  340  ESWPLKNDDFFPYADKPNACWTGYF  364



>ref|XP_006290539.1| hypothetical protein CARUB_v10016625mg [Capsella rubella]
 gb|EOA23437.1| hypothetical protein CARUB_v10016625mg [Capsella rubella]
Length=1017

 Score =   346 bits (888),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 180/205 (88%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +F   PR+GWQIDPFGHSAVQAYLLGAE GFDSL+F RIDYQDRAKR  +K+LEV+W+ S
Sbjct  157  EFGQVPRVGWQIDPFGHSAVQAYLLGAEFGFDSLFFARIDYQDRAKRLRDKTLEVIWQGS  216

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            KSLG+SSQIF G FP +Y+PP GF FE+ND S  VQDD  LFDYNV ERVNDFVAAAL+Q
Sbjct  217  KSLGSSSQIFTGVFPRHYDPPDGFTFEINDVSAPVQDDPLLFDYNVQERVNDFVAAALAQ  276

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
             N+TRTNH+MW MGTDF+YQYA+SWFR +DK IHYVN+DGR+N LYSTPSIYTDAKYA++
Sbjct  277  VNVTRTNHIMWLMGTDFRYQYAYSWFRQMDKFIHYVNKDGRLNVLYSTPSIYTDAKYAAN  336

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            +SWPLKT+D+FPYAD+ NAYWTGYF
Sbjct  337  ESWPLKTDDFFPYADKPNAYWTGYF  361



>ref|XP_008242061.1| PREDICTED: lysosomal alpha-mannosidase [Prunus mume]
Length=1013

 Score =   346 bits (887),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 157/206 (76%), Positives = 184/206 (89%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            QQFN TPR GWQIDPFGHSAVQAYLLGAE+GFDS++F RIDYQDRAKRKG+KSLEV+WR 
Sbjct  163  QQFNKTPRAGWQIDPFGHSAVQAYLLGAELGFDSVHFARIDYQDRAKRKGDKSLEVIWRG  222

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            S++ G+SSQIFA AFP +Y PP GF+FEVNDD   VQD+  LFDYNV +RV+DF+ A++ 
Sbjct  223  SRTFGSSSQIFANAFPVHYSPPPGFHFEVNDDFIPVQDNPLLFDYNVEKRVSDFINASII  282

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QAN+TRTNH+MWTMG DF+YQYA SWF+ +DKLIHYVN+DGRVNALYSTPSIYTDAK A+
Sbjct  283  QANVTRTNHIMWTMGDDFQYQYAESWFKQMDKLIHYVNKDGRVNALYSTPSIYTDAKNAA  342

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            +QSWPLKT+DYFPYADR +AYWTG+F
Sbjct  343  NQSWPLKTDDYFPYADRVDAYWTGFF  368



>gb|EMS63584.1| Lysosomal alpha-mannosidase [Triticum urartu]
Length=1260

 Score =   349 bits (896),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 161/207 (78%), Positives = 182/207 (88%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F   PRIGWQIDPFGHSAVQAYLLGAEVGFD+LYF RIDYQDR  R G K LEVVWR 
Sbjct  93   EEFGQIPRIGWQIDPFGHSAVQAYLLGAEVGFDALYFFRIDYQDRDTRNGTKELEVVWRG  152

Query  182  SKSLGTSSQIFAGAFPENYEPPSG-FYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SK+ G+S+ IFAG FP+NYEPP G FYFEV+D SPVVQDD  LFDYNV +RVNDFVAAAL
Sbjct  153  SKTFGSSADIFAGIFPKNYEPPPGEFYFEVDDTSPVVQDDPLLFDYNVEQRVNDFVAAAL  212

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            +QAN+TRTNH+M+TMGTDFKYQYA SWFR +DKLIHYVN+DGRVNALYSTPSIYTDAK++
Sbjct  213  AQANVTRTNHIMFTMGTDFKYQYAESWFRQMDKLIHYVNKDGRVNALYSTPSIYTDAKFS  272

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            +++ WPLKT D+FPYAD  NAYWTGYF
Sbjct  273  TNEPWPLKTNDFFPYADNPNAYWTGYF  299



>ref|XP_007214915.1| hypothetical protein PRUPE_ppa000707mg [Prunus persica]
 gb|EMJ16114.1| hypothetical protein PRUPE_ppa000707mg [Prunus persica]
Length=1027

 Score =   345 bits (886),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 180/206 (87%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F   PR+GWQIDPFGHSAVQAYLLGAE+GFDSL+F RIDYQDRA+R  +K+LEV+W+ 
Sbjct  166  KEFGKVPRVGWQIDPFGHSAVQAYLLGAELGFDSLFFARIDYQDRARRLRDKTLEVIWQG  225

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSL +SSQIF G FP +Y+PP GF FE+ND SP +QDD  LFDYNV +RVNDFVAAA +
Sbjct  226  SKSLASSSQIFTGIFPRHYDPPDGFTFEINDVSPPIQDDILLFDYNVQDRVNDFVAAAFA  285

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QAN+TRTNH+MW MGTDF+YQYA+SWFR +DK IHYVNQDGRVNALYSTPSIYTDAKYA+
Sbjct  286  QANVTRTNHIMWNMGTDFRYQYANSWFRQMDKFIHYVNQDGRVNALYSTPSIYTDAKYAA  345

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
             + WPLKT+D+FPYAD  NAYWTGYF
Sbjct  346  HEQWPLKTDDFFPYADHPNAYWTGYF  371



>gb|KDP41856.1| hypothetical protein JCGZ_26874 [Jatropha curcas]
Length=1015

 Score =   345 bits (886),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 180/205 (88%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +F   PR+GWQIDPFGHSAVQAYLLGAE+GFDSL+F RIDYQDRAKR  EK+LE +WR S
Sbjct  156  EFAQFPRVGWQIDPFGHSAVQAYLLGAELGFDSLFFARIDYQDRAKRLEEKNLEFIWRGS  215

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            KSL ++SQIF G FP +Y+PP GF FE+ND SP +QDD  LFDYNV ERV+DFVAAAL+Q
Sbjct  216  KSLSSTSQIFTGIFPRHYDPPDGFTFEINDISPPIQDDILLFDYNVQERVDDFVAAALAQ  275

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            AN+TRTNH+MW MGTDF+YQYA+SWFR +DK IHYVN+DGRVNALYSTPSIYTDAKYA++
Sbjct  276  ANVTRTNHIMWLMGTDFRYQYANSWFRQMDKFIHYVNEDGRVNALYSTPSIYTDAKYAAN  335

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            + WP+KTED+FPYAD  NAYWTGYF
Sbjct  336  EQWPIKTEDFFPYADHPNAYWTGYF  360



>ref|XP_004306319.1| PREDICTED: alpha-mannosidase [Fragaria vesca subsp. vesca]
Length=1015

 Score =   345 bits (885),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 180/206 (87%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F  TPR+GWQIDPFGHSAVQAYLLGAE+GFDSL+F RIDYQDRA R  +K+LEV+W+ 
Sbjct  154  KEFGQTPRVGWQIDPFGHSAVQAYLLGAELGFDSLFFARIDYQDRAVRLRDKTLEVIWQG  213

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
             KSL +SSQIF G FP++Y+PP GF FE+ND SP +QDD  LFDYNV ERVN+FVAAAL+
Sbjct  214  CKSLASSSQIFTGIFPKHYDPPDGFVFEINDVSPPIQDDILLFDYNVQERVNNFVAAALA  273

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QAN+TRTNH+MW MGTDF+YQYA+SWFR +DK IHYVNQD RVNA YSTPSIYTDAKYA+
Sbjct  274  QANVTRTNHIMWLMGTDFRYQYANSWFRQMDKFIHYVNQDARVNAFYSTPSIYTDAKYAA  333

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            D+ WPLKT+D+FPYAD  NAYWTGYF
Sbjct  334  DEQWPLKTDDFFPYADHPNAYWTGYF  359



>ref|XP_009591889.1| PREDICTED: lysosomal alpha-mannosidase-like, partial [Nicotiana 
tomentosiformis]
Length=671

 Score =   337 bits (864),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +FN+TPR GWQIDPFGHSAVQAYLLGAEVGFDS++F RIDYQDRAKRK +KSLEV+WRAS
Sbjct  162  EFNITPRAGWQIDPFGHSAVQAYLLGAEVGFDSVHFARIDYQDRAKRKEDKSLEVIWRAS  221

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            K+ G+SSQIF  AFP +Y PP+GF+FEV+DD   VQDD  +FD+NV  RVNDF+ AA++Q
Sbjct  222  KTFGSSSQIFTNAFPVHYSPPNGFHFEVDDDFVPVQDDPFIFDFNVDVRVNDFINAAITQ  281

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            AN+TRTNH+MWTMG DF+YQYA SWF+ +DKLIHYVN+DGRVNALYSTPSIY DAK+A++
Sbjct  282  ANVTRTNHIMWTMGDDFQYQYAESWFKEMDKLIHYVNKDGRVNALYSTPSIYVDAKHATN  341

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            QS PLKT+DYFPYAD  N+YWTG+F
Sbjct  342  QSLPLKTDDYFPYADGANSYWTGFF  366



>gb|EPS72012.1| hypothetical protein M569_02745, partial [Genlisea aurea]
Length=1017

 Score =   345 bits (885),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +FN  PR+GWQIDPFGHS+VQAYLLGAEVGFDSL+F RIDYQDRAKR+ +K+LEV+W+ S
Sbjct  171  EFNKKPRVGWQIDPFGHSSVQAYLLGAEVGFDSLFFARIDYQDRAKRRADKTLEVIWQGS  230

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            +SLG+++QIF G FP +YEPP GF FEVND S  +QDD  LFDYNV +RV+DFVAAAL+Q
Sbjct  231  RSLGSTAQIFTGIFPIHYEPPDGFTFEVNDVSSPIQDDDQLFDYNVQQRVDDFVAAALAQ  290

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            AN+TR NH+MWTMGTDF+YQYA SWFR +DK IHYVN DGRV+ALYSTPSIYTDAKYA++
Sbjct  291  ANLTRANHIMWTMGTDFRYQYAASWFRQMDKFIHYVNLDGRVHALYSTPSIYTDAKYAAN  350

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            + WP+KT D+FPYADRENAYWTGYF
Sbjct  351  EDWPIKTGDFFPYADRENAYWTGYF  375



>ref|XP_004493076.1| PREDICTED: lysosomal alpha-mannosidase-like [Cicer arietinum]
Length=1023

 Score =   345 bits (884),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 180/205 (88%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +F   PR+GWQIDPFGHSAVQAYLLGAE+GFDSL+F RIDYQDRAKR  E++LEVVW+ S
Sbjct  156  EFGKIPRVGWQIDPFGHSAVQAYLLGAELGFDSLFFARIDYQDRAKRLKERTLEVVWQGS  215

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            +SLG+SSQIF G  P +Y+PP GF FE+ND SP +QDD  LFDYNV ERV+DFV+AAL+Q
Sbjct  216  RSLGSSSQIFTGISPRHYDPPDGFTFEINDVSPPIQDDILLFDYNVEERVDDFVSAALAQ  275

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            AN+TRTNH+MW MGTDF+YQYA+SWFR +DK IHYVNQDGRVNALYSTPSIYTDAKYA++
Sbjct  276  ANVTRTNHIMWMMGTDFRYQYANSWFRQMDKFIHYVNQDGRVNALYSTPSIYTDAKYAAN  335

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            + WPLK +D+FPYAD  NAYWTGYF
Sbjct  336  EQWPLKIDDFFPYADHPNAYWTGYF  360



>ref|XP_011462234.1| PREDICTED: alpha-mannosidase isoform X1 [Fragaria vesca subsp. 
vesca]
Length=1006

 Score =   344 bits (883),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 156/206 (76%), Positives = 182/206 (88%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            QQFN TPR GWQIDPFGHSAVQ YLLGAE+GFDS++F RIDYQDRA+RKG+KSLEV+W  
Sbjct  159  QQFNKTPRAGWQIDPFGHSAVQGYLLGAELGFDSVHFARIDYQDRAQRKGDKSLEVIWHG  218

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SK+ G+SSQIFA AFP +Y PP GF+FEV DD   VQD+  +FDYNV +RVNDF+ AA++
Sbjct  219  SKTFGSSSQIFANAFPRHYSPPEGFHFEVFDDFVPVQDNPLIFDYNVEQRVNDFITAAIT  278

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QAN+TRTNH+MWTMG DF+YQYA SWF+ +DKLIHYVN+DGRVNALYSTPS+YTDAK A+
Sbjct  279  QANVTRTNHMMWTMGDDFQYQYAESWFKQMDKLIHYVNKDGRVNALYSTPSLYTDAKNAA  338

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            +QSWPLKTEDYFPYAD+ NAYWTGYF
Sbjct  339  NQSWPLKTEDYFPYADQINAYWTGYF  364



>ref|XP_011462239.1| PREDICTED: alpha-mannosidase isoform X2 [Fragaria vesca subsp. 
vesca]
Length=1005

 Score =   344 bits (883),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 156/206 (76%), Positives = 182/206 (88%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            QQFN TPR GWQIDPFGHSAVQ YLLGAE+GFDS++F RIDYQDRA+RKG+KSLEV+W  
Sbjct  159  QQFNKTPRAGWQIDPFGHSAVQGYLLGAELGFDSVHFARIDYQDRAQRKGDKSLEVIWHG  218

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SK+ G+SSQIFA AFP +Y PP GF+FEV DD   VQD+  +FDYNV +RVNDF+ AA++
Sbjct  219  SKTFGSSSQIFANAFPRHYSPPEGFHFEVFDDFVPVQDNPLIFDYNVEQRVNDFITAAIT  278

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QAN+TRTNH+MWTMG DF+YQYA SWF+ +DKLIHYVN+DGRVNALYSTPS+YTDAK A+
Sbjct  279  QANVTRTNHMMWTMGDDFQYQYAESWFKQMDKLIHYVNKDGRVNALYSTPSLYTDAKNAA  338

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            +QSWPLKTEDYFPYAD+ NAYWTGYF
Sbjct  339  NQSWPLKTEDYFPYADQINAYWTGYF  364



>ref|XP_003573734.1| PREDICTED: lysosomal alpha-mannosidase [Brachypodium distachyon]
Length=998

 Score =   344 bits (882),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 157/206 (76%), Positives = 182/206 (88%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFN TPR GWQIDPFGHSAVQAYLLGAE+GFDS++F RIDYQDRAKRK +K+LEV+WR 
Sbjct  152  KQFNKTPRAGWQIDPFGHSAVQAYLLGAELGFDSVHFARIDYQDRAKRKEDKALEVIWRG  211

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            S++ G+SSQIF  AFP +Y PPSGF FEV DD   VQDD  LFDYNV +RVNDFV+AA++
Sbjct  212  SRTFGSSSQIFTNAFPVHYSPPSGFGFEVLDDISPVQDDLLLFDYNVEQRVNDFVSAAIA  271

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QAN+TRTNH+MWTMG DF YQYA SWFRN+D+LIHYVN+DGRV+ALYSTPSIYTDAK+AS
Sbjct  272  QANLTRTNHIMWTMGDDFNYQYAESWFRNMDRLIHYVNKDGRVHALYSTPSIYTDAKHAS  331

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWPLK +DYFPYAD  NAYWTGYF
Sbjct  332  NESWPLKYDDYFPYADSTNAYWTGYF  357



>ref|XP_010040832.1| PREDICTED: lysosomal alpha-mannosidase-like [Eucalyptus grandis]
 gb|KCW44882.1| hypothetical protein EUGRSUZ_L01536 [Eucalyptus grandis]
Length=588

 Score =   333 bits (855),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 179/205 (87%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            QF+  PR+GWQIDPFGHSAVQAYLLGAEVGFDSL+F RIDYQDRA RK +KSLEV+WR S
Sbjct  160  QFDKVPRVGWQIDPFGHSAVQAYLLGAEVGFDSLHFARIDYQDRATRKNDKSLEVIWRGS  219

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            K+ G+SSQIF  AFP +Y PP GF FEV++D   VQD+T L+DYNV +RVNDF++AA++Q
Sbjct  220  KTFGSSSQIFTNAFPIHYSPPEGFNFEVSNDFEPVQDNTLLYDYNVEKRVNDFISAAMTQ  279

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            AN+TRTNH+MWTMG DF YQYA SWF+ +DKLIHYVN+DGRVNALYSTPSIY DAK A++
Sbjct  280  ANVTRTNHIMWTMGDDFVYQYAESWFKQMDKLIHYVNKDGRVNALYSTPSIYVDAKNAAN  339

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
             SWPLKT+DY PYADR++AYWTGYF
Sbjct  340  VSWPLKTDDYLPYADRKDAYWTGYF  364



>tpg|DAA42033.1| TPA: alpha-mannosidase [Zea mays]
Length=1036

 Score =   344 bits (883),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 165/227 (73%), Positives = 185/227 (81%), Gaps = 21/227 (9%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F   PRIGWQIDPFGHSAVQAYLLGAEVGFD+ YF RIDYQDR  RKG K LEVVWR 
Sbjct  155  EEFGQIPRIGWQIDPFGHSAVQAYLLGAEVGFDAFYFFRIDYQDRDTRKGTKELEVVWRG  214

Query  182  SKSLGTSSQ--------------------IFAGAFPENYEPPSG-FYFEVNDDSPVVQDD  298
            SK+LG+S+                     IFAG FP+NYEPP G FYFEV+D+SPVVQDD
Sbjct  215  SKTLGSSADVSGLFLFQKYTMHLVICSIYIFAGIFPKNYEPPPGDFYFEVDDNSPVVQDD  274

Query  299  TDLFDYNVPERVNDFVAAALSQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQ  478
              LFDYNV ERVNDFVAAA++QANITRTNH+M+TMGTDFKYQYA SWFRN+DKLIHYVN+
Sbjct  275  PLLFDYNVEERVNDFVAAAVAQANITRTNHIMFTMGTDFKYQYAESWFRNMDKLIHYVNK  334

Query  479  DGRVNALYSTPSIYTDAKYASDQSWPLKTEDYFPYADRENAYWTGYF  619
            DGR+NALYSTPSIYTDAKYA+++ WPLKT D+FPYAD  NAYWTGYF
Sbjct  335  DGRINALYSTPSIYTDAKYAANEQWPLKTNDFFPYADNPNAYWTGYF  381



>ref|XP_008231240.1| PREDICTED: lysosomal alpha-mannosidase [Prunus mume]
Length=1023

 Score =   344 bits (882),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 180/206 (87%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F   PR+GWQIDPFGHSAVQAYLLGAE+GFDSL+F RIDYQDRA+R  +K+LEV+W+ 
Sbjct  162  KEFGKVPRVGWQIDPFGHSAVQAYLLGAELGFDSLFFARIDYQDRARRLRDKTLEVIWQG  221

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSL +SSQIF G FP +Y+PP GF FE+ND SP +QDD  LFDYNV +RV+DFVAAA +
Sbjct  222  SKSLASSSQIFTGIFPRHYDPPDGFTFEINDVSPPIQDDVLLFDYNVQDRVHDFVAAAFA  281

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QAN+TRTNH+MW MGTDF+YQYA+SWFR +DK IHYVNQDGRVNALYSTPSIYTDAKYA+
Sbjct  282  QANVTRTNHIMWNMGTDFRYQYANSWFRQMDKFIHYVNQDGRVNALYSTPSIYTDAKYAA  341

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
             + WPLKT+D+FPYAD  NAYWTGYF
Sbjct  342  HEQWPLKTDDFFPYADHPNAYWTGYF  367



>ref|XP_006665027.1| PREDICTED: lysosomal alpha-mannosidase-like, partial [Oryza brachyantha]
Length=1008

 Score =   343 bits (881),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 161/207 (78%), Positives = 179/207 (86%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F   PRIGWQIDPFGHSAVQAYLLG EVGFD+ YF RIDYQDR  RKG K LEVVWR 
Sbjct  147  EEFGQVPRIGWQIDPFGHSAVQAYLLGTEVGFDAFYFFRIDYQDRDTRKGTKELEVVWRG  206

Query  182  SKSLGTSSQIFAGAFPENYEPPSG-FYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SK+ G+S+ IFAG FP+NYEPP G FYFEV+D SP+VQDD  LFDYNV +RVNDFVAAA+
Sbjct  207  SKTFGSSADIFAGIFPKNYEPPPGEFYFEVDDTSPIVQDDPLLFDYNVEQRVNDFVAAAI  266

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            +QANITRTNHVM+TMGTDFKYQYA SWFR +DKLIHYVN+DGRVNALYSTPSIYTDAK+A
Sbjct  267  AQANITRTNHVMFTMGTDFKYQYAESWFRQMDKLIHYVNKDGRVNALYSTPSIYTDAKHA  326

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
             +  WPLKT D+FPYAD  NAYWTGYF
Sbjct  327  ENVPWPLKTNDFFPYADDPNAYWTGYF  353



>ref|XP_010246823.1| PREDICTED: lysosomal alpha-mannosidase isoform X1 [Nelumbo nucifera]
 ref|XP_010246824.1| PREDICTED: lysosomal alpha-mannosidase isoform X1 [Nelumbo nucifera]
Length=1011

 Score =   343 bits (881),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 157/210 (75%), Positives = 183/210 (87%), Gaps = 4/210 (2%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFN  PR+GWQIDPFGHSAVQAYL GAE+GFDSLYF RIDYQDR KRK +KSLEVVWR 
Sbjct  162  KQFNKVPRVGWQIDPFGHSAVQAYLFGAELGFDSLYFARIDYQDREKRKEDKSLEVVWRG  221

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDS----PVVQDDTDLFDYNVPERVNDFVA  349
            SK+ G+SS+IF  AFP +Y PP+GF+FEVNDDS      VQD+  LFDYNV +RVNDFVA
Sbjct  222  SKTFGSSSEIFTSAFPVHYGPPTGFHFEVNDDSSPDSAPVQDNPHLFDYNVEQRVNDFVA  281

Query  350  AALSQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDA  529
            AA++Q N+TRTNH+MWTMG DF+YQYA +WF+ +DKLIHYVN+DGRVNALYSTPSIY DA
Sbjct  282  AAVTQENVTRTNHIMWTMGDDFQYQYAETWFKQMDKLIHYVNKDGRVNALYSTPSIYADA  341

Query  530  KYASDQSWPLKTEDYFPYADRENAYWTGYF  619
            K A+++SWPLKT+DYFPYADRENAYWTG+F
Sbjct  342  KNAANESWPLKTDDYFPYADRENAYWTGFF  371



>ref|XP_004983404.1| PREDICTED: lysosomal alpha-mannosidase-like [Setaria italica]
Length=1013

 Score =   343 bits (880),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/207 (76%), Positives = 182/207 (88%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFN TPR GWQIDPFGHSAVQAYLLGAE+GFDS++F RIDYQDRAKRKG+K LEV+WR 
Sbjct  163  KQFNKTPRAGWQIDPFGHSAVQAYLLGAELGFDSVHFARIDYQDRAKRKGDKGLEVIWRG  222

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPV-VQDDTDLFDYNVPERVNDFVAAAL  358
            S++ G+SSQIF  AFP +Y PP GF FEV D++ + VQDD  LFDYNV ERVNDFVAAA+
Sbjct  223  SRTFGSSSQIFTNAFPVHYSPPDGFSFEVLDENVIPVQDDMSLFDYNVIERVNDFVAAAI  282

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            +QAN+TRTNH+MWTMG DF YQYA SWFRN+DKLI YVN+DGRV+ALYSTPSIYTDAK+A
Sbjct  283  AQANVTRTNHIMWTMGDDFNYQYAESWFRNMDKLIQYVNKDGRVHALYSTPSIYTDAKHA  342

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            SD+SWP+K +DYFPYAD  NAYWTGYF
Sbjct  343  SDESWPVKYDDYFPYADSTNAYWTGYF  369



>gb|ABG65906.1| glycosyl hydrolase family 38 protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=873

 Score =   340 bits (873),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 179/206 (87%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFN  PR GWQIDPFGHSAVQ YLLGAE+GFDS++F RIDYQDRAKRKG+K LEV+WR 
Sbjct  25   KQFNKIPRAGWQIDPFGHSAVQGYLLGAELGFDSMHFARIDYQDRAKRKGDKGLEVIWRG  84

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            S++ G+SSQIF  AFP +Y PP GF FE+ DD   VQDD  LFDYN+ ERVNDFVAAAL 
Sbjct  85   SRTFGSSSQIFTNAFPVHYSPPDGFGFEIFDDFVPVQDDMLLFDYNLKERVNDFVAAALK  144

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QAN+TRTNH+MWTMG DF YQYA SWFRN+D+LI+YVN+DGRV+ALYSTPSIYTDAK+AS
Sbjct  145  QANVTRTNHIMWTMGDDFNYQYAESWFRNMDRLINYVNKDGRVHALYSTPSIYTDAKHAS  204

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWPLK +DYFPYAD +NAYWTGYF
Sbjct  205  NESWPLKYDDYFPYADAKNAYWTGYF  230



>ref|XP_010246825.1| PREDICTED: lysosomal alpha-mannosidase isoform X2 [Nelumbo nucifera]
Length=988

 Score =   343 bits (879),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 157/210 (75%), Positives = 183/210 (87%), Gaps = 4/210 (2%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFN  PR+GWQIDPFGHSAVQAYL GAE+GFDSLYF RIDYQDR KRK +KSLEVVWR 
Sbjct  162  KQFNKVPRVGWQIDPFGHSAVQAYLFGAELGFDSLYFARIDYQDREKRKEDKSLEVVWRG  221

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDS----PVVQDDTDLFDYNVPERVNDFVA  349
            SK+ G+SS+IF  AFP +Y PP+GF+FEVNDDS      VQD+  LFDYNV +RVNDFVA
Sbjct  222  SKTFGSSSEIFTSAFPVHYGPPTGFHFEVNDDSSPDSAPVQDNPHLFDYNVEQRVNDFVA  281

Query  350  AALSQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDA  529
            AA++Q N+TRTNH+MWTMG DF+YQYA +WF+ +DKLIHYVN+DGRVNALYSTPSIY DA
Sbjct  282  AAVTQENVTRTNHIMWTMGDDFQYQYAETWFKQMDKLIHYVNKDGRVNALYSTPSIYADA  341

Query  530  KYASDQSWPLKTEDYFPYADRENAYWTGYF  619
            K A+++SWPLKT+DYFPYADRENAYWTG+F
Sbjct  342  KNAANESWPLKTDDYFPYADRENAYWTGFF  371



>gb|EYU30803.1| hypothetical protein MIMGU_mgv1a000690mg [Erythranthe guttata]
Length=1017

 Score =   343 bits (880),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            QFN TPR GWQIDPFGHSAVQAYLLGAE+GFDS++F RIDYQDRAKRKG+KSLEVVW+ S
Sbjct  158  QFNTTPRAGWQIDPFGHSAVQAYLLGAELGFDSVHFARIDYQDRAKRKGDKSLEVVWQGS  217

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            ++ G SSQIFA AFP +Y PPSGF+FEVNDD   VQD+  LFD+NV  RV+DF+AAA++Q
Sbjct  218  RTFGPSSQIFANAFPVHYSPPSGFHFEVNDDYNPVQDNPLLFDFNVEARVSDFIAAAVTQ  277

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            AN+TRTNH+MWTMG DF+YQYA SWF+ +DKLIHYVN+DG+VN LYSTPS+YTDAKYASD
Sbjct  278  ANVTRTNHIMWTMGDDFQYQYAESWFKQMDKLIHYVNEDGQVNVLYSTPSLYTDAKYASD  337

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            +SWPLK +DYFPYAD  NAYWTG++
Sbjct  338  ESWPLKVDDYFPYADSANAYWTGFY  362



>ref|XP_007203420.1| hypothetical protein PRUPE_ppa021513mg [Prunus persica]
 gb|EMJ04619.1| hypothetical protein PRUPE_ppa021513mg [Prunus persica]
Length=1015

 Score =   342 bits (878),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 183/206 (89%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            QQFN TPR GWQIDPFGHSAVQAYLLGAE+GFDS++F RIDYQDRAKRKG+KSLEV+WR 
Sbjct  163  QQFNKTPRAGWQIDPFGHSAVQAYLLGAELGFDSVHFARIDYQDRAKRKGDKSLEVIWRG  222

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            S++ G+SSQIFA AFP +Y PP GF+FEVNDD   VQD+  LFDYNV +RV+DF+ A+++
Sbjct  223  SRTFGSSSQIFANAFPVHYSPPPGFHFEVNDDFIPVQDNPLLFDYNVEKRVSDFINASIT  282

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QAN+TRTNH+MWTMG DF+YQYA SWF+ +DKLIHYVN+D RVNALYSTPSIYTDAK A+
Sbjct  283  QANVTRTNHIMWTMGDDFQYQYAESWFKQMDKLIHYVNKDSRVNALYSTPSIYTDAKNAA  342

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            +QSWPLKT+DYFPYAD  +AYWTG+F
Sbjct  343  NQSWPLKTDDYFPYADTADAYWTGFF  368



>gb|ABG22500.1| Glycosyl hydrolases family 38 protein, expressed [Oryza sativa 
Japonica Group]
Length=1018

 Score =   342 bits (878),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 160/207 (77%), Positives = 179/207 (86%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F   PRIGWQIDPFGHSAVQAYLLG EVGFD+ YF RIDYQDR  RKG K LEVVWR 
Sbjct  159  EEFGQIPRIGWQIDPFGHSAVQAYLLGTEVGFDAFYFFRIDYQDRDTRKGTKELEVVWRG  218

Query  182  SKSLGTSSQIFAGAFPENYEPPSG-FYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SK+ G+S+ IFAG FP+NYEPP G FYFEV+D SP+VQDD  LFDYNV +RV+DFVAAA+
Sbjct  219  SKTFGSSADIFAGIFPKNYEPPPGQFYFEVDDTSPIVQDDPLLFDYNVEQRVDDFVAAAI  278

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            +QANITRTNHVM+TMGTDFKYQYA SWFR +DKLIHYVN+DGRVNALYSTPSIYTDAK+A
Sbjct  279  AQANITRTNHVMFTMGTDFKYQYAESWFRQMDKLIHYVNKDGRVNALYSTPSIYTDAKHA  338

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
             +  WPLKT D+FPYAD  NAYWTGYF
Sbjct  339  ENVPWPLKTNDFFPYADNPNAYWTGYF  365



>gb|EEC68272.1| hypothetical protein OsI_36309 [Oryza sativa Indica Group]
Length=1022

 Score =   342 bits (878),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 160/207 (77%), Positives = 179/207 (86%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F   PRIGWQIDPFGHSAVQAYLLG EVGFD+ YF RIDYQDR  RKG K LEVVWR 
Sbjct  161  EEFGQIPRIGWQIDPFGHSAVQAYLLGTEVGFDAFYFFRIDYQDRDTRKGTKELEVVWRG  220

Query  182  SKSLGTSSQIFAGAFPENYEPPSG-FYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SK+ G+S+ IFAG FP+NYEPP G FYFEV+D SP+VQDD  LFDYNV +RV+DFVAAA+
Sbjct  221  SKTFGSSADIFAGIFPKNYEPPPGQFYFEVDDTSPIVQDDPLLFDYNVEQRVDDFVAAAI  280

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            +QANITRTNHVM+TMGTDFKYQYA SWFR +DKLIHYVN+DGRVNALYSTPSIYTDAK+A
Sbjct  281  AQANITRTNHVMFTMGTDFKYQYAESWFRQMDKLIHYVNKDGRVNALYSTPSIYTDAKHA  340

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
             +  WPLKT D+FPYAD  NAYWTGYF
Sbjct  341  ENVPWPLKTNDFFPYADNPNAYWTGYF  367



>ref|NP_001067993.1| Os11g0525600 [Oryza sativa Japonica Group]
 gb|ABA94007.1| Glycosyl hydrolases family 38 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF28356.1| Os11g0525600 [Oryza sativa Japonica Group]
 dbj|BAG90901.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE52198.1| hypothetical protein OsJ_34079 [Oryza sativa Japonica Group]
Length=1020

 Score =   342 bits (878),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 160/207 (77%), Positives = 179/207 (86%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F   PRIGWQIDPFGHSAVQAYLLG EVGFD+ YF RIDYQDR  RKG K LEVVWR 
Sbjct  159  EEFGQIPRIGWQIDPFGHSAVQAYLLGTEVGFDAFYFFRIDYQDRDTRKGTKELEVVWRG  218

Query  182  SKSLGTSSQIFAGAFPENYEPPSG-FYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SK+ G+S+ IFAG FP+NYEPP G FYFEV+D SP+VQDD  LFDYNV +RV+DFVAAA+
Sbjct  219  SKTFGSSADIFAGIFPKNYEPPPGQFYFEVDDTSPIVQDDPLLFDYNVEQRVDDFVAAAI  278

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            +QANITRTNHVM+TMGTDFKYQYA SWFR +DKLIHYVN+DGRVNALYSTPSIYTDAK+A
Sbjct  279  AQANITRTNHVMFTMGTDFKYQYAESWFRQMDKLIHYVNKDGRVNALYSTPSIYTDAKHA  338

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
             +  WPLKT D+FPYAD  NAYWTGYF
Sbjct  339  ENVPWPLKTNDFFPYADNPNAYWTGYF  365



>gb|AIX48013.1| LMann protein, partial [synthetic construct]
Length=863

 Score =   339 bits (869),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 181/206 (88%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFN TPR GWQIDPFGHSAVQAYLLGAE+GFDS++F RIDYQDRAKRK +KSLEV+WR 
Sbjct  134  EQFNKTPRAGWQIDPFGHSAVQAYLLGAELGFDSVHFARIDYQDRAKRKVDKSLEVIWRG  193

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SK+ G+SSQIFA  FP +Y PP GF+FEV++D   VQD+  LFDYNV +RVNDFV AA++
Sbjct  194  SKTFGSSSQIFANTFPVHYSPPPGFHFEVSEDFVPVQDNPLLFDYNVEQRVNDFVDAAMT  253

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QAN+TRTNH+MWTMG DF+YQYA SWF+ +DKLIHYVN+DGRVNALYSTPSIYTD K A+
Sbjct  254  QANVTRTNHIMWTMGDDFQYQYAESWFKQMDKLIHYVNKDGRVNALYSTPSIYTDMKNAA  313

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
             +SWPLK +DYFPYADRE+AYWTG+F
Sbjct  314  SESWPLKIDDYFPYADREDAYWTGFF  339



>ref|XP_006830303.1| hypothetical protein AMTR_s00121p00111530 [Amborella trichopoda]
 gb|ERM97719.1| hypothetical protein AMTR_s00121p00111530 [Amborella trichopoda]
Length=976

 Score =   341 bits (875),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 177/206 (86%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFN  PR+GWQIDPFGHSAVQAYL GAE+GFDSLYF RIDYQDR KRK EKSLEV+WR 
Sbjct  156  KQFNKVPRVGWQIDPFGHSAVQAYLFGAELGFDSLYFARIDYQDREKRKDEKSLEVIWRG  215

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SK+ G+SSQIF GAFP +Y PP+GF+FEVNDDS  +QDD  L+D N+ +RVNDF+ AA +
Sbjct  216  SKTFGSSSQIFTGAFPIHYGPPTGFHFEVNDDSAPIQDDPLLYDNNIAQRVNDFIDAATT  275

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            Q N+TRTNH+MWTMG DF+YQYA SWF+ +DK IHYVN+DGRVNA YSTPSIYTD K A 
Sbjct  276  QVNVTRTNHIMWTMGDDFQYQYAESWFKQMDKFIHYVNKDGRVNAFYSTPSIYTDTKNAE  335

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWPLKT+DYFPYADR NAYWTGYF
Sbjct  336  NESWPLKTDDYFPYADRANAYWTGYF  361



>ref|XP_006573549.1| PREDICTED: lysosomal alpha-mannosidase-like [Glycine max]
Length=1004

 Score =   342 bits (876),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 181/205 (88%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            QFN  PR GWQIDPFGHSAVQAYLLGAE+GFDS++F RIDYQDRAKRK +K+LEVVWR+S
Sbjct  159  QFNKVPRAGWQIDPFGHSAVQAYLLGAELGFDSVHFARIDYQDRAKRKVDKTLEVVWRSS  218

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            K+ G+S+QIFA AFP +Y PPSGF+FE+NDD   VQDD  LFDYNV +RV DF+AAA++Q
Sbjct  219  KTFGSSAQIFANAFPVHYSPPSGFHFEINDDFVPVQDDPLLFDYNVEQRVKDFIAAAITQ  278

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            AN+TRTNH+MWTMG DF+YQ A SWF+ +DKLIHYVN+DGRVNALYSTPSIYTDAK A++
Sbjct  279  ANVTRTNHIMWTMGDDFQYQNAESWFKQMDKLIHYVNKDGRVNALYSTPSIYTDAKNAAN  338

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            Q WPLKT+DYFPYAD  NAYWTGYF
Sbjct  339  QPWPLKTDDYFPYADGPNAYWTGYF  363



>ref|XP_009759741.1| PREDICTED: lysosomal alpha-mannosidase isoform X2 [Nicotiana 
sylvestris]
Length=998

 Score =   341 bits (875),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 184/205 (90%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +FN+TPR GWQIDPFGHSAVQAYLLGAEVGFDS++F RIDYQDRAKRKG+KSLEV+WRAS
Sbjct  162  EFNITPRAGWQIDPFGHSAVQAYLLGAEVGFDSVHFARIDYQDRAKRKGDKSLEVIWRAS  221

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            K+ G+SSQIF  AFP +Y PP+GF+FEV+DD   VQDD  +FD+NV  RVNDF+ AA++Q
Sbjct  222  KTFGSSSQIFTNAFPVHYSPPNGFHFEVDDDFVPVQDDPFIFDFNVDIRVNDFINAAITQ  281

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            AN+TRTNH+MWTMG DF+YQYA SWF+ +DKLIHYVN+DGRV+ALYSTPSIY DAK+A++
Sbjct  282  ANVTRTNHIMWTMGDDFQYQYAESWFKEMDKLIHYVNKDGRVHALYSTPSIYVDAKHATN  341

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            +SWPLKT+DYFPYAD  N+YWTG+F
Sbjct  342  ESWPLKTDDYFPYADGANSYWTGFF  366



>gb|KJB17633.1| hypothetical protein B456_003G008600 [Gossypium raimondii]
Length=915

 Score =   339 bits (870),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 182/206 (88%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFN  PR GWQIDPFGHSAVQ+YLLGAEVGFDS++F RIDYQDRA+RK +KSLEV+W+ 
Sbjct  159  EQFNNVPRAGWQIDPFGHSAVQSYLLGAEVGFDSMHFARIDYQDRAQRKNKKSLEVIWQG  218

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            S + G+SSQIFA AFP +Y PP+GF+FEV+DDS  VQD+  LFDYNV +RVNDF+ AA+ 
Sbjct  219  SNTFGSSSQIFANAFPIHYSPPTGFHFEVDDDSAPVQDNPLLFDYNVEQRVNDFINAAMI  278

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QAN+TRTNH+MWTMG DF+YQYA +WFR +DK IHYVN+DGRVNALYSTPSIYTDAK A+
Sbjct  279  QANVTRTNHIMWTMGDDFQYQYAETWFRQMDKFIHYVNKDGRVNALYSTPSIYTDAKNAA  338

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            +++WPLKT+DYFPYAD +NAYWTGYF
Sbjct  339  NETWPLKTDDYFPYADSQNAYWTGYF  364



>ref|XP_002530831.1| lysosomal alpha-mannosidase, putative [Ricinus communis]
 gb|EEF31544.1| lysosomal alpha-mannosidase, putative [Ricinus communis]
Length=891

 Score =   338 bits (868),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 181/206 (88%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFN TPR GWQIDPFGHSAVQAYLLGAE+GFDS++F RIDYQDRAKRK +KSLEV+WR 
Sbjct  162  EQFNKTPRAGWQIDPFGHSAVQAYLLGAELGFDSVHFARIDYQDRAKRKVDKSLEVIWRG  221

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SK+ G+SSQIFA  FP +Y PP GF+FEV++D   VQD+  LFDYNV +RVNDFV AA++
Sbjct  222  SKTFGSSSQIFANTFPVHYSPPPGFHFEVSEDFVPVQDNPLLFDYNVEQRVNDFVDAAMT  281

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QAN+TRTNH+MWTMG DF+YQYA SWF+ +DKLIHYVN+DGRVNALYSTPSIYTD K A+
Sbjct  282  QANVTRTNHIMWTMGDDFQYQYAESWFKQMDKLIHYVNKDGRVNALYSTPSIYTDMKNAA  341

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
             +SWPLK +DYFPYADRE+AYWTG+F
Sbjct  342  SESWPLKIDDYFPYADREDAYWTGFF  367



>ref|XP_009759740.1| PREDICTED: lysosomal alpha-mannosidase isoform X1 [Nicotiana 
sylvestris]
Length=1006

 Score =   341 bits (874),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 184/205 (90%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +FN+TPR GWQIDPFGHSAVQAYLLGAEVGFDS++F RIDYQDRAKRKG+KSLEV+WRAS
Sbjct  162  EFNITPRAGWQIDPFGHSAVQAYLLGAEVGFDSVHFARIDYQDRAKRKGDKSLEVIWRAS  221

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            K+ G+SSQIF  AFP +Y PP+GF+FEV+DD   VQDD  +FD+NV  RVNDF+ AA++Q
Sbjct  222  KTFGSSSQIFTNAFPVHYSPPNGFHFEVDDDFVPVQDDPFIFDFNVDIRVNDFINAAITQ  281

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            AN+TRTNH+MWTMG DF+YQYA SWF+ +DKLIHYVN+DGRV+ALYSTPSIY DAK+A++
Sbjct  282  ANVTRTNHIMWTMGDDFQYQYAESWFKEMDKLIHYVNKDGRVHALYSTPSIYVDAKHATN  341

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            +SWPLKT+DYFPYAD  N+YWTG+F
Sbjct  342  ESWPLKTDDYFPYADGANSYWTGFF  366



>gb|KHN36022.1| Lysosomal alpha-mannosidase [Glycine soja]
Length=1035

 Score =   342 bits (876),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 181/205 (88%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            QFN  PR GWQIDPFGHSAVQAYLLGAE+GFDS++F RIDYQDRAKRK +K+LEVVWR+S
Sbjct  159  QFNKVPRAGWQIDPFGHSAVQAYLLGAELGFDSVHFARIDYQDRAKRKVDKTLEVVWRSS  218

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            K+ G+S+QIFA AFP +Y PPSGF+FE+NDD   VQDD  LFDYNV +RV DF+AAA++Q
Sbjct  219  KTFGSSAQIFANAFPVHYSPPSGFHFEINDDFVPVQDDPLLFDYNVEQRVKDFIAAAITQ  278

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            AN+TRTNH+MWTMG DF+YQ A SWF+ +DKLIHYVN+DGRVNALYSTPSIYTDAK A++
Sbjct  279  ANVTRTNHIMWTMGDDFQYQNAESWFKQMDKLIHYVNKDGRVNALYSTPSIYTDAKNAAN  338

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            Q WPLKT+DYFPYAD  NAYWTGYF
Sbjct  339  QPWPLKTDDYFPYADGPNAYWTGYF  363



>ref|XP_006661627.1| PREDICTED: lysosomal alpha-mannosidase-like [Oryza brachyantha]
Length=927

 Score =   339 bits (869),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 178/206 (86%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFN  PR GWQIDPFGHSAVQ YLLGAE+GFDS++F RIDYQDRAKRKG+K LEV+WR 
Sbjct  84   KQFNKIPRAGWQIDPFGHSAVQGYLLGAELGFDSMHFARIDYQDRAKRKGDKGLEVIWRG  143

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            S++ G+S+QIF  AFP +Y PP+GF FEV DD   VQDD  LFDYNV +RVNDFV AA+ 
Sbjct  144  SRTFGSSAQIFTNAFPVHYSPPNGFGFEVLDDFVPVQDDMLLFDYNVEQRVNDFVFAAIK  203

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QAN+TRTNH+MWTMG DF YQYA SWFRN+D+LIHYVN+DGRV+ALYSTPSIYTDAK+AS
Sbjct  204  QANVTRTNHIMWTMGDDFNYQYAESWFRNMDRLIHYVNKDGRVHALYSTPSIYTDAKHAS  263

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWPLK +DYFPYAD  NAYWTGYF
Sbjct  264  NESWPLKYDDYFPYADSTNAYWTGYF  289



>gb|EEC66555.1| hypothetical protein OsI_32713 [Oryza sativa Indica Group]
Length=1004

 Score =   340 bits (872),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 179/206 (87%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFN  PR GWQIDPFGHSAVQ YLLGAE+GFDS++F RIDYQDRAKRKG+K LEV+WR 
Sbjct  156  KQFNKIPRAGWQIDPFGHSAVQGYLLGAELGFDSMHFARIDYQDRAKRKGDKGLEVIWRG  215

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            S++ G+SSQIF  AFP +Y PP GF FE+ DD   VQDD  LFDYN+ ERVNDFVAAAL 
Sbjct  216  SRTFGSSSQIFTNAFPVHYSPPDGFGFEIFDDFVPVQDDMLLFDYNLKERVNDFVAAALK  275

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QAN+TRTNH+MWTMG DF YQYA SWFRN+D+LI+YVN+DGRV+ALYSTPSIYTDAK+AS
Sbjct  276  QANVTRTNHIMWTMGDDFNYQYAESWFRNMDRLINYVNKDGRVHALYSTPSIYTDAKHAS  335

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWPLK +DYFPYAD +NAYWTGYF
Sbjct  336  NESWPLKYDDYFPYADAKNAYWTGYF  361



>ref|NP_001064140.1| Os10g0140200 [Oryza sativa Japonica Group]
 gb|ABG65904.1| glycosyl hydrolase family 38 protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF26054.1| Os10g0140200 [Oryza sativa Japonica Group]
 gb|EEE50554.1| hypothetical protein OsJ_30682 [Oryza sativa Japonica Group]
Length=1004

 Score =   340 bits (872),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 179/206 (87%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFN  PR GWQIDPFGHSAVQ YLLGAE+GFDS++F RIDYQDRAKRKG+K LEV+WR 
Sbjct  156  KQFNKIPRAGWQIDPFGHSAVQGYLLGAELGFDSMHFARIDYQDRAKRKGDKGLEVIWRG  215

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            S++ G+SSQIF  AFP +Y PP GF FE+ DD   VQDD  LFDYN+ ERVNDFVAAAL 
Sbjct  216  SRTFGSSSQIFTNAFPVHYSPPDGFGFEIFDDFVPVQDDMLLFDYNLKERVNDFVAAALK  275

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QAN+TRTNH+MWTMG DF YQYA SWFRN+D+LI+YVN+DGRV+ALYSTPSIYTDAK+AS
Sbjct  276  QANVTRTNHIMWTMGDDFNYQYAESWFRNMDRLINYVNKDGRVHALYSTPSIYTDAKHAS  335

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWPLK +DYFPYAD +NAYWTGYF
Sbjct  336  NESWPLKYDDYFPYADAKNAYWTGYF  361



>gb|KHG14504.1| Lysosomal alpha-mannosidase [Gossypium arboreum]
Length=1007

 Score =   340 bits (872),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 182/206 (88%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFN  PR GWQIDPFGHSAVQ+YLLGAEVGFDS++F RIDYQDRA+RK +KSLEV+W+ 
Sbjct  159  EQFNNVPRAGWQIDPFGHSAVQSYLLGAEVGFDSMHFARIDYQDRAQRKNDKSLEVIWQG  218

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            S + G+SSQIFA AFP +Y PP+GF+FEV+DDS  VQD+  LFDYNV +RVNDF+ AA+ 
Sbjct  219  SNTFGSSSQIFANAFPIHYSPPTGFHFEVDDDSAPVQDNPLLFDYNVEQRVNDFINAAMI  278

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QAN+TRTNH+MWTMG DF+YQYA +WFR +DK IHYVN+DGRVNALYSTPSIYTDAK A+
Sbjct  279  QANVTRTNHIMWTMGDDFQYQYAETWFRQMDKFIHYVNKDGRVNALYSTPSIYTDAKNAA  338

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            +++WPLKT+DYFPYAD +NAYWTGYF
Sbjct  339  NETWPLKTDDYFPYADSQNAYWTGYF  364



>gb|KJB17632.1| hypothetical protein B456_003G008600 [Gossypium raimondii]
Length=1007

 Score =   340 bits (872),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 182/206 (88%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFN  PR GWQIDPFGHSAVQ+YLLGAEVGFDS++F RIDYQDRA+RK +KSLEV+W+ 
Sbjct  159  EQFNNVPRAGWQIDPFGHSAVQSYLLGAEVGFDSMHFARIDYQDRAQRKNKKSLEVIWQG  218

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            S + G+SSQIFA AFP +Y PP+GF+FEV+DDS  VQD+  LFDYNV +RVNDF+ AA+ 
Sbjct  219  SNTFGSSSQIFANAFPIHYSPPTGFHFEVDDDSAPVQDNPLLFDYNVEQRVNDFINAAMI  278

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QAN+TRTNH+MWTMG DF+YQYA +WFR +DK IHYVN+DGRVNALYSTPSIYTDAK A+
Sbjct  279  QANVTRTNHIMWTMGDDFQYQYAETWFRQMDKFIHYVNKDGRVNALYSTPSIYTDAKNAA  338

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            +++WPLKT+DYFPYAD +NAYWTGYF
Sbjct  339  NETWPLKTDDYFPYADSQNAYWTGYF  364



>ref|XP_008440841.1| PREDICTED: lysosomal alpha-mannosidase [Cucumis melo]
Length=1007

 Score =   339 bits (870),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 181/206 (88%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++FN  PR GWQIDPFGHSAVQAYLL AEVGF+S++F RIDYQDR KRK +KSLEVVWR 
Sbjct  161  EEFNKVPRAGWQIDPFGHSAVQAYLLSAEVGFESVHFARIDYQDREKRKVDKSLEVVWRG  220

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SK+ G+SSQIF  AFP +Y PP GF+FEVNDDS ++QDD  L+DYNV +RVNDF+ AAL+
Sbjct  221  SKTFGSSSQIFTNAFPVHYSPPPGFHFEVNDDSNLIQDDPSLYDYNVEQRVNDFIDAALT  280

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMG DF+YQYA SWFR +DK IHY+ +DGR+NALYSTPSIYTDAK+A+
Sbjct  281  QANITRTNHIMWTMGDDFQYQYAESWFRQMDKFIHYIKKDGRINALYSTPSIYTDAKHAA  340

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWPLKT+D+FPYADR +AYWTG+F
Sbjct  341  NESWPLKTDDFFPYADRAHAYWTGFF  366



>gb|KCW64296.1| hypothetical protein EUGRSUZ_G01931 [Eucalyptus grandis]
Length=920

 Score =   337 bits (863),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 159/206 (77%), Positives = 184/206 (89%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++FN  PR+GWQIDPFGHSAVQAYLLGAE+GFDSL+F RIDYQDRAKR  +K+LEV+WR 
Sbjct  61   KEFNQVPRVGWQIDPFGHSAVQAYLLGAELGFDSLFFARIDYQDRAKRLKDKTLEVIWRG  120

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSLG+SSQIF G FP +Y+PP GF FE+ND SP +QDD  LFDYNV ERV+ FVAAAL+
Sbjct  121  SKSLGSSSQIFTGVFPRHYDPPDGFVFEINDVSPPIQDDIFLFDYNVQERVDAFVAAALA  180

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QAN+TRTNH+MWTMGTDF+YQYA SWFR +DK IHYVN+DGRVNALYSTPSIYTDAKYA+
Sbjct  181  QANVTRTNHIMWTMGTDFRYQYAVSWFRQIDKFIHYVNKDGRVNALYSTPSIYTDAKYAA  240

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++ WPLKT+D+FPYADR NAYWTGYF
Sbjct  241  NEQWPLKTDDFFPYADRPNAYWTGYF  266



>ref|XP_008788433.1| PREDICTED: lysosomal alpha-mannosidase-like isoform X2 [Phoenix 
dactylifera]
Length=999

 Score =   338 bits (867),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 180/206 (87%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFN  PR+GWQIDPFGHSAVQAYLLGAE+GFDS++F RIDYQDR KRK +KSLEV+WR 
Sbjct  154  KQFNKVPRVGWQIDPFGHSAVQAYLLGAELGFDSVHFARIDYQDRQKRKVDKSLEVIWRG  213

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SK+ G+SSQIFA AFP +Y PP GF FEVNDD   VQDD  L+DYNV +RVNDF+ AA++
Sbjct  214  SKTFGSSSQIFANAFPVHYSPPEGFGFEVNDDILPVQDDKLLYDYNVEQRVNDFIDAAIT  273

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QAN+TRTNH+MWTMG DFKYQYA SWFR +DKLIHYVN+DGRV+ALYS+PSIYTDAK A+
Sbjct  274  QANVTRTNHMMWTMGDDFKYQYAESWFRQMDKLIHYVNKDGRVHALYSSPSIYTDAKNAA  333

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWPLK +DYFPYAD  NAYWTGYF
Sbjct  334  NESWPLKFDDYFPYADAANAYWTGYF  359



>gb|KCW53179.1| hypothetical protein EUGRSUZ_J024562, partial [Eucalyptus grandis]
Length=866

 Score =   335 bits (860),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 179/205 (87%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            QF+  PR+GWQIDPFGHSAVQAYLLGAEVGFDSL+F RIDYQDRA RK +KSLEV+WR S
Sbjct  160  QFDKVPRVGWQIDPFGHSAVQAYLLGAEVGFDSLHFARIDYQDRATRKNDKSLEVIWRGS  219

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            K+ G+SSQIF  AFP +Y PP GF FEV++D   VQD+T L+DYNV +RVNDF++AA++Q
Sbjct  220  KTFGSSSQIFTNAFPIHYSPPEGFNFEVSNDFEPVQDNTLLYDYNVEKRVNDFISAAMTQ  279

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            AN+TRTNH+MWTMG DF YQYA SWF+ +DKLIHYVN+DGRVNALYSTPSIY DAK A++
Sbjct  280  ANVTRTNHIMWTMGDDFVYQYAESWFKQMDKLIHYVNKDGRVNALYSTPSIYVDAKNAAN  339

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
             SWPLKT+DY PYADR++AYWTGYF
Sbjct  340  VSWPLKTDDYLPYADRKDAYWTGYF  364



>ref|XP_011099865.1| PREDICTED: alpha-mannosidase [Sesamum indicum]
Length=1012

 Score =   338 bits (867),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 181/205 (88%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            QFN TPR GWQIDPFGHSAVQAYLLGAE+GFDS++F R+DYQDRAKRKG+KSLEV+W+ S
Sbjct  162  QFNKTPRAGWQIDPFGHSAVQAYLLGAELGFDSVHFARVDYQDRAKRKGDKSLEVIWQGS  221

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            ++ G+SSQIFA AFP +Y PP GF+FEVND    VQD+  LFD+NV  RVNDF+AAA+ Q
Sbjct  222  RTFGSSSQIFANAFPVHYSPPEGFHFEVNDYFNPVQDNPLLFDFNVEVRVNDFIAAAMIQ  281

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            AN+TRTNH+MWTMG DF+YQYA SWF+ +DKLIHYVN+DGRVNALYSTPSIYTDAKYA++
Sbjct  282  ANVTRTNHIMWTMGDDFQYQYAESWFKQMDKLIHYVNKDGRVNALYSTPSIYTDAKYAAN  341

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            ++WPLK +DYFPYAD  NAYWTG++
Sbjct  342  ETWPLKLDDYFPYADSPNAYWTGFY  366



>ref|XP_010034700.1| PREDICTED: lysosomal alpha-mannosidase-like [Eucalyptus grandis]
Length=876

 Score =   335 bits (859),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 179/205 (87%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            QF+  PR+GWQIDPFGHSAVQAYLLGAEVGFDSL+F RIDYQDRA RK +KSLEV+WR S
Sbjct  160  QFDKVPRVGWQIDPFGHSAVQAYLLGAEVGFDSLHFARIDYQDRATRKNDKSLEVIWRGS  219

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            K+ G+SSQIF  AFP +Y PP GF FEV++D   VQD+T L+DYNV +RVNDF++AA++Q
Sbjct  220  KTFGSSSQIFTNAFPIHYSPPEGFNFEVSNDFEPVQDNTLLYDYNVEKRVNDFISAAMTQ  279

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            AN+TRTNH+MWTMG DF YQYA SWF+ +DKLIHYVN+DGRVNALYSTPSIY DAK A++
Sbjct  280  ANVTRTNHIMWTMGDDFVYQYAESWFKQMDKLIHYVNKDGRVNALYSTPSIYVDAKNAAN  339

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
             SWPLKT+DY PYADR++AYWTGYF
Sbjct  340  VSWPLKTDDYLPYADRKDAYWTGYF  364



>ref|XP_004135022.1| PREDICTED: lysosomal alpha-mannosidase-like [Cucumis sativus]
 gb|KGN48931.1| hypothetical protein Csa_6G507060 [Cucumis sativus]
Length=1007

 Score =   338 bits (866),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 182/206 (88%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++FN  PR GWQIDPFGHSAVQAYLL AEVGF+S++F RIDYQDR KRK +KSLEVVWR 
Sbjct  161  EEFNKVPRAGWQIDPFGHSAVQAYLLSAEVGFESVHFARIDYQDREKRKVDKSLEVVWRG  220

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SK+ G+SSQIF  AFP +Y PP GF+FEV+DDS ++QDD  L+DYNV +RVNDF+ AAL+
Sbjct  221  SKTFGSSSQIFTNAFPVHYSPPPGFHFEVDDDSNLIQDDPSLYDYNVEQRVNDFIEAALT  280

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMG DF+YQYA SWFR +D+ IHY+ +DGR+NALYSTPSIYTDAK+A+
Sbjct  281  QANITRTNHIMWTMGDDFQYQYAESWFRQMDRFIHYIKKDGRINALYSTPSIYTDAKHAA  340

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWPLKT+D+FPYADR++AYWTG+F
Sbjct  341  NESWPLKTDDFFPYADRDHAYWTGFF  366



>ref|XP_008354644.1| PREDICTED: lysosomal alpha-mannosidase-like [Malus domestica]
Length=1013

 Score =   338 bits (866),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 181/205 (88%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            QFN TPR GWQIDPFGHSAVQAYLL AE+GFDS++F RIDYQDRAKRK +KSLEV+WR S
Sbjct  164  QFNKTPRAGWQIDPFGHSAVQAYLLTAELGFDSVHFARIDYQDRAKRKEDKSLEVIWRGS  223

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            K+ G+SSQIFA AFP NY PP GF+FEV DD   VQD+  LFDYNV +RV+DF++A+++Q
Sbjct  224  KTFGSSSQIFANAFPVNYNPPPGFHFEVFDDVVPVQDNPLLFDYNVEQRVSDFISASVTQ  283

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            AN+TRT+HVMWTMG DF+YQYA SWF+ +DKLIHYVN+DGRVNALYSTPSIYTDAK A++
Sbjct  284  ANVTRTBHVMWTMGDDFQYQYAESWFKQMDKLIHYVNKDGRVNALYSTPSIYTDAKNAAN  343

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            QSWPLKTEDYFPYAD  +AYWTG+F
Sbjct  344  QSWPLKTEDYFPYADAVDAYWTGFF  368



>ref|XP_004158902.1| PREDICTED: lysosomal alpha-mannosidase-like [Cucumis sativus]
Length=1007

 Score =   337 bits (865),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 182/206 (88%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++FN  PR GWQIDPFGHSAVQAYLL AEVGF+S++F RIDYQDR KRK +KSLEVVWR 
Sbjct  161  EEFNKVPRAGWQIDPFGHSAVQAYLLSAEVGFESVHFARIDYQDREKRKVDKSLEVVWRG  220

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SK+ G+SSQIF  AFP +Y PP GF+FEV+DDS ++QDD  L+DYNV +RVNDF+ AAL+
Sbjct  221  SKTFGSSSQIFTNAFPVHYSPPPGFHFEVDDDSNLIQDDPSLYDYNVEQRVNDFIEAALT  280

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QANITRTNH+MWTMG DF+YQYA SWFR +D+ IHY+ +DGR+NALYSTPSIYTDAK+A+
Sbjct  281  QANITRTNHIMWTMGDDFQYQYAESWFRQMDRFIHYIKKDGRINALYSTPSIYTDAKHAA  340

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWPLKT+D+FPYADR++AYWTG+F
Sbjct  341  NESWPLKTDDFFPYADRDHAYWTGFF  366



>gb|KDP43185.1| hypothetical protein JCGZ_22737 [Jatropha curcas]
Length=1007

 Score =   337 bits (865),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 180/205 (88%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            QFN TPR GWQIDPFGHSAVQ YLLGAE+GFDS++F RIDYQDRAKR  +KSLEV+WR S
Sbjct  164  QFNKTPRAGWQIDPFGHSAVQGYLLGAELGFDSVHFARIDYQDRAKRYVDKSLEVIWRGS  223

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            K+ G+SSQIFA AFP +Y PP GF+FEV D+   VQD+  LFDYNV +RV+DF+ AA++Q
Sbjct  224  KTFGSSSQIFANAFPVHYSPPPGFHFEVFDNFEPVQDNPLLFDYNVEQRVSDFIKAAIAQ  283

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            AN+TRTNH+MWTMG DF+YQYA SWF+ +DKLIHYVN+DGRVNALYSTPSIYTD K A+D
Sbjct  284  ANVTRTNHIMWTMGDDFQYQYAESWFKQMDKLIHYVNKDGRVNALYSTPSIYTDVKNAAD  343

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            +SWPLKT+DYFPYADRENAYWTG+F
Sbjct  344  ESWPLKTDDYFPYADRENAYWTGFF  368



>ref|XP_011008830.1| PREDICTED: alpha-mannosidase isoform X2 [Populus euphratica]
Length=971

 Score =   336 bits (862),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 181/206 (88%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFN TPR GWQIDPFGHSAVQAYLLG E+GFDS++F RIDYQDRAKRK +K+LEV+WR 
Sbjct  166  EQFNKTPRAGWQIDPFGHSAVQAYLLGTELGFDSVHFARIDYQDRAKRKDDKALEVIWRG  225

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SK+ G+SSQIFA AFP +Y PP+GF+FEV DD   VQD+  L DYNV +RVNDF+ AA++
Sbjct  226  SKTFGSSSQIFANAFPVHYSPPNGFHFEVFDDFVPVQDNPLLDDYNVEQRVNDFINAAMT  285

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QAN+TRTNH+MWTMG DF+YQYA SWF+ +DKLIHYVN+DGRVNALYSTPSIYTD K A+
Sbjct  286  QANVTRTNHIMWTMGDDFQYQYAESWFKQMDKLIHYVNKDGRVNALYSTPSIYTDVKNAA  345

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWPLKT+DYFPYAD ENAYWTG+F
Sbjct  346  NESWPLKTDDYFPYADTENAYWTGFF  371



>ref|XP_006380603.1| hypothetical protein POPTR_0007s09730g [Populus trichocarpa]
 gb|ERP58400.1| hypothetical protein POPTR_0007s09730g [Populus trichocarpa]
Length=1011

 Score =   337 bits (863),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 181/206 (88%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFN TPR GWQIDPFGHSAVQAYLLG E+GFDS++F RIDYQDRAKRK +K+LEV+WR 
Sbjct  166  EQFNKTPRAGWQIDPFGHSAVQAYLLGTELGFDSVHFARIDYQDRAKRKDDKALEVIWRG  225

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SK+ G+SSQIFA AFP +Y PP+GF+FEV DD   VQD+  L DYNV +RVNDF+ AA++
Sbjct  226  SKTFGSSSQIFANAFPVHYSPPNGFHFEVFDDFVPVQDNPLLDDYNVEQRVNDFINAAMT  285

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QAN+TRTNH+MWTMG DF+YQYA SWF+ +DKLIHYVN+DGRVNALYSTPSIYTD K A+
Sbjct  286  QANVTRTNHIMWTMGDDFQYQYAESWFKQMDKLIHYVNKDGRVNALYSTPSIYTDVKNAA  345

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWPLKT+DYFPYAD ENAYWTG+F
Sbjct  346  NESWPLKTDDYFPYADTENAYWTGFF  371



>ref|XP_010066409.1| PREDICTED: LOW QUALITY PROTEIN: lysosomal alpha-mannosidase-like 
[Eucalyptus grandis]
Length=1032

 Score =   337 bits (864),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 159/206 (77%), Positives = 184/206 (89%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++FN  PR+GWQIDPFGHSAVQAYLLGAE+GFDSL+F RIDYQDRAKR  +K+LEV+WR 
Sbjct  173  KEFNQVPRVGWQIDPFGHSAVQAYLLGAELGFDSLFFARIDYQDRAKRLKDKTLEVIWRG  232

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SKSLG+SSQIF G FP +Y+PP GF FE+ND SP +QDD  LFDYNV ERV+ FVAAAL+
Sbjct  233  SKSLGSSSQIFTGVFPRHYDPPDGFVFEINDVSPPIQDDIFLFDYNVQERVDAFVAAALA  292

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QAN+TRTNH+MWTMGTDF+YQYA SWFR +DK IHYVN+DGRVNALYSTPSIYTDAKYA+
Sbjct  293  QANVTRTNHIMWTMGTDFRYQYAVSWFRQIDKFIHYVNKDGRVNALYSTPSIYTDAKYAA  352

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++ WPLKT+D+FPYADR NAYWTGYF
Sbjct  353  NEQWPLKTDDFFPYADRPNAYWTGYF  378



>ref|XP_011008829.1| PREDICTED: alpha-mannosidase isoform X1 [Populus euphratica]
Length=1011

 Score =   336 bits (862),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 181/206 (88%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFN TPR GWQIDPFGHSAVQAYLLG E+GFDS++F RIDYQDRAKRK +K+LEV+WR 
Sbjct  166  EQFNKTPRAGWQIDPFGHSAVQAYLLGTELGFDSVHFARIDYQDRAKRKDDKALEVIWRG  225

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SK+ G+SSQIFA AFP +Y PP+GF+FEV DD   VQD+  L DYNV +RVNDF+ AA++
Sbjct  226  SKTFGSSSQIFANAFPVHYSPPNGFHFEVFDDFVPVQDNPLLDDYNVEQRVNDFINAAMT  285

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QAN+TRTNH+MWTMG DF+YQYA SWF+ +DKLIHYVN+DGRVNALYSTPSIYTD K A+
Sbjct  286  QANVTRTNHIMWTMGDDFQYQYAESWFKQMDKLIHYVNKDGRVNALYSTPSIYTDVKNAA  345

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWPLKT+DYFPYAD ENAYWTG+F
Sbjct  346  NESWPLKTDDYFPYADTENAYWTGFF  371



>gb|KCW53178.1| hypothetical protein EUGRSUZ_J02455 [Eucalyptus grandis]
Length=776

 Score =   331 bits (849),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 177/205 (86%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            QFN  PR+GWQIDPFGHSAVQAYLLGAEVGFDSL+F RIDYQDRA RK +KSLEV+WR S
Sbjct  160  QFNKVPRVGWQIDPFGHSAVQAYLLGAEVGFDSLHFARIDYQDRANRKNDKSLEVIWRGS  219

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            K+ G+SSQIF  AFP +Y PP GF FE+++D   VQD+  L+DYNV +RVNDF++AA++Q
Sbjct  220  KTFGSSSQIFTNAFPVHYSPPDGFDFEMSNDFEPVQDNILLYDYNVEKRVNDFISAAMTQ  279

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            AN+TRTNH+MWTMG DF+YQYA SWF+ +DK +HYVN+DGRVNALYSTPSIY DAK A +
Sbjct  280  ANVTRTNHIMWTMGDDFQYQYAESWFKEMDKFVHYVNKDGRVNALYSTPSIYVDAKNAEN  339

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
             SWPLKT+DYFPYAD ++AYWTGYF
Sbjct  340  GSWPLKTDDYFPYADSKDAYWTGYF  364



>ref|XP_007157901.1| hypothetical protein PHAVU_002G1073000g, partial [Phaseolus vulgaris]
 gb|ESW29895.1| hypothetical protein PHAVU_002G1073000g, partial [Phaseolus vulgaris]
Length=692

 Score =   329 bits (843),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 177/205 (86%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            QFN  PR GWQIDPFGHSAVQAYLLGAE+GFDS++F RIDYQDR KRK +K+LEVVWR S
Sbjct  159  QFNKVPRAGWQIDPFGHSAVQAYLLGAELGFDSVHFARIDYQDRDKRKVDKTLEVVWRGS  218

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            K+ G+SSQIFA  FP +Y PP GF+FEVND+   VQDD  LFDYNV +RV DFVAAA++Q
Sbjct  219  KTFGSSSQIFANTFPVHYGPPRGFHFEVNDNLVPVQDDPLLFDYNVDQRVQDFVAAAITQ  278

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            AN+TRTNH+MWTMG DF+YQYA +WFR +DKLIH+VN+DGRVNALYSTPSIYTDAK A++
Sbjct  279  ANVTRTNHIMWTMGDDFQYQYAENWFRQMDKLIHHVNKDGRVNALYSTPSIYTDAKNAAN  338

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            Q WPLK +DY+PYAD  +AYWTG++
Sbjct  339  QQWPLKIDDYYPYADEPHAYWTGFY  363



>ref|XP_007046660.1| Fatty acid hydroxylase superfamily isoform 2 [Theobroma cacao]
 gb|EOX90817.1| Fatty acid hydroxylase superfamily isoform 2 [Theobroma cacao]
Length=1000

 Score =   335 bits (860),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 151/207 (73%), Positives = 182/207 (88%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFN  PR GWQIDPFGHSAVQ YLLGAE+GFDS++F R+DYQDRA+RK +K+LEV+WR 
Sbjct  163  EQFNKVPRAGWQIDPFGHSAVQGYLLGAELGFDSVHFARVDYQDRAQRKNDKTLEVIWRG  222

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SK+  +SSQIFA AFP +Y PP+GF+FEV+D    VQD+  LFDYNV +RVNDF+ AA++
Sbjct  223  SKTFRSSSQIFANAFPVHYSPPTGFHFEVDDSDLPVQDNPLLFDYNVEQRVNDFINAAMT  282

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQ-DGRVNALYSTPSIYTDAKYA  538
            QAN+TRTNH+MWTMG DF+YQYA SWFR +DKLIHYVN+ DGRVNALYSTPSIYTDAK+A
Sbjct  283  QANVTRTNHIMWTMGDDFQYQYAESWFRQMDKLIHYVNKVDGRVNALYSTPSIYTDAKHA  342

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            +++SWPLKT+DYFPYAD +NAYWTGYF
Sbjct  343  ANESWPLKTDDYFPYADSQNAYWTGYF  369



>ref|XP_007046659.1| Glycosyl hydrolase family 38 protein isoform 1 [Theobroma cacao]
 gb|EOX90816.1| Glycosyl hydrolase family 38 protein isoform 1 [Theobroma cacao]
Length=1012

 Score =   336 bits (861),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 151/207 (73%), Positives = 182/207 (88%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFN  PR GWQIDPFGHSAVQ YLLGAE+GFDS++F R+DYQDRA+RK +K+LEV+WR 
Sbjct  163  EQFNKVPRAGWQIDPFGHSAVQGYLLGAELGFDSVHFARVDYQDRAQRKNDKTLEVIWRG  222

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SK+  +SSQIFA AFP +Y PP+GF+FEV+D    VQD+  LFDYNV +RVNDF+ AA++
Sbjct  223  SKTFRSSSQIFANAFPVHYSPPTGFHFEVDDSDLPVQDNPLLFDYNVEQRVNDFINAAMT  282

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQ-DGRVNALYSTPSIYTDAKYA  538
            QAN+TRTNH+MWTMG DF+YQYA SWFR +DKLIHYVN+ DGRVNALYSTPSIYTDAK+A
Sbjct  283  QANVTRTNHIMWTMGDDFQYQYAESWFRQMDKLIHYVNKVDGRVNALYSTPSIYTDAKHA  342

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            +++SWPLKT+DYFPYAD +NAYWTGYF
Sbjct  343  ANESWPLKTDDYFPYADSQNAYWTGYF  369



>ref|XP_008788432.1| PREDICTED: lysosomal alpha-mannosidase-like isoform X1 [Phoenix 
dactylifera]
Length=1000

 Score =   335 bits (859),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 156/207 (75%), Positives = 180/207 (87%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFN  PR+GWQIDPFGHSAVQAYLLGAE+GFDS++F RIDYQDR KRK +KSLEV+WR 
Sbjct  154  KQFNKVPRVGWQIDPFGHSAVQAYLLGAELGFDSVHFARIDYQDRQKRKVDKSLEVIWRG  213

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SK+ G+SSQIFA AFP +Y PP GF FEVNDD   VQDD  L+DYNV +RVNDF+ AA++
Sbjct  214  SKTFGSSSQIFANAFPVHYSPPEGFGFEVNDDILPVQDDKLLYDYNVEQRVNDFIDAAIT  273

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVN-QDGRVNALYSTPSIYTDAKYA  538
            QAN+TRTNH+MWTMG DFKYQYA SWFR +DKLIHYVN QDGRV+ALYS+PSIYTDAK A
Sbjct  274  QANVTRTNHMMWTMGDDFKYQYAESWFRQMDKLIHYVNKQDGRVHALYSSPSIYTDAKNA  333

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            +++SWPLK +DYFPYAD  NAYWTGYF
Sbjct  334  ANESWPLKFDDYFPYADAANAYWTGYF  360



>emb|CDP01879.1| unnamed protein product [Coffea canephora]
Length=1009

 Score =   335 bits (859),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 181/205 (88%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            QFN TPR GWQIDPFGHSAV+AYLLGAE+GFDS++F RIDYQDRAKRK +K+LEV+W  S
Sbjct  162  QFNKTPRAGWQIDPFGHSAVEAYLLGAELGFDSVHFARIDYQDRAKRKVDKTLEVIWHGS  221

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            ++ G+SSQIFA AFP +Y PP+GF+FEV+DD   VQD+  LFD+NV  RV DFV+AA++Q
Sbjct  222  RTFGSSSQIFANAFPVHYSPPNGFHFEVDDDFVPVQDNPLLFDFNVERRVADFVSAAMAQ  281

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            AN+TRTNHVMWTMG DF+YQYA SWF+ +DKLIHYVN+DGRVNALYSTPSIYTDAK+A++
Sbjct  282  ANVTRTNHVMWTMGDDFQYQYAESWFKQMDKLIHYVNKDGRVNALYSTPSIYTDAKHAAN  341

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            ++WPLKT DYFPYAD  NAYWTGYF
Sbjct  342  ETWPLKTADYFPYADSANAYWTGYF  366



>ref|XP_008337530.1| PREDICTED: lysosomal alpha-mannosidase [Malus domestica]
Length=906

 Score =   333 bits (853),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 180/205 (88%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            QFN TPR GWQIDPFGHSAVQAYLL AE+GFDS++F RIDYQDRAKRK +KSLEV+WR S
Sbjct  56   QFNKTPRAGWQIDPFGHSAVQAYLLTAELGFDSVHFARIDYQDRAKRKVDKSLEVIWRGS  115

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            K+  +SSQIFA AFP +Y PP GF+FEV D+   VQD+  LFDYNV +RV+DF++A+L+Q
Sbjct  116  KTFSSSSQIFANAFPVHYSPPPGFHFEVFDNFEPVQDNPLLFDYNVEQRVSDFISASLTQ  175

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            AN+TRTNH+MWTMG DF+YQYA SWF+ +DKLIHYVN+DGRVNALYSTPSIYTDAK A++
Sbjct  176  ANVTRTNHIMWTMGDDFQYQYAESWFKQMDKLIHYVNKDGRVNALYSTPSIYTDAKNAAN  235

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            QSWPLKTEDYFPYAD  +AYWTG+F
Sbjct  236  QSWPLKTEDYFPYADAVDAYWTGFF  260



>ref|XP_009379376.1| PREDICTED: lysosomal alpha-mannosidase-like [Pyrus x bretschneideri]
Length=1020

 Score =   335 bits (858),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 180/205 (88%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            QFN TPR GWQIDPFGHSAVQAYLL AE+GFDS++F RIDYQDRAKRK +KSLEV+WR S
Sbjct  171  QFNKTPRAGWQIDPFGHSAVQAYLLTAELGFDSVHFARIDYQDRAKRKEDKSLEVIWRGS  230

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            K+ G+SSQIFA AFP NY PP GF+FEV DD   VQD+  LF+YNV +RV+DF++A+++Q
Sbjct  231  KTFGSSSQIFANAFPVNYNPPPGFHFEVFDDVIPVQDNPLLFNYNVEQRVSDFISASVTQ  290

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            AN+TRTNHVMWTMG DF+YQYA SWF+ +DKLIHYVN+DGRVNALYSTPSIY DAK A++
Sbjct  291  ANVTRTNHVMWTMGDDFQYQYAESWFKQMDKLIHYVNKDGRVNALYSTPSIYADAKNAAN  350

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            QSWPLKTEDYFPYAD  +AYWTG+F
Sbjct  351  QSWPLKTEDYFPYADAVDAYWTGFF  375



>ref|XP_010920133.1| PREDICTED: alpha-mannosidase-like [Elaeis guineensis]
Length=999

 Score =   334 bits (857),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 179/206 (87%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFN  PR+GWQIDPFGHSAVQ YLLGAE+GFDS++F RIDYQDR KRK +KSLEV+WR 
Sbjct  154  KQFNKVPRVGWQIDPFGHSAVQGYLLGAELGFDSVHFARIDYQDRQKRKVDKSLEVIWRG  213

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SK+ G+SSQIFA AFP +Y PP GF FEV+DD   VQDD  L+DYNV +RVNDF+ AA++
Sbjct  214  SKTFGSSSQIFANAFPVHYGPPEGFGFEVDDDILPVQDDKLLYDYNVEQRVNDFIDAAIT  273

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QAN+TRTNH+MWTMG DF+YQYA SWFR +D+LIHYVN+DGRV+ALYSTPSIYTDAK A+
Sbjct  274  QANVTRTNHIMWTMGDDFQYQYAESWFRQMDRLIHYVNKDGRVHALYSTPSIYTDAKNAA  333

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWPLK +DYFPYAD  NAYWTGYF
Sbjct  334  NESWPLKFDDYFPYADAANAYWTGYF  359



>ref|XP_010113332.1| Lysosomal alpha-mannosidase [Morus notabilis]
 gb|EXC35339.1| Lysosomal alpha-mannosidase [Morus notabilis]
Length=1011

 Score =   334 bits (857),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 181/206 (88%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFN  PR GWQIDPFGHSAVQAYLL AEVGF+S++F RIDYQDRAKRKG+KSLEV+WR 
Sbjct  161  KQFNKVPRAGWQIDPFGHSAVQAYLLSAEVGFESVHFARIDYQDRAKRKGDKSLEVIWRG  220

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SK+ G+SSQIF  AFP +Y PP+GF+FEVNDD   VQD++ L+ YNV  RV +FV AA +
Sbjct  221  SKTFGSSSQIFTNAFPVHYSPPNGFHFEVNDDFVPVQDNSLLYGYNVETRVQNFVDAANA  280

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QAN+TRTNH+MWTMG DF+YQYA SWF+ +DKLIHYVN+DGRVNALYSTPS+YTDAKYA+
Sbjct  281  QANVTRTNHIMWTMGDDFQYQYADSWFKQMDKLIHYVNKDGRVNALYSTPSLYTDAKYAA  340

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            +++WPLKT+DYFPYAD +NAYWTG+F
Sbjct  341  NETWPLKTDDYFPYADSQNAYWTGFF  366



>ref|XP_009379379.1| PREDICTED: lysosomal alpha-mannosidase-like isoform X2 [Pyrus 
x bretschneideri]
Length=1014

 Score =   334 bits (857),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 181/205 (88%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            QFN TPR GWQIDPFGHSAVQAYLL AE+GFDS++F RIDYQDRAKRK +KSLEV+WR S
Sbjct  164  QFNKTPRAGWQIDPFGHSAVQAYLLTAELGFDSVHFARIDYQDRAKRKVDKSLEVIWRGS  223

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            K+ G+SSQIFA AFP +Y PP GF+FEV D+   VQD+  LFDYNV +RV+DF++A+L+Q
Sbjct  224  KTFGSSSQIFANAFPVHYSPPPGFHFEVFDNFEPVQDNPLLFDYNVEQRVSDFISASLTQ  283

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            AN+TRTNH+MWTMG DF+YQYA SWF+ +DKLIHYVN+DGRVNALYSTPSIYTD+K A++
Sbjct  284  ANVTRTNHIMWTMGDDFQYQYAESWFKQMDKLIHYVNKDGRVNALYSTPSIYTDSKNAAN  343

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            QSWPLKTEDYFPYAD  +AYWTG+F
Sbjct  344  QSWPLKTEDYFPYADAVDAYWTGFF  368



>gb|AIX48017.1| LMann protein, partial [synthetic construct]
Length=982

 Score =   333 bits (855),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 179/206 (87%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            + FN  PR GWQIDPFGHSAVQAYLLGAE+GFDS++F RIDYQDRAKRK +KSLEV+WR 
Sbjct  134  KAFNKAPRAGWQIDPFGHSAVQAYLLGAELGFDSVHFARIDYQDRAKRKEDKSLEVIWRG  193

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SK+ G++SQIF  AFP +Y PP+GF FE++D S  VQD+  LFDYNV +R+NDFVAAAL 
Sbjct  194  SKTFGSTSQIFTNAFPVHYSPPNGFGFEIDDFSIPVQDNPHLFDYNVEQRINDFVAAALV  253

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QAN+TRT+H+MWTMG DF+YQYA +WF+ +DKLIHYVN+DGRVNALYSTPS+Y DAK+A+
Sbjct  254  QANVTRTDHIMWTMGDDFQYQYAETWFKQMDKLIHYVNKDGRVNALYSTPSMYVDAKHAT  313

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++ WPLKT DYFPYADR NAYWTGYF
Sbjct  314  NEEWPLKTHDYFPYADRINAYWTGYF  339



>ref|XP_009379378.1| PREDICTED: lysosomal alpha-mannosidase-like isoform X1 [Pyrus 
x bretschneideri]
Length=1016

 Score =   334 bits (857),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 181/205 (88%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            QFN TPR GWQIDPFGHSAVQAYLL AE+GFDS++F RIDYQDRAKRK +KSLEV+WR S
Sbjct  164  QFNKTPRAGWQIDPFGHSAVQAYLLTAELGFDSVHFARIDYQDRAKRKVDKSLEVIWRGS  223

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            K+ G+SSQIFA AFP +Y PP GF+FEV D+   VQD+  LFDYNV +RV+DF++A+L+Q
Sbjct  224  KTFGSSSQIFANAFPVHYSPPPGFHFEVFDNFEPVQDNPLLFDYNVEQRVSDFISASLTQ  283

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            AN+TRTNH+MWTMG DF+YQYA SWF+ +DKLIHYVN+DGRVNALYSTPSIYTD+K A++
Sbjct  284  ANVTRTNHIMWTMGDDFQYQYAESWFKQMDKLIHYVNKDGRVNALYSTPSIYTDSKNAAN  343

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            QSWPLKTEDYFPYAD  +AYWTG+F
Sbjct  344  QSWPLKTEDYFPYADAVDAYWTGFF  368



>ref|XP_011024751.1| PREDICTED: alpha-mannosidase isoform X1 [Populus euphratica]
Length=1020

 Score =   334 bits (856),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 159/205 (78%), Positives = 180/205 (88%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +F   PR+GWQIDPFGHSAVQAYLLGAE+GFDSL+F RIDYQDRAKR  EK+LEVVW+ S
Sbjct  160  EFGQLPRVGWQIDPFGHSAVQAYLLGAELGFDSLFFARIDYQDRAKRLKEKNLEVVWQGS  219

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            KSLG++SQIF G FP +YEPP GF FE+ND SP +QDD  LFDYNV ERVN FVAAAL+Q
Sbjct  220  KSLGSTSQIFTGIFPRHYEPPDGFTFEINDVSPPIQDDVLLFDYNVQERVNAFVAAALAQ  279

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            AN+TRTNH+MW MGTDF+YQYA+SWFR +DK IHYVNQDGRVNALYSTPSIYTD K+A+D
Sbjct  280  ANVTRTNHIMWLMGTDFRYQYANSWFRQMDKFIHYVNQDGRVNALYSTPSIYTDLKHAAD  339

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            + WPLKTED+FPYAD  NAYWTGYF
Sbjct  340  EEWPLKTEDFFPYADHPNAYWTGYF  364



>ref|XP_008354624.1| PREDICTED: lysosomal alpha-mannosidase-like [Malus domestica]
Length=1016

 Score =   334 bits (856),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 180/205 (88%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            QFN TPR GWQIDPFGHSAVQAYLL AE+GFDS++F RIDYQDRAKRK +KSLEV+WR S
Sbjct  164  QFNKTPRAGWQIDPFGHSAVQAYLLTAELGFDSVHFARIDYQDRAKRKVDKSLEVIWRGS  223

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            K+  +SSQIFA AFP +Y PP GF+FEV D+   VQD+  LFDYNV +RV+DF++A+L+Q
Sbjct  224  KTFSSSSQIFANAFPVHYSPPPGFHFEVFDNFEPVQDNPLLFDYNVEQRVSDFISASLTQ  283

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            AN+TRTNH+MWTMG DF+YQYA SWF+ +DKLIHYVN+DGRVNALYSTPSIYTDAK A++
Sbjct  284  ANVTRTNHIMWTMGDDFQYQYAESWFKQMDKLIHYVNKDGRVNALYSTPSIYTDAKNAAN  343

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            QSWPLKTEDYFPYAD  +AYWTG+F
Sbjct  344  QSWPLKTEDYFPYADAVBAYWTGFF  368



>dbj|BAJ94660.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=998

 Score =   333 bits (855),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 177/206 (86%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFN TPR GWQIDPFGHSAVQAYLLG E+GFDS++F RIDYQDRAKRK +K LEV+W+ 
Sbjct  155  KQFNKTPRAGWQIDPFGHSAVQAYLLGTELGFDSVHFARIDYQDRAKRKDDKGLEVIWQG  214

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            S++ G+SSQIF  AFP +Y PP GF FEV +D   VQDD  LFD NV +RVNDFV+AA+ 
Sbjct  215  SRTFGSSSQIFTNAFPVHYSPPDGFSFEVLNDMTPVQDDPLLFDTNVEQRVNDFVSAAIV  274

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QAN+TRTNH+MWTMG DF YQYA SWFRN+D+LIHYVN+DGRV+ALYSTPSIYTDAK+AS
Sbjct  275  QANVTRTNHIMWTMGDDFNYQYAESWFRNMDRLIHYVNKDGRVHALYSTPSIYTDAKHAS  334

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWPLK +DYFPYAD  NAYWTGYF
Sbjct  335  NESWPLKQDDYFPYADSTNAYWTGYF  360



>ref|XP_002265360.1| PREDICTED: alpha-mannosidase [Vitis vinifera]
 emb|CBI17353.3| unnamed protein product [Vitis vinifera]
Length=1006

 Score =   333 bits (855),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 179/206 (87%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            + FN  PR GWQIDPFGHSAVQAYLLGAE+GFDS++F RIDYQDRAKRK +KSLEV+WR 
Sbjct  158  KAFNKAPRAGWQIDPFGHSAVQAYLLGAELGFDSVHFARIDYQDRAKRKEDKSLEVIWRG  217

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SK+ G++SQIF  AFP +Y PP+GF FE++D S  VQD+  LFDYNV +R+NDFVAAAL 
Sbjct  218  SKTFGSTSQIFTNAFPVHYSPPNGFGFEIDDFSIPVQDNPHLFDYNVEQRINDFVAAALV  277

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QAN+TRT+H+MWTMG DF+YQYA +WF+ +DKLIHYVN+DGRVNALYSTPS+Y DAK+A+
Sbjct  278  QANVTRTDHIMWTMGDDFQYQYAETWFKQMDKLIHYVNKDGRVNALYSTPSMYVDAKHAT  337

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++ WPLKT DYFPYADR NAYWTGYF
Sbjct  338  NEEWPLKTHDYFPYADRINAYWTGYF  363



>ref|XP_007156173.1| hypothetical protein PHAVU_003G264400g [Phaseolus vulgaris]
 gb|ESW28167.1| hypothetical protein PHAVU_003G264400g [Phaseolus vulgaris]
Length=1012

 Score =   333 bits (855),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 154/208 (74%), Positives = 181/208 (87%), Gaps = 3/208 (1%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +FN TP +GWQIDPFGHSAVQAYLLGAE+GFDS++F RIDYQDRAKRK +KSLEVVWRAS
Sbjct  160  EFNKTPTVGWQIDPFGHSAVQAYLLGAELGFDSVHFARIDYQDRAKRKADKSLEVVWRAS  219

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVND---DSPVVQDDTDLFDYNVPERVNDFVAAA  355
            K+ G+S+QIFA AFP +Y  P+GF FEVN+   D   VQDD  +FDYNV +RV DF+ AA
Sbjct  220  KTFGSSAQIFANAFPVHYSAPNGFNFEVNNVDIDVVPVQDDPLIFDYNVEKRVQDFIDAA  279

Query  356  LSQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKY  535
            ++QAN+TRTNH+MWTMG DF+YQYA SWF+ +DKLIHYVN+DGRVNALYSTPSIYT+AK 
Sbjct  280  ITQANVTRTNHIMWTMGDDFQYQYAESWFKQMDKLIHYVNKDGRVNALYSTPSIYTNAKN  339

Query  536  ASDQSWPLKTEDYFPYADRENAYWTGYF  619
            A+ Q+WPLKT+DYFPYADR NAYWTGYF
Sbjct  340  AAQQTWPLKTDDYFPYADRANAYWTGYF  367



>ref|XP_010920132.1| PREDICTED: alpha-mannosidase-like [Elaeis guineensis]
Length=999

 Score =   333 bits (854),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 178/206 (86%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFN  PR+GWQIDPFGHSAVQ YLLGAE+GFDS++F RIDYQDR KRK +KSLEV+WR 
Sbjct  154  KQFNKVPRVGWQIDPFGHSAVQGYLLGAELGFDSVHFARIDYQDRQKRKVDKSLEVIWRG  213

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            SK+ G+SSQIFA  FP +Y PP GF FEV+DD   VQDD  L+DYNV +RVNDF+ AA++
Sbjct  214  SKTFGSSSQIFANTFPVHYSPPEGFGFEVDDDILPVQDDELLYDYNVEQRVNDFIDAAIT  273

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QAN+TRTNH+MWTMG DF+YQYA SWFR +DKLIHYVN+DGRV+ALYSTPSIYTDAK A+
Sbjct  274  QANVTRTNHIMWTMGDDFQYQYAESWFRQMDKLIHYVNKDGRVHALYSTPSIYTDAKNAA  333

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWPLK +DYFPYAD  NAYWTGYF
Sbjct  334  NESWPLKFDDYFPYADPPNAYWTGYF  359



>gb|EMS46456.1| Lysosomal alpha-mannosidase [Triticum urartu]
Length=1033

 Score =   334 bits (856),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 178/206 (86%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFN TPR GWQIDPFGHSAVQAYLLG E+GFDS++F RIDYQDRAKRK +K LEV+W+ 
Sbjct  155  KQFNKTPRAGWQIDPFGHSAVQAYLLGTELGFDSVHFARIDYQDRAKRKDDKGLEVIWQG  214

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            S++ G+SSQIF  AFP +Y PP GF FEV +D   VQDD  LFD NV +RVNDFV+AA++
Sbjct  215  SRTFGSSSQIFTNAFPVHYSPPDGFSFEVLNDMTPVQDDPLLFDTNVEQRVNDFVSAAIA  274

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QAN+TRTNH+MWTMG DF YQYA SWFRN+D+LIHYVN+DGRV+ALYSTPSIYTDAK+AS
Sbjct  275  QANVTRTNHIMWTMGDDFNYQYAESWFRNMDRLIHYVNKDGRVHALYSTPSIYTDAKHAS  334

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWPLK +DYFPYAD  NAYWTGYF
Sbjct  335  NESWPLKRDDYFPYADSTNAYWTGYF  360



>gb|EMT01931.1| Lysosomal alpha-mannosidase [Aegilops tauschii]
Length=1072

 Score =   334 bits (857),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 178/206 (86%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFN TPR GWQIDPFGHSAVQAYLLG E+GFDS++F RIDYQDRAKRK +K LEV+W+ 
Sbjct  155  KQFNKTPRAGWQIDPFGHSAVQAYLLGTELGFDSVHFARIDYQDRAKRKDDKGLEVIWQG  214

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            S++ G+SSQIF  AFP +Y PP GF FEV +D   VQDD  LFD NV +RVNDFV+AA++
Sbjct  215  SRTFGSSSQIFTNAFPIHYSPPDGFSFEVLNDMTPVQDDPLLFDTNVEQRVNDFVSAAIA  274

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QAN+TRTNH+MWTMG DF YQYA SWFRN+D+LIHYVN+DGRV+ALYSTPSIYTDAK+AS
Sbjct  275  QANVTRTNHIMWTMGDDFNYQYAESWFRNMDRLIHYVNKDGRVHALYSTPSIYTDAKHAS  334

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWPLK +DYFPYAD  NAYWTGYF
Sbjct  335  NESWPLKQDDYFPYADSTNAYWTGYF  360



>ref|XP_008659412.1| PREDICTED: lysosomal alpha-mannosidase-like [Zea mays]
Length=1007

 Score =   333 bits (854),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 153/207 (74%), Positives = 180/207 (87%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFN TPR GWQIDPFGHSAVQAYLLGAE+GFDS++F RIDYQDRA RK +K LEV+WR 
Sbjct  157  KQFNKTPRAGWQIDPFGHSAVQAYLLGAELGFDSVHFARIDYQDRATRKADKGLEVIWRG  216

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPV-VQDDTDLFDYNVPERVNDFVAAAL  358
            S++ G+SSQIF  AFP +Y PP GF FEV D++ + VQDD  LFDYNV ERV+DFVAAAL
Sbjct  217  SRTFGSSSQIFTNAFPVHYSPPDGFGFEVLDENIIPVQDDLSLFDYNVQERVDDFVAAAL  276

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            +QAN+TRT+H+MWTMG DF YQYA SWFRN+DKLI +VN+DGRV+ALYSTPSIYTDAK+A
Sbjct  277  AQANVTRTDHIMWTMGDDFNYQYAESWFRNMDKLIQHVNKDGRVHALYSTPSIYTDAKHA  336

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            S++SWP+K +DYFPYAD  NAYWTGYF
Sbjct  337  SNESWPVKYDDYFPYADSTNAYWTGYF  363



>ref|XP_003577518.1| PREDICTED: lysosomal alpha-mannosidase-like [Brachypodium distachyon]
Length=1011

 Score =   333 bits (854),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 160/207 (77%), Positives = 184/207 (89%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            ++F   PRIGWQIDPFGHSAVQAYLLGA+VGFD+LYF RIDYQDR KRKG K LEVVWR 
Sbjct  157  EEFAQIPRIGWQIDPFGHSAVQAYLLGAQVGFDALYFSRIDYQDRGKRKGTKELEVVWRG  216

Query  182  SKSLGTSSQIFAGAFPENYEPPSG-FYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            SK+ G+S+ IF+G FP NYEPP+G FYFEV+ DSP+VQDD  LFDYNV +RVN FVAAAL
Sbjct  217  SKTFGSSADIFSGIFPNNYEPPTGEFYFEVDADSPIVQDDPLLFDYNVEDRVNAFVAAAL  276

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            +QANITRTNH+M+TMGTDFKYQYA SWFR +DKLIHYVN+DGRVNALYSTPSIYTDAK+A
Sbjct  277  AQANITRTNHIMFTMGTDFKYQYAESWFRQMDKLIHYVNKDGRVNALYSTPSIYTDAKFA  336

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            + ++WPLKT D+FPYAD+ N+YWTGYF
Sbjct  337  ASETWPLKTNDFFPYADKPNSYWTGYF  363



>gb|KCW53177.1| hypothetical protein EUGRSUZ_J02455 [Eucalyptus grandis]
Length=1010

 Score =   332 bits (852),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 177/205 (86%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            QFN  PR+GWQIDPFGHSAVQAYLLGAEVGFDSL+F RIDYQDRA RK +KSLEV+WR S
Sbjct  160  QFNKVPRVGWQIDPFGHSAVQAYLLGAEVGFDSLHFARIDYQDRANRKNDKSLEVIWRGS  219

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            K+ G+SSQIF  AFP +Y PP GF FE+++D   VQD+  L+DYNV +RVNDF++AA++Q
Sbjct  220  KTFGSSSQIFTNAFPVHYSPPDGFDFEMSNDFEPVQDNILLYDYNVEKRVNDFISAAMTQ  279

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            AN+TRTNH+MWTMG DF+YQYA SWF+ +DK +HYVN+DGRVNALYSTPSIY DAK A +
Sbjct  280  ANVTRTNHIMWTMGDDFQYQYAESWFKEMDKFVHYVNKDGRVNALYSTPSIYVDAKNAEN  339

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
             SWPLKT+DYFPYAD ++AYWTGYF
Sbjct  340  GSWPLKTDDYFPYADSKDAYWTGYF  364



>ref|XP_010033509.1| PREDICTED: lysosomal alpha-mannosidase-like [Eucalyptus grandis]
 gb|KCW53176.1| hypothetical protein EUGRSUZ_J02455 [Eucalyptus grandis]
Length=1011

 Score =   332 bits (852),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 177/205 (86%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            QFN  PR+GWQIDPFGHSAVQAYLLGAEVGFDSL+F RIDYQDRA RK +KSLEV+WR S
Sbjct  160  QFNKVPRVGWQIDPFGHSAVQAYLLGAEVGFDSLHFARIDYQDRANRKNDKSLEVIWRGS  219

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            K+ G+SSQIF  AFP +Y PP GF FE+++D   VQD+  L+DYNV +RVNDF++AA++Q
Sbjct  220  KTFGSSSQIFTNAFPVHYSPPDGFDFEMSNDFEPVQDNILLYDYNVEKRVNDFISAAMTQ  279

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            AN+TRTNH+MWTMG DF+YQYA SWF+ +DK +HYVN+DGRVNALYSTPSIY DAK A +
Sbjct  280  ANVTRTNHIMWTMGDDFQYQYAESWFKEMDKFVHYVNKDGRVNALYSTPSIYVDAKNAEN  339

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
             SWPLKT+DYFPYAD ++AYWTGYF
Sbjct  340  GSWPLKTDDYFPYADSKDAYWTGYF  364



>ref|XP_010040831.1| PREDICTED: LOW QUALITY PROTEIN: lysosomal alpha-mannosidase-like 
[Eucalyptus grandis]
Length=1011

 Score =   332 bits (852),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 176/205 (86%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            QFN  PR+GWQIDPFGHSAVQAY LGAEVGFDSL+F RIDYQDRA RK +KSLEV+WR S
Sbjct  160  QFNKVPRVGWQIDPFGHSAVQAYXLGAEVGFDSLHFARIDYQDRANRKNDKSLEVIWRGS  219

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            K+ G+SSQIF  AFP +Y PP GF FE+++D   VQD+  L+DYNV +RVNDF++AA++Q
Sbjct  220  KTFGSSSQIFTNAFPVHYSPPDGFDFEMSNDFEPVQDNILLYDYNVEKRVNDFISAAMTQ  279

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            AN+TRTNH+MWTMG DF+YQYA SWF+ +DK +HYVN+DGRVNALYSTPSIY DAK A +
Sbjct  280  ANVTRTNHIMWTMGDDFQYQYAESWFKEMDKFVHYVNKDGRVNALYSTPSIYVDAKNAEN  339

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
             SWPLKT+DYFPYAD +NAYWTGYF
Sbjct  340  GSWPLKTDDYFPYADSKNAYWTGYF  364



>ref|XP_011098969.1| PREDICTED: alpha-mannosidase [Sesamum indicum]
Length=1019

 Score =   332 bits (851),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 181/205 (88%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +F   PR+GWQIDPFGHSAVQAYLLGAE+GFDSL+F RIDYQDRAKR+ +++LEV+WR S
Sbjct  160  EFGKKPRVGWQIDPFGHSAVQAYLLGAELGFDSLFFARIDYQDRAKRRSDRTLEVIWRGS  219

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            +SL +SSQIF G FP +YEPP GF FE+ND S  +QDD  LFDYNV +RV++FVAAA++Q
Sbjct  220  RSLSSSSQIFTGIFPIHYEPPEGFTFEINDVSAPIQDDDLLFDYNVQQRVDNFVAAAVAQ  279

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            AN+TRTNH+MWTMGTDF+YQYA SWFR +DK IHYVN DGRVNALYSTPSIYTDAKYA++
Sbjct  280  ANLTRTNHIMWTMGTDFRYQYAVSWFRQMDKFIHYVNLDGRVNALYSTPSIYTDAKYAAN  339

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
            + WPLKT D+FPYADRENAYWTGYF
Sbjct  340  EKWPLKTGDFFPYADRENAYWTGYF  364



>ref|XP_004232502.1| PREDICTED: lysosomal alpha-mannosidase [Solanum lycopersicum]
Length=1009

 Score =   332 bits (850),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/207 (73%), Positives = 180/207 (87%), Gaps = 2/207 (1%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +FN+TPR GWQIDPFGHSAVQAYLLGAEVGFDS++F RIDYQDRAKRK +K+LEV+WR S
Sbjct  163  EFNITPRAGWQIDPFGHSAVQAYLLGAEVGFDSVHFARIDYQDRAKRKEDKALEVIWRGS  222

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVND--DSPVVQDDTDLFDYNVPERVNDFVAAAL  358
            ++ G+SSQIF  AFP +Y PP GF+FEV+D  D   VQDD  +FD NV  RVNDF+ AA+
Sbjct  223  RTFGSSSQIFTNAFPVHYSPPHGFHFEVDDADDFVPVQDDPLIFDINVDIRVNDFINAAI  282

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            +QAN+TRTNHVMWTMG DF+YQYA SWF+ +DKLIHYVN+DGRVNALYSTPSIY D K+A
Sbjct  283  TQANVTRTNHVMWTMGDDFQYQYAESWFKEMDKLIHYVNKDGRVNALYSTPSIYVDTKHA  342

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            +++SWPLKT+DYFPYAD EN+YWTG+F
Sbjct  343  TNESWPLKTDDYFPYADGENSYWTGFF  369



>ref|XP_010034699.1| PREDICTED: lysosomal alpha-mannosidase-like [Eucalyptus grandis]
Length=1011

 Score =   332 bits (850),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 176/205 (86%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +FN  PR+GWQIDPFGHSAVQAYLLGAEVGF+SL+F RIDYQDRAKRK +KSLEV+WR S
Sbjct  160  EFNKVPRVGWQIDPFGHSAVQAYLLGAEVGFNSLHFARIDYQDRAKRKDDKSLEVIWRGS  219

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALSQ  364
            K+ G+SSQIF   FP++Y PP GF FEV DD   +QD+T L+DYNV  RVNDF++AA++Q
Sbjct  220  KTFGSSSQIFTNVFPDHYGPPEGFSFEVFDDFEPLQDNTLLYDYNVEIRVNDFISAAMTQ  279

Query  365  ANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYASD  544
            AN+TRTNH+MWTMG DF YQYA SWF+ +DK IHYVN+DGRVNALYSTPSIY DAK A +
Sbjct  280  ANVTRTNHIMWTMGEDFTYQYAESWFKQMDKFIHYVNKDGRVNALYSTPSIYVDAKNAEN  339

Query  545  QSWPLKTEDYFPYADRENAYWTGYF  619
             SWPLKT+DY PYADRE+AYWTG+F
Sbjct  340  VSWPLKTDDYLPYADREDAYWTGFF  364



>ref|XP_002464752.1| hypothetical protein SORBIDRAFT_01g026390 [Sorghum bicolor]
 gb|EER91750.1| hypothetical protein SORBIDRAFT_01g026390 [Sorghum bicolor]
Length=1007

 Score =   332 bits (850),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/207 (73%), Positives = 178/207 (86%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QFN TPR GWQIDPFGHSAVQAYLLG E+GFDS++F RIDYQDR  RK +K LEV+WR 
Sbjct  158  KQFNKTPRAGWQIDPFGHSAVQAYLLGVELGFDSVHFARIDYQDRKTRKADKGLEVIWRG  217

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPV-VQDDTDLFDYNVPERVNDFVAAAL  358
            S++ G+SSQIF  AFP +Y PP GF FEV D++ + VQDD  LFDYNV ERVNDFVAAAL
Sbjct  218  SRTFGSSSQIFTNAFPVHYSPPDGFGFEVLDENIIPVQDDLSLFDYNVQERVNDFVAAAL  277

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            +QAN+TRT+H+MWTMG DF YQYA SWFRN+DKLI +VN+DGRV+ALYSTPSIYTDAK+A
Sbjct  278  AQANVTRTDHIMWTMGDDFNYQYAESWFRNMDKLIQHVNKDGRVHALYSTPSIYTDAKHA  337

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            S++SWP+K +DYFPYAD  NAYWTGYF
Sbjct  338  SNESWPVKYDDYFPYADSTNAYWTGYF  364



>emb|CDP16739.1| unnamed protein product [Coffea canephora]
Length=931

 Score =   330 bits (846),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 180/206 (87%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
             +FN  PR+GWQIDPFGHSAVQAYLLGAE+GFDSL+F RIDYQDRAKRK +KSLEVVW+ 
Sbjct  176  HEFNQKPRVGWQIDPFGHSAVQAYLLGAELGFDSLFFARIDYQDRAKRKTDKSLEVVWQG  235

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            S+SLG+SSQIF G FP +Y PP GF FEVND S  +QDD  LFDYNV ERV+DFV AAL+
Sbjct  236  SQSLGSSSQIFTGIFPVHYSPPDGFTFEVNDVSAPIQDDLTLFDYNVKERVDDFVIAALA  295

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QAN+TRTNH+MWTMG DF+YQYA SWFR +DK IHYVN DGRVNALYSTPSIYT+AK+A+
Sbjct  296  QANVTRTNHIMWTMGEDFRYQYALSWFRQMDKFIHYVNMDGRVNALYSTPSIYTEAKHAA  355

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++ WPLKT D+FPYADRENAYWTGYF
Sbjct  356  NEKWPLKTGDFFPYADRENAYWTGYF  381



>ref|XP_006340752.1| PREDICTED: lysosomal alpha-mannosidase-like [Solanum tuberosum]
Length=1008

 Score =   330 bits (847),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 180/206 (87%), Gaps = 1/206 (0%)
 Frame = +2

Query  5    QFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRAS  184
            +FN+TPR GWQIDPFGHSAVQAYLLGAEVGFDS++F RIDYQDRAKRK +K+LEV+WR S
Sbjct  163  EFNITPRAGWQIDPFGHSAVQAYLLGAEVGFDSVHFARIDYQDRAKRKEDKALEVIWRGS  222

Query  185  KSLGTSSQIFAGAFPENYEPPSGFYFEVND-DSPVVQDDTDLFDYNVPERVNDFVAAALS  361
            ++ G+SSQIF  AFP +Y PP GF+FEV+D D   VQDD  +FD NV  RVNDF+ AA++
Sbjct  223  RTFGSSSQIFTNAFPVHYSPPHGFHFEVDDADFVPVQDDPLIFDLNVDIRVNDFINAAIT  282

Query  362  QANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYAS  541
            QAN+TRTNH+MWTMG DF+YQYA SWF+ +DKLIHYVN+DGRVNALYSTPSIY DAK+A+
Sbjct  283  QANVTRTNHIMWTMGDDFQYQYAESWFKEMDKLIHYVNKDGRVNALYSTPSIYVDAKHAT  342

Query  542  DQSWPLKTEDYFPYADRENAYWTGYF  619
            ++SWPLKT+DYFPYAD  N+YWTG+F
Sbjct  343  NESWPLKTDDYFPYADGGNSYWTGFF  368



>gb|ABY83271.1| alpha-mannosidase [Solanum lycopersicum]
Length=1029

 Score =   330 bits (847),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 160/209 (77%), Positives = 179/209 (86%), Gaps = 4/209 (2%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYF--GRIDYQDRAKRKGEKSLEVVW  175
            QQFNVTPRIGWQIDPFG         G++ G+  L F    +  +DR KRK EKSLEV+W
Sbjct  158  QQFNVTPRIGWQIDPFGTFCCSGIPSGSK-GWIRLSFLWDALTTKDREKRKIEKSLEVIW  216

Query  176  RASKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPV-VQDDTDLFDYNVPERVNDFVAA  352
            R SKSL +S+QIF+GAFP+NYEPPS FYFEVNDD+ + VQDD +LFDYNV ERVNDFVAA
Sbjct  217  RGSKSLSSSTQIFSGAFPQNYEPPSKFYFEVNDDNSLPVQDDVNLFDYNVQERVNDFVAA  276

Query  353  ALSQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAK  532
            ALSQANITRTNH+MWTMGTDFKYQYAH+WFRN+DKLIHYVNQDGRVNALYS+PSIYTDAK
Sbjct  277  ALSQANITRTNHIMWTMGTDFKYQYAHTWFRNMDKLIHYVNQDGRVNALYSSPSIYTDAK  336

Query  533  YASDQSWPLKTEDYFPYADRENAYWTGYF  619
            YA D+SWPLKT+DYFPYADR NAYWTGYF
Sbjct  337  YALDESWPLKTDDYFPYADRINAYWTGYF  365



>tpg|DAA46691.1| TPA: hypothetical protein ZEAMMB73_463862, partial [Zea mays]
Length=682

 Score =   323 bits (827),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 149/207 (72%), Positives = 174/207 (84%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QF   PR GWQIDPFGHSAVQAYLLGAE+GFDS++F RIDYQDRA RK  K LEV+WR 
Sbjct  168  KQFKKIPRAGWQIDPFGHSAVQAYLLGAELGFDSVHFARIDYQDRATRKANKGLEVIWRG  227

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPV-VQDDTDLFDYNVPERVNDFVAAAL  358
            S+ +G+SSQIF   FP +Y  P GF FEV  ++ + VQDD  LFDYNV ERV+DFVAAA+
Sbjct  228  SRPVGSSSQIFTNVFPVHYSAPVGFSFEVLAENVIPVQDDMSLFDYNVQERVDDFVAAAI  287

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            +QAN+TRTNH+MWTMG DF YQYA SWFRN+DKLI YVN+DGRV+ALYSTPSIYTDAK+A
Sbjct  288  AQANVTRTNHIMWTMGDDFNYQYAESWFRNMDKLIQYVNKDGRVHALYSTPSIYTDAKHA  347

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            S++SWP+K +DYFPYAD  NAYWTGYF
Sbjct  348  SNESWPVKYDDYFPYADSTNAYWTGYF  374



>ref|XP_002464754.1| hypothetical protein SORBIDRAFT_01g026405 [Sorghum bicolor]
 gb|EER91752.1| hypothetical protein SORBIDRAFT_01g026405 [Sorghum bicolor]
Length=874

 Score =   326 bits (835),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 149/207 (72%), Positives = 174/207 (84%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLYFGRIDYQDRAKRKGEKSLEVVWRA  181
            +QF   PR GWQIDPFGHSAVQAYLLGAE+GFDS++F RIDYQDRA RK  K LEV+WR 
Sbjct  25   KQFKKIPRAGWQIDPFGHSAVQAYLLGAELGFDSVHFARIDYQDRATRKANKGLEVIWRG  84

Query  182  SKSLGTSSQIFAGAFPENYEPPSGFYFEVNDDSPV-VQDDTDLFDYNVPERVNDFVAAAL  358
            S++ G+SSQIF   FP++Y  P GF FEV  ++ + VQDD  LFDYNV ERVNDFVA A+
Sbjct  85   SRTFGSSSQIFTNVFPDHYNAPDGFSFEVLAENVIPVQDDMSLFDYNVQERVNDFVATAI  144

Query  359  SQANITRTNHVMWTMGTDFKYQYAHSWFRNLDKLIHYVNQDGRVNALYSTPSIYTDAKYA  538
            +QAN+TRTNH+MWTMG DF YQYA SWFRN+DKLI YVN+DGRV+ALYSTPSIYTDAK+A
Sbjct  145  AQANVTRTNHIMWTMGDDFNYQYAESWFRNMDKLIQYVNKDGRVHALYSTPSIYTDAKHA  204

Query  539  SDQSWPLKTEDYFPYADRENAYWTGYF  619
            S++SWP+K +DYFPYAD  NAYWTGYF
Sbjct  205  SNESWPVKYDDYFPYADSTNAYWTGYF  231



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520