BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS091D06

Length=620
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004304330.1|  PREDICTED: caffeic acid 3-O-methyltransferase      306   3e-100   Fragaria vesca subsp. vesca
ref|XP_007027514.1|  O-methyltransferase family protein                 300   7e-98    
ref|XP_008442758.1|  PREDICTED: caffeic acid 3-O-methyltransferase      300   1e-97    Cucumis melo [Oriental melon]
gb|KDP29212.1|  hypothetical protein JCGZ_16601                         299   3e-97    Jatropha curcas
ref|XP_008361606.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    293   2e-96    
gb|KJB62321.1|  hypothetical protein B456_009G411600                    292   3e-96    Gossypium raimondii
gb|KJB62322.1|  hypothetical protein B456_009G411600                    292   4e-96    Gossypium raimondii
gb|KJB62324.1|  hypothetical protein B456_009G411600                    293   4e-96    Gossypium raimondii
ref|XP_009341082.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    295   9e-96    Pyrus x bretschneideri [bai li]
gb|KGN59032.1|  hypothetical protein Csa_3G747630                       295   1e-95    Cucumis sativus [cucumbers]
ref|XP_004137858.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    295   3e-95    
ref|XP_007202084.1|  hypothetical protein PRUPE_ppa007420mg             294   4e-95    Prunus persica
ref|XP_011101458.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    293   5e-95    Sesamum indicum [beniseed]
gb|KJB62323.1|  hypothetical protein B456_009G411600                    292   6e-95    Gossypium raimondii
gb|KJB62320.1|  hypothetical protein B456_009G411600                    292   1e-94    Gossypium raimondii
gb|KHG05883.1|  Caffeic acid 3-O-methyltransferase                      292   2e-94    Gossypium arboreum [tree cotton]
ref|XP_008361604.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    288   4e-94    
ref|XP_009341081.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    290   1e-93    Pyrus x bretschneideri [bai li]
ref|XP_006428524.1|  hypothetical protein CICLE_v10013655mg             285   3e-93    
ref|XP_008241354.1|  PREDICTED: caffeic acid 3-O-methyltransferase      288   4e-93    Prunus mume [ume]
ref|XP_004488687.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    285   5e-92    Cicer arietinum [garbanzo]
emb|CAN65776.1|  hypothetical protein VITISV_030414                     285   6e-92    Vitis vinifera
ref|XP_002264566.1|  PREDICTED: caffeic acid 3-O-methyltransferase      285   7e-92    Vitis vinifera
ref|XP_006367254.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    285   7e-92    Solanum tuberosum [potatoes]
ref|XP_006381360.1|  hypothetical protein POPTR_0006s12160g             280   4e-91    
ref|XP_010050337.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    282   8e-91    Eucalyptus grandis [rose gum]
ref|XP_006367255.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    281   1e-90    Solanum tuberosum [potatoes]
ref|XP_011018830.1|  PREDICTED: caffeic acid 3-O-methyltransferase      281   2e-90    Populus euphratica
gb|AFK33955.1|  unknown                                                 275   6e-90    Medicago truncatula
ref|XP_006381361.1|  hypothetical protein POPTR_0006s12160g             279   1e-89    
ref|XP_010267318.1|  PREDICTED: caffeic acid 3-O-methyltransferase      279   1e-89    Nelumbo nucifera [Indian lotus]
ref|XP_006594705.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    276   3e-89    Glycine max [soybeans]
gb|KEH38506.1|  caffeic acid O-methyltransferase                        278   4e-89    Medicago truncatula
ref|XP_002519426.1|  o-methyltransferase, putative                      277   8e-89    Ricinus communis
ref|XP_006594704.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    276   1e-88    
ref|XP_010312333.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1    275   4e-88    Solanum lycopersicum
ref|XP_011098295.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    273   3e-87    Sesamum indicum [beniseed]
ref|XP_007149437.1|  hypothetical protein PHAVU_005G070300g             273   4e-87    Phaseolus vulgaris [French bean]
ref|XP_006291371.1|  hypothetical protein CARUB_v10017511mg             272   7e-87    Capsella rubella
ref|XP_010426946.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    271   2e-86    Camelina sativa [gold-of-pleasure]
ref|XP_006598126.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    271   3e-86    Glycine max [soybeans]
ref|XP_010504072.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    271   6e-86    Camelina sativa [gold-of-pleasure]
ref|XP_006403721.1|  hypothetical protein EUTSA_v10010488mg             269   1e-85    Eutrema salsugineum [saltwater cress]
ref|XP_006391885.1|  hypothetical protein EUTSA_v10023542mg             269   2e-85    Eutrema salsugineum [saltwater cress]
ref|XP_010098845.1|  Caffeic acid 3-O-methyltransferase                 268   3e-85    Morus notabilis
ref|XP_009617330.1|  PREDICTED: flavone 3'-O-methyltransferase 1        268   4e-85    Nicotiana tomentosiformis
ref|NP_190882.1|  putative O-diphenol-O-methyl transferase              266   2e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010515802.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    265   3e-84    Camelina sativa [gold-of-pleasure]
ref|XP_009774776.1|  PREDICTED: caffeic acid 3-O-methyltransferase      261   4e-84    Nicotiana sylvestris
emb|CDX76223.1|  BnaA04g04870D                                          260   3e-83    
ref|XP_010546519.1|  PREDICTED: flavone 3'-O-methyltransferase 1        261   1e-82    Tarenaya hassleriana [spider flower]
ref|XP_009139429.1|  PREDICTED: caffeic acid 3-O-methyltransferase      259   7e-82    Brassica rapa
emb|CDX95399.1|  BnaC04g27590D                                          258   2e-81    
gb|KFK34550.1|  hypothetical protein AALP_AA5G160800                    258   3e-81    Arabis alpina [alpine rockcress]
ref|XP_011101457.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    256   2e-80    
gb|KHN47498.1|  Caffeic acid 3-O-methyltransferase                      238   1e-73    Glycine soja [wild soybean]
ref|XP_010271244.1|  PREDICTED: uncharacterized protein LOC104607...    231   1e-72    Nelumbo nucifera [Indian lotus]
gb|AAP03058.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    235   3e-72    Limonium latifolium
ref|XP_010271241.1|  PREDICTED: uncharacterized protein LOC104607...    230   5e-72    Nelumbo nucifera [Indian lotus]
ref|XP_004502926.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    233   1e-71    Cicer arietinum [garbanzo]
gb|KDO38249.1|  hypothetical protein CISIN_1g043063mg                   225   3e-69    Citrus sinensis [apfelsine]
ref|XP_006423903.1|  hypothetical protein CICLE_v10029876mg             223   1e-68    
ref|XP_003602597.1|  Caffeic acid 3-O-methyltransferase                 224   2e-68    
gb|KDO41959.1|  hypothetical protein CISIN_1g021707mg                   223   3e-68    Citrus sinensis [apfelsine]
gb|AFK47565.1|  unknown                                                 217   5e-67    Medicago truncatula
emb|CAB65279.1|  O-diphenol-O-methyl transferase                        220   1e-66    Medicago sativa subsp. x varia
ref|XP_003602596.1|  Caffeic acid 3-O-methyltransferase                 216   3e-66    
ref|XP_006436414.1|  hypothetical protein CICLE_v10033543mg             218   3e-66    Citrus clementina [clementine]
ref|XP_006485837.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    218   3e-66    Citrus sinensis [apfelsine]
ref|XP_006451708.1|  hypothetical protein CICLE_v10010561mg             216   2e-65    
ref|XP_003602595.1|  Caffeic acid 3-O-methyltransferase                 216   3e-65    Medicago truncatula
ref|XP_006485822.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    213   5e-65    
gb|AAP03053.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    209   3e-64    Limonium latifolium
gb|AGW45465.1|  beta-alanine n-methyltransferase                        203   5e-62    Reaumuria trigyna
ref|XP_009382782.1|  PREDICTED: caffeic acid 3-O-methyltransferase      207   2e-61    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010683979.1|  PREDICTED: caffeic acid 3-O-methyltransferase      204   5e-60    Beta vulgaris subsp. vulgaris [field beet]
gb|AAP03054.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    195   6e-59    Limonium latifolium
dbj|BAJ96291.1|  predicted protein                                      195   6e-57    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004954455.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    193   2e-56    Setaria italica
ref|XP_010935842.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    192   7e-56    
ref|XP_010935841.1|  PREDICTED: quercetin 3-O-methyltransferase 1...    191   6e-55    Elaeis guineensis
ref|XP_008387516.1|  PREDICTED: caffeic acid 3-O-methyltransferase      187   8e-55    
ref|XP_002453074.1|  hypothetical protein SORBIDRAFT_04g037820          189   2e-54    Sorghum bicolor [broomcorn]
gb|KCW89310.1|  hypothetical protein EUGRSUZ_A01600                     185   6e-54    Eucalyptus grandis [rose gum]
ref|NP_001149617.1|  LOC100283243                                       186   2e-53    
gb|ACN25427.1|  unknown                                                 186   2e-53    Zea mays [maize]
gb|KDO38695.1|  hypothetical protein CISIN_1g037818mg                   178   2e-52    Citrus sinensis [apfelsine]
gb|EEC74273.1|  hypothetical protein OsI_09508                          182   4e-52    Oryza sativa Indica Group [Indian rice]
ref|NP_001048569.1|  Os02g0823400                                       182   1e-51    
ref|XP_006425490.1|  hypothetical protein CICLE_v10027189mg             174   1e-49    
gb|AES72848.2|  caffeic acid O-methyltransferase                        174   4e-49    Medicago truncatula
ref|XP_003572969.1|  PREDICTED: caffeic acid 3-O-methyltransferase      174   8e-49    Brachypodium distachyon [annual false brome]
ref|XP_010275846.1|  PREDICTED: uncharacterized protein LOC104610771    167   4e-47    
gb|KCW89309.1|  hypothetical protein EUGRSUZ_A01600                     169   5e-47    Eucalyptus grandis [rose gum]
gb|KDO39806.1|  hypothetical protein CISIN_1g025363mg                   157   1e-43    Citrus sinensis [apfelsine]
ref|XP_006838729.1|  hypothetical protein AMTR_s00002p00253410          147   1e-38    Amborella trichopoda
ref|XP_011101495.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    126   4e-33    
ref|XP_002963872.1|  caffeic acid O-methyltransferase                   127   2e-31    Selaginella moellendorffii
ref|XP_002988275.1|  caffeic acid O-methyltransferase                   127   3e-31    Selaginella moellendorffii
gb|KDO54338.1|  hypothetical protein CISIN_1g032721mg                   120   1e-30    Citrus sinensis [apfelsine]
ref|XP_006649184.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    122   1e-29    
ref|XP_002986612.1|  hypothetical protein SELMODRAFT_124122             120   1e-29    
ref|XP_002986521.1|  hypothetical protein SELMODRAFT_124205             120   1e-29    
ref|XP_006432602.1|  hypothetical protein CICLE_v10002505mg             120   1e-29    
ref|XP_002965284.1|  hypothetical protein SELMODRAFT_83100              120   2e-29    
ref|XP_006280681.1|  hypothetical protein CARUB_v10026645mg             120   1e-28    Capsella rubella
gb|ADE88153.1|  caffeyl alcohol/5-hydroxyconiferyl alcohol 3/5-O-...    120   2e-28    Selaginella moellendorffii
gb|AFM73596.1|  caffeate O-methyltransferase                            118   2e-28    Populus simonii
ref|XP_006451875.1|  hypothetical protein CICLE_v10010158mg             117   2e-28    Citrus clementina [clementine]
ref|XP_010027213.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    113   5e-28    Eucalyptus grandis [rose gum]
ref|NP_200227.1|  caffeic acid/5-hydroxyferulic acid O-methyltran...    118   8e-28    Arabidopsis thaliana [mouse-ear cress]
gb|AAB96879.1|  O-methyltransferase 1                                   118   8e-28    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002864309.1|  O-methyltransferase 1                              117   1e-27    
gb|AAF60951.1|  O-methyltransferase                                     117   1e-27    Populus trichocarpa x Populus deltoides
gb|ABU53653.1|  caffeic acid O-3-methyltransferase                      117   1e-27    Populus deltoides
prf||1906376A  O-methyltransferase                                      117   1e-27 
gb|AFK40372.1|  unknown                                                 116   4e-27    Lotus japonicus
ref|XP_002317838.1|  Chain A family protein                             115   5e-27    Populus trichocarpa [western balsam poplar]
ref|XP_011043758.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1    115   5e-27    Populus euphratica
sp|Q00763.1|COMT1_POPTM  RecName: Full=Caffeic acid 3-O-methyltra...    115   5e-27    Populus tremuloides
gb|AFZ78575.1|  caffeic acid O-methyltransferase                        115   5e-27    Populus tomentosa [Chinese white poplar]
ref|XP_010241050.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1    115   6e-27    Nelumbo nucifera [Indian lotus]
ref|XP_003621323.1|  Isoliquiritigenin 2'-O-methyltransferase           114   1e-26    Medicago truncatula
dbj|BAJ34520.1|  unnamed protein product                                114   2e-26    Eutrema halophilum
gb|KDO39208.1|  hypothetical protein CISIN_1g041308mg                   112   2e-26    Citrus sinensis [apfelsine]
ref|XP_006401613.1|  hypothetical protein EUTSA_v10013897mg             114   2e-26    Eutrema salsugineum [saltwater cress]
gb|KHF97637.1|  Caffeic acid 3-O-methyltransferase                      113   2e-26    Gossypium arboreum [tree cotton]
gb|AAF63200.1|  caffeic acid O-3-methyltransferase                      114   2e-26    Populus tomentosa [Chinese white poplar]
ref|XP_007136428.1|  hypothetical protein PHAVU_009G044400g             114   2e-26    Phaseolus vulgaris [French bean]
sp|Q43046.1|COMT1_POPKI  RecName: Full=Caffeic acid 3-O-methyltra...    114   2e-26    Populus sieboldii x Populus grandidentata
gb|AIJ28474.1|  O-methyltransferase                                     113   3e-26    Vaccinium corymbosum [American blueberry]
ref|XP_001762717.1|  predicted protein                                  113   4e-26    
gb|KDP30064.1|  hypothetical protein JCGZ_18389                         112   7e-26    Jatropha curcas
gb|ACT32028.1|  caffeic acid O-methyltransferase 1                      112   8e-26    Gossypium hirsutum [American cotton]
ref|XP_009352092.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    111   8e-26    Pyrus x bretschneideri [bai li]
gb|ACT87981.1|  caffeic acid O-methyltransferase                        112   8e-26    Jatropha curcas
ref|XP_010243879.1|  PREDICTED: uncharacterized protein LOC104587837    107   8e-26    Nelumbo nucifera [Indian lotus]
gb|AER35881.1|  S-adenosyl-L-methionine:flavonoid O-methyltransfe...    112   8e-26    Ginkgo biloba [ginkgo]
gb|KHG13754.1|  Caffeic acid 3-O-methyltransferase                      112   9e-26    Gossypium arboreum [tree cotton]
gb|KJB16304.1|  hypothetical protein B456_002G222400                    112   9e-26    Gossypium raimondii
ref|XP_002864307.1|  O-methyltransferase 1                              112   1e-25    Arabidopsis lyrata subsp. lyrata
gb|ACN41351.2|  putative caffeic acid O-methyltransferase               112   1e-25    Betula pendula [white birch]
gb|KFK27028.1|  hypothetical protein AALP_AA8G324800                    112   1e-25    Arabis alpina [alpine rockcress]
ref|XP_010671332.1|  PREDICTED: caffeic acid 3-O-methyltransferase      112   1e-25    Beta vulgaris subsp. vulgaris [field beet]
gb|KHF97352.1|  Caffeic acid 3-O-methyltransferase                      111   1e-25    Gossypium arboreum [tree cotton]
gb|ACY06328.1|  S-adenosyl-L-methionine: caffeic acid 3-0-methylt...    112   1e-25    Medicago sativa [alfalfa]
gb|AFK39562.1|  unknown                                                 111   1e-25    Lotus japonicus
gb|AGG91492.1|  caffeic acid 3-O-methyltransferase                      111   2e-25    Betula platyphylla [Asian white birch]
ref|XP_003634161.1|  PREDICTED: caffeic acid 3-O-methyltransferase      111   2e-25    Vitis vinifera
gb|ABR18380.1|  unknown                                                 111   2e-25    Picea sitchensis
ref|XP_002525818.1|  o-methyltransferase, putative                      111   2e-25    Ricinus communis
gb|ABO41840.1|  putative caffeic acid methyltransferase                 111   2e-25    Gossypium arboreum [tree cotton]
sp|Q8W013.1|COMT1_CATRO  RecName: Full=Caffeic acid 3-O-methyltra...    111   3e-25    Catharanthus roseus [chatas]
dbj|BAC78827.1|  caffeic acid O-methyltransferase                       111   3e-25    Rosa chinensis var. spontanea
gb|AEV93478.1|  caffeic acid O-methyltransferase                        110   3e-25    Caragana korshinskii
sp|Q8GU25.1|COMT1_ROSCH  RecName: Full=Caffeic acid 3-O-methyltra...    110   3e-25    Rosa chinensis [China rose]
sp|P28002.1|COMT1_MEDSA  RecName: Full=Caffeic acid 3-O-methyltra...    110   3e-25    Medicago sativa [alfalfa]
gb|ABO41845.1|  putative caffeic acid methyltransferase                 110   3e-25    Gossypium hirsutum [American cotton]
gb|AFK45226.1|  unknown                                                 110   3e-25    Lotus japonicus
gb|ABO41834.1|  putative caffeic acid methyltransferase                 110   4e-25    Gossypium raimondii
gb|AFK39235.1|  unknown                                                 110   4e-25    Medicago truncatula
ref|XP_003602396.1|  Caffeic acid O-methyltransferase                   110   4e-25    Medicago truncatula
emb|CDY70033.1|  BnaCnng66420D                                          108   5e-25    Brassica napus [oilseed rape]
gb|ABI54119.1|  caffeic acid O-methyltransferase                        110   5e-25    Malus domestica [apple tree]
dbj|BAA13683.1|  O-methyltransferase                                    110   6e-25    Glycyrrhiza echinata [hedgehog licorice]
dbj|BAO79380.1|  5-hydroxyconiferylaldehyde O-methyltransferase         110   6e-25    Anthriscus sylvestris
gb|ABK21417.1|  unknown                                                 109   7e-25    Picea sitchensis
emb|CDY43839.1|  BnaC03g14720D                                          109   7e-25    Brassica napus [oilseed rape]
ref|XP_010482824.1|  PREDICTED: flavone 3'-O-methyltransferase 1        109   9e-25    Camelina sativa [gold-of-pleasure]
gb|ACD56610.1|  putative caffeic acid protein                           109   9e-25    Gossypioides kirkii
ref|XP_007032646.1|  Caffeic acid 3-O-methyltransferase 1               109   9e-25    
ref|XP_009132451.1|  PREDICTED: flavone 3'-O-methyltransferase 1        109   1e-24    Brassica rapa
gb|ACT32029.1|  caffeic acid O-methyltransferase 2                      109   1e-24    Gossypium hirsutum [American cotton]
gb|AAC18863.1|  caffeic acid 3-O-methyltransferase                      108   1e-24    Mesembryanthemum crystallinum
gb|AHM25237.1|  noraucuparin O-methyltransferase                        109   1e-24    Sorbus aucuparia [European mountain ash]
ref|XP_010446534.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    108   1e-24    Camelina sativa [gold-of-pleasure]
gb|AAF28353.1|AF220491_1  O-methyltransferase                           108   1e-24    Fragaria x ananassa
gb|ABO41846.1|  putative caffeic acid methyltransferase                 108   2e-24    Gossypium hirsutum [American cotton]
ref|XP_010442991.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    108   2e-24    Camelina sativa [gold-of-pleasure]
ref|XP_003526767.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    108   2e-24    Glycine max [soybeans]
ref|XP_008376825.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    108   2e-24    
gb|ABI54117.1|  caffeic acid O-methyltransferase                        108   2e-24    Malus domestica [apple tree]
ref|NP_001240003.1|  uncharacterized protein LOC100780100               108   2e-24    Glycine max [soybeans]
gb|AAD29845.1|AF064697_1  O-methyltransferase                           108   2e-24    Thalictrum tuberosum
emb|CAI30878.1|  caffeate O-methyltransferase                           108   2e-24    Picea abies
gb|KJB52493.1|  hypothetical protein B456_008G264900                    107   3e-24    Gossypium raimondii
ref|XP_008381500.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    108   3e-24    
sp|P59049.1|OMT1_CHRAE  RecName: Full=Quercetin 3-O-methyltransfe...    108   3e-24    Chrysosplenium americanum [water-carpet]
gb|KDP35860.1|  hypothetical protein JCGZ_10599                         108   3e-24    Jatropha curcas
gb|ABK22490.1|  unknown                                                 108   3e-24    Picea sitchensis
dbj|BAD83867.1|  Caffeic acid O-methyltransferase                       108   3e-24    Iris x hollandica [Dutch iris]
ref|XP_008376828.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    108   3e-24    Malus domestica [apple tree]
ref|XP_004502769.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    108   3e-24    Cicer arietinum [garbanzo]
ref|XP_006478241.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    108   3e-24    
gb|KJB23956.1|  hypothetical protein B456_004G125600                    106   3e-24    Gossypium raimondii
ref|NP_001289246.1|  caffeic acid 3-O-methyltransferase                 107   3e-24    Pyrus x bretschneideri [bai li]
ref|XP_008234634.1|  PREDICTED: caffeic acid 3-O-methyltransferase      107   3e-24    Prunus mume [ume]
dbj|BAE94403.1|  Caffeic acid 3-O-methyltransferase                     107   4e-24    Ipomoea nil [qian niu]
sp|Q42653.1|OMT2_CHRAE  RecName: Full=Quercetin 3-O-methyltransfe...    107   4e-24    Chrysosplenium americanum [water-carpet]
dbj|BAE94400.1|  Caffeic acid 3-O-methyltransferase                     107   4e-24    Ipomoea nil [qian niu]
gb|KHG13289.1|  Caffeic acid 3-O-methyltransferase                      107   4e-24    Gossypium arboreum [tree cotton]
ref|XP_009418616.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    107   4e-24    Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB23955.1|  hypothetical protein B456_004G125600                    106   5e-24    Gossypium raimondii
gb|ABO41852.1|  putative caffeic acid methyltransferase                 107   5e-24    Gossypium hirsutum [American cotton]
gb|AGJ84131.1|  putative caffeic acid O-methyltransferase               107   6e-24    Hibiscus cannabinus [bimli-jute]
sp|P46484.1|COMT1_EUCGU  RecName: Full=Caffeic acid 3-O-methyltra...    107   6e-24    Eucalyptus gunnii
gb|AGR85824.1|  caffeic acid O-methyltransferase                        106   6e-24    Hibiscus cannabinus [bimli-jute]
ref|XP_004307899.1|  PREDICTED: caffeic acid 3-O-methyltransferase      107   6e-24    Fragaria vesca subsp. vesca
ref|NP_001242325.1|  uncharacterized protein LOC100805999               107   6e-24    
gb|KHN23296.1|  Caffeic acid 3-O-methyltransferase                      107   7e-24    Glycine soja [wild soybean]
gb|KJB23957.1|  hypothetical protein B456_004G125600                    106   7e-24    Gossypium raimondii
gb|AAD29841.1|AF064693_1  catechol O-methyltransferase                  107   7e-24    Thalictrum tuberosum
sp|Q43609.1|COMT1_PRUDU  RecName: Full=Caffeic acid 3-O-methyltra...    107   7e-24    Prunus dulcis [sweet almond]
gb|ABK25932.1|  unknown                                                 107   7e-24    Picea sitchensis
dbj|BAD18975.1|  phloroglucinol O-methyltransferase                     107   7e-24    Rosa chinensis var. spontanea
gb|AAD29844.1|AF064696_1  catechol O-methyltransferase                  107   8e-24    Thalictrum tuberosum
gb|ADB82906.1|  caffeic O-methyltransferase1                            106   9e-24    Eucalyptus camaldulensis
gb|KJB52492.1|  hypothetical protein B456_008G264900                    107   9e-24    Gossypium raimondii
sp|Q6T1F5.1|COMT1_AMMMJ  RecName: Full=Caffeic acid 3-O-methyltra...    106   9e-24    Ammi majus [ameo mayor]
ref|XP_009119951.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    106   9e-24    Brassica rapa
gb|ACY66932.1|  caffeic O-methyltransferase 1                           106   1e-23    Eucalyptus camaldulensis
ref|XP_007039215.1|  Caffeic acid 3-O-methyltransferase 1               106   1e-23    
ref|XP_009119948.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    106   1e-23    Brassica rapa
ref|XP_010048429.1|  PREDICTED: caffeic acid 3-O-methyltransferase      106   1e-23    Eucalyptus grandis [rose gum]
gb|KHN23295.1|  Caffeic acid 3-O-methyltransferase                      106   1e-23    Glycine soja [wild soybean]
emb|CCC55423.1|  caffeic acid O-3-methyltransferase                     106   1e-23    Pinus pinaster [cluster pine]
ref|XP_007218167.1|  hypothetical protein PRUPE_ppa007511mg             106   1e-23    Prunus persica
gb|KCW89068.1|  hypothetical protein EUGRSUZ_A01397                     106   1e-23    Eucalyptus grandis [rose gum]
ref|XP_007218166.1|  hypothetical protein PRUPE_ppa007511mg             106   1e-23    
gb|AEI54336.1|  S-adenosyl-L-methionine: caffeic acid 3-0-methylt...    106   1e-23    Glycine max [soybeans]
gb|AAD29843.1|AF064695_1  catechol O-methyltransferase                  106   1e-23    Thalictrum tuberosum
gb|ABG27066.1|  caffeic acid O-methyltransferase                        106   1e-23    Boehmeria nivea [Chinese silk-plant]
gb|AHA44835.1|  caffeate O-methyltransferase                            106   1e-23    Larix kaempferi [karamatsu]
gb|AAD29842.1|AF064694_1  catechol O-methyltransferase                  106   1e-23    Thalictrum tuberosum
gb|ABK23795.1|  unknown                                                 106   1e-23    Picea sitchensis
ref|XP_008788729.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    106   1e-23    Phoenix dactylifera
gb|KJB23954.1|  hypothetical protein B456_004G125600                    106   1e-23    Gossypium raimondii
ref|XP_003528001.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    106   1e-23    Glycine max [soybeans]
ref|XP_008462913.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1    106   1e-23    Cucumis melo [Oriental melon]
ref|XP_010934913.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    105   2e-23    Elaeis guineensis
emb|CDY18306.1|  BnaC09g30560D                                          105   2e-23    Brassica napus [oilseed rape]
gb|KDP36008.1|  hypothetical protein JCGZ_10407                         105   2e-23    Jatropha curcas
gb|AEO14871.1|  caffeic acid O-methyltransferase                        105   2e-23    Salvia miltiorrhiza [Chinese salvia]
gb|AEO14870.1|  caffeic acid O-methyltransferase                        105   2e-23    Salvia miltiorrhiza [Chinese salvia]
gb|AAY86361.1|  caffeic acid O-methyltransferase                        105   2e-23    Acacia auriculiformis x Acacia mangium
ref|XP_007015114.1|  Caffeic acid 3-O-methyltransferase 1 isoform 2     105   3e-23    
ref|XP_007015113.1|  Caffeic acid 3-O-methyltransferase 1 isoform 1     105   3e-23    
dbj|BAO79382.1|  hypothetical plant O-methyltransferase                 105   3e-23    Anthriscus sylvestris
gb|ABS57468.1|  caffeic acid O-methyl transferase                       105   3e-23    Leucaena leucocephala [cassie]
ref|XP_009392797.1|  PREDICTED: flavone O-methyltransferase 1-like      105   3e-23    Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP37670.1|  hypothetical protein JCGZ_06898                         105   3e-23    Jatropha curcas
ref|XP_008803441.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    105   3e-23    Phoenix dactylifera
gb|AAG43822.1|AF212316_1  caffeic acid O-methyltransferase              104   5e-23    Capsicum annuum
gb|AGS49216.1|  O-methyltransferase                                     104   6e-23    Zea mays [maize]
sp|Q9FQY8.2|COMT1_CAPAN  RecName: Full=Caffeic acid 3-O-methyltra...    104   6e-23    Capsicum annuum
ref|XP_010934914.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    104   7e-23    Elaeis guineensis
gb|ABR18103.1|  unknown                                                 104   7e-23    Picea sitchensis
gb|KEH43550.1|  caffeic acid O-methyltransferase                        104   7e-23    Medicago truncatula
gb|KDO40925.1|  hypothetical protein CISIN_1g0357381mg                  102   7e-23    Citrus sinensis [apfelsine]
gb|ABK23414.1|  unknown                                                 104   7e-23    Picea sitchensis
ref|XP_010537046.1|  PREDICTED: flavone 3'-O-methyltransferase 1        104   7e-23    Tarenaya hassleriana [spider flower]
ref|XP_008376824.1|  PREDICTED: caffeic acid 3-O-methyltransferase      104   7e-23    
ref|XP_008775842.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    104   7e-23    Phoenix dactylifera
ref|XP_008357058.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    103   7e-23    Malus domestica [apple tree]
sp|Q8LL87.1|COMT1_COFCA  RecName: Full=Caffeic acid 3-O-methyltra...    103   8e-23    Coffea canephora [robusta coffee]
ref|XP_006441468.1|  hypothetical protein CICLE_v10020874mg             103   9e-23    Citrus clementina [clementine]
gb|AAN03726.1|  caffeic acid O-methyltransferase                        103   1e-22    Coffea canephora [robusta coffee]
gb|AET34455.1|  putative S-adenosyl-L-methionine: flavonoid O-met...    102   1e-22    Ginkgo biloba [ginkgo]
ref|XP_010918594.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    103   1e-22    Elaeis guineensis
ref|XP_010103059.1|  Caffeic acid 3-O-methyltransferase                 102   1e-22    
dbj|BAK42963.1|  caffeic acid O-methylltransferase                      103   1e-22    Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_006829216.1|  hypothetical protein AMTR_s00001p00272250          103   1e-22    Amborella trichopoda
dbj|BAM05584.1|  caffeic acid O-methyltransferase 2                     103   1e-22    Eucalyptus globulus subsp. globulus
gb|AEQ59236.1|  putative S-adenosyl-L-methionine:flavonoid O-meth...    102   1e-22    Ginkgo biloba [ginkgo]
ref|XP_004235028.1|  PREDICTED: caffeic acid 3-O-methyltransferase      103   1e-22    Solanum lycopersicum
ref|XP_006478221.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    103   1e-22    Citrus sinensis [apfelsine]
ref|XP_008362805.1|  PREDICTED: caffeic acid 3-O-methyltransferase      103   2e-22    
ref|XP_004137204.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    103   2e-22    Cucumis sativus [cucumbers]
ref|XP_006441599.1|  hypothetical protein CICLE_v10020870mg             103   2e-22    Citrus clementina [clementine]
ref|XP_010068758.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    103   2e-22    
prf||2119166A  caffeic acid O-methyltransferase                         103   2e-22 
ref|XP_008380838.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    103   2e-22    
gb|ABI54120.1|  caffeic acid O-methyltransferase                        103   2e-22    
gb|ABI54118.1|  caffeic acid O-methyltransferase                        103   2e-22    
ref|XP_002971011.1|  hypothetical protein SELMODRAFT_94918              102   2e-22    
gb|KDO41090.1|  hypothetical protein CISIN_1g018681mg                   102   2e-22    
ref|XP_006441596.1|  hypothetical protein CICLE_v10023568mg             102   2e-22    
ref|XP_006478347.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    102   3e-22    
ref|XP_006441603.1|  hypothetical protein CICLE_v10020875mg             102   3e-22    
ref|XP_002962074.1|  hypothetical protein SELMODRAFT_76630              102   3e-22    
gb|AAP03055.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    100   3e-22    
sp|P93324.1|CHOMT_MEDSA  RecName: Full=Isoliquiritigenin 2'-O-met...    102   3e-22    
ref|XP_010520933.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    102   3e-22    
ref|XP_009608171.1|  PREDICTED: caffeic acid 3-O-methyltransferase      102   3e-22    
emb|CAA52461.1|  catechol O-methyltransferase                           102   3e-22    
gb|KDO44005.1|  hypothetical protein CISIN_1g018576mg                   102   3e-22    
ref|XP_009757562.1|  PREDICTED: caffeic acid 3-O-methyltransferase      102   3e-22    
ref|XP_006431772.1|  hypothetical protein CICLE_v10001661mg             102   3e-22    
emb|CAA52462.1|  catechol O-methyltransferase                           102   3e-22    
sp|Q9XGV9.1|COMT2_OCIBA  RecName: Full=Caffeic acid 3-O-methyltra...    102   3e-22    
ref|XP_003556202.1|  PREDICTED: isoliquiritigenin 2'-O-methyltran...    102   4e-22    
ref|XP_006478225.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    100   4e-22    
gb|KDO44721.1|  hypothetical protein CISIN_1g036188mg                   100   4e-22    
ref|XP_006478222.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    102   4e-22    
ref|XP_006478224.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    100   4e-22    
gb|AGS49209.1|  O-methyltransferase                                     102   4e-22    
sp|Q43047.1|COMT3_POPKI  RecName: Full=Caffeic acid 3-O-methyltra...    102   4e-22    
dbj|BAM05583.1|  caffeic acid O-methyltransferase 2                     101   5e-22    
ref|XP_006401618.1|  hypothetical protein EUTSA_v10013896mg             101   5e-22    
ref|XP_006478226.1|  PREDICTED: anthranilate N-methyltransferase-...    102   5e-22    
ref|XP_006441263.1|  hypothetical protein CICLE_v100208142mg            100   5e-22    
ref|XP_006495276.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    100   5e-22    
sp|Q9XGW0.1|COMT1_OCIBA  RecName: Full=Caffeic acid 3-O-methyltra...    101   5e-22    
ref|XP_008803442.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    101   5e-22    
gb|AAD50440.1|AF168777_1  caffeic acid O-methyltransferase              101   5e-22    
ref|XP_011084580.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    101   6e-22    
ref|XP_008347272.1|  PREDICTED: caffeic acid 3-O-methyltransferase      101   6e-22    
gb|ADI24332.1|  caffeic acid 3-O-methyltransferase                      101   6e-22    
dbj|BAO31650.1|  O-methyltransferase                                    101   7e-22    
ref|XP_010034911.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    101   7e-22    
sp|O23760.1|COMT1_CLABR  RecName: Full=Caffeic acid 3-O-methyltra...    101   7e-22    
ref|XP_006401615.1|  hypothetical protein EUTSA_v10013908mg             101   7e-22    
dbj|BAM05582.1|  caffeic acid O-methyltransferase 2                     100   8e-22    
ref|XP_010061962.1|  PREDICTED: caffeic acid 3-O-methyltransferase      101   8e-22    
gb|AGO50639.1|  caffeic acid O-methyltransferase                        101   8e-22    
ref|XP_002321948.1|  Chain A family protein                             100   9e-22    
ref|XP_009361268.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    100   9e-22    
gb|ACJ76442.1|  caffeic acid 3-O-methyltransferase 2                    100   9e-22    
gb|KCW90804.1|  hypothetical protein EUGRSUZ_A02870                     100   9e-22    
ref|XP_007223223.1|  hypothetical protein PRUPE_ppa007212mg             100   1e-21    
ref|XP_004156527.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    100   1e-21    
gb|ADO16247.1|  caffeic acid O-methyltransferase                        100   1e-21    
gb|AGS49206.1|  O-methyltransferase                                     100   1e-21    
gb|AAQ67347.1|  caffeic acid 3-O-methyltransferase                      100   1e-21    
sp|O82054.1|COMT1_SACOF  RecName: Full=Caffeic acid 3-O-methyltra...    100   1e-21    
ref|XP_006436417.1|  hypothetical protein CICLE_v10031953mg           99.4    1e-21    
ref|XP_011075886.1|  PREDICTED: LOW QUALITY PROTEIN: caffeic acid...    100   1e-21    
gb|AFD61598.1|  caffeic acid 3-O-methyltransferase                      100   1e-21    
gb|AGS49201.1|  O-methyltransferase                                     100   2e-21    
gb|AAQ01670.1|  catechol O-methyltransferase                            100   2e-21    
gb|AFK48989.1|  unknown                                                 100   2e-21    
ref|XP_002869540.1|  hypothetical protein ARALYDRAFT_913747             100   2e-21    
gb|ADN27527.1|  caffeic acid O-methyltransferase                        100   2e-21    
gb|AGS49210.1|  O-methyltransferase                                     100   2e-21    
ref|XP_008219627.1|  PREDICTED: LOW QUALITY PROTEIN: caffeic acid...    100   2e-21    
gb|AGS49202.1|  O-methyltransferase                                     100   2e-21    
ref|XP_011003285.1|  PREDICTED: caffeic acid 3-O-methyltransferase 3    100   2e-21    
gb|AGS49204.1|  O-methyltransferase                                     100   2e-21    
ref|XP_006441607.1|  hypothetical protein CICLE_v10020880mg             100   2e-21    
gb|AAQ24337.1|  O-methyltransferase                                     100   2e-21    
ref|XP_003618025.1|  Caffeic acid 3-O-methyltransferase                 100   2e-21    
gb|ACF04799.1|  caffeic acid 3-O-methytransferase                       100   2e-21    
gb|AET00984.2|  caffeic acid O-methyltransferase                        100   2e-21    
gb|AGS49214.1|  O-methyltransferase                                   99.8    2e-21    
gb|AAQ24345.1|  O-methyltransferase                                   99.8    2e-21    
gb|AFZ78574.1|  caffeic acid O-methyltransferase                      99.8    2e-21    
gb|AFK41218.1|  unknown                                               99.8    2e-21    
ref|XP_006478090.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  99.8    2e-21    
gb|AAQ24339.1|  O-methyltransferase                                   99.8    2e-21    
ref|XP_006436416.1|  hypothetical protein CICLE_v10031953mg           99.8    2e-21    
gb|AAQ24338.1|  O-methyltransferase                                   99.8    2e-21    
gb|KDP24164.1|  hypothetical protein JCGZ_25821                       99.8    2e-21    
ref|XP_009361271.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  99.8    3e-21    
gb|AAQ24355.1|  O-methyltransferase                                   99.8    3e-21    
ref|XP_006485684.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  99.8    3e-21    
gb|EPS67212.1|  hypothetical protein M569_07558                       99.8    3e-21    
gb|AAD48913.1|AF139533_1  caffeate O-methyltransferase                99.8    3e-21    
gb|AAA80579.1|  3' flavonoid O-methyltransferase                      99.4    3e-21    
ref|XP_006494834.1|  PREDICTED: anthranilate N-methyltransferase-...  99.4    3e-21    
gb|AGS49196.1|  O-methyltransferase                                   99.4    3e-21    
gb|AFX98069.1|  caffeic acid O-methyltransferase                      99.4    3e-21    
ref|XP_010048410.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  99.4    4e-21    
ref|XP_003621331.1|  Isoliquiritigenin 2'-O-methyltransferase         99.4    4e-21    
gb|KHN00814.1|  Isoliquiritigenin 2'-O-methyltransferase              99.0    4e-21    
ref|XP_009387259.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  99.0    4e-21    
gb|AFO69477.1|  caffeic acid O-methyltransferase                      99.0    4e-21    
dbj|BAO31651.1|  O-methyltransferase                                  99.0    4e-21    
ref|XP_003536383.1|  PREDICTED: isoliquiritigenin 2'-O-methyltran...  99.0    4e-21    
gb|AAO43609.1|  caffeic acid O-methyltransferase                      99.0    4e-21    
gb|ACJ84475.1|  unknown                                               99.0    4e-21    
ref|XP_002320237.1|  eugenol O-methyltransferase family protein       99.0    5e-21    
ref|XP_004496361.1|  PREDICTED: isoliquiritigenin 2'-O-methyltran...  99.0    5e-21    
gb|KEH21637.1|  caffeic acid O-methyltransferase                      97.8    5e-21    
ref|NP_001240974.1|  isoliquiritigenin 2'-O-methyltransferase-like    98.6    5e-21    
ref|XP_003556208.1|  PREDICTED: isoliquiritigenin 2'-O-methyltran...  98.6    6e-21    
gb|EMS55685.1|  Tricetin 3',4',5'-O-trimethyltransferase              98.6    6e-21    
gb|ABP63535.1|  caffeic acid 3-O-methyltransferase                    98.6    7e-21    
sp|Q38J50.1|FOMT2_WHEAT  RecName: Full=Tricetin 3',4',5'-O-trimet...  98.6    7e-21    
emb|CDM87233.1|  unnamed protein product                              98.6    7e-21    
ref|XP_009361274.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  98.6    7e-21    
gb|AGS49190.1|  O-methyltransferase                                   98.6    7e-21    
gb|ADK97702.1|  putative caffeic acid O-methyltransferase             98.2    7e-21    
sp|O81646.1|COMT1_CAPCH  RecName: Full=Caffeic acid 3-O-methyltra...  98.2    7e-21    
gb|AGS49199.1|  O-methyltransferase                                   98.2    8e-21    
gb|AGS49184.1|  O-methyltransferase                                   98.2    9e-21    
gb|KEH21636.1|  caffeic acid O-methyltransferase                      97.8    1e-20    
gb|EYU19261.1|  hypothetical protein MIMGU_mgv1a026228mg              97.1    1e-20    
pdb|4PGG|A  Chain A, Caffeic Acid O-methyltransferase From Sorghu...  97.8    1e-20    
ref|XP_006477839.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  97.8    1e-20    
ref|XP_002445083.1|  hypothetical protein SORBIDRAFT_07g003860        97.8    1e-20    
gb|AAL57301.1|AF387790_1  O-methyltransferase                         97.8    1e-20    
ref|XP_003621334.1|  O-methyltransferase                              97.8    1e-20    
pdb|4PGH|A  Chain A, Caffeic Acid O-methyltransferase From Sorghu...  97.4    1e-20    
dbj|BAM05579.1|  caffeic acid O-methyltransferase 1                   97.4    1e-20    
ref|XP_010035325.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  97.4    1e-20    
ref|XP_010107139.1|  Caffeic acid 3-O-methyltransferase               97.4    2e-20    
ref|XP_010911558.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  97.4    2e-20    
gb|AGS49197.1|  O-methyltransferase                                   97.4    2e-20    
sp|Q43239.1|COMT1_ZINVI  RecName: Full=Caffeic acid 3-O-methyltra...  97.1    2e-20    
ref|XP_006436320.1|  hypothetical protein CICLE_v10031951mg           96.3    2e-20    
ref|XP_008358297.1|  PREDICTED: anthranilate N-methyltransferase-...  97.1    2e-20    
ref|XP_008343466.1|  PREDICTED: anthranilate N-methyltransferase-...  97.1    2e-20    
ref|XP_010100665.1|  Anthranilate N-methyltransferase                 97.1    2e-20    
gb|ABP93668.1|  O-methytransferase 4                                  97.1    2e-20    
ref|XP_011039447.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  97.1    2e-20    
ref|XP_008348753.1|  PREDICTED: anthranilate N-methyltransferase-...  97.1    2e-20    
gb|EMT17011.1|  Caffeic acid 3-O-methyltransferase                    97.1    2e-20    
gb|AGS49181.1|  O-methyltransferase                                   97.1    2e-20    
gb|EYU35612.1|  hypothetical protein MIMGU_mgv1a021833mg              95.5    2e-20    
gb|AGS49183.1|  O-methyltransferase                                   96.7    3e-20    
gb|AAQ24348.1|  O-methyltransferase                                   96.7    3e-20    
gb|AAQ24361.1|  O-methyltransferase                                   96.7    3e-20    
gb|AGF25396.1|  caffeic acid 3-O-methyltransferase                    96.7    3e-20    
sp|Q06509.1|COMT1_MAIZE  RecName: Full=Caffeic acid 3-O-methyltra...  96.7    3e-20    
ref|XP_010261275.1|  PREDICTED: LOW QUALITY PROTEIN: (S)-scouleri...  96.7    3e-20    
gb|AGS49200.1|  O-methyltransferase                                   96.7    3e-20    
gb|AAQ24343.1|  O-methyltransferase                                   96.7    3e-20    
sp|Q9SWC2.1|COMT1_EUCGL  RecName: Full=Caffeic acid 3-O-methyltra...  96.3    3e-20    
gb|AAQ24342.1|  O-methyltransferase                                   96.7    3e-20    
gb|AAQ24344.1|  O-methyltransferase                                   96.7    3e-20    
ref|NP_001266643.1|  quercetin 3-O-methyltransferase 1                96.7    3e-20    
gb|AGS49185.1|  O-methyltransferase                                   96.7    3e-20    
gb|KCW89065.1|  hypothetical protein EUGRSUZ_A01392                   95.9    3e-20    
gb|AGS49198.1|  O-methyltransferase                                   96.7    3e-20    
gb|AAQ24351.1|  O-methyltransferase                                   96.7    3e-20    
ref|XP_007019090.1|  Caffeic acid 3-O-methyltransferase 1             96.7    3e-20    
gb|AGS49188.1|  O-methyltransferase                                   96.7    3e-20    
gb|AGS49182.1|  O-methyltransferase                                   96.7    3e-20    
ref|XP_006436317.1|  hypothetical protein CICLE_v10031952mg           95.9    3e-20    
gb|AGS49208.1|  O-methyltransferase                                   96.7    3e-20    
ref|NP_001106047.1|  catechol O-methyltransferase                     96.7    3e-20    
ref|XP_006442371.1|  hypothetical protein CICLE_v10024037mg           96.7    3e-20    
gb|AGS49215.1|  O-methyltransferase                                   96.7    3e-20    
gb|AGS49187.1|  O-methyltransferase                                   96.3    3e-20    
gb|AGS49186.1|  O-methyltransferase                                   96.3    3e-20    
ref|XP_006494578.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  96.3    3e-20    
ref|XP_003626615.1|  Caffeic acid 3-O-methyltransferase               95.5    3e-20    
gb|AEI54338.1|  isoliquiritigenin 2'-O-methyltransferase              96.3    3e-20    
ref|XP_009386883.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  96.3    4e-20    
ref|XP_009137685.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  96.3    4e-20    
ref|XP_006436319.1|  hypothetical protein CICLE_v10031951mg           96.3    4e-20    
ref|XP_010520935.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  96.3    4e-20    
ref|XP_006436316.1|  hypothetical protein CICLE_v10031952mg           95.9    4e-20    
gb|AGS49219.1|  O-methyltransferase                                   96.3    4e-20    
gb|AGS49205.1|  O-methyltransferase                                   95.9    5e-20    
ref|XP_009761316.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  95.9    5e-20    
gb|KDP32877.1|  hypothetical protein JCGZ_12169                       95.9    5e-20    
ref|XP_010662844.1|  PREDICTED: caffeic acid O-methyltransferase ...  95.9    5e-20    
ref|XP_010048400.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  95.9    5e-20    
ref|XP_009361272.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  95.9    6e-20    
gb|KDP32878.1|  hypothetical protein JCGZ_12170                       95.9    6e-20    
gb|KHN00805.1|  Isoliquiritigenin 2'-O-methyltransferase              95.5    6e-20    
gb|AFK42771.1|  unknown                                               95.5    7e-20    
ref|XP_003626614.1|  Caffeic acid 3-O-methyltransferase               95.5    7e-20    
dbj|BAM05581.1|  caffeic acid O-methyltransferase 1                   95.1    7e-20    
gb|ABP94018.1|  O-methyltransferase                                   95.5    8e-20    
gb|KHN17090.1|  Isoliquiritigenin 2'-O-methyltransferase              95.1    8e-20    
gb|KHN06374.1|  Anthranilate N-methyltransferase                      95.5    8e-20    
ref|XP_006436307.1|  hypothetical protein CICLE_v10031949mg           95.1    8e-20    
ref|XP_009384375.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  95.1    8e-20    
ref|XP_006436309.1|  hypothetical protein CICLE_v10031949mg           94.7    9e-20    
ref|XP_009384387.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  95.1    9e-20    
ref|XP_006436308.1|  hypothetical protein CICLE_v10031949mg           95.1    9e-20    
sp|O04385.2|IEMT_CLABR  RecName: Full=(Iso)eugenol O-methyltransf...  95.1    1e-19    
gb|AFQ94040.1|  monolignol 4-O-methyltransferase 4                    95.1    1e-19    
gb|AGS49191.1|  O-methyltransferase                                   95.1    1e-19    
sp|Q41086.1|COMT2_POPTM  RecName: Full=Caffeic acid 3-O-methyltra...  95.1    1e-19    
ref|XP_006472905.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  95.1    1e-19    
ref|XP_008352782.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  94.7    1e-19    
gb|AFK45057.1|  unknown                                               93.2    1e-19    
ref|XP_010112212.1|  Caffeic acid 3-O-methyltransferase               94.7    1e-19    
ref|XP_010433307.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  94.7    1e-19    
ref|XP_010448093.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  94.7    2e-19    
ref|XP_006441606.1|  hypothetical protein CICLE_v10023994mg           94.4    2e-19    
ref|XP_007143654.1|  hypothetical protein PHAVU_007G090100g           94.4    2e-19    
ref|XP_002268308.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  94.4    2e-19    
gb|AID68566.1|  caffeic O-methyltransferase                           94.4    2e-19    
gb|AGS49203.1|  O-methyltransferase                                   94.4    2e-19    
gb|KHN00804.1|  Isoliquiritigenin 2'-O-methyltransferase              94.4    2e-19    
ref|XP_010527383.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  94.4    2e-19    
pdb|3REO|A  Chain A, Monolignol O-Methyltransferase (Momt)            94.4    2e-19    
ref|XP_010438549.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  94.4    2e-19    
gb|KFK29300.1|  hypothetical protein AALP_AA7G115400                  94.4    2e-19    
emb|CDX92835.1|  BnaC07g40930D                                        94.0    2e-19    
gb|AGS49211.1|  O-methyltransferase                                   94.0    2e-19    
gb|AGS49207.1|  O-methyltransferase                                   94.0    2e-19    
gb|AAK68910.1|  caffeic acid O-methyltransferase                      94.0    2e-19    
gb|ABS18316.1|  caffeic acid-3-O-methyltransferase                    94.0    2e-19    
ref|XP_002302676.2|  eugenol O-methyltransferase family protein       94.0    3e-19    
sp|A9X7L0.1|ANMT_RUTGR  RecName: Full=Anthranilate N-methyltransf...  94.0    3e-19    



>ref|XP_004304330.1| PREDICTED: caffeic acid 3-O-methyltransferase [Fragaria vesca 
subsp. vesca]
Length=358

 Score =   306 bits (785),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 143/192 (74%), Positives = 164/192 (85%), Gaps = 0/192 (0%)
 Frame = +3

Query  45   ESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGD  224
            E+ N AR+ I+ELANMISVPMSL AV+RLNVADAIWQ GSN PLSAS+IL  VLP+G GD
Sbjct  9    EASNEARIAILELANMISVPMSLNAVVRLNVADAIWQKGSNTPLSASQILERVLPTGSGD  68

Query  225  APNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAM  404
            A NL+R+LRMLTSYG+F EH NAD SER++S+ EVG+TLVT++DGLSYG YVLQHHQ  +
Sbjct  69   AENLQRILRMLTSYGVFSEHFNADGSERKFSLTEVGQTLVTNQDGLSYGDYVLQHHQDVL  128

Query  405  MKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSY  584
            M AWPLVHEAV+D S+EPFVK NGE  Y YYGK PEMN LMQKAMSG+SVPF+KA LD Y
Sbjct  129  MGAWPLVHEAVIDPSVEPFVKANGEPAYQYYGKRPEMNGLMQKAMSGVSVPFIKAVLDGY  188

Query  585  QGFKGVTRLVDV  620
             GF+GVTRLVDV
Sbjct  189  DGFQGVTRLVDV  200



>ref|XP_007027514.1| O-methyltransferase family protein [Theobroma cacao]
 gb|EOY08016.1| O-methyltransferase family protein [Theobroma cacao]
Length=356

 Score =   300 bits (768),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 166/193 (86%), Gaps = 0/193 (0%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  221
            ++S N ARL I+ELANM+SVPMSL AV+RLNV DAIWQGG+N PLSA++ILS VLPSGGG
Sbjct  6    ADSRNKARLAILELANMMSVPMSLNAVVRLNVPDAIWQGGANTPLSATQILSRVLPSGGG  65

Query  222  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  401
            D  NL+R+LRMLTSYG+F EH++++  ERR+S+ ++GKTLVTD DGLS   YVLQHHQ A
Sbjct  66   DPENLQRILRMLTSYGVFAEHLDSECPERRFSLTDIGKTLVTDADGLSCAPYVLQHHQDA  125

Query  402  MMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDS  581
            +M+ WPL+HEAV+D + EPFVKVNGEA YSYYGK PEMN LMQKAMSG+SVPFM+A L+S
Sbjct  126  LMRVWPLMHEAVLDPTSEPFVKVNGEAAYSYYGKKPEMNGLMQKAMSGVSVPFMRAILNS  185

Query  582  YQGFKGVTRLVDV  620
            Y GFKGV RLVDV
Sbjct  186  YDGFKGVKRLVDV  198



>ref|XP_008442758.1| PREDICTED: caffeic acid 3-O-methyltransferase [Cucumis melo]
Length=371

 Score =   300 bits (769),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  221
            SE  N ARL I+ELANMISVPMSL A++RLNVADAIWQ GSN+PLSASEIL+ V+PSGGG
Sbjct  21   SEIQNKARLAILELANMISVPMSLNAIVRLNVADAIWQNGSNSPLSASEILARVVPSGGG  80

Query  222  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  401
            DA NLER+LRMLTSYG+F EH++ ++S  RYS+ +VGKTLVTD DGLSY  YVLQHHQ A
Sbjct  81   DAHNLERILRMLTSYGVFEEHLSPNSSNHRYSLTDVGKTLVTDTDGLSYAPYVLQHHQDA  140

Query  402  MMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDS  581
            +M+AWP VHEA +DS+ EPFV+ NGE  YSYYGK  EMN LMQ+AM+G+SVPFMKA LD 
Sbjct  141  LMRAWPRVHEAAIDSTTEPFVRANGEPAYSYYGKKTEMNELMQRAMAGVSVPFMKAVLDG  200

Query  582  YQGFKGVTRLVDV  620
            Y GFKGV +LVDV
Sbjct  201  YDGFKGVEKLVDV  213



>gb|KDP29212.1| hypothetical protein JCGZ_16601 [Jatropha curcas]
Length=357

 Score =   299 bits (765),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 165/193 (85%), Gaps = 1/193 (1%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  221
            SES N ARL I+ELANMISVPMSL A++RLNVAD IWQGG+NAPLSASEIL+ V PSGG 
Sbjct  8    SESRNRARLAILELANMISVPMSLNAIVRLNVADVIWQGGANAPLSASEILARVHPSGG-  66

Query  222  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  401
            D  NL+R+LRMLTSY +F EH+N+DA+ERRYS+ E+GKTLVTD +GLSY +YVLQHHQ A
Sbjct  67   DPENLQRILRMLTSYDVFTEHVNSDATERRYSLTEIGKTLVTDSEGLSYASYVLQHHQDA  126

Query  402  MMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDS  581
            +M+AWPLVHEAVVD + EPFVK N E  Y+YYGK PEMN LMQKAMSG+SVPFMKA L+ 
Sbjct  127  LMRAWPLVHEAVVDPTTEPFVKANDEPAYAYYGKQPEMNGLMQKAMSGVSVPFMKAILNG  186

Query  582  YQGFKGVTRLVDV  620
            Y GF+G+ +LVDV
Sbjct  187  YDGFQGMEKLVDV  199



>ref|XP_008361606.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like isoform 
X2 [Malus domestica]
Length=278

 Score =   293 bits (751),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 169/205 (82%), Gaps = 3/205 (1%)
 Frame = +3

Query  15   KLKEIGAMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEIL  194
            ++  + A  S S+N ARL I+ELANMISVPMSL AV+RLNV DAIWQGG N PLSAS++L
Sbjct  6    QVSNVTAGPSSSNNEARLAILELANMISVPMSLNAVVRLNVPDAIWQGGCNTPLSASDVL  65

Query  195  SSVLPSGGGDAPNLERLLRMLTSYGIFREHI-NAD--ASERRYSVDEVGKTLVTDKDGLS  365
            + V+P+GGGDA NL+R+LRMLTSYG+F EH+ N D  + +R++S+  +G+TLVTD++GLS
Sbjct  66   ARVIPNGGGDAENLQRILRMLTSYGVFEEHLSNLDDGSDDRKFSLTPIGQTLVTDQNGLS  125

Query  366  YGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSG  545
            YG YVLQHHQ  +M AWP+VHEAVVDS++EPFVK NGE  Y YYGK PEMN LMQKAMSG
Sbjct  126  YGPYVLQHHQDVLMGAWPMVHEAVVDSTVEPFVKANGELAYEYYGKKPEMNGLMQKAMSG  185

Query  546  ISVPFMKAFLDSYQGFKGVTRLVDV  620
            +SVPFMKA LD Y GF+GV RLVDV
Sbjct  186  VSVPFMKAILDGYDGFEGVERLVDV  210



>gb|KJB62321.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=248

 Score =   292 bits (748),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 161/198 (81%), Gaps = 5/198 (3%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  221
            +ES N ARL IMELANMISVPMSL A++RLNV DAIWQGG+N PLS  +ILS VLPSGGG
Sbjct  7    AESSNKARLAIMELANMISVPMSLNAIVRLNVPDAIWQGGANTPLSVVQILSRVLPSGGG  66

Query  222  DAPNLERLLRMLTSYGIFREHINAD-----ASERRYSVDEVGKTLVTDKDGLSYGAYVLQ  386
            D  NL+R+LRMLTSYG+F EH+N       + ER+YS+ ++GKTLVTD +GLSY  YVLQ
Sbjct  67   DPENLQRILRMLTSYGVFDEHLNCSGDDSHSPERKYSLTDIGKTLVTDAEGLSYAPYVLQ  126

Query  387  HHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMK  566
            HHQ A+M+AWPLVHEAV++ + EPFVK NGE  YSYYGK PEMN LMQKAMSG+SVPFM+
Sbjct  127  HHQDALMRAWPLVHEAVLNPTSEPFVKANGEGAYSYYGKKPEMNGLMQKAMSGVSVPFMR  186

Query  567  AFLDSYQGFKGVTRLVDV  620
            A LD Y G KGV RLVDV
Sbjct  187  AILDGYDGLKGVKRLVDV  204



>gb|KJB62322.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=258

 Score =   292 bits (748),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 161/198 (81%), Gaps = 5/198 (3%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  221
            +ES N ARL IMELANMISVPMSL A++RLNV DAIWQGG+N PLS  +ILS VLPSGGG
Sbjct  7    AESSNKARLAIMELANMISVPMSLNAIVRLNVPDAIWQGGANTPLSVVQILSRVLPSGGG  66

Query  222  DAPNLERLLRMLTSYGIFREHINAD-----ASERRYSVDEVGKTLVTDKDGLSYGAYVLQ  386
            D  NL+R+LRMLTSYG+F EH+N       + ER+YS+ ++GKTLVTD +GLSY  YVLQ
Sbjct  67   DPENLQRILRMLTSYGVFDEHLNCSGDDSHSPERKYSLTDIGKTLVTDAEGLSYAPYVLQ  126

Query  387  HHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMK  566
            HHQ A+M+AWPLVHEAV++ + EPFVK NGE  YSYYGK PEMN LMQKAMSG+SVPFM+
Sbjct  127  HHQDALMRAWPLVHEAVLNPTSEPFVKANGEGAYSYYGKKPEMNGLMQKAMSGVSVPFMR  186

Query  567  AFLDSYQGFKGVTRLVDV  620
            A LD Y G KGV RLVDV
Sbjct  187  AILDGYDGLKGVKRLVDV  204



>gb|KJB62324.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=269

 Score =   293 bits (749),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 161/198 (81%), Gaps = 5/198 (3%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  221
            +ES N ARL IMELANMISVPMSL A++RLNV DAIWQGG+N PLS  +ILS VLPSGGG
Sbjct  7    AESSNKARLAIMELANMISVPMSLNAIVRLNVPDAIWQGGANTPLSVVQILSRVLPSGGG  66

Query  222  DAPNLERLLRMLTSYGIFREHINAD-----ASERRYSVDEVGKTLVTDKDGLSYGAYVLQ  386
            D  NL+R+LRMLTSYG+F EH+N       + ER+YS+ ++GKTLVTD +GLSY  YVLQ
Sbjct  67   DPENLQRILRMLTSYGVFDEHLNCSGDDSHSPERKYSLTDIGKTLVTDAEGLSYAPYVLQ  126

Query  387  HHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMK  566
            HHQ A+M+AWPLVHEAV++ + EPFVK NGE  YSYYGK PEMN LMQKAMSG+SVPFM+
Sbjct  127  HHQDALMRAWPLVHEAVLNPTSEPFVKANGEGAYSYYGKKPEMNGLMQKAMSGVSVPFMR  186

Query  567  AFLDSYQGFKGVTRLVDV  620
            A LD Y G KGV RLVDV
Sbjct  187  AILDGYDGLKGVKRLVDV  204



>ref|XP_009341082.1| PREDICTED: caffeic acid 3-O-methyltransferase isoform X2 [Pyrus 
x bretschneideri]
Length=369

 Score =   295 bits (756),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 141/196 (72%), Positives = 165/196 (84%), Gaps = 3/196 (2%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  221
            S S N ARL I+ELANMISVPMSL AV+RLNVADAIWQGG N PLSAS+IL+ VLP+GGG
Sbjct  16   SSSSNEARLAILELANMISVPMSLNAVVRLNVADAIWQGGCNTPLSASDILARVLPNGGG  75

Query  222  DAPNLERLLRMLTSYGIFREHI-NAD--ASERRYSVDEVGKTLVTDKDGLSYGAYVLQHH  392
            DA NL+R+LRMLTSYG+F EH+ N D  + +R++S+  +G+TLVTD++GLSYG YVLQHH
Sbjct  76   DAENLQRILRMLTSYGVFEEHLSNLDDGSDDRKFSLTPIGQTLVTDQNGLSYGPYVLQHH  135

Query  393  QAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAF  572
            Q  +M AWP+VHEAVVDS++EPFVK NGE  Y YYGK PEMN LMQKAMSG+SVPFMKA 
Sbjct  136  QDVLMGAWPMVHEAVVDSTVEPFVKANGEPAYEYYGKKPEMNGLMQKAMSGVSVPFMKAI  195

Query  573  LDSYQGFKGVTRLVDV  620
            LD Y GF+GV RLVDV
Sbjct  196  LDGYDGFEGVERLVDV  211



>gb|KGN59032.1| hypothetical protein Csa_3G747630 [Cucumis sativus]
Length=370

 Score =   295 bits (755),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 163/193 (84%), Gaps = 1/193 (1%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  221
            SE  N ARL I+ELANMISVPMSL A++RLNVADAIWQ GSN+PLSASEIL+ V+PSGG 
Sbjct  21   SEIQNKARLAIIELANMISVPMSLNAIVRLNVADAIWQNGSNSPLSASEILARVVPSGG-  79

Query  222  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  401
            DA NLER+LRMLTSYG+F EH++ ++S  RYS+ +VGKTLVTD DGLSY  YVLQHHQ A
Sbjct  80   DAHNLERILRMLTSYGVFEEHLSPNSSNHRYSLTDVGKTLVTDSDGLSYAPYVLQHHQDA  139

Query  402  MMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDS  581
            +M+AWP VHEA +DS+ EPFV+ NGEA YSYYGK  EMN LMQ+AM+G+SVPFMKA LD 
Sbjct  140  LMRAWPRVHEAAIDSTTEPFVRANGEAAYSYYGKKTEMNELMQRAMAGVSVPFMKAVLDG  199

Query  582  YQGFKGVTRLVDV  620
            Y GFKGV +LVDV
Sbjct  200  YDGFKGVEKLVDV  212



>ref|XP_004137858.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cucumis sativus]
 ref|XP_004169388.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cucumis sativus]
Length=409

 Score =   295 bits (756),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 163/193 (84%), Gaps = 1/193 (1%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  221
            SE  N ARL I+ELANMISVPMSL A++RLNVADAIWQ GSN+PLSASEIL+ V+PSGG 
Sbjct  58   SEIQNKARLAIIELANMISVPMSLNAIVRLNVADAIWQNGSNSPLSASEILARVVPSGG-  116

Query  222  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  401
            DA NLER+LRMLTSYG+F EH++ ++S  RYS+ +VGKTLVTD DGLSY  YVLQHHQ A
Sbjct  117  DAHNLERILRMLTSYGVFEEHLSPNSSNHRYSLTDVGKTLVTDSDGLSYAPYVLQHHQDA  176

Query  402  MMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDS  581
            +M+AWP VHEA +DS+ EPFV+ NGEA YSYYGK  EMN LMQ+AM+G+SVPFMKA LD 
Sbjct  177  LMRAWPRVHEAAIDSTTEPFVRANGEAAYSYYGKKTEMNELMQRAMAGVSVPFMKAVLDG  236

Query  582  YQGFKGVTRLVDV  620
            Y GFKGV +LVDV
Sbjct  237  YDGFKGVEKLVDV  249



>ref|XP_007202084.1| hypothetical protein PRUPE_ppa007420mg [Prunus persica]
 gb|EMJ03283.1| hypothetical protein PRUPE_ppa007420mg [Prunus persica]
Length=368

 Score =   294 bits (752),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 167/206 (81%), Gaps = 5/206 (2%)
 Frame = +3

Query  18   LKEIGAMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILS  197
            +  +     +  N ARL I+ELANMISVPMSL AV+RLNV DAIWQGGSN+PLSAS ILS
Sbjct  5    VSHVTTTAEQPSNEARLGILELANMISVPMSLNAVVRLNVPDAIWQGGSNSPLSASAILS  64

Query  198  SVLPSGGGDAPNLERLLRMLTSYGIFREH-INAD----ASERRYSVDEVGKTLVTDKDGL  362
             VLP GGGDA NL+R+LRMLTSYG+F EH ++AD    + +R++S+ E+GKTLVTD++GL
Sbjct  65   HVLPDGGGDAENLQRILRMLTSYGVFAEHLVSADDDGGSHQRKFSLTEIGKTLVTDQNGL  124

Query  363  SYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMS  542
            SYG Y+LQHHQ  +M AWP+VHEAVVD +IEPFVKVNGE  Y YYGK PEMN LMQ+AMS
Sbjct  125  SYGPYILQHHQDVLMGAWPMVHEAVVDPTIEPFVKVNGEPAYEYYGKKPEMNGLMQRAMS  184

Query  543  GISVPFMKAFLDSYQGFKGVTRLVDV  620
            G+SVPFMKA LD Y GF+GV RLVDV
Sbjct  185  GVSVPFMKAILDGYDGFEGVGRLVDV  210



>ref|XP_011101458.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Sesamum indicum]
Length=354

 Score =   293 bits (749),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 140/195 (72%), Positives = 162/195 (83%), Gaps = 0/195 (0%)
 Frame = +3

Query  36   MGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSG  215
            M +   N     IMELANMISVPM+L AV+RLNVADAIWQGGSN PLSA+EILS+     
Sbjct  1    MENSQTNSPTTAIMELANMISVPMALNAVVRLNVADAIWQGGSNNPLSAAEILSAAAVGP  60

Query  216  GGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            GGDA NL+R+LR+LTS+G+F EH+NADA++RRYS+ EVGKTL TD++GLSYGAYVLQHHQ
Sbjct  61   GGDAENLQRILRLLTSFGVFEEHLNADATKRRYSLTEVGKTLATDENGLSYGAYVLQHHQ  120

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
             A+M+AW LVHEAV+D S EPFVK NGE  YSYYGK PEMN LM KAMSG+SVPFMKAFL
Sbjct  121  DALMRAWTLVHEAVLDPSSEPFVKANGEGAYSYYGKKPEMNELMLKAMSGVSVPFMKAFL  180

Query  576  DSYQGFKGVTRLVDV  620
            +SY GF+GV  LVDV
Sbjct  181  NSYDGFQGVGTLVDV  195



>gb|KJB62323.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=347

 Score =   292 bits (748),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 161/198 (81%), Gaps = 5/198 (3%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  221
            +ES N ARL IMELANMISVPMSL A++RLNV DAIWQGG+N PLS  +ILS VLPSGGG
Sbjct  7    AESSNKARLAIMELANMISVPMSLNAIVRLNVPDAIWQGGANTPLSVVQILSRVLPSGGG  66

Query  222  DAPNLERLLRMLTSYGIFREHINAD-----ASERRYSVDEVGKTLVTDKDGLSYGAYVLQ  386
            D  NL+R+LRMLTSYG+F EH+N       + ER+YS+ ++GKTLVTD +GLSY  YVLQ
Sbjct  67   DPENLQRILRMLTSYGVFDEHLNCSGDDSHSPERKYSLTDIGKTLVTDAEGLSYAPYVLQ  126

Query  387  HHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMK  566
            HHQ A+M+AWPLVHEAV++ + EPFVK NGE  YSYYGK PEMN LMQKAMSG+SVPFM+
Sbjct  127  HHQDALMRAWPLVHEAVLNPTSEPFVKANGEGAYSYYGKKPEMNGLMQKAMSGVSVPFMR  186

Query  567  AFLDSYQGFKGVTRLVDV  620
            A LD Y G KGV RLVDV
Sbjct  187  AILDGYDGLKGVKRLVDV  204



>gb|KJB62320.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=361

 Score =   292 bits (748),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 161/198 (81%), Gaps = 5/198 (3%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  221
            +ES N ARL IMELANMISVPMSL A++RLNV DAIWQGG+N PLS  +ILS VLPSGGG
Sbjct  7    AESSNKARLAIMELANMISVPMSLNAIVRLNVPDAIWQGGANTPLSVVQILSRVLPSGGG  66

Query  222  DAPNLERLLRMLTSYGIFREHINAD-----ASERRYSVDEVGKTLVTDKDGLSYGAYVLQ  386
            D  NL+R+LRMLTSYG+F EH+N       + ER+YS+ ++GKTLVTD +GLSY  YVLQ
Sbjct  67   DPENLQRILRMLTSYGVFDEHLNCSGDDSHSPERKYSLTDIGKTLVTDAEGLSYAPYVLQ  126

Query  387  HHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMK  566
            HHQ A+M+AWPLVHEAV++ + EPFVK NGE  YSYYGK PEMN LMQKAMSG+SVPFM+
Sbjct  127  HHQDALMRAWPLVHEAVLNPTSEPFVKANGEGAYSYYGKKPEMNGLMQKAMSGVSVPFMR  186

Query  567  AFLDSYQGFKGVTRLVDV  620
            A LD Y G KGV RLVDV
Sbjct  187  AILDGYDGLKGVKRLVDV  204



>gb|KHG05883.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=361

 Score =   292 bits (747),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 161/198 (81%), Gaps = 5/198 (3%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  221
            +ES N ARL IMELANMISVPMSL A++RLNV DAIWQGG+N PLSA +ILS VLP GGG
Sbjct  7    AESSNKARLAIMELANMISVPMSLNAIVRLNVPDAIWQGGANTPLSAVQILSRVLPYGGG  66

Query  222  DAPNLERLLRMLTSYGIFREHINAD-----ASERRYSVDEVGKTLVTDKDGLSYGAYVLQ  386
            D  NL+R+LRMLTSYG+F EH+N       + ER+YS+ ++GKTLVTD +GLSY  YVLQ
Sbjct  67   DPENLQRILRMLTSYGVFDEHLNCSGDDSHSPERKYSLTDIGKTLVTDAEGLSYAPYVLQ  126

Query  387  HHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMK  566
            HHQ A+M+AWPLVHEAV++ + EPFVK NGE  YSYYGK PEMN LMQKAMSG+SVPFM+
Sbjct  127  HHQDALMRAWPLVHEAVLNPTSEPFVKANGEGAYSYYGKKPEMNGLMQKAMSGVSVPFMR  186

Query  567  AFLDSYQGFKGVTRLVDV  620
            A LD Y G KGV RLVDV
Sbjct  187  AILDGYDGLKGVKRLVDV  204



>ref|XP_008361604.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like isoform 
X1 [Malus domestica]
Length=281

 Score =   288 bits (737),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 169/208 (81%), Gaps = 6/208 (3%)
 Frame = +3

Query  15   KLKEIGAMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEIL  194
            ++  + A  S S+N ARL I+ELANMISVPMSL AV+RLNV DAIWQGG N PLSAS++L
Sbjct  6    QVSNVTAGPSSSNNEARLAILELANMISVPMSLNAVVRLNVPDAIWQGGCNTPLSASDVL  65

Query  195  SSVLPSGGGDAPNLERLLRMLTSYGIFREHI-NAD--ASERRYSVDEVGKTLVTDKDGLS  365
            + V+P+GGGDA NL+R+LRMLTSYG+F EH+ N D  + +R++S+  +G+TLVTD++GLS
Sbjct  66   ARVIPNGGGDAENLQRILRMLTSYGVFEEHLSNLDDGSDDRKFSLTPIGQTLVTDQNGLS  125

Query  366  YGAYVLQHHQA---AMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKA  536
            YG YVLQHHQ     +M AWP+VHEAVVDS++EPFVK NGE  Y YYGK PEMN LMQKA
Sbjct  126  YGPYVLQHHQLFKDVLMGAWPMVHEAVVDSTVEPFVKANGELAYEYYGKKPEMNGLMQKA  185

Query  537  MSGISVPFMKAFLDSYQGFKGVTRLVDV  620
            MSG+SVPFMKA LD Y GF+GV RLVDV
Sbjct  186  MSGVSVPFMKAILDGYDGFEGVERLVDV  213



>ref|XP_009341081.1| PREDICTED: caffeic acid 3-O-methyltransferase isoform X1 [Pyrus 
x bretschneideri]
Length=372

 Score =   290 bits (742),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/199 (71%), Positives = 165/199 (83%), Gaps = 6/199 (3%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  221
            S S N ARL I+ELANMISVPMSL AV+RLNVADAIWQGG N PLSAS+IL+ VLP+GGG
Sbjct  16   SSSSNEARLAILELANMISVPMSLNAVVRLNVADAIWQGGCNTPLSASDILARVLPNGGG  75

Query  222  DAPNLERLLRMLTSYGIFREHI-NAD--ASERRYSVDEVGKTLVTDKDGLSYGAYVLQHH  392
            DA NL+R+LRMLTSYG+F EH+ N D  + +R++S+  +G+TLVTD++GLSYG YVLQHH
Sbjct  76   DAENLQRILRMLTSYGVFEEHLSNLDDGSDDRKFSLTPIGQTLVTDQNGLSYGPYVLQHH  135

Query  393  QA---AMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFM  563
            Q     +M AWP+VHEAVVDS++EPFVK NGE  Y YYGK PEMN LMQKAMSG+SVPFM
Sbjct  136  QLFKDVLMGAWPMVHEAVVDSTVEPFVKANGEPAYEYYGKKPEMNGLMQKAMSGVSVPFM  195

Query  564  KAFLDSYQGFKGVTRLVDV  620
            KA LD Y GF+GV RLVDV
Sbjct  196  KAILDGYDGFEGVERLVDV  214



>ref|XP_006428524.1| hypothetical protein CICLE_v10013655mg [Citrus clementina]
 gb|ESR41764.1| hypothetical protein CICLE_v10013655mg [Citrus clementina]
Length=261

 Score =   285 bits (729),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 156/186 (84%), Gaps = 1/186 (1%)
 Frame = +3

Query  63   RLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLER  242
            RL IMELANMISVPMSL A IRL+V DAIWQGG+N PLSAS+IL+ +LPSGGGDA NL+R
Sbjct  14   RLAIMELANMISVPMSLTAAIRLHVPDAIWQGGANTPLSASQILTRILPSGGGDAENLQR  73

Query  243  LLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPL  422
            +LR+LTSYG+F EH      ER+YS+ E+GK+LVTD +GLSY  YVLQHHQ A+M AWPL
Sbjct  74   ILRLLTSYGVFSEH-REFGGERKYSLTEIGKSLVTDAEGLSYAPYVLQHHQDALMSAWPL  132

Query  423  VHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQGFKGV  602
            VHEAV+D +IEPFVKV+GE  YSYYGK PEMN LM+KAMSG+SVPFM + LD Y GFKGV
Sbjct  133  VHEAVLDPTIEPFVKVHGEPAYSYYGKKPEMNGLMRKAMSGVSVPFMTSVLDGYDGFKGV  192

Query  603  TRLVDV  620
             RLVDV
Sbjct  193  KRLVDV  198



>ref|XP_008241354.1| PREDICTED: caffeic acid 3-O-methyltransferase [Prunus mume]
Length=368

 Score =   288 bits (738),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 135/197 (69%), Positives = 160/197 (81%), Gaps = 5/197 (3%)
 Frame = +3

Query  45   ESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGD  224
            +  N ARL I+ELANMISVPMSL AV+RLNV DAIWQ GSN PLSAS IL+ VLP GGGD
Sbjct  14   QPSNEARLGILELANMISVPMSLNAVVRLNVPDAIWQAGSNTPLSASAILARVLPDGGGD  73

Query  225  APNLERLLRMLTSYGIFREHI-----NADASERRYSVDEVGKTLVTDKDGLSYGAYVLQH  389
            A NL+R+LRMLTSYG+F EH+     +  + +R++S+ E+GKTLVTD++GLSYG Y+LQH
Sbjct  74   AENLQRILRMLTSYGVFEEHLIKEDDDGGSQQRKFSLTEIGKTLVTDQNGLSYGPYILQH  133

Query  390  HQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKA  569
            HQ  +M AWP+VHEAVVD ++EPFVK NGE  Y YYGK PEMN LMQ+AMSG+SVPFMKA
Sbjct  134  HQDVLMGAWPMVHEAVVDPTVEPFVKANGEPAYEYYGKKPEMNGLMQRAMSGVSVPFMKA  193

Query  570  FLDSYQGFKGVTRLVDV  620
             LD Y GF+GV RLVDV
Sbjct  194  ILDGYDGFEGVGRLVDV  210



>ref|XP_004488687.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cicer arietinum]
Length=353

 Score =   285 bits (730),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 159/193 (82%), Gaps = 2/193 (1%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  221
            ++S   ARL I+ELANMISVPMSL AV+RLNVADAIW+GGSNAPLSA +IL  VLP GGG
Sbjct  5    TDSRKQARLSILELANMISVPMSLNAVVRLNVADAIWEGGSNAPLSADQILKRVLPGGGG  64

Query  222  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  401
            DA NL+R+LRMLTSY +F EH+     ER+YS+ +VGKTLVTD+ GLSYG+YVLQHHQ A
Sbjct  65   DAENLQRVLRMLTSYDVFEEHLGG--GERKYSLTDVGKTLVTDEQGLSYGSYVLQHHQDA  122

Query  402  MMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDS  581
            +M+AWPLVHEAVVD S EPF + NGEA Y YY K PEMN LM KAMSG+SVPFMKA L S
Sbjct  123  LMRAWPLVHEAVVDPSKEPFERANGEAAYDYYLKKPEMNELMLKAMSGVSVPFMKALLAS  182

Query  582  YQGFKGVTRLVDV  620
            Y GF+GV +LVDV
Sbjct  183  YNGFQGVEKLVDV  195



>emb|CAN65776.1| hypothetical protein VITISV_030414 [Vitis vinifera]
Length=358

 Score =   285 bits (729),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 159/196 (81%), Gaps = 6/196 (3%)
 Frame = +3

Query  45   ESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGD  224
            ES N ARL I+EL NMISVPM L A++RLNV DAIWQGGSNAPLSAS+IL+ VLPSG  D
Sbjct  7    ESRNQARLAILELTNMISVPMCLHAIVRLNVPDAIWQGGSNAPLSASQILTRVLPSG--D  64

Query  225  APNLERLLRMLTSYGIFREHINADASE----RRYSVDEVGKTLVTDKDGLSYGAYVLQHH  392
              NL+R+LR+LT+YG+F EH+  D S     R+YS+ ++GKTLVTD DGLSYGAYVLQH+
Sbjct  65   PHNLQRILRLLTTYGVFAEHLLTDPSSDQVLRKYSLTDIGKTLVTDADGLSYGAYVLQHY  124

Query  393  QAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAF  572
            Q  +M AWPLVHEAVVDS+ EPFVK NGE  YSYYGK PEMN LMQ+AMSG+SVPFMKA 
Sbjct  125  QEELMTAWPLVHEAVVDSTTEPFVKANGEPAYSYYGKKPEMNDLMQRAMSGVSVPFMKAI  184

Query  573  LDSYQGFKGVTRLVDV  620
            L+ Y GF GV RLVDV
Sbjct  185  LNGYSGFDGVQRLVDV  200



>ref|XP_002264566.1| PREDICTED: caffeic acid 3-O-methyltransferase [Vitis vinifera]
Length=358

 Score =   285 bits (729),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 159/196 (81%), Gaps = 6/196 (3%)
 Frame = +3

Query  45   ESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGD  224
            ES N ARL I+EL NMISVPM L A++RLNV DAIWQGGSNAPLSAS+IL+ VLPSG  D
Sbjct  7    ESRNQARLAILELTNMISVPMCLHAIVRLNVPDAIWQGGSNAPLSASQILTRVLPSG--D  64

Query  225  APNLERLLRMLTSYGIFREHINADASE----RRYSVDEVGKTLVTDKDGLSYGAYVLQHH  392
              NL+R+LR+LT+YG+F EH+  D S     R+YS+ ++GKTLVTD DGLSYGAYVLQH+
Sbjct  65   PHNLQRILRLLTTYGVFAEHLLTDPSSDQVLRKYSLTDIGKTLVTDADGLSYGAYVLQHY  124

Query  393  QAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAF  572
            Q  +M AWPLVHEAVVDS+ EPFVK NGE  YSYYGK PEMN LMQ+AMSG+SVPFMKA 
Sbjct  125  QEELMTAWPLVHEAVVDSTTEPFVKANGEPAYSYYGKKPEMNDLMQRAMSGVSVPFMKAI  184

Query  573  LDSYQGFKGVTRLVDV  620
            L+ Y GF GV RLVDV
Sbjct  185  LNGYNGFDGVQRLVDV  200



>ref|XP_006367254.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Solanum tuberosum]
Length=361

 Score =   285 bits (729),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 137/188 (73%), Positives = 160/188 (85%), Gaps = 1/188 (1%)
 Frame = +3

Query  60   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVL-PSGGGDAPNL  236
            ARL IMELANMISVPMSL AV++L VADAIWQ GSNAPLS  EIL+ +  P GGGDA NL
Sbjct  15   ARLAIMELANMISVPMSLNAVVKLKVADAIWQNGSNAPLSPVEILAKIRGPQGGGDAENL  74

Query  237  ERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAW  416
            +R+LRMLTSYG+F+EH+  D+S+RRYS+ EVGKTLVTD++GLS+G+YVLQHHQ A+M+AW
Sbjct  75   QRILRMLTSYGVFKEHVVDDSSQRRYSLTEVGKTLVTDENGLSHGSYVLQHHQDALMRAW  134

Query  417  PLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQGFK  596
             +VHEAV DSSIEPFVK NGE  Y+YYGKN EMNSLM  AMSG+SVPFMKA L+ Y GF+
Sbjct  135  TMVHEAVNDSSIEPFVKANGEPAYNYYGKNSEMNSLMLNAMSGVSVPFMKAILEGYDGFQ  194

Query  597  GVTRLVDV  620
            GV  LVDV
Sbjct  195  GVKTLVDV  202



>ref|XP_006381360.1| hypothetical protein POPTR_0006s12160g [Populus trichocarpa]
 gb|ERP59157.1| hypothetical protein POPTR_0006s12160g [Populus trichocarpa]
Length=270

 Score =   280 bits (716),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 156/200 (78%), Gaps = 8/200 (4%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  221
            +E    ARL I ELANMISVPMSL A++RL VADAIWQGGSNAPLSAS+IL  +  S G 
Sbjct  8    AEKRKSARLAIFELANMISVPMSLNAIVRLKVADAIWQGGSNAPLSASQILQRIA-STGS  66

Query  222  DAPNLERLLRMLTSYGIFREHINADAS-------ERRYSVDEVGKTLVTDKDGLSYGAYV  380
            D  NL+R+LRMLTSYG+F EH+  ++S       ER+YS+ EVGKTLVTD +GLSY  YV
Sbjct  67   DPENLQRILRMLTSYGVFEEHLTIESSPLDGSVSERKYSLTEVGKTLVTDTEGLSYAPYV  126

Query  381  LQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPF  560
            LQHHQ A+MKAWPLVHEAV+D + EPFVK NGE  Y YYGK PEMN LM KAMSG+SVPF
Sbjct  127  LQHHQDALMKAWPLVHEAVLDPTTEPFVKANGEPAYDYYGKQPEMNELMLKAMSGVSVPF  186

Query  561  MKAFLDSYQGFKGVTRLVDV  620
            M+A LD Y GFKGV RLVDV
Sbjct  187  MEAMLDGYDGFKGVERLVDV  206



>ref|XP_010050337.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Eucalyptus 
grandis]
Length=360

 Score =   282 bits (722),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 160/197 (81%), Gaps = 4/197 (2%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  221
            S++ N ARLRI+ELANMISVPMSL AV+RL V DA+WQGGSNAPLSASEIL+    +  G
Sbjct  6    SDARNAARLRILELANMISVPMSLNAVVRLGVPDALWQGGSNAPLSASEILARSPAAPAG  65

Query  222  DAPNLERLLRMLTSYGIFREHINADAS----ERRYSVDEVGKTLVTDKDGLSYGAYVLQH  389
            DA NL+RLLRML S+G+F EH+   AS    ERRYS+ EVGKTLVTD +GLSY  YVLQH
Sbjct  66   DAENLQRLLRMLASHGVFEEHVAPAASSASSERRYSLTEVGKTLVTDAEGLSYAPYVLQH  125

Query  390  HQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKA  569
            HQ A+M+AWPLVHEAV+D + EPFVK NG+  Y++YGKNPEMN LMQ+AMSG+SVPFMKA
Sbjct  126  HQDALMRAWPLVHEAVLDPATEPFVKANGDTAYAHYGKNPEMNKLMQRAMSGVSVPFMKA  185

Query  570  FLDSYQGFKGVTRLVDV  620
             LD Y GF GV RLVDV
Sbjct  186  ILDGYDGFSGVGRLVDV  202



>ref|XP_006367255.1| PREDICTED: caffeic acid 3-O-methyltransferase 2-like [Solanum 
tuberosum]
Length=360

 Score =   281 bits (720),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 156/187 (83%), Gaps = 0/187 (0%)
 Frame = +3

Query  60   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLE  239
            ARL IMELANMISVPMSL A+I+L VADAIW+GGSNAPLS +EIL+ + P GGGDA NL+
Sbjct  16   ARLAIMELANMISVPMSLNAIIKLKVADAIWEGGSNAPLSPAEILAKIRPQGGGDAENLQ  75

Query  240  RLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWP  419
            R+LRMLTSY +F EH+  D S+RRYS+ EVGKTLVTD++GLS+G YVLQHHQ A+M+ W 
Sbjct  76   RILRMLTSYRVFEEHVVDDGSQRRYSLTEVGKTLVTDENGLSHGLYVLQHHQDALMRVWT  135

Query  420  LVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQGFKG  599
            +VHE V DSS +PFVKV GE PYSYYGKNPEMNSLM  AMSG+S+PFMK  L+ Y GF+G
Sbjct  136  MVHETVNDSSSDPFVKVYGEQPYSYYGKNPEMNSLMFNAMSGVSMPFMKVMLERYDGFEG  195

Query  600  VTRLVDV  620
            V  LVDV
Sbjct  196  VKTLVDV  202



>ref|XP_011018830.1| PREDICTED: caffeic acid 3-O-methyltransferase [Populus euphratica]
Length=364

 Score =   281 bits (719),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 157/200 (79%), Gaps = 8/200 (4%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  221
            +E    ARL I+ELANMISVPMSL A++RL VADAIWQGGSNAPLSAS+IL  +  S G 
Sbjct  8    AEKRKSARLAILELANMISVPMSLNAIVRLKVADAIWQGGSNAPLSASQILQRI-ASTGS  66

Query  222  DAPNLERLLRMLTSYGIFREHI-------NADASERRYSVDEVGKTLVTDKDGLSYGAYV  380
            D  NL+R+LRMLTSYG+F EH+       +  ASER+YS+ EVGKTLVTD +GLSY  YV
Sbjct  67   DPENLQRILRMLTSYGVFEEHLTNESSPLDGSASERKYSLTEVGKTLVTDTEGLSYAPYV  126

Query  381  LQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPF  560
            LQHHQ A+MKAWPLVHEAV+D + EPFVK NGE  Y YYGK PEMN LM KAMSG+SVPF
Sbjct  127  LQHHQDALMKAWPLVHEAVLDPTTEPFVKANGEPAYDYYGKQPEMNELMLKAMSGVSVPF  186

Query  561  MKAFLDSYQGFKGVTRLVDV  620
            M+A LD Y GFKGV RLVDV
Sbjct  187  MEAMLDGYDGFKGVERLVDV  206



>gb|AFK33955.1| unknown [Medicago truncatula]
Length=201

 Score =   275 bits (702),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 158/193 (82%), Gaps = 2/193 (1%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  221
            +E+   ARL I+ELANMIS+PMSL AV+RLNVADAIW+GG+NAPLSA++IL+ V+P GGG
Sbjct  6    TEAQKQARLAILELANMISIPMSLHAVVRLNVADAIWEGGANAPLSAAQILARVVPGGGG  65

Query  222  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  401
            DA NL+R+LRML SYG+F EHI     ER+YS+  VGKTLV+D++G+SYGAYVLQ HQ A
Sbjct  66   DAENLQRVLRMLASYGVFEEHIGD--GERKYSLTNVGKTLVSDENGVSYGAYVLQLHQDA  123

Query  402  MMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDS  581
            +M+AWPLVHEAV+D S EPF + NGE  Y YY K PEMN LM KAM+G+SVPFMKA  +S
Sbjct  124  LMRAWPLVHEAVLDPSKEPFERANGEGAYDYYLKKPEMNELMLKAMAGVSVPFMKALFES  183

Query  582  YQGFKGVTRLVDV  620
            Y GF+ V +LVDV
Sbjct  184  YHGFQNVEKLVDV  196



>ref|XP_006381361.1| hypothetical protein POPTR_0006s12160g [Populus trichocarpa]
 gb|ERP59158.1| hypothetical protein POPTR_0006s12160g [Populus trichocarpa]
Length=364

 Score =   279 bits (714),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 156/200 (78%), Gaps = 8/200 (4%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  221
            +E    ARL I ELANMISVPMSL A++RL VADAIWQGGSNAPLSAS+IL  +  S G 
Sbjct  8    AEKRKSARLAIFELANMISVPMSLNAIVRLKVADAIWQGGSNAPLSASQILQRI-ASTGS  66

Query  222  DAPNLERLLRMLTSYGIFREHINADAS-------ERRYSVDEVGKTLVTDKDGLSYGAYV  380
            D  NL+R+LRMLTSYG+F EH+  ++S       ER+YS+ EVGKTLVTD +GLSY  YV
Sbjct  67   DPENLQRILRMLTSYGVFEEHLTIESSPLDGSVSERKYSLTEVGKTLVTDTEGLSYAPYV  126

Query  381  LQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPF  560
            LQHHQ A+MKAWPLVHEAV+D + EPFVK NGE  Y YYGK PEMN LM KAMSG+SVPF
Sbjct  127  LQHHQDALMKAWPLVHEAVLDPTTEPFVKANGEPAYDYYGKQPEMNELMLKAMSGVSVPF  186

Query  561  MKAFLDSYQGFKGVTRLVDV  620
            M+A LD Y GFKGV RLVDV
Sbjct  187  MEAMLDGYDGFKGVERLVDV  206



>ref|XP_010267318.1| PREDICTED: caffeic acid 3-O-methyltransferase [Nelumbo nucifera]
Length=354

 Score =   279 bits (713),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 155/193 (80%), Gaps = 2/193 (1%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  221
            +E  N ARL I+ELANMISVPMSL A++RL V DAIWQ GSN PLSASEIL+  LP+G  
Sbjct  6    TEIRNNARLAILELANMISVPMSLNAIVRLKVPDAIWQSGSNVPLSASEILARALPTG--  63

Query  222  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  401
            D  NL+R+LRMLT+Y +F EHI   +SER+YS+ E+GKTLVTD +GLSY AYVLQHHQ A
Sbjct  64   DPENLQRILRMLTTYDVFSEHIADGSSERKYSLTEIGKTLVTDGEGLSYAAYVLQHHQDA  123

Query  402  MMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDS  581
            +MKAWP++HEAVVD   EPFVK NGE  YSYYG   EMN LMQKAMSG+SVPFMKA L+ 
Sbjct  124  LMKAWPILHEAVVDPKEEPFVKANGEPAYSYYGDKSEMNELMQKAMSGVSVPFMKAILEG  183

Query  582  YQGFKGVTRLVDV  620
            Y GFKGV RLVDV
Sbjct  184  YNGFKGVERLVDV  196



>ref|XP_006594705.1| PREDICTED: caffeic acid 3-O-methyltransferase-like isoform X2 
[Glycine max]
Length=298

 Score =   276 bits (706),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 159/193 (82%), Gaps = 2/193 (1%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  221
            +E    ARL IMELANMISVPM+L AV+RLNVADAIWQGG+N PLSA+EIL  +LP+GGG
Sbjct  7    TEQRKQARLAIMELANMISVPMALNAVVRLNVADAIWQGGANNPLSAAEILPRLLPAGGG  66

Query  222  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  401
            DA NL+RLLRML SYG+F EH++A   ER+YS+ +VGKTLVTD+ GLSY  YVLQHHQ A
Sbjct  67   DAENLQRLLRMLASYGVFYEHLSA--GERKYSLTDVGKTLVTDEQGLSYAHYVLQHHQDA  124

Query  402  MMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDS  581
            +M+AWP+VHEAVVD + EPF + NGE  Y YY K+PEMN LM +AMSG+SVPF++A L+ 
Sbjct  125  LMRAWPMVHEAVVDPTKEPFERANGEPAYGYYLKHPEMNDLMVRAMSGVSVPFIRAMLEG  184

Query  582  YQGFKGVTRLVDV  620
            Y GF+GV +LVDV
Sbjct  185  YDGFQGVEKLVDV  197



>gb|KEH38506.1| caffeic acid O-methyltransferase [Medicago truncatula]
Length=354

 Score =   278 bits (710),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 159/193 (82%), Gaps = 2/193 (1%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  221
            +E+   ARL I+ELANMIS+PMSL AV+RLNVADAIW+GG+NAPLSA++IL+ V+P GGG
Sbjct  6    TEAQKQARLAILELANMISIPMSLHAVVRLNVADAIWEGGANAPLSAAQILARVVPGGGG  65

Query  222  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  401
            DA NL+R+LRML SYG+F EHI     ER+YS+  VGKTLV+D++G+SYGAYVLQHHQ A
Sbjct  66   DAENLQRVLRMLASYGVFEEHIGD--GERKYSLTNVGKTLVSDENGVSYGAYVLQHHQDA  123

Query  402  MMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDS  581
            +M+AWPLVHEAV+D S EPF + NGE  Y YY K PEMN LM KAM+G+SVPFMKA  +S
Sbjct  124  LMRAWPLVHEAVLDPSKEPFERANGEGAYDYYLKKPEMNELMLKAMAGVSVPFMKALFES  183

Query  582  YQGFKGVTRLVDV  620
            Y GF+ V +LVDV
Sbjct  184  YHGFQNVEKLVDV  196



>ref|XP_002519426.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF42840.1| o-methyltransferase, putative [Ricinus communis]
Length=357

 Score =   277 bits (708),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 135/195 (69%), Positives = 161/195 (83%), Gaps = 3/195 (2%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  221
            SE+   A+L I+ELANMISVPMSL AV++LNVADAIWQ G N+PLSASEILS +  SGG 
Sbjct  6    SETRKNAKLAIIELANMISVPMSLNAVVQLNVADAIWQNGVNSPLSASEILSRINLSGG-  64

Query  222  DAPNLERLLRMLTSYGIFREHINA--DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            D  NL+R+LRML+SY +F EH++A    +ERRYS+ E+GKTLVTD +GLSYGAYVLQHHQ
Sbjct  65   DPDNLQRILRMLSSYNVFTEHLSAVDGVTERRYSLTEIGKTLVTDVNGLSYGAYVLQHHQ  124

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
             A+M+AWPLVHEAV+DS+ EPF K NGE  Y YYGK PEMN LMQKAMSG+SVPFMKA L
Sbjct  125  DALMRAWPLVHEAVLDSTTEPFAKANGEPAYDYYGKRPEMNELMQKAMSGLSVPFMKAVL  184

Query  576  DSYQGFKGVTRLVDV  620
            + Y GF+GV ++VDV
Sbjct  185  NGYDGFQGVEKIVDV  199



>ref|XP_006594704.1| PREDICTED: caffeic acid 3-O-methyltransferase-like isoform X1 
[Glycine max]
Length=355

 Score =   276 bits (707),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 159/193 (82%), Gaps = 2/193 (1%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  221
            +E    ARL IMELANMISVPM+L AV+RLNVADAIWQGG+N PLSA+EIL  +LP+GGG
Sbjct  7    TEQRKQARLAIMELANMISVPMALNAVVRLNVADAIWQGGANNPLSAAEILPRLLPAGGG  66

Query  222  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  401
            DA NL+RLLRML SYG+F EH++A   ER+YS+ +VGKTLVTD+ GLSY  YVLQHHQ A
Sbjct  67   DAENLQRLLRMLASYGVFYEHLSA--GERKYSLTDVGKTLVTDEQGLSYAHYVLQHHQDA  124

Query  402  MMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDS  581
            +M+AWP+VHEAVVD + EPF + NGE  Y YY K+PEMN LM +AMSG+SVPF++A L+ 
Sbjct  125  LMRAWPMVHEAVVDPTKEPFERANGEPAYGYYLKHPEMNDLMVRAMSGVSVPFIRAMLEG  184

Query  582  YQGFKGVTRLVDV  620
            Y GF+GV +LVDV
Sbjct  185  YDGFQGVEKLVDV  197



>ref|XP_010312333.1| PREDICTED: caffeic acid 3-O-methyltransferase 1 [Solanum lycopersicum]
Length=361

 Score =   275 bits (704),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 156/187 (83%), Gaps = 2/187 (1%)
 Frame = +3

Query  63   RLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVL-PSGGGDAPNLE  239
            RL IMELANMISVPMSL AV++L V DA+W+ GSNAPLS  EIL+ +  P GGGDA NL+
Sbjct  17   RLAIMELANMISVPMSLNAVVKLKVTDAVWENGSNAPLSPVEILAKIRGPQGGGDAENLQ  76

Query  240  RLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWP  419
            R+LRMLTSYG+F+EH++ D S+RRYS+ +VGKTLVTD++GLS+G+YVLQHHQ A+MKAW 
Sbjct  77   RILRMLTSYGVFKEHVD-DGSQRRYSLTKVGKTLVTDENGLSHGSYVLQHHQDALMKAWT  135

Query  420  LVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQGFKG  599
            +VHEAV DSSIEPF K NGE  YSYYGKN EMNSLM  AMSG+SVPFMKA L  Y GF+G
Sbjct  136  MVHEAVNDSSIEPFAKANGEPAYSYYGKNSEMNSLMLNAMSGVSVPFMKAILQGYDGFQG  195

Query  600  VTRLVDV  620
            V  LVDV
Sbjct  196  VKTLVDV  202



>ref|XP_011098295.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Sesamum indicum]
Length=355

 Score =   273 bits (698),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 150/189 (79%), Gaps = 0/189 (0%)
 Frame = +3

Query  54   NGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPN  233
            N   L IMELAN++SVPMSL AVI+L V D IWQ GSN PLSA+EILS++     GDA N
Sbjct  7    NSPILAIMELANLVSVPMSLNAVIKLKVLDTIWQDGSNNPLSAAEILSAIALGPAGDAEN  66

Query  234  LERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKA  413
            L+R+LR+LTSYG+F EHI  D  ERRYS+ EVGK L  D++GLSY  Y+LQHHQ A+M A
Sbjct  67   LQRILRLLTSYGVFDEHIGKDGRERRYSLTEVGKALAADENGLSYAPYILQHHQDALMLA  126

Query  414  WPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQGF  593
            WP VHEAV+D S EPFVKV+GE PYSYYGKNPEMN LMQKAMSG+SVPFM+ FLD Y GF
Sbjct  127  WPRVHEAVLDPSSEPFVKVHGELPYSYYGKNPEMNLLMQKAMSGVSVPFMETFLDRYDGF  186

Query  594  KGVTRLVDV  620
            +GV  LVDV
Sbjct  187  QGVETLVDV  195



>ref|XP_007149437.1| hypothetical protein PHAVU_005G070300g [Phaseolus vulgaris]
 gb|ESW21431.1| hypothetical protein PHAVU_005G070300g [Phaseolus vulgaris]
Length=354

 Score =   273 bits (697),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 157/193 (81%), Gaps = 2/193 (1%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  221
            ++S   +RL IMELANMISVPM+L AV+RLNVADAIW GG+NAPLSA++IL  +LP G G
Sbjct  6    TDSRKQSRLAIMELANMISVPMALNAVVRLNVADAIWNGGANAPLSAAQILPRILPVGDG  65

Query  222  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  401
            DA NL+RLLR+LTSYG+F EH+ A   ER+YS+ +VGK LVTD+ GLSYGAYVLQHHQ A
Sbjct  66   DAENLQRLLRILTSYGVFHEHLAA--GERKYSLTDVGKALVTDEQGLSYGAYVLQHHQDA  123

Query  402  MMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDS  581
            +M+AW LVHEAVVD + EPF + NGE  Y+YY K  EMN LM KAMSG+SVPFM+A L+ 
Sbjct  124  LMRAWTLVHEAVVDPTKEPFERANGEGAYAYYLKQAEMNELMVKAMSGVSVPFMRAMLEG  183

Query  582  YQGFKGVTRLVDV  620
            Y GF+GV RLVDV
Sbjct  184  YDGFQGVERLVDV  196



>ref|XP_006291371.1| hypothetical protein CARUB_v10017511mg [Capsella rubella]
 gb|EOA24269.1| hypothetical protein CARUB_v10017511mg [Capsella rubella]
Length=359

 Score =   272 bits (696),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 136/197 (69%), Positives = 159/197 (81%), Gaps = 5/197 (3%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVL-PSG-  215
            SES N ARL IMELANMISVPMSL A +RL +ADAIW GG+N+PLSASEIL  +L PS  
Sbjct  6    SESRNRARLAIMELANMISVPMSLNAAVRLGIADAIWNGGANSPLSASEILPRLLIPSAT  65

Query  216  --GGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQH  389
              GGD  NL+R+LRMLTSYG+F EH+   +SER++S+ +VGKTLVTD DGLSY AY+LQH
Sbjct  66   TTGGDPENLQRILRMLTSYGVFSEHL-VGSSERKFSLTDVGKTLVTDSDGLSYAAYILQH  124

Query  390  HQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKA  569
            HQ A+M+AWPLVH AVV+   EP+VK NGEA Y  YGK+ EMNSLM KAMSG+SVPFMKA
Sbjct  125  HQEALMRAWPLVHTAVVEPETEPYVKANGEAAYVQYGKSEEMNSLMLKAMSGVSVPFMKA  184

Query  570  FLDSYQGFKGVTRLVDV  620
             L+ Y+GFK V RLVDV
Sbjct  185  ILEGYEGFKSVERLVDV  201



>ref|XP_010426946.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Camelina 
sativa]
Length=356

 Score =   271 bits (692),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/194 (69%), Positives = 155/194 (80%), Gaps = 2/194 (1%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVL-PSGG  218
            SES N ARL I+ELANMISVPMSL A ++L +ADAIW  G+N+PLSA+EIL  +L PSGG
Sbjct  6    SESRNRARLAILELANMISVPMSLNAAVKLGIADAIWNDGTNSPLSAAEILPRLLLPSGG  65

Query  219  GDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQA  398
            GD  NL+R+LRMLTSYG+F EH+   ++ER+YS+ +VGKTLVTD  GLSY AYVLQHHQ 
Sbjct  66   GDPENLQRILRMLTSYGVFSEHL-VGSTERKYSLTDVGKTLVTDSGGLSYAAYVLQHHQD  124

Query  399  AMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLD  578
            A+M+AWPLVH AVV+   EP+VK NGE  Y  YGKN EMN LM KAMSG+SVPFMKA LD
Sbjct  125  ALMRAWPLVHTAVVEPETEPYVKANGEGAYVQYGKNEEMNGLMLKAMSGVSVPFMKAILD  184

Query  579  SYQGFKGVTRLVDV  620
             Y GFK V RLVDV
Sbjct  185  GYDGFKSVERLVDV  198



>ref|XP_006598126.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Glycine max]
Length=356

 Score =   271 bits (692),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 133/194 (69%), Positives = 154/194 (79%), Gaps = 3/194 (2%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLP-SGG  218
            +E    A L IMELANMISVPM+L AV+RLNVADA+WQGG+NAPLSASEIL  +LP + G
Sbjct  7    TEQRKQAMLAIMELANMISVPMALNAVVRLNVADALWQGGANAPLSASEILPRILPGADG  66

Query  219  GDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQA  398
             DA NL+RLLRML SYG+FREH+ A   ER YS+ EVGKTLVTD+ GLSY  YVLQHHQ 
Sbjct  67   ADAENLQRLLRMLASYGVFREHLAA--GERNYSLTEVGKTLVTDEQGLSYAHYVLQHHQD  124

Query  399  AMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLD  578
            A+M+AWPLVHEAVVD + EPF   NGE  Y YY K PEMN LM +AMSG+SVPFM+A L+
Sbjct  125  ALMRAWPLVHEAVVDPTKEPFEMANGEPAYGYYLKQPEMNDLMVRAMSGVSVPFMRAMLE  184

Query  579  SYQGFKGVTRLVDV  620
             Y GF+GV +LVDV
Sbjct  185  GYDGFQGVEKLVDV  198



>ref|XP_010504072.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Camelina 
sativa]
Length=385

 Score =   271 bits (692),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 135/207 (65%), Positives = 161/207 (78%), Gaps = 2/207 (1%)
 Frame = +3

Query  3    QITGKLKE-IGAMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLS  179
            +IT K K+ +    SES N ARL I+ELANMISVPMSL A ++L +ADAIW GG+N+PLS
Sbjct  22   KITNKQKKKMEKESSESRNRARLAILELANMISVPMSLNAAVKLGIADAIWNGGANSPLS  81

Query  180  ASEILSSVLPSGGGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDG  359
            A+EILS +L   GGD  NL+R+LR LTSYG+F EH+   ++ER+YS+ +VGKTLVTD  G
Sbjct  82   AAEILSRLLLQSGGDPENLQRILRTLTSYGVFSEHL-VGSTERKYSLTDVGKTLVTDSGG  140

Query  360  LSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAM  539
            LSY AYVLQHHQ A+M+AWPLVH AVV+   EP+VK NGEA Y  YGKN EMN LM KAM
Sbjct  141  LSYAAYVLQHHQDALMRAWPLVHTAVVEPETEPYVKANGEAAYVQYGKNEEMNDLMLKAM  200

Query  540  SGISVPFMKAFLDSYQGFKGVTRLVDV  620
            SG+SVPFMKA L+ Y GFK V RLVDV
Sbjct  201  SGVSVPFMKAILEGYDGFKSVERLVDV  227



>ref|XP_006403721.1| hypothetical protein EUTSA_v10010488mg [Eutrema salsugineum]
 gb|ESQ45174.1| hypothetical protein EUTSA_v10010488mg [Eutrema salsugineum]
Length=361

 Score =   269 bits (687),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 152/198 (77%), Gaps = 5/198 (3%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSG--  215
            SES N ARL IMELANMISVPMSL A ++L +ADAIW  G+N+PLSA+EIL  +L S   
Sbjct  6    SESRNKARLAIMELANMISVPMSLNAAVKLGIADAIWNAGANSPLSAAEILPRLLLSSST  65

Query  216  ---GGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQ  386
                GD  NL+R+LRMLTSYG+F EHIN  + ER+YS+ +VGKTLVTD  GLSY AYVLQ
Sbjct  66   TTIAGDPENLQRILRMLTSYGVFSEHINGSSVERKYSLTDVGKTLVTDSGGLSYAAYVLQ  125

Query  387  HHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMK  566
            HHQ A+M+AWPLVH AV++   EP+VK NGEA YS YGK  EMN LMQKAMSG+S PFMK
Sbjct  126  HHQEALMRAWPLVHTAVMEPETEPYVKANGEAAYSQYGKCEEMNGLMQKAMSGVSAPFMK  185

Query  567  AFLDSYQGFKGVTRLVDV  620
            A LD Y GFK V  LVDV
Sbjct  186  AILDGYDGFKSVEHLVDV  203



>ref|XP_006391885.1| hypothetical protein EUTSA_v10023542mg [Eutrema salsugineum]
 gb|ESQ29171.1| hypothetical protein EUTSA_v10023542mg [Eutrema salsugineum]
Length=363

 Score =   269 bits (687),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 154/200 (77%), Gaps = 7/200 (4%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVL-PSG-  215
            SES N ARL IMELANMISVPMSL A +RL +ADAIW  G+N+PLSASEIL  +L PS  
Sbjct  6    SESRNKARLAIMELANMISVPMSLNAAVRLGIADAIWNSGANSPLSASEILPRLLLPSRD  65

Query  216  ---GGDAPNLERLLRMLTSYGIFREHINADAS--ERRYSVDEVGKTLVTDKDGLSYGAYV  380
               GGD  NL+R+LRMLTSYG+F EH+N DA   ER+YS+  VGKTLVTD  GLSY AYV
Sbjct  66   STIGGDPENLQRILRMLTSYGVFSEHLNGDAGSVERKYSLTNVGKTLVTDSGGLSYAAYV  125

Query  381  LQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPF  560
            LQHHQ ++M+AWPLVH AVV+   EP+VK NGEA Y  YGK  EMN LMQKAMSG+SVPF
Sbjct  126  LQHHQESLMRAWPLVHTAVVEPETEPYVKANGEAAYVQYGKCEEMNGLMQKAMSGVSVPF  185

Query  561  MKAFLDSYQGFKGVTRLVDV  620
            MKA LD Y GFK V  LVDV
Sbjct  186  MKAILDGYDGFKSVEHLVDV  205



>ref|XP_010098845.1| Caffeic acid 3-O-methyltransferase [Morus notabilis]
 gb|EXB75933.1| Caffeic acid 3-O-methyltransferase [Morus notabilis]
Length=359

 Score =   268 bits (685),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 155/198 (78%), Gaps = 7/198 (4%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  221
            SE  N ARL+++ELANMISVPMSL AV+RL V DAIWQ GSN+PLSAS+IL+ VLPS   
Sbjct  6    SEKRNQARLKVLELANMISVPMSLNAVVRLGVPDAIWQSGSNSPLSASQILTRVLPSSSS  65

Query  222  -----DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQ  386
                 D  NL+RLLR LTSYG+F EHI+ +   R+YS+ +VGKTLVTD DGLSY  YVLQ
Sbjct  66   SAASADPDNLQRLLRTLTSYGVFSEHISGEI--RKYSLTDVGKTLVTDSDGLSYAPYVLQ  123

Query  387  HHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMK  566
            HHQ A+M+AW L+HEAVVD + EPF K NGE  Y YYGK PEMN LMQ+AMSG+SVPFMK
Sbjct  124  HHQDALMRAWSLLHEAVVDPTTEPFAKANGEPAYKYYGKMPEMNGLMQRAMSGVSVPFMK  183

Query  567  AFLDSYQGFKGVTRLVDV  620
            A L+ Y GF+GV RLVDV
Sbjct  184  AILNGYDGFEGVRRLVDV  201



>ref|XP_009617330.1| PREDICTED: flavone 3'-O-methyltransferase 1 [Nicotiana tomentosiformis]
Length=366

 Score =   268 bits (685),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 157/193 (81%), Gaps = 6/193 (3%)
 Frame = +3

Query  60   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPS------GGG  221
            ARL IMELANMISVPMSL A++RL VADAIW+GGSNAPLS +EILS +  S      GGG
Sbjct  15   ARLAIMELANMISVPMSLNAIVRLKVADAIWEGGSNAPLSPTEILSKIRASEGGGGGGGG  74

Query  222  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  401
            DA NL+R+LRMLTSY +F EHI  D S+RRYS+ EVGKTLVTD++GLSYG+YVLQHHQ A
Sbjct  75   DAENLQRILRMLTSYDVFAEHIVDDGSQRRYSLTEVGKTLVTDENGLSYGSYVLQHHQDA  134

Query  402  MMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDS  581
            +M AW +V EAV DSS EPF K NGE  Y+YYGK PEMN+LM  AMSG+SVPFMKA L+S
Sbjct  135  LMSAWTMVDEAVNDSSTEPFAKANGEPAYNYYGKRPEMNNLMLNAMSGVSVPFMKAILES  194

Query  582  YQGFKGVTRLVDV  620
            Y+GF+GV  LVDV
Sbjct  195  YEGFQGVKILVDV  207



>ref|NP_190882.1| putative O-diphenol-O-methyl transferase [Arabidopsis thaliana]
 gb|AAK56277.1|AF367289_1 AT3g53140/T4D2_70 [Arabidopsis thaliana]
 emb|CAB64217.1| caffeic acid O-methyltransferase-like protein [Arabidopsis thaliana]
 gb|AAM91448.1| AT3g53140/T4D2_70 [Arabidopsis thaliana]
 gb|AEE79041.1| putative O-diphenol-O-methyl transferase [Arabidopsis thaliana]
Length=359

 Score =   266 bits (679),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 135/197 (69%), Positives = 156/197 (79%), Gaps = 5/197 (3%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSV-LPSG-  215
            SES N ARL IMELANMISVPMSL A +RL +ADAIW GG+N+PLSA+EIL  + LPS  
Sbjct  6    SESRNRARLAIMELANMISVPMSLNAAVRLGIADAIWNGGANSPLSAAEILPRLHLPSHT  65

Query  216  --GGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQH  389
              GGD  NL+R+LRMLTSYG+F EH+   + ER+YS+ +VGKTLVTD  GLSY AYVLQH
Sbjct  66   TIGGDPENLQRILRMLTSYGVFSEHL-VGSIERKYSLTDVGKTLVTDSGGLSYAAYVLQH  124

Query  390  HQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKA  569
            HQ A+M+AWPLVH AVV+   EP+VK NGEA Y+ YGK+ EMN LMQKAMSG+SVPFMKA
Sbjct  125  HQEALMRAWPLVHTAVVEPETEPYVKANGEAAYAQYGKSEEMNGLMQKAMSGVSVPFMKA  184

Query  570  FLDSYQGFKGVTRLVDV  620
             LD Y GFK V  LVDV
Sbjct  185  ILDGYDGFKSVDILVDV  201



>ref|XP_010515802.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Camelina 
sativa]
Length=355

 Score =   265 bits (678),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 127/193 (66%), Positives = 154/193 (80%), Gaps = 1/193 (1%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  221
            SES N ARL I+ELANMISVPMSL A ++L +ADA+W GG+N+PLSA+EIL+ +L   GG
Sbjct  6    SESRNRARLAILELANMISVPMSLNAAVKLGIADAVWNGGTNSPLSAAEILTRLLLPSGG  65

Query  222  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  401
            D  NL+R+LRMLTSYG+F EH+   ++ER+YS+ +VGKTLVTD  GLSY AYVLQHHQ A
Sbjct  66   DPENLQRILRMLTSYGVFSEHL-VGSTERKYSLTDVGKTLVTDSGGLSYAAYVLQHHQDA  124

Query  402  MMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDS  581
            +M+AWPLVH AVV+   EP+VK N EA Y  YGKN EMN LM KAMSG+SVPFMKA L+ 
Sbjct  125  LMRAWPLVHTAVVEPETEPYVKANSEAAYVQYGKNEEMNDLMLKAMSGVSVPFMKAILEG  184

Query  582  YQGFKGVTRLVDV  620
            Y GFK V +L+DV
Sbjct  185  YDGFKSVEQLIDV  197



>ref|XP_009774776.1| PREDICTED: caffeic acid 3-O-methyltransferase [Nicotiana sylvestris]
Length=252

 Score =   261 bits (668),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 152/193 (79%), Gaps = 6/193 (3%)
 Frame = +3

Query  60   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAP---  230
            ARL IMELANMISVPMSL AV+RL VADAIW+GGSNAPLS +EIL+ +  S GG      
Sbjct  15   ARLAIMELANMISVPMSLNAVVRLKVADAIWEGGSNAPLSPTEILAKISGSEGGGGAGGG  74

Query  231  ---NLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  401
               NL+R+LRMLTSY +F EHI  D  +RRYS+ EVGKTLVTDK+GLSYG+Y+LQHHQ A
Sbjct  75   DAENLQRILRMLTSYDVFAEHIVDDGPQRRYSLTEVGKTLVTDKNGLSYGSYILQHHQDA  134

Query  402  MMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDS  581
            +M AW +V EAV DSS EPF K NGE  Y+YYGK PEMN+LM  AMSG+SVPFMKA L+S
Sbjct  135  LMSAWTMVDEAVNDSSTEPFAKANGEPAYNYYGKKPEMNNLMLNAMSGVSVPFMKAILES  194

Query  582  YQGFKGVTRLVDV  620
            Y GF+GV  LVDV
Sbjct  195  YNGFQGVKTLVDV  207



>emb|CDX76223.1| BnaA04g04870D [Brassica napus]
Length=268

 Score =   260 bits (664),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 152/198 (77%), Gaps = 7/198 (4%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSV---LPS  212
            SES N ARL IMELANMISVPMSL A +RL +ADAIW  G N+PLSA+EIL  +     +
Sbjct  6    SESRNKARLAIMELANMISVPMSLNAAVRLGLADAIWNDGDNSPLSATEILPRLHLTYQN  65

Query  213  G--GGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQ  386
            G  GGD  NL+R+LRMLTSYG+F EH+    + R+YS+ +VGKTLVTD DGLSY AYVLQ
Sbjct  66   GTIGGDPENLQRILRMLTSYGVFSEHLTN--AGRKYSITDVGKTLVTDSDGLSYAAYVLQ  123

Query  387  HHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMK  566
            HHQ A+M+AWPLVH AVV+   EP+VK NGEA Y+ YGK  EMN LMQKAMSG+SVPFMK
Sbjct  124  HHQEALMRAWPLVHTAVVEPETEPYVKANGEAAYAQYGKCEEMNGLMQKAMSGVSVPFMK  183

Query  567  AFLDSYQGFKGVTRLVDV  620
            A LD Y GFK V  LVDV
Sbjct  184  AILDGYDGFKYVEHLVDV  201



>ref|XP_010546519.1| PREDICTED: flavone 3'-O-methyltransferase 1 [Tarenaya hassleriana]
Length=354

 Score =   261 bits (668),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 152/193 (79%), Gaps = 2/193 (1%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  221
            SE  N ARL IMELANMISVPMSL A ++L VADAIW GG+N+P+SA+EILS     G G
Sbjct  6    SERRNRARLAIMELANMISVPMSLNAAVKLGVADAIWCGGANSPISAAEILSRCC-GGAG  64

Query  222  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  401
               NL+R+LRMLTSYG+F EH + D SER+YS+ +VGKTLVTD DGLSYG+YVLQHHQ A
Sbjct  65   GPENLQRILRMLTSYGVFSEHFSGD-SERKYSLTDVGKTLVTDSDGLSYGSYVLQHHQEA  123

Query  402  MMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDS  581
            +M+AWPLVH AV D + EP+VK NGE  Y+ YGK+ EMN LM +AMSG+SVPFM+A LD 
Sbjct  124  LMRAWPLVHTAVEDPTREPYVKANGEPAYAQYGKSEEMNGLMLRAMSGVSVPFMRAILDG  183

Query  582  YQGFKGVTRLVDV  620
            Y GFK V  LVDV
Sbjct  184  YDGFKSVEHLVDV  196



>ref|XP_009139429.1| PREDICTED: caffeic acid 3-O-methyltransferase [Brassica rapa]
Length=359

 Score =   259 bits (662),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 152/198 (77%), Gaps = 7/198 (4%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSV---LPS  212
            SES N ARL IMELANMISVPMSL A +RL +ADAIW  G N+PLSA+EIL  +     +
Sbjct  6    SESRNKARLAIMELANMISVPMSLNAAVRLGLADAIWNDGDNSPLSAAEILPRLHLTYQN  65

Query  213  G--GGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQ  386
            G  GGD  NL+R+LRMLTSYG+F EH+    + R+YS+ +VGKTLVTD DGLSY AYVLQ
Sbjct  66   GTIGGDPENLQRILRMLTSYGVFSEHLTN--AGRKYSITDVGKTLVTDSDGLSYAAYVLQ  123

Query  387  HHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMK  566
            HHQ A+M+AWPLVH AVV+   EP+VK NGEA Y+ YGK  EMN LMQKAMSG+SVPFMK
Sbjct  124  HHQEALMRAWPLVHTAVVEPETEPYVKANGEAAYAQYGKCEEMNGLMQKAMSGVSVPFMK  183

Query  567  AFLDSYQGFKGVTRLVDV  620
            A LD Y GFK V  LVDV
Sbjct  184  AILDGYDGFKYVEHLVDV  201



>emb|CDX95399.1| BnaC04g27590D [Brassica napus]
Length=359

 Score =   258 bits (659),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 152/198 (77%), Gaps = 7/198 (4%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSV---LPS  212
            SES N ARL IMELANMISVPMSL A +RL +ADAIW  G N+P+SA+EIL  +     +
Sbjct  6    SESRNKARLAIMELANMISVPMSLNAAVRLGLADAIWNDGDNSPVSAAEILPRLHLTYQN  65

Query  213  G--GGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQ  386
            G  GGD  NL+R+LRMLTSYG+F EH+    + R+YS+ +VGKTLVTD DGLSY AYVLQ
Sbjct  66   GTIGGDPENLQRILRMLTSYGVFSEHLTN--AGRKYSITDVGKTLVTDSDGLSYAAYVLQ  123

Query  387  HHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMK  566
            HHQ A+M+AWPLVH AVV+   EP+VK NGEA Y+ YGK  EMN LMQKAMSG+SVPFMK
Sbjct  124  HHQEALMRAWPLVHTAVVEPETEPYVKANGEAAYAQYGKCEEMNGLMQKAMSGVSVPFMK  183

Query  567  AFLDSYQGFKGVTRLVDV  620
            A LD Y GFK V  LVDV
Sbjct  184  AILDGYDGFKYVEHLVDV  201



>gb|KFK34550.1| hypothetical protein AALP_AA5G160800 [Arabis alpina]
Length=360

 Score =   258 bits (658),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 148/197 (75%), Gaps = 4/197 (2%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVL-PSGG  218
            SE  N ARL IMELANMISVPMSL A +RL +AD IW  G N+PLSA+EIL  +L PS  
Sbjct  6    SERRNKARLAIMELANMISVPMSLNAAVRLGIADVIWNDGENSPLSAAEILPRLLLPSDT  65

Query  219  ---GDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQH  389
               GD  NL+R+LRMLTSY +F EH+ A + ER+YS+ +VGKTLVTD  GLSY AYVLQH
Sbjct  66   TITGDPENLQRILRMLTSYDVFSEHLAAGSVERKYSLTDVGKTLVTDSGGLSYAAYVLQH  125

Query  390  HQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKA  569
            HQ A+M+AWPLVH AVV    EP++K NGE  Y+ YGK  EMN LMQKAMSG+SVPFMKA
Sbjct  126  HQEALMRAWPLVHTAVVQPETEPYMKANGETAYAQYGKCEEMNCLMQKAMSGVSVPFMKA  185

Query  570  FLDSYQGFKGVTRLVDV  620
             LD Y GFK V  LVDV
Sbjct  186  ILDGYDGFKSVDHLVDV  202



>ref|XP_011101457.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Sesamum indicum]
Length=360

 Score =   256 bits (654),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 130/201 (65%), Positives = 147/201 (73%), Gaps = 19/201 (9%)
 Frame = +3

Query  75   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLERLLRM  254
            MELAN++SVPMSL AVI+L V D IWQ G N PLSA+EILS+V      DA NL+R+LR+
Sbjct  1    MELANLVSVPMSLNAVIKLKVLDTIWQDGFNNPLSAAEILSAVAVGPHADAENLQRILRL  60

Query  255  LTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLVHEA  434
            LTSYG+F EHI  D S RRYS+ EVGK L TD++GLSY  YVLQHHQ A+M AWPLVHEA
Sbjct  61   LTSYGVFNEHIAGDGSGRRYSLTEVGKALATDENGLSYAPYVLQHHQDAIMLAWPLVHEA  120

Query  435  VVDSSIEPFVKV-------------------NGEAPYSYYGKNPEMNSLMQKAMSGISVP  557
            V+D S EPFVKV                   +GE PYSYYGK PEMN LMQKAMSG+SVP
Sbjct  121  VLDPSSEPFVKVHGELAYSYYGKYPEMNLLMHGELPYSYYGKYPEMNLLMQKAMSGVSVP  180

Query  558  FMKAFLDSYQGFKGVTRLVDV  620
            FMKAFLD Y GF+GV  LVDV
Sbjct  181  FMKAFLDGYDGFQGVETLVDV  201



>gb|KHN47498.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=337

 Score =   238 bits (606),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/193 (62%), Positives = 139/193 (72%), Gaps = 20/193 (10%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  221
            +E    A L IMELANMISVPM+L AV+RLNVADA+WQGG+NAPLSASEIL  +LP G  
Sbjct  7    TEQRKQAMLAIMELANMISVPMALNAVVRLNVADALWQGGANAPLSASEILPRILPGG--  64

Query  222  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  401
                            +FREH+ A   ER YS+ EVGKTLVTD+ GLSY  YVLQHHQ A
Sbjct  65   ----------------VFREHLAA--GERNYSLTEVGKTLVTDEQGLSYAHYVLQHHQDA  106

Query  402  MMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDS  581
            +M+AWPLVHEAVVD + EPF   NGE  Y YY K PEMN LM +AMSG+SVPFM+A L+ 
Sbjct  107  LMRAWPLVHEAVVDPTKEPFEMANGEPAYGYYLKQPEMNDLMVRAMSGVSVPFMRAMLEG  166

Query  582  YQGFKGVTRLVDV  620
            Y GF+GV +LVDV
Sbjct  167  YDGFQGVEKLVDV  179



>ref|XP_010271244.1| PREDICTED: uncharacterized protein LOC104607311 isoform X2 [Nelumbo 
nucifera]
Length=210

 Score =   231 bits (588),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 136/182 (75%), Gaps = 10/182 (5%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  221
            +E+ N ARL I+ELANMISVPMSL A++ L V DAIWQG SN PLSASE+L+ VLP+G  
Sbjct  6    TETRNNARLAILELANMISVPMSLNAIVCLKVPDAIWQGSSNIPLSASEVLAHVLPTGNS  65

Query  222  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  401
            +  NL R+LRM TSY +F EHI    SER+YS+ E+GK LVTD +GLSY  YVLQHHQ  
Sbjct  66   E--NLRRILRMFTSYDVFSEHIADGFSERKYSLTEIGKILVTDGEGLSYAVYVLQHHQDT  123

Query  402  MMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVP---FMKAF  572
            ++KAWPL HEAVVD   EPFVK N     +YYG  PEMN LMQKAMSG+SVP   FMKA 
Sbjct  124  LVKAWPLQHEAVVDLKEEPFVKAN-----AYYGDKPEMNELMQKAMSGVSVPFVLFMKAI  178

Query  573  LD  578
            ++
Sbjct  179  VE  180



>gb|AAP03058.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=375

 Score =   235 bits (600),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 152/203 (75%), Gaps = 11/203 (5%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSG--  215
            SE+ N ARL+I+ELAN+ISVPMSL A++RL V +AIW  GSN P+SA+EILS  LP    
Sbjct  16   SEARNNARLKIIELANLISVPMSLTAIVRLKVPEAIWSNGSNTPVSAAEILSR-LPDAPA  74

Query  216  GGDAPNLERLLRMLTSYGIFREHINADAS------ERRYSVDEVGKTLVT-DKDGLSYGA  374
              DA NL+RLLR+LTS+G+F EH++  +S      ERRY + EVG+TLV+ D+   S+GA
Sbjct  75   TADAENLQRLLRVLTSFGVFSEHLDTTSSSSSSTSERRYCLTEVGQTLVSFDESCPSHGA  134

Query  375  YVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISV  554
            YVLQHHQ  ++KAWP +H A++D+S EPF +VNGE  Y YYGKN E+N  MQ AMSG+SV
Sbjct  135  YVLQHHQETLLKAWPFLHTAILDASTEPFARVNGEPAYQYYGKNDELNKNMQYAMSGVSV  194

Query  555  PFMKAFLDS-YQGFKGVTRLVDV  620
            P+MKA L S Y GF+GV  LVDV
Sbjct  195  PYMKALLGSGYDGFEGVKTLVDV  217



>ref|XP_010271241.1| PREDICTED: uncharacterized protein LOC104607311 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010271242.1| PREDICTED: uncharacterized protein LOC104607311 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010271243.1| PREDICTED: uncharacterized protein LOC104607311 isoform X1 [Nelumbo 
nucifera]
Length=248

 Score =   230 bits (587),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 136/182 (75%), Gaps = 10/182 (5%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  221
            +E+ N ARL I+ELANMISVPMSL A++ L V DAIWQG SN PLSASE+L+ VLP+G  
Sbjct  6    TETRNNARLAILELANMISVPMSLNAIVCLKVPDAIWQGSSNIPLSASEVLAHVLPTGNS  65

Query  222  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  401
            +  NL R+LRM TSY +F EHI    SER+YS+ E+GK LVTD +GLSY  YVLQHHQ  
Sbjct  66   E--NLRRILRMFTSYDVFSEHIADGFSERKYSLTEIGKILVTDGEGLSYAVYVLQHHQDT  123

Query  402  MMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVP---FMKAF  572
            ++KAWPL HEAVVD   EPFVK N     +YYG  PEMN LMQKAMSG+SVP   FMKA 
Sbjct  124  LVKAWPLQHEAVVDLKEEPFVKAN-----AYYGDKPEMNELMQKAMSGVSVPFVLFMKAI  178

Query  573  LD  578
            ++
Sbjct  179  VE  180



>ref|XP_004502926.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cicer arietinum]
Length=361

 Score =   233 bits (595),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 146/186 (78%), Gaps = 1/186 (1%)
 Frame = +3

Query  63   RLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLER  242
            RL I+E+A+M+SVPMSL AV+ + V DAIWQGG+N PLSASEIL+ V P+GGGDA NL+R
Sbjct  19   RLAILEVAHMMSVPMSLVAVLNMKVPDAIWQGGNNTPLSASEILAVVRPNGGGDAENLQR  78

Query  243  LLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPL  422
            +LR+LT+Y IF E +N+   ER+YS+ +VGKTL+ D DGLSY AYVLQHHQ A+M+AW L
Sbjct  79   ILRLLTTYDIFDEQLNSKG-ERKYSLSDVGKTLIADADGLSYAAYVLQHHQEALMRAWAL  137

Query  423  VHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQGFKGV  602
            V EAV D ++EPF K NGE+  +YY K  ++ SL+  +++G+SVPFM+  L++Y GF+GV
Sbjct  138  VGEAVEDPTVEPFEKANGESAVAYYIKRADVMSLIYSSLAGMSVPFMREMLENYDGFQGV  197

Query  603  TRLVDV  620
              L DV
Sbjct  198  ETLADV  203



>gb|KDO38249.1| hypothetical protein CISIN_1g043063mg [Citrus sinensis]
Length=301

 Score =   225 bits (573),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 126/153 (82%), Gaps = 1/153 (1%)
 Frame = +3

Query  162  SNAPLSASEILSSVLPSGGGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTL  341
            +N PLSAS+IL+ +LPSGGGDA NL+R+LR+LT+YG+F EH      ER+YS+ E+GK+L
Sbjct  16   ANTPLSASQILTRILPSGGGDAENLQRILRLLTNYGVFSEH-REFGGERKYSLTEIGKSL  74

Query  342  VTDKDGLSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNS  521
            VTD +G SY  YVLQHHQ A+M AWPLVHEA++D +IEPFVKV+GE  YSYYGK PEMN 
Sbjct  75   VTDAEGQSYAPYVLQHHQDALMSAWPLVHEAILDPTIEPFVKVHGEPTYSYYGKMPEMNG  134

Query  522  LMQKAMSGISVPFMKAFLDSYQGFKGVTRLVDV  620
            LM+KAMSG+SVPFM + LD Y GFKGV RLVDV
Sbjct  135  LMRKAMSGVSVPFMTSILDGYDGFKGVKRLVDV  167



>ref|XP_006423903.1| hypothetical protein CICLE_v10029876mg [Citrus clementina]
 gb|ESR37143.1| hypothetical protein CICLE_v10029876mg [Citrus clementina]
Length=294

 Score =   223 bits (569),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 125/153 (82%), Gaps = 1/153 (1%)
 Frame = +3

Query  162  SNAPLSASEILSSVLPSGGGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTL  341
            +N PLS S+IL+ +LPSGGGDA NL+ +LR+LTSYG+F EH      ER+YS+ E+GK+L
Sbjct  16   ANTPLSVSQILTCILPSGGGDAENLQCILRLLTSYGVFSEH-REFRGERKYSLTEIGKSL  74

Query  342  VTDKDGLSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNS  521
            VTD +GLSY  YVLQHHQ A M AWPLVHEAV+D +IEPFVKV+GE  YSYYGK PEMN 
Sbjct  75   VTDAEGLSYAPYVLQHHQDAFMSAWPLVHEAVLDPTIEPFVKVHGEPAYSYYGKMPEMNG  134

Query  522  LMQKAMSGISVPFMKAFLDSYQGFKGVTRLVDV  620
            LM++A+SG+SVPFM + LDSY GFKGV RLVDV
Sbjct  135  LMRRAISGVSVPFMTSVLDSYNGFKGVKRLVDV  167



>ref|XP_003602597.1| Caffeic acid 3-O-methyltransferase [Medicago truncatula]
Length=358

 Score =   224 bits (572),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 146/192 (76%), Gaps = 1/192 (1%)
 Frame = +3

Query  45   ESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGD  224
            +S + ARL I+ELA+++SVP SL AV+++ V +AIWQGG+N PLSAS+ILS V P+GGGD
Sbjct  10   KSQSEARLAILELAHIMSVPTSLVAVLKMKVPEAIWQGGNNTPLSASQILSIVRPNGGGD  69

Query  225  APNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAM  404
            A NL+R+LR+LT+Y IF E ++++  +R+YS+ EVGK LV D DGLSYG YVLQH+Q   
Sbjct  70   AENLQRILRLLTTYAIFAEDLSSNG-KRKYSLTEVGKALVPDDDGLSYGTYVLQHYQDQY  128

Query  405  MKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSY  584
            ++AWPLV EAV D ++EPF K++GE  Y+Y  K P+  SL   +MSG+S+P M   L+ Y
Sbjct  129  LRAWPLVGEAVEDPTVEPFEKLHGEGAYAYCMKRPDEMSLFYASMSGMSMPHMNEMLEKY  188

Query  585  QGFKGVTRLVDV  620
             GFKGV  LVDV
Sbjct  189  DGFKGVESLVDV  200



>gb|KDO41959.1| hypothetical protein CISIN_1g021707mg [Citrus sinensis]
Length=309

 Score =   223 bits (567),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 125/153 (82%), Gaps = 1/153 (1%)
 Frame = +3

Query  162  SNAPLSASEILSSVLPSGGGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTL  341
            +N PLS S+IL+ +LPSGGGDA NL+ +LR+LTSYG+F EH      ER+YS+ E+GK+L
Sbjct  16   ANTPLSVSQILTCILPSGGGDAENLQCILRLLTSYGVFSEH-REFRGERKYSLTEIGKSL  74

Query  342  VTDKDGLSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNS  521
            VTD +GLSY  YVLQHHQ A M AWPLVHEAV+D +IEPFVKV+GE  YSYYGK PEMN 
Sbjct  75   VTDAEGLSYAPYVLQHHQDAFMSAWPLVHEAVLDPTIEPFVKVHGEPAYSYYGKMPEMNG  134

Query  522  LMQKAMSGISVPFMKAFLDSYQGFKGVTRLVDV  620
            LM++A+SG+SVPFM + LDSY GFKGV RLVDV
Sbjct  135  LMRRAISGVSVPFMTSVLDSYNGFKGVKRLVDV  167



>gb|AFK47565.1| unknown [Medicago truncatula]
Length=224

 Score =   217 bits (552),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 143/187 (76%), Gaps = 1/187 (1%)
 Frame = +3

Query  60   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLE  239
            ARL I+ELA+++SVP SL AV+++ V +AIWQGG N PLSAS+ILS V P+GGGDA NL+
Sbjct  15   ARLAILELAHIMSVPTSLNAVLKMKVPEAIWQGGKNTPLSASQILSIVRPNGGGDAENLQ  74

Query  240  RLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWP  419
            R+LR+LT+Y IF E ++++  ER+YS+ +VGK LV D  GL+  ++ +QHHQ   ++AWP
Sbjct  75   RILRLLTTYTIFVEDLSSNG-ERKYSLTDVGKALVPDDHGLTCASFFVQHHQDPYLRAWP  133

Query  420  LVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQGFKG  599
            LV +AV D ++EPF K++GEA Y+Y  K PE  SL   +MSG+S+P+M+  L++Y GFKG
Sbjct  134  LVGDAVEDPTVEPFEKLHGEAAYAYCTKGPEEMSLFYASMSGMSLPYMREMLENYDGFKG  193

Query  600  VTRLVDV  620
            V  LVDV
Sbjct  194  VETLVDV  200



>emb|CAB65279.1| O-diphenol-O-methyl transferase [Medicago sativa subsp. x varia]
Length=358

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 142/187 (76%), Gaps = 1/187 (1%)
 Frame = +3

Query  60   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLE  239
            ARL I+ELA+++SVP SL AV+++ V +AIWQGG N PLSAS+ILS V P+GGGDA NL+
Sbjct  15   ARLAILELAHIMSVPTSLVAVLKMKVPEAIWQGGKNTPLSASQILSIVRPNGGGDAENLQ  74

Query  240  RLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWP  419
            R+LR+LT+Y IF E ++++  +R+YS+ ++GK LV D DGLSY  YVLQH+Q   ++AWP
Sbjct  75   RILRLLTTYAIFAEDLSSNG-KRKYSLTDIGKALVPDDDGLSYATYVLQHYQDQYLRAWP  133

Query  420  LVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQGFKG  599
            LV +AV D+S+EPF K++GE  Y+Y  K P+  SL   +MSG+S+P M   L+ Y GFKG
Sbjct  134  LVGDAVEDASVEPFEKLHGEGAYAYCMKRPDEMSLFYASMSGLSMPHMNEMLEKYDGFKG  193

Query  600  VTRLVDV  620
            V  LVDV
Sbjct  194  VETLVDV  200



>ref|XP_003602596.1| Caffeic acid 3-O-methyltransferase [Medicago truncatula]
 gb|AES72847.1| caffeic acid O-methyltransferase [Medicago truncatula]
Length=264

 Score =   216 bits (550),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 143/187 (76%), Gaps = 1/187 (1%)
 Frame = +3

Query  60   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLE  239
            ARL I+ELA+++SVP SL AV+++ V +AIWQGG N PLSAS+ILS V P+GGGDA NL+
Sbjct  15   ARLAILELAHIMSVPTSLNAVLKMKVPEAIWQGGKNTPLSASQILSIVRPNGGGDAENLQ  74

Query  240  RLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWP  419
            R+LR+LT+Y IF E ++++  ER+YS+ +VGK LV D  GL+  ++ +QHHQ   ++AWP
Sbjct  75   RILRLLTTYTIFVEDLSSNG-ERKYSLTDVGKALVPDDHGLTCASFFVQHHQDPYLRAWP  133

Query  420  LVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQGFKG  599
            LV +AV D ++EPF K++GEA Y+Y  K PE  SL   +MSG+S+P+M+  L++Y GFKG
Sbjct  134  LVGDAVEDPTVEPFEKLHGEAAYAYCTKGPEEMSLFYASMSGMSLPYMREMLENYDGFKG  193

Query  600  VTRLVDV  620
            V  LVDV
Sbjct  194  VETLVDV  200



>ref|XP_006436414.1| hypothetical protein CICLE_v10033543mg [Citrus clementina]
 gb|ESR49654.1| hypothetical protein CICLE_v10033543mg [Citrus clementina]
Length=317

 Score =   218 bits (555),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 125/153 (82%), Gaps = 1/153 (1%)
 Frame = +3

Query  162  SNAPLSASEILSSVLPSGGGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTL  341
            +N PLSAS+IL+ +LPSGGGDA NL+R+LR+LTSYG+F EH      +R YS+ E+GK+L
Sbjct  16   ANTPLSASQILTRILPSGGGDAENLQRILRLLTSYGVFSEH-REFGGKRMYSLTEIGKSL  74

Query  342  VTDKDGLSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNS  521
            VTD +GLSY  YVLQHHQ A+M  WPLVH+A++D +IEPF+KV+GE  YSYYGK PEMN 
Sbjct  75   VTDVEGLSYAPYVLQHHQDALMSMWPLVHKAILDPTIEPFLKVHGEPAYSYYGKIPEMNG  134

Query  522  LMQKAMSGISVPFMKAFLDSYQGFKGVTRLVDV  620
            LM+KAMSG+SVPFM + L+ Y GFKGV RLVDV
Sbjct  135  LMRKAMSGVSVPFMTSVLEGYNGFKGVKRLVDV  167



>ref|XP_006485837.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Citrus sinensis]
Length=337

 Score =   218 bits (556),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 125/153 (82%), Gaps = 1/153 (1%)
 Frame = +3

Query  162  SNAPLSASEILSSVLPSGGGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTL  341
            +N PLSAS+IL+ +LPSGGGDA NL+R+LR+LTSYG+F EH      +R YS+ E+GK+L
Sbjct  16   ANTPLSASQILTRILPSGGGDAENLQRILRLLTSYGVFSEH-REFGGKRMYSLTEIGKSL  74

Query  342  VTDKDGLSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNS  521
            VTD +GLSY  YVLQHHQ A+M  WPLVH+A++D +IEPF+KV+GE  YSYYGK PEMN 
Sbjct  75   VTDVEGLSYAPYVLQHHQDALMSMWPLVHKAILDPTIEPFLKVHGEPAYSYYGKIPEMNG  134

Query  522  LMQKAMSGISVPFMKAFLDSYQGFKGVTRLVDV  620
            LM+KAMSG+SVPFM + L+ Y GFKGV RLVDV
Sbjct  135  LMRKAMSGVSVPFMTSVLEGYNGFKGVKRLVDV  167



>ref|XP_006451708.1| hypothetical protein CICLE_v10010561mg, partial [Citrus clementina]
 gb|ESR64948.1| hypothetical protein CICLE_v10010561mg, partial [Citrus clementina]
Length=305

 Score =   216 bits (549),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 123/153 (80%), Gaps = 1/153 (1%)
 Frame = +3

Query  162  SNAPLSASEILSSVLPSGGGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTL  341
            +N PLSAS+IL+ +LPSG GDA NL+R+LR+LTSYG+F EH      + +YS+ E+GK+L
Sbjct  4    ANTPLSASQILTHILPSGSGDAENLQRILRLLTSYGVFSEH-REFGGQMKYSITEIGKSL  62

Query  342  VTDKDGLSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNS  521
            VTD +GLSY  YVLQHHQ A+M  WPLVHEAV+D +IEP VKV+G+  YSYYGK PEMN 
Sbjct  63   VTDAEGLSYAPYVLQHHQDALMSMWPLVHEAVLDPTIEPLVKVHGKPAYSYYGKMPEMNG  122

Query  522  LMQKAMSGISVPFMKAFLDSYQGFKGVTRLVDV  620
            LM+KAMSG+SVPFM + LD Y GFKGV RLV+V
Sbjct  123  LMRKAMSGVSVPFMTSVLDGYNGFKGVKRLVEV  155



>ref|XP_003602595.1| Caffeic acid 3-O-methyltransferase [Medicago truncatula]
 gb|ACJ84599.1| unknown [Medicago truncatula]
 gb|AES72846.1| caffeic acid O-methyltransferase [Medicago truncatula]
 gb|AFK37235.1| unknown [Medicago truncatula]
Length=358

 Score =   216 bits (551),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 143/187 (76%), Gaps = 1/187 (1%)
 Frame = +3

Query  60   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLE  239
            ARL I+ELA+++SVP SL AV+++ V +AIWQGG N PLSAS+ILS V P+GGGDA NL+
Sbjct  15   ARLAILELAHIMSVPTSLNAVLKMKVPEAIWQGGKNTPLSASQILSIVRPNGGGDAENLQ  74

Query  240  RLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWP  419
            R+LR+LT+Y IF E ++++  ER+YS+ +VGK LV D  GL+  ++ +QHHQ   ++AWP
Sbjct  75   RILRLLTTYTIFVEDLSSNG-ERKYSLTDVGKALVPDDHGLTCASFFVQHHQDPYLRAWP  133

Query  420  LVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQGFKG  599
            LV +AV D ++EPF K++GEA Y+Y  K PE  SL   +MSG+S+P+M+  L++Y GFKG
Sbjct  134  LVGDAVEDPTVEPFEKLHGEAAYAYCTKGPEEMSLFYASMSGMSLPYMREMLENYDGFKG  193

Query  600  VTRLVDV  620
            V  LVDV
Sbjct  194  VETLVDV  200



>ref|XP_006485822.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Citrus sinensis]
Length=274

 Score =   213 bits (543),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 123/153 (80%), Gaps = 1/153 (1%)
 Frame = +3

Query  162  SNAPLSASEILSSVLPSGGGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTL  341
            +N PLSAS+IL+ +LPSG GDA NL+R+LR+LTSYG+F EH      + +YS+ E+GK+L
Sbjct  16   ANTPLSASQILTHILPSGSGDAENLQRILRLLTSYGVFSEH-REFGGQMKYSITEIGKSL  74

Query  342  VTDKDGLSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNS  521
            VTD +GLSY  YVLQHHQ A+M  WPLV+EAV+D +IEP VKV+G+  YSYYGK PEMN 
Sbjct  75   VTDAEGLSYAPYVLQHHQDALMSMWPLVYEAVLDPTIEPLVKVHGKPAYSYYGKMPEMNG  134

Query  522  LMQKAMSGISVPFMKAFLDSYQGFKGVTRLVDV  620
            LM+KAMSG+SVPFM + LD Y GFKGV RLV+V
Sbjct  135  LMRKAMSGVSVPFMTSVLDGYNGFKGVKRLVEV  167



>gb|AAP03053.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=191

 Score =   209 bits (531),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 136/185 (74%), Gaps = 11/185 (6%)
 Frame = +3

Query  96   SVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSG--GGDAPNLERLLRMLTSYG  269
            +VPMSL A++RL V +AIW  GSN P+SA+EILS  LP      DA NL+RLLR+LTS+G
Sbjct  6    NVPMSLTAIVRLKVPEAIWSNGSNTPVSAAEILSR-LPDAPPTADAENLQRLLRVLTSFG  64

Query  270  IFREHINADAS------ERRYSVDEVGKTLVT-DKDGLSYGAYVLQHHQAAMMKAWPLVH  428
            +F EH++  +S      ERRY + EVG+TLV+ D+   S+GAYVLQHHQ  ++KAWP +H
Sbjct  65   VFSEHLDTTSSSSSSTSERRYCLTEVGQTLVSFDESCPSHGAYVLQHHQETLLKAWPFLH  124

Query  429  EAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDS-YQGFKGVT  605
             A++D+S EPF +VNGE  Y YYGKN E+N  MQ AMSG+SVP+MKA L S Y GF+GV 
Sbjct  125  TAILDASTEPFARVNGEPAYQYYGKNDELNKNMQYAMSGVSVPYMKALLGSGYDGFEGVK  184

Query  606  RLVDV  620
             LVDV
Sbjct  185  TLVDV  189



>gb|AGW45465.1| beta-alanine n-methyltransferase, partial [Reaumuria trigyna]
Length=204

 Score =   203 bits (517),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 126/168 (75%), Gaps = 4/168 (2%)
 Frame = +3

Query  129  LNVADAIWQGGSNAPLSASEILSSVLP-SGGGDAPNLERLLRMLTSYGIFREHI-NADAS  302
            L V +AIW  GSN PL+A+EILS +LP S   D  NL+R+LR+LT+Y IF EH+ +    
Sbjct  1    LKVPEAIWAHGSNKPLTATEILSHILPNSPTADPENLQRMLRLLTTYNIFVEHLSDTTPV  60

Query  303  ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEA  482
            +RRYS+ EVG+TLV D DGLSYG Y++QHHQ A++++WPLVH AVVD   EPFV+ NGE+
Sbjct  61   QRRYSLTEVGETLVPDSDGLSYGDYIMQHHQDALVRSWPLVHMAVVDPVTEPFVRANGES  120

Query  483  PYSYYGKNPEMNSLMQKAMSGISVPFMKAFLD-SYQGF-KGVTRLVDV  620
             Y YYGK+ EMN LMQKAM+G SVPFM+  LD  Y GF + V RLVDV
Sbjct  121  AYWYYGKDEEMNELMQKAMAGFSVPFMRELLDGGYDGFERDVERLVDV  168



>ref|XP_009382782.1| PREDICTED: caffeic acid 3-O-methyltransferase [Musa acuminata 
subsp. malaccensis]
Length=370

 Score =   207 bits (526),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 142/199 (71%), Gaps = 6/199 (3%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  221
            SE     RL +MELANMISVPM+L AV+RLNV DAIWQ GSN+PL+A+EIL+ + P    
Sbjct  14   SEVGKQGRLAMMELANMISVPMALNAVVRLNVPDAIWQSGSNSPLTAAEILALLRPPPPS  73

Query  222  DAPN--LERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
             +    L+RLLR+L S+G+F E+  A +  RRYS+ +VG+TLV   DG SY AYVLQHHQ
Sbjct  74   SSDPSVLQRLLRLLASHGVFAENRCATSGARRYSLTDVGRTLVPSGDGASYAAYVLQHHQ  133

Query  396  AAMMKAWPLVHEAVVD-SSIEPFVKVNGEAP-YSYYGKNPEMNSLMQKAMSGISVPFMKA  569
             A+++AWP +HEAV+D +  EPF + NG  P Y+YYG + E N+LMQ+AM G+S PFM+A
Sbjct  134  DALVRAWPRLHEAVLDPAGPEPFARANGGVPAYAYYGGDREANALMQRAMWGVSEPFMEA  193

Query  570  FLDSY--QGFKGVTRLVDV  620
             LD Y   GF  V  LVDV
Sbjct  194  LLDGYGSAGFGSVETLVDV  212



>ref|XP_010683979.1| PREDICTED: caffeic acid 3-O-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=383

 Score =   204 bits (518),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 115/207 (56%), Positives = 142/207 (69%), Gaps = 15/207 (7%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGG-  218
            SE+ N ARL IMELANMISVPM+L AV+RL V  AIW  G+N PL+A+ I+S +LP+   
Sbjct  20   SETRNKARLAIMELANMISVPMALNAVVRLKVPAAIWSCGANTPLTAAAIISLILPNNPE  79

Query  219  GDAPNLERLLRMLTSYGIFREH--INADASERRYSVDEVGKTLVTDKDGL---------S  365
             DA NL RLLR+L++YG+F EH  +  D   RRYS+ EVG+TLV    G          S
Sbjct  80   ADADNLARLLRLLSTYGVFSEHPPLYGDIF-RRYSLTEVGRTLVAGDGGGGGGDDGGGSS  138

Query  366  YGAYVLQHHQAAMMKAWPLVHEAVV-DSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMS  542
            +G YVLQHHQ A+++AW  V  AVV  +S  PF   NGE  Y YYGKN EMN LMQ+AM+
Sbjct  139  HGEYVLQHHQEALVRAWLQVDRAVVGPTSKTPFEVANGEPAYDYYGKNEEMNGLMQRAMA  198

Query  543  GISVPFMKAFLD-SYQGFKGVTRLVDV  620
            G+SVPFMKA ++  Y GF GV +LVDV
Sbjct  199  GVSVPFMKAVVEGGYDGFDGVVKLVDV  225



>gb|AAP03054.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=181

 Score =   195 bits (495),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 125/167 (75%), Gaps = 10/167 (6%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSG--  215
            SE+ N ARL+I+ELAN+ISVPMSL A++RL V +AIW  GSN P+SA+EILS  LP    
Sbjct  16   SEARNNARLKIIELANLISVPMSLTAIVRLKVPEAIWSNGSNTPVSAAEILSR-LPDAPA  74

Query  216  GGDAPNLERLLRMLTSYGIFREHINADAS------ERRYSVDEVGKTLVT-DKDGLSYGA  374
              DA NL+RLLR+LTS+G+F EH++  +S      ERRY + EVG+TLV+ D+   S+GA
Sbjct  75   TADAENLQRLLRVLTSFGVFSEHLDTTSSSSSSTSERRYCLTEVGQTLVSFDESCPSHGA  134

Query  375  YVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEM  515
            YVLQHHQ  ++KAWP +H A++D+S EPF +VNGE  Y YYGKN E+
Sbjct  135  YVLQHHQETLLKAWPFLHTAILDASTEPFARVNGEPAYQYYGKNDEL  181



>dbj|BAJ96291.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00225.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=367

 Score =   195 bits (496),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 103/191 (54%), Positives = 135/191 (71%), Gaps = 8/191 (4%)
 Frame = +3

Query  60   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLE  239
            ARL +MELANMI+VPM+L AVIRL V  A+W GG+N PLSA+E+    LP+G  D   LE
Sbjct  23   ARLAMMELANMIAVPMALTAVIRLGVPAAVWAGGANLPLSAAEL----LPAGHPDPSVLE  78

Query  240  RLLRMLTSYGIFREHINADASERRYSVDEVGKTLV-TDKDGLSYGAYVLQHHQAAMMKAW  416
            RLLR+L S G+F EH      ERRY++  VG+TLV +   G SY  YVLQHHQ A++ AW
Sbjct  79   RLLRLLASRGVFSEHAADGGRERRYALTAVGRTLVPSAPSGASYADYVLQHHQDALVLAW  138

Query  417  PLVHEAVVD-SSIEPFVKVNGEAP-YSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQ-  587
            P +HEAV+D +  EPF + +   P Y+YYG++ + N +M +AM+G+S PFM+A LD Y+ 
Sbjct  139  PRLHEAVLDPAGPEPFARAHAGVPAYAYYGQDRDANEVMLRAMTGVSEPFMEALLDGYEG  198

Query  588  GFKGVTRLVDV  620
            GF+GV  LVDV
Sbjct  199  GFEGVGTLVDV  209



>ref|XP_004954455.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Setaria italica]
Length=344

 Score =   193 bits (491),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 132/188 (70%), Gaps = 9/188 (5%)
 Frame = +3

Query  72   IMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLERLLR  251
            +MELANMISVPM+L AVIRL V  A+W GG+NAPLSA+E+    LP G  D   LERLLR
Sbjct  1    MMELANMISVPMALTAVIRLGVPSAVWAGGANAPLSAAEL----LPEGHPDPSVLERLLR  56

Query  252  MLTSYGIFREHINADA-SERRYSVDEVGKTLV-TDKDGLSYGAYVLQHHQAAMMKAWPLV  425
            +L S G+F EH    A S RR+++  VG+TLV +   G SY  YVLQHHQ A++ AWP +
Sbjct  57   LLASRGVFSEHGGGSAGSPRRFALTAVGRTLVPSGPSGASYADYVLQHHQDALVSAWPRL  116

Query  426  HEAVVD-SSIEPFVKVNGEAP-YSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSY-QGFK  596
            HEAV+D +  EPF + N   P Y+YYG++ E N +M +AM+G+S PFM+A LD Y  GF+
Sbjct  117  HEAVLDPAGPEPFARANAGVPAYAYYGRDREANEVMLRAMTGVSEPFMEALLDGYAAGFE  176

Query  597  GVTRLVDV  620
            GV  LVDV
Sbjct  177  GVATLVDV  184



>ref|XP_010935842.1| PREDICTED: caffeic acid 3-O-methyltransferase isoform X2 [Elaeis 
guineensis]
Length=346

 Score =   192 bits (487),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 140/204 (69%), Gaps = 13/204 (6%)
 Frame = +3

Query  45   ESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEI--LSSVLPSGG  218
            E    A L +MEL+NMI+VPMSL AV+RLNV  AIWQ G+N+PLSA+EI  L    P   
Sbjct  49   EVQKKANLAMMELSNMIAVPMSLHAVVRLNVPAAIWQSGTNSPLSAAEILPLLRPPPPPS  108

Query  219  GDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVT-------DKDGLSYGAY  377
             D  NL+RLLR+L S+G+F EH++  +  RR+S+  VG+TLV+        +DG SY AY
Sbjct  109  TDPGNLQRLLRLLASHGVFTEHLSP-SGVRRFSLTPVGQTLVSAASSNGGGEDGPSYAAY  167

Query  378  VLQHHQAAMMKAWPLVHEAVVD-SSIEPFVKVNGEAP-YSYYGKNPEMNSLMQKAMSGIS  551
            VLQHHQ A+++AWP +HEAV+D +  EPF + NG  P Y+YYG + E N LMQ+AM G+S
Sbjct  168  VLQHHQDALVRAWPRLHEAVLDPAGPEPFARANGGTPAYAYYGGDGEANELMQRAMWGVS  227

Query  552  VPFMKAFLDSY-QGFKGVTRLVDV  620
             PFM AFL+ +   F GV  +VDV
Sbjct  228  KPFMDAFLNGHAAAFAGVRTVVDV  251



>ref|XP_010935841.1| PREDICTED: quercetin 3-O-methyltransferase 1 isoform X1 [Elaeis 
guineensis]
Length=409

 Score =   191 bits (486),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 140/204 (69%), Gaps = 13/204 (6%)
 Frame = +3

Query  45   ESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEI--LSSVLPSGG  218
            E    A L +MEL+NMI+VPMSL AV+RLNV  AIWQ G+N+PLSA+EI  L    P   
Sbjct  49   EVQKKANLAMMELSNMIAVPMSLHAVVRLNVPAAIWQSGTNSPLSAAEILPLLRPPPPPS  108

Query  219  GDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVT-------DKDGLSYGAY  377
             D  NL+RLLR+L S+G+F EH++  +  RR+S+  VG+TLV+        +DG SY AY
Sbjct  109  TDPGNLQRLLRLLASHGVFTEHLSP-SGVRRFSLTPVGQTLVSAASSNGGGEDGPSYAAY  167

Query  378  VLQHHQAAMMKAWPLVHEAVVD-SSIEPFVKVNGEAP-YSYYGKNPEMNSLMQKAMSGIS  551
            VLQHHQ A+++AWP +HEAV+D +  EPF + NG  P Y+YYG + E N LMQ+AM G+S
Sbjct  168  VLQHHQDALVRAWPRLHEAVLDPAGPEPFARANGGTPAYAYYGGDGEANELMQRAMWGVS  227

Query  552  VPFMKAFLDSY-QGFKGVTRLVDV  620
             PFM AFL+ +   F GV  +VDV
Sbjct  228  KPFMDAFLNGHAAAFAGVRTVVDV  251



>ref|XP_008387516.1| PREDICTED: caffeic acid 3-O-methyltransferase [Malus domestica]
Length=284

 Score =   187 bits (476),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 104/126 (83%), Gaps = 3/126 (2%)
 Frame = +3

Query  252  MLTSYGIFREHI-NAD--ASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPL  422
            MLTSYG+F EH+ N D  + +R++S+  +G+TLVTD++GLSYG YVLQHHQ  +M AWP+
Sbjct  1    MLTSYGVFEEHLSNLDDGSDDRKFSLTPIGQTLVTDQNGLSYGPYVLQHHQDVLMGAWPM  60

Query  423  VHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQGFKGV  602
            VHEAVVDS++EPFVK NGE  Y YYGK PEMN LMQKAMSG+SVPFMKA LD Y GF+GV
Sbjct  61   VHEAVVDSTVEPFVKANGELAYEYYGKKPEMNGLMQKAMSGVSVPFMKAILDGYDGFEGV  120

Query  603  TRLVDV  620
             RLVDV
Sbjct  121  ERLVDV  126



>ref|XP_002453074.1| hypothetical protein SORBIDRAFT_04g037820 [Sorghum bicolor]
 gb|EES06050.1| hypothetical protein SORBIDRAFT_04g037820 [Sorghum bicolor]
Length=377

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 131/197 (66%), Gaps = 14/197 (7%)
 Frame = +3

Query  60   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLE  239
            ARL +MELANM+SVPM+L AVIRL V  AIW GG+NAP SA+E+    LP+G  D   LE
Sbjct  27   ARLAMMELANMVSVPMALTAVIRLGVPAAIWAGGANAPRSAAEL----LPAGHPDPSVLE  82

Query  240  RLLRMLTSYGIFREHINAD----ASERRYSVDEVGKTLVTD-KDGLSYGAYVLQHHQAAM  404
            RLLR+L S G+F E  +       + RR+++  VG+TLV +   G SY  YVLQHHQ A+
Sbjct  83   RLLRLLASRGVFSESTSTSEDRTTTTRRFALTAVGRTLVPEGASGASYADYVLQHHQDAL  142

Query  405  MKAWPLVHEAVVD-SSIEPFVKVNGEAP-YSYYGKNPEMNSLMQKAMSGISVPFMKAFLD  578
            + AWP +HEAV+D    EPF + N   P Y+YYGK+ E N +M +AM+G+S PFM A LD
Sbjct  143  VAAWPRLHEAVLDPRGPEPFARANAGVPAYAYYGKDREANQVMLRAMTGVSEPFMHALLD  202

Query  579  SY---QGFKGVTRLVDV  620
             Y    GF GV  LVDV
Sbjct  203  GYGFDGGFHGVATLVDV  219



>gb|KCW89310.1| hypothetical protein EUGRSUZ_A01600 [Eucalyptus grandis]
Length=285

 Score =   185 bits (470),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 102/127 (80%), Gaps = 4/127 (3%)
 Frame = +3

Query  252  MLTSYGIFREHINADAS----ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWP  419
            ML S+G+F EH+   AS    ERRYS+ EVGKTLVTD +GLSY  YVLQHHQ A+M+AWP
Sbjct  1    MLASHGVFEEHVAPAASSASSERRYSLTEVGKTLVTDAEGLSYAPYVLQHHQDALMRAWP  60

Query  420  LVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQGFKG  599
            LVHEAV+D + EPFVK NG+  Y++YGKNPEMN LMQ+AMSG+SVPFMKA LD Y GF G
Sbjct  61   LVHEAVLDPATEPFVKANGDTAYAHYGKNPEMNKLMQRAMSGVSVPFMKAILDGYDGFSG  120

Query  600  VTRLVDV  620
            V RLVDV
Sbjct  121  VGRLVDV  127



>ref|NP_001149617.1| LOC100283243 [Zea mays]
 gb|ACG36095.1| caffeic acid 3-O-methyltransferase [Zea mays]
Length=374

 Score =   186 bits (473),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 101/195 (52%), Positives = 132/195 (68%), Gaps = 12/195 (6%)
 Frame = +3

Query  60   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLE  239
            ARL +MELANM+SVPM+L AVIRL V  A+W GG+NAP+SA+++    LP G  D   LE
Sbjct  25   ARLAMMELANMVSVPMALAAVIRLGVPXAVWAGGANAPMSAADL----LPPGHPDPSVLE  80

Query  240  RLLRMLTSYGIFREHINADASERR--YSVDEVGKTLVT-DKDGLSYGAYVLQHHQAAMMK  410
            RLLR+L S G+F E   +  + RR  +++  VG+TLV     G SY  YVLQHHQ A++ 
Sbjct  81   RLLRLLASRGVFSESTESTPTTRRRLFALTAVGRTLVPGPASGASYADYVLQHHQDALVA  140

Query  411  AWPLVHEAVVDSS-IEPFVKVN-GEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSY  584
            AWP +HEAV+D +  EPF + N G   Y+YYGK+ + N +M +AM+G+S PFM A LD Y
Sbjct  141  AWPRLHEAVLDPAGPEPFARANAGVTAYAYYGKDQDANRVMLRAMAGVSEPFMGALLDGY  200

Query  585  ---QGFKGVTRLVDV  620
                GF+GV  LVDV
Sbjct  201  GAAGGFRGVATLVDV  215



>gb|ACN25427.1| unknown [Zea mays]
 gb|AFW63931.1| caffeic acid 3-O-methyltransferase [Zea mays]
Length=374

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 101/195 (52%), Positives = 132/195 (68%), Gaps = 12/195 (6%)
 Frame = +3

Query  60   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLE  239
            ARL +MELANM+SVPM+L AVIRL V  A+W GG+NAP+SA+++    LP G  D   LE
Sbjct  25   ARLAMMELANMVSVPMALAAVIRLGVPAAVWAGGANAPMSAADL----LPPGHPDPSVLE  80

Query  240  RLLRMLTSYGIFREHINADASERR--YSVDEVGKTLVT-DKDGLSYGAYVLQHHQAAMMK  410
            RLLR+L S G+F E   +  + RR  +++  VG+TLV     G SY  YVLQHHQ A++ 
Sbjct  81   RLLRLLASRGVFSESTESTPTTRRRLFALTAVGRTLVPGPASGASYADYVLQHHQDALVA  140

Query  411  AWPLVHEAVVDSS-IEPFVKVN-GEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSY  584
            AWP +HEAV+D +  EPF + N G   Y+YYGK+ + N +M +AM+G+S PFM A LD Y
Sbjct  141  AWPRLHEAVLDPAGPEPFARANAGVTAYAYYGKDQDANRVMLRAMAGVSEPFMGALLDGY  200

Query  585  ---QGFKGVTRLVDV  620
                GF+GV  LVDV
Sbjct  201  GAAGGFRGVATLVDV  215



>gb|KDO38695.1| hypothetical protein CISIN_1g037818mg, partial [Citrus sinensis]
Length=199

 Score =   178 bits (452),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 106/153 (69%), Gaps = 29/153 (19%)
 Frame = +3

Query  162  SNAPLSASEILSSVLPSGGGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTL  341
            +N PLSAS+IL+ +LPSG GDA NL+R+LR+LTSYG                        
Sbjct  16   ANTPLSASQILTRILPSGDGDAENLQRILRLLTSYG------------------------  51

Query  342  VTDKDGLSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNS  521
                 GLSY  Y+LQHHQ A+M AWPLVHEAV+D +IEPFVKV+GE  YSYYGK PEMN 
Sbjct  52   -----GLSYAPYMLQHHQDALMSAWPLVHEAVLDPTIEPFVKVHGEPAYSYYGKMPEMNG  106

Query  522  LMQKAMSGISVPFMKAFLDSYQGFKGVTRLVDV  620
            LM+KAMSG+SVPF+ + LD Y GFKGV +LVDV
Sbjct  107  LMRKAMSGVSVPFITSVLDGYNGFKGVKQLVDV  139



>gb|EEC74273.1| hypothetical protein OsI_09508 [Oryza sativa Indica Group]
Length=345

 Score =   182 bits (462),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 140/208 (67%), Gaps = 15/208 (7%)
 Frame = +3

Query  30   GAMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLP  209
            G  G  S   ARL +MELANMISVPM+L AVIRL V   +W GG+NAPL+A+++    LP
Sbjct  4    GGDGELSPAEARLAMMELANMISVPMALTAVIRLGVPAKLWAGGANAPLTAADL----LP  59

Query  210  SGGGDAPNLERLLRMLTSYGIFREHIN-ADASERRYSVDEVGKTLVTDKDGL------SY  368
            +G  D   LERLLR+L S G+F EH   +  S RR+S+  VG+TLV    G       SY
Sbjct  60   AGHPDPSVLERLLRLLASRGVFSEHTGSSSPSPRRFSLTAVGRTLVPGGGGSPSGSGASY  119

Query  369  GAYVLQHHQAAMMKAWPLVHEAVVD-SSIEPFVKVNGEAP-YSYYGKNPEMNSLMQKAMS  542
              YVLQHHQ A+++AWPL+HEAV+D S  EPF + N   P Y+YYGK+ E N +M +AM+
Sbjct  120  ADYVLQHHQDALVRAWPLLHEAVLDPSGPEPFARANAGVPAYAYYGKDREANEVMLRAMT  179

Query  543  GISVPFMKAFLDSY--QGFKGVTRLVDV  620
            G+S PFM+A L+ Y   GF+GV+ LVDV
Sbjct  180  GVSEPFMEALLEGYGDGGFEGVSTLVDV  207



>ref|NP_001048569.1| Os02g0823400 [Oryza sativa Japonica Group]
 dbj|BAD22923.1| putative O-diphenol-O-methyl transferase [Oryza sativa Japonica 
Group]
 dbj|BAD22855.1| putative O-diphenol-O-methyl transferase [Oryza sativa Japonica 
Group]
 dbj|BAF10483.1| Os02g0823400 [Oryza sativa Japonica Group]
 dbj|BAG97074.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58073.1| hypothetical protein OsJ_08933 [Oryza sativa Japonica Group]
Length=365

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 140/208 (67%), Gaps = 15/208 (7%)
 Frame = +3

Query  30   GAMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLP  209
            G  G  S   ARL +MELANMISVPM+L AVIRL V   +W GG+NAPL+A+++    LP
Sbjct  4    GGDGELSPAEARLAMMELANMISVPMALTAVIRLGVPAKLWAGGANAPLAAADL----LP  59

Query  210  SGGGDAPNLERLLRMLTSYGIFREHIN-ADASERRYSVDEVGKTLVTDKDGL------SY  368
            +G  D   LERLLR+L S G+F EH   +  S RR+S+  VG+TLV    G       SY
Sbjct  60   AGHPDPSVLERLLRLLASRGVFSEHTGSSSPSPRRFSLTAVGRTLVPGGGGSPSGSGASY  119

Query  369  GAYVLQHHQAAMMKAWPLVHEAVVD-SSIEPFVKVNGEAP-YSYYGKNPEMNSLMQKAMS  542
              YVLQHHQ A+++AWPL+HEAV+D S  EPF + N   P Y+YYGK+ E N +M +AM+
Sbjct  120  ADYVLQHHQDALVRAWPLLHEAVLDPSGPEPFARANAGVPAYAYYGKDREANEVMLRAMT  179

Query  543  GISVPFMKAFLDSY--QGFKGVTRLVDV  620
            G+S PFM+A L+ Y   GF+GV+ LVDV
Sbjct  180  GVSEPFMEALLEGYGDGGFEGVSTLVDV  207



>ref|XP_006425490.1| hypothetical protein CICLE_v10027189mg, partial [Citrus clementina]
 gb|ESR38730.1| hypothetical protein CICLE_v10027189mg, partial [Citrus clementina]
Length=298

 Score =   174 bits (442),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 106/153 (69%), Gaps = 21/153 (14%)
 Frame = +3

Query  162  SNAPLSASEILSSVLPSGGGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTL  341
            +N  LSAS+IL+ +L SGGGDA NL+R+L   T                     E+GK+L
Sbjct  4    ANTHLSASQILTRILSSGGGDAENLQRILLQPT---------------------EIGKSL  42

Query  342  VTDKDGLSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNS  521
            VTD +GLSY  YVLQHH  A+M AWPLVHE V+D +IE FVKV+G   YSYYGK PE+NS
Sbjct  43   VTDAEGLSYAPYVLQHHHDALMSAWPLVHEVVLDPTIELFVKVHGVPAYSYYGKMPEINS  102

Query  522  LMQKAMSGISVPFMKAFLDSYQGFKGVTRLVDV  620
            LM+KAMSG+SVPFM + LD Y GFKGV RLVDV
Sbjct  103  LMRKAMSGVSVPFMTSVLDGYNGFKGVKRLVDV  135



>gb|AES72848.2| caffeic acid O-methyltransferase [Medicago truncatula]
Length=335

 Score =   174 bits (441),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 127/192 (66%), Gaps = 24/192 (13%)
 Frame = +3

Query  45   ESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGD  224
            +S + ARL I+ELA+++SVP SL AV+++ V +AIWQGG+N PLSAS+ILS V P+GGGD
Sbjct  10   KSQSEARLAILELAHIMSVPTSLVAVLKMKVPEAIWQGGNNTPLSASQILSIVRPNGGGD  69

Query  225  APNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAM  404
            A NL+R+LR+LT+Y IF E ++++  +R+YS+ E                          
Sbjct  70   AENLQRILRLLTTYAIFAEDLSSNG-KRKYSLTE-----------------------DQY  105

Query  405  MKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSY  584
            ++AWPLV EAV D ++EPF K++GE  Y+Y  K P+  SL   +MSG+S+P M   L+ Y
Sbjct  106  LRAWPLVGEAVEDPTVEPFEKLHGEGAYAYCMKRPDEMSLFYASMSGMSMPHMNEMLEKY  165

Query  585  QGFKGVTRLVDV  620
             GFKGV  LVDV
Sbjct  166  DGFKGVESLVDV  177



>ref|XP_003572969.1| PREDICTED: caffeic acid 3-O-methyltransferase [Brachypodium distachyon]
Length=362

 Score =   174 bits (441),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 129/193 (67%), Gaps = 10/193 (5%)
 Frame = +3

Query  60   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLE  239
            ARL +MELANMISVPM+L A IRL V  AIW  G+NAPLSA+++    LP+   D   LE
Sbjct  16   ARLAMMELANMISVPMALTAAIRLGVPGAIWADGANAPLSAADL----LPADHPDPSVLE  71

Query  240  RLLRMLTSYGIFREHINADASE--RRYSVDEVGKTLV-TDKDGLSYGAYVLQHHQAAMMK  410
            R+LR+L S G+F EH     +E  RR+++  VG+TLV     G SY  YVLQHHQ A++ 
Sbjct  72   RVLRLLASRGVFSEHHGPGPAEPTRRFALTAVGRTLVPAGPSGASYADYVLQHHQDALVL  131

Query  411  AWPLVHEAVVD-SSIEPFVKVNGEAP-YSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSY  584
            AWP +HEA++D +  EPF + +   P Y++Y ++ E N +M + M+G+S PFM+A LD Y
Sbjct  132  AWPRLHEALLDPAGPEPFARAHRGLPAYAFYAQDKEANEVMLRGMTGVSEPFMEALLDGY  191

Query  585  Q-GFKGVTRLVDV  620
              GF+ V  LVDV
Sbjct  192  AGGFEDVRTLVDV  204



>ref|XP_010275846.1| PREDICTED: uncharacterized protein LOC104610771 [Nelumbo nucifera]
Length=277

 Score =   167 bits (423),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 99/215 (46%), Positives = 120/215 (56%), Gaps = 45/215 (21%)
 Frame = +3

Query  45   ESDNGARLRIMELANMISVP--------------MSLC----------AVIRLNVA-DAI  149
            E+ +  RL I+ELANMI  P              +  C             R       I
Sbjct  7    ETRDNGRLAILELANMIKSPNVPQRHHPPQASKRIKACPGQPWPGRRTGFFRCRTTLVTI  66

Query  150  WQGGSNAPLSASEILSSVLPSGGGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEV  329
            WQGGSN PLSASEIL+ VLP    D  N + +L+ML+SYGIF EHI              
Sbjct  67   WQGGSNVPLSASEILAYVLPIS--DPENFQHILQMLSSYGIFSEHI--------------  110

Query  330  GKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNP  509
                VT+++GL Y AY+L+HHQ A++KAWP++HEAVVD   E  VK NGE   SYYG   
Sbjct  111  ----VTNREGLFYVAYILKHHQDALVKAWPILHEAVVDLEEELLVKSNGEPVRSYYGDKL  166

Query  510  EMNSLMQKAMSGISVPFMKAFLDSYQGFKGVTRLV  614
            EMN LMQKA+SG+SV FMK  L  Y GFK V RL+
Sbjct  167  EMNELMQKAISGVSVSFMKTILKGYDGFKRVERLL  201



>gb|KCW89309.1| hypothetical protein EUGRSUZ_A01600 [Eucalyptus grandis]
Length=345

 Score =   169 bits (428),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 112/180 (62%), Gaps = 36/180 (20%)
 Frame = +3

Query  183  SEILSSVLPSGGGDAPNLERLLRMLTSYGIFREHINADAS--------ERRYSVDEVGKT  338
            S + S+  P+G  DA NL+RLLRML S+G F E   A ++        ERR+S+ EV KT
Sbjct  10   SPLGSTAAPAG--DAENLQRLLRMLASHGAFEERFPATSASSASSGCFERRFSLTEVRKT  67

Query  339  LVTDKDGLSYGAYV--------------------------LQHHQAAMMKAWPLVHEAVV  440
            LVTD +GLSY AYV                           +    A+M+AWPLVHEAV+
Sbjct  68   LVTDAEGLSYAAYVSSSTTRPKKAMERREICLPESRKKRRQKKASDALMRAWPLVHEAVL  127

Query  441  DSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQGFKGVTRLVDV  620
            D + EPFVK NG+  Y++YGKNPEMN LMQ+AMSG+SVPFMKA LD Y GF GV RLVDV
Sbjct  128  DPATEPFVKANGDTAYAHYGKNPEMNKLMQRAMSGVSVPFMKAILDGYDGFSGVGRLVDV  187



>gb|KDO39806.1| hypothetical protein CISIN_1g025363mg [Citrus sinensis]
Length=254

 Score =   157 bits (398),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = +3

Query  312  YSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYS  491
            YS+ E+GK+LVTD +GLSY  YVLQHHQ A+M  WPLVH+A++D +IEPF+KV+GE  YS
Sbjct  2    YSLTEIGKSLVTDVEGLSYAPYVLQHHQDALMSMWPLVHKAILDPTIEPFLKVHGEPAYS  61

Query  492  YYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQGFKGVTRLVDV  620
            YYGK PEMN LM+KAMSG+SVPFM + L+ Y GFKGV RLVDV
Sbjct  62   YYGKIPEMNGLMRKAMSGVSVPFMTSVLEGYNGFKGVKRLVDV  104



>ref|XP_006838729.1| hypothetical protein AMTR_s00002p00253410 [Amborella trichopoda]
 gb|ERN01298.1| hypothetical protein AMTR_s00002p00253410 [Amborella trichopoda]
Length=352

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 120/194 (62%), Gaps = 6/194 (3%)
 Frame = +3

Query  39   GSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGG  218
            GS   +     +MEL N I+V MSL A+ +L+V   IWQ G N PL+A EI + +    G
Sbjct  8    GSNGASHTTWAMMELTNSIAVSMSLRAMAKLDVPKIIWQNGENTPLTALEIATKLGSEAG  67

Query  219  GDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQA  398
              + NLER+LR+LT++G+F E +   +  RR+S+  +G+ +V D+   S GA++L     
Sbjct  68   --SSNLERMLRLLTAHGVFNETMLGPSEGRRFSLTGLGREIV-DR---SMGAFILYRLDD  121

Query  399  AMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLD  578
            A++ AW L+HEAV++ S EPF+K +G+  Y Y+  +P  N  M +AMS  S   M  FL+
Sbjct  122  ALLDAWRLLHEAVLEPSSEPFIKAHGKPAYHYHADDPVFNERMMEAMSSSSGAVMDWFLE  181

Query  579  SYQGFKGVTRLVDV  620
             Y GF+GV R+VD+
Sbjct  182  RYDGFEGVRRVVDL  195



>ref|XP_011101495.1| PREDICTED: caffeic acid 3-O-methyltransferase-like, partial [Sesamum 
indicum]
Length=113

 Score =   126 bits (316),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 78/109 (72%), Gaps = 5/109 (5%)
 Frame = +3

Query  54   NGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSG---GGD  224
            N   L IMEL N++SVPMSL AVI+L V D I Q GSN PLS +EI  S LPS      D
Sbjct  7    NSPILAIMELVNLVSVPMSLKAVIQLKVLDTIRQDGSNNPLSPAEI--SYLPSRLALARD  64

Query  225  APNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYG  371
            A NL+R+LR+LTSYG+F EHI AD SERRYS+ EVGK L  DK+GLSY 
Sbjct  65   AENLQRILRLLTSYGVFNEHIGADGSERRYSLKEVGKALAADKNGLSYA  113



>ref|XP_002963872.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
 gb|ADE88151.1| caffeyl alcohol/5-hydroxyconiferyl alcohol 3/5-O-methyltransferase 
[Selaginella moellendorffii]
 gb|EFJ35743.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
Length=353

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 109/187 (58%), Gaps = 4/187 (2%)
 Frame = +3

Query  63   RLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAP-NLE  239
            RL+IMELA M SVPM+L   + ++VA+ I + G    LSA+EI+S +       +P  L+
Sbjct  14   RLQIMELATMCSVPMALKVAVEMDVAERIEKAGPGGLLSAAEIVSQIPECSSPMSPIYLD  73

Query  240  RLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWP  419
            R++R+L S  IF+E    +   R+Y +  + K L+ D+ G+S   +VL +     M+ W 
Sbjct  74   RIMRVLASRKIFKE--VDEGGVRKYGLTSMCKHLIKDERGVSLAHHVLMNQDKVFMETWQ  131

Query  420  LVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQGFKG  599
             +HEAV+D   EPF K  G+  +    +N  +N+L   AMS  S  +M A L++Y GFKG
Sbjct  132  YLHEAVLDGG-EPFTKAFGQTEFELGKENSRVNNLFHAAMSNHSKLYMNAILEAYHGFKG  190

Query  600  VTRLVDV  620
            +  LVDV
Sbjct  191  IGTLVDV  197



>ref|XP_002988275.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
 gb|EFJ10694.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
Length=353

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 109/187 (58%), Gaps = 4/187 (2%)
 Frame = +3

Query  63   RLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAP-NLE  239
            RL+IMELA M SVPM+L   + ++VA+ I + G    LSA+EI+S +       +P  L+
Sbjct  14   RLQIMELATMCSVPMALKVAVEMDVAERIEKAGPGGLLSAAEIVSQIPECSSPMSPIYLD  73

Query  240  RLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWP  419
            R++R+L S  IF+E    +   R+Y +  + K L+ D+ G+S   +VL +     M+ W 
Sbjct  74   RIMRVLASRKIFKE--VDEGGVRKYGLTSMCKHLIKDERGVSLAHHVLMNQDKVFMETWQ  131

Query  420  LVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQGFKG  599
             +HEAV+D   EPF K  G+  +    +N  +N+L   AMS  S  +M A L++Y GFKG
Sbjct  132  YLHEAVLDGG-EPFTKAFGQTEFELGKENSRVNNLFHAAMSNHSKLYMNAILEAYHGFKG  190

Query  600  VTRLVDV  620
            +  LVDV
Sbjct  191  IGTLVDV  197



>gb|KDO54338.1| hypothetical protein CISIN_1g032721mg [Citrus sinensis]
Length=135

 Score =   120 bits (301),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +3

Query  405  MKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSY  584
            M AWPLVHEAV+D +IEPFVKV+GE  YSYYGK PEMN LM+KAMSG+SVPFM + LD Y
Sbjct  1    MSAWPLVHEAVLDPTIEPFVKVHGEPAYSYYGKKPEMNGLMRKAMSGVSVPFMTSVLDGY  60

Query  585  QGFKGVTRLVDV  620
             GFKGV RLVDV
Sbjct  61   DGFKGVKRLVDV  72



>ref|XP_006649184.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Oryza brachyantha]
Length=313

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 95/175 (54%), Gaps = 48/175 (27%)
 Frame = +3

Query  60   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLE  239
            ARL +MELANMISVPM+L AVIRL                      S  P+G G      
Sbjct  12   ARLAMMELANMISVPMALTAVIRLGF--------------------SPDPAGSG------  45

Query  240  RLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWP  419
                                S RR+++  VG+TLV    G SY  YVLQHHQ A+++AWP
Sbjct  46   --------------------SLRRFALTAVGRTLVPGPSGASYADYVLQHHQDALVRAWP  85

Query  420  LVHEAVVD-SSIEPFVKVNGEAP-YSYYGKNPEMNSLMQKAMSGISVPFMKAFLD  578
             +HEAV+D +  EPF + N   P Y+YYG++ E N +M +AM+G+S PFM+A LD
Sbjct  86   RLHEAVLDPAGPEPFARANAGVPAYAYYGQDREANEVMLRAMTGVSEPFMEALLD  140



>ref|XP_002986612.1| hypothetical protein SELMODRAFT_124122 [Selaginella moellendorffii]
 gb|EFJ12469.1| hypothetical protein SELMODRAFT_124122 [Selaginella moellendorffii]
Length=235

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/189 (35%), Positives = 108/189 (57%), Gaps = 6/189 (3%)
 Frame = +3

Query  63   RLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGG-GDAPNLE  239
            RLRIME   M  +P +L AVI+L + D I     +APLS++EI++ +   G  G   NL+
Sbjct  11   RLRIMEFGTMCGIPSALNAVIKLGIPD-ILSSSQDAPLSSAEIIAQIPACGSSGSGANLD  69

Query  240  RLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTD--KDGLSYGAYVLQHHQAAMMKA  413
            R+LR+L+S G+F+E ++ D   R+Y V  + + LVT+    GL   ++V+ +     MK 
Sbjct  70   RILRVLSSVGVFQESLH-DGGIRKYGVTPLCRYLVTNPSNGGLPLSSWVIANQDVVFMKT  128

Query  414  WPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQGF  593
            W  ++++V  +  +PF   +G+  +     NP    +   AMS  S  +M+  +++Y GF
Sbjct  129  WEFLYQSVT-TGADPFTAAHGKPLFDLTADNPRFRGIFDSAMSDNSNAYMRLIVEAYDGF  187

Query  594  KGVTRLVDV  620
            +GV  LVDV
Sbjct  188  QGVRTLVDV  196



>ref|XP_002986521.1| hypothetical protein SELMODRAFT_124205 [Selaginella moellendorffii]
 gb|EFJ12378.1| hypothetical protein SELMODRAFT_124205 [Selaginella moellendorffii]
Length=238

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/204 (34%), Positives = 115/204 (56%), Gaps = 8/204 (4%)
 Frame = +3

Query  18   LKEIGAMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILS  197
            +  +G+M  + D+  RLRIME   M  +P +L AVI+L + D I     +APLS++EI++
Sbjct  1    MGSLGSMVLQDDD--RLRIMEFGTMCGIPSALNAVIKLGIPD-ILSSSQDAPLSSAEIIA  57

Query  198  SVLPSGG-GDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTD--KDGLSY  368
             +   G  G   NL+R+LR+L+S G+F+E ++ D   R+Y V  + + LVT+    GL  
Sbjct  58   QIPACGSSGSGANLDRILRVLSSVGVFQESLH-DGGIRKYGVTPLCRYLVTNPSNSGLPL  116

Query  369  GAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGI  548
             ++V  +     MK W  ++++V  +  +PF   +G+  +     NP    +   AMS  
Sbjct  117  SSWVTLNQDVVFMKTWEFLYQSVT-TGADPFTAAHGKPVFDLTANNPRFRGIFDSAMSDN  175

Query  549  SVPFMKAFLDSYQGFKGVTRLVDV  620
            S  +M+  +++Y GF+GV  LVDV
Sbjct  176  SNAYMRLVVEAYDGFQGVRTLVDV  199



>ref|XP_006432602.1| hypothetical protein CICLE_v10002505mg [Citrus clementina]
 gb|ESR45842.1| hypothetical protein CICLE_v10002505mg [Citrus clementina]
Length=206

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +3

Query  405  MKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSY  584
            M AWPLVHEA++D +IEPFVKV+GE  YSYYGK PEMN LM+KAMSG+SVPFM + LD Y
Sbjct  1    MSAWPLVHEAILDPTIEPFVKVHGEPTYSYYGKMPEMNGLMRKAMSGVSVPFMTSILDGY  60

Query  585  QGFKGVTRLVDV  620
             GFKGV RLVDV
Sbjct  61   DGFKGVKRLVDV  72



>ref|XP_002965284.1| hypothetical protein SELMODRAFT_83100 [Selaginella moellendorffii]
 gb|EFJ34122.1| hypothetical protein SELMODRAFT_83100 [Selaginella moellendorffii]
Length=235

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/189 (35%), Positives = 108/189 (57%), Gaps = 6/189 (3%)
 Frame = +3

Query  63   RLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGG-GDAPNLE  239
            RLRIME   M  +P +L AVI+L + D I     +APLS++EI++ +   G  G   NL+
Sbjct  11   RLRIMEFGTMCGIPSALNAVIKLGIPD-ILSSSQDAPLSSAEIIAQIPACGSSGSGANLD  69

Query  240  RLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTD--KDGLSYGAYVLQHHQAAMMKA  413
            R+LR+L+S G+F+E ++ D   R+Y V  + + LVT+    GL   ++V+ +     MK 
Sbjct  70   RILRVLSSIGVFQESLH-DGGIRKYGVTPLCRYLVTNPSNGGLPLSSWVIVNQDVVFMKT  128

Query  414  WPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQGF  593
            W  ++++V  +  +PF   +G+  +     NP    +   AMS  S  +M+  +++Y GF
Sbjct  129  WEFLYQSVT-TGADPFTAAHGKPLFDLTADNPRFRGIFDSAMSDNSNAYMRLIVEAYDGF  187

Query  594  KGVTRLVDV  620
            +GV  LVDV
Sbjct  188  QGVRTLVDV  196



>ref|XP_006280681.1| hypothetical protein CARUB_v10026645mg [Capsella rubella]
 gb|EOA13579.1| hypothetical protein CARUB_v10026645mg [Capsella rubella]
Length=363

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 71/195 (36%), Positives = 116/195 (59%), Gaps = 8/195 (4%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            +D+ A L  M+LA+   +PM+L A + L++ + + +  S  P+S +EI +S LP+   +A
Sbjct  15   TDDEAALFAMQLASASVLPMALKAALELDLLEIMAKNAS--PMSPTEI-ASKLPTKNPEA  71

Query  228  P-NLERLLRMLTSYGIF---REHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+LTSY +       ++ D+ ER Y +  V K L  ++DG+S  A  L +  
Sbjct  72   PVMLDRILRLLTSYSVLTCSNRKLSGDSVERIYGLGPVCKYLTKNEDGVSIAALCLMNQD  131

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV+D  I PF K  G + + Y+G +P  N +    MS  S   MK FL
Sbjct  132  KVLMESWYHLKDAVLDGGI-PFNKAYGMSAFEYHGTDPRFNKVFNNGMSNHSTIAMKKFL  190

Query  576  DSYQGFKGVTRLVDV  620
            ++Y+GF+G+T LVDV
Sbjct  191  ETYKGFEGLTSLVDV  205



>gb|ADE88153.1| caffeyl alcohol/5-hydroxyconiferyl alcohol 3/5-O-methyltransferase-like 
2 [Selaginella moellendorffii]
Length=357

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/189 (35%), Positives = 108/189 (57%), Gaps = 6/189 (3%)
 Frame = +3

Query  63   RLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGG-GDAPNLE  239
            RLRIME   M  +P +L AVI+L + D I     +APLS++EI++ +   G  G   NL+
Sbjct  11   RLRIMEFGTMCGIPSALNAVIKLGIPD-ILSSSQDAPLSSAEIIAQIPACGSSGSGANLD  69

Query  240  RLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTD--KDGLSYGAYVLQHHQAAMMKA  413
            R+LR+L+S G+F+E ++ D   R+Y V  + + LVT+    GL   ++V+ +     MK 
Sbjct  70   RILRVLSSIGVFQESLH-DGGIRKYGVTPLCRYLVTNPSNGGLPLSSWVIVNQDVVFMKT  128

Query  414  WPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQGF  593
            W  ++++V  +  +PF   +G+  +     NP    +   AMS  S  +M+  +++Y GF
Sbjct  129  WEFLYQSVT-TGADPFTAAHGKPLFDLTADNPRFRGIFDSAMSDNSNAYMRLIVEAYDGF  187

Query  594  KGVTRLVDV  620
            +GV  LVDV
Sbjct  188  QGVRTLVDV  196



>gb|AFM73596.1| caffeate O-methyltransferase, partial [Populus simonii]
Length=300

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/181 (39%), Positives = 103/181 (57%), Gaps = 8/181 (4%)
 Frame = +3

Query  96   SVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAP-NLERLLRMLTSYGI  272
            +VPM+L A I L+V + I +GG  A LSA EI +  LP+   DAP  L+R+LR+L SY +
Sbjct  5    AVPMALKAAIELDVLEIIAKGGPGAHLSALEI-ARCLPTQNADAPIMLDRMLRLLASYNV  63

Query  273  FREHI-----NADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLVHEAV  437
                I        + ERRY +  V K L+ ++DG+S    VL +     M++W  + EAV
Sbjct  64   LTCSIVSLDGGCGSIERRYGLAPVCKFLIRNQDGVSIAPLVLMNQDKVTMESWYHLKEAV  123

Query  438  VDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQGFKGVTRLVD  617
            +D  I PF K +G + + Y+  +P  N +  + MS  S   MK  L++Y+GF G+  LVD
Sbjct  124  LDGGI-PFNKAHGMSAFEYHSTDPRFNKIFNRTMSDHSTLVMKKILETYKGFDGLKELVD  182

Query  618  V  620
            V
Sbjct  183  V  183



>ref|XP_006451875.1| hypothetical protein CICLE_v10010158mg [Citrus clementina]
 gb|ESR65115.1| hypothetical protein CICLE_v10010158mg [Citrus clementina]
Length=222

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +3

Query  405  MKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSY  584
            M AWPLVHEAV+D +IEPFVKV+GE  YSYYGK PEMN LM+KAMSG+SVPFM + LDSY
Sbjct  1    MSAWPLVHEAVLDPTIEPFVKVHGEPAYSYYGKMPEMNGLMRKAMSGVSVPFMTSVLDSY  60

Query  585  QGFKGVTRLVDV  620
              FKGV +LVDV
Sbjct  61   NRFKGVKQLVDV  72



>ref|XP_010027213.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Eucalyptus 
grandis]
Length=128

 Score =   113 bits (283),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +3

Query  405  MKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSY  584
            M+AWPLVHEA+++ + EPFVK NG+  Y++YGKNPEMN LMQ+AMSG+SVPFMKA LD Y
Sbjct  1    MRAWPLVHEAMLNPTSEPFVKANGDTAYAHYGKNPEMNELMQQAMSGVSVPFMKAILDGY  60

Query  585  QGFKGVTRLVDV  620
             GF  V RLVDV
Sbjct  61   DGFSEVRRLVDV  72



>ref|NP_200227.1| caffeic acid/5-hydroxyferulic acid O-methyltransferase [Arabidopsis 
thaliana]
 sp|Q9FK25.1|OMT1_ARATH RecName: Full=Flavone 3'-O-methyltransferase 1; Short=AtOMT1; 
AltName: Full=Caffeate O-methyltransferase 1; AltName: Full=Quercetin 
3'-O-methyltransferase 1 [Arabidopsis thaliana]
 dbj|BAB11578.1| O-methyltransferase [Arabidopsis thaliana]
 gb|AAL32915.1| O-methyltransferase [Arabidopsis thaliana]
 gb|AAM10127.1| O-methyltransferase [Arabidopsis thaliana]
 gb|AAM64849.1| O-methyltransferase [Arabidopsis thaliana]
 gb|AED96460.1| caffeic acid/5-hydroxyferulic acid O-methyltransferase [Arabidopsis 
thaliana]
Length=363

 Score =   118 bits (295),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 115/195 (59%), Gaps = 8/195 (4%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            +D+ A L  M+LA+   +PM+L + + L++ + + + GS  P+S +EI +S LP+   +A
Sbjct  15   TDDEAALFAMQLASASVLPMALKSALELDLLEIMAKNGS--PMSPTEI-ASKLPTKNPEA  71

Query  228  P-NLERLLRMLTSYGIF---REHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+LTSY +       ++ D  ER Y +  V K L  ++DG+S  A  L +  
Sbjct  72   PVMLDRILRLLTSYSVLTCSNRKLSGDGVERIYGLGPVCKYLTKNEDGVSIAALCLMNQD  131

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +A++D  I PF K  G + + Y+G +P  N +    MS  S   MK  L
Sbjct  132  KVLMESWYHLKDAILDGGI-PFNKAYGMSAFEYHGTDPRFNKVFNNGMSNHSTITMKKIL  190

Query  576  DSYQGFKGVTRLVDV  620
            ++Y+GF+G+T LVDV
Sbjct  191  ETYKGFEGLTSLVDV  205



>gb|AAB96879.1| O-methyltransferase 1 [Arabidopsis thaliana]
Length=363

 Score =   118 bits (295),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 115/195 (59%), Gaps = 8/195 (4%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            +D+ A L  M+LA+   +PM+L + + L++ + + + GS  P+S +EI +S LP+   +A
Sbjct  15   TDDEAALFAMQLASASVLPMALKSALELDLLEIMAKNGS--PMSPTEI-ASKLPTKNPEA  71

Query  228  P-NLERLLRMLTSYGIF---REHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+LTSY +       ++ D  ER Y +  V K L  ++DG+S  A  L +  
Sbjct  72   PVMLDRILRLLTSYSVLTCSNRKLSGDGVERIYGLGPVCKYLTKNEDGVSIAALCLMNQD  131

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +A++D  I PF K  G + + Y+G +P  N +    MS  S   MK  L
Sbjct  132  KVLMESWYHLKDAILDGGI-PFNKAYGMSAFEYHGTDPRFNKVFNNGMSNHSTITMKKIL  190

Query  576  DSYQGFKGVTRLVDV  620
            ++Y+GF+G+T LVDV
Sbjct  191  ETYKGFEGLTSLVDV  205



>ref|XP_002864309.1| O-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40568.1| O-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
Length=363

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 115/195 (59%), Gaps = 8/195 (4%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            +D+ A L  M+LA+   +PM+L + + L++ + + + GS  P+S +EI +S LP+   +A
Sbjct  15   TDDEAALFAMQLASASVLPMALKSALELDLLEIMAKNGS--PMSPTEI-ASHLPTKNPEA  71

Query  228  P-NLERLLRMLTSYGIF---REHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+LTSY +       ++ D  ER Y +  V K L  ++DG+S  A  L +  
Sbjct  72   PVMLDRILRLLTSYSVLTCSNRKLSGDGVERIYGLGPVCKYLTKNEDGVSIAALCLMNQD  131

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +A++D  I PF K  G + + Y+G +P  N +    MS  S   MK  L
Sbjct  132  KVLMESWYHLKDAILDGGI-PFNKAYGMSAFEYHGTDPRFNKVFNNGMSNHSTITMKKIL  190

Query  576  DSYQGFKGVTRLVDV  620
            ++Y+GF+G+T LVDV
Sbjct  191  ETYKGFEGLTSLVDV  205



>gb|AAF60951.1| O-methyltransferase [Populus trichocarpa x Populus deltoides]
Length=364

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 73/196 (37%), Positives = 110/196 (56%), Gaps = 8/196 (4%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L   I L++ + + + G  A LS SEI +S LP+   DA
Sbjct  15   SDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-ASHLPTKNPDA  73

Query  228  P-NLERLLRMLTSYGIF----REHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHH  392
            P  L+R+LR+L SY I     ++H +    ER Y +  V K L  ++DG+S     L + 
Sbjct  74   PVMLDRILRLLASYSILTCSLKDHPDGKV-ERLYGLAPVCKFLTKNEDGVSVSPLCLMNQ  132

Query  393  QAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAF  572
               +M++W  + +A++D  I PF K  G   + Y+G +P  N +  K MS  S   MK  
Sbjct  133  DKVLMESWYYLKDAILDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKI  191

Query  573  LDSYQGFKGVTRLVDV  620
            L++Y+GF+G+T LVDV
Sbjct  192  LETYKGFEGLTSLVDV  207



>gb|ABU53653.1| caffeic acid O-3-methyltransferase [Populus deltoides]
Length=364

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 73/196 (37%), Positives = 110/196 (56%), Gaps = 8/196 (4%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L   I L++ + + + G  A LS SEI +S LP+   DA
Sbjct  15   SDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-ASHLPTKNPDA  73

Query  228  P-NLERLLRMLTSYGIF----REHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHH  392
            P  L+R+LR+L SY I     ++H +    ER Y +  V K L  ++DG+S     L + 
Sbjct  74   PVMLDRILRLLASYSILTCSLKDHPDGKV-ERLYGLAPVCKFLTKNEDGVSVSPLCLMNQ  132

Query  393  QAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAF  572
               +M++W  + +A++D  I PF K  G   + Y+G +P  N +  K MS  S   MK  
Sbjct  133  DKVLMESWYYLKDAILDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKI  191

Query  573  LDSYQGFKGVTRLVDV  620
            L++Y+GF+G+T LVDV
Sbjct  192  LETYKGFEGLTSLVDV  207



>prf||1906376A O-methyltransferase
Length=364

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 73/196 (37%), Positives = 110/196 (56%), Gaps = 8/196 (4%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L   I L++ + + + G  A LS SEI +S LP+   DA
Sbjct  15   SDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-ASHLPTKNPDA  73

Query  228  P-NLERLLRMLTSYGIF----REHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHH  392
            P  L+R+LR+L SY I     ++H +    ER Y +  V K L  ++DG+S     L + 
Sbjct  74   PVMLDRILRLLASYSILICSLKDHPDGKV-ERLYGLAPVCKFLTKNEDGVSVSPLCLMNQ  132

Query  393  QAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAF  572
               +M++W  + +A++D  I PF K  G   + Y+G +P  N +  K MS  S   MK  
Sbjct  133  DKVLMESWYYLKDAILDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKI  191

Query  573  LDSYQGFKGVTRLVDV  620
            L++Y+GF+G+T LVDV
Sbjct  192  LETYKGFEGLTSLVDV  207



>gb|AFK40372.1| unknown [Lotus japonicus]
Length=365

 Score =   116 bits (290),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 71/195 (36%), Positives = 109/195 (56%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L + I L++ + I + G+ A LS +EI +S LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSAIELDLLEFIAKAGTGAQLSPAEI-ASQLPTTNPDA  73

Query  228  PN-LERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L  Y I    +  +     +R Y +  V K LV ++DG+S  A  L +  
Sbjct  74   PTVLDRMLRLLACYNILTCSVRTEQDGKVQRLYGLAPVAKYLVKNEDGVSISALNLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  K MS  S   MK  L
Sbjct  134  KVLMESWYHLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y GF+G+  LVDV
Sbjct  193  ETYTGFEGLKSLVDV  207



>ref|XP_002317838.1| Chain A family protein [Populus trichocarpa]
 gb|ABK92533.1| unknown [Populus trichocarpa]
 gb|ACC63886.1| caffeic acid 3-O-methyltransferase [Populus trichocarpa]
 gb|ACJ76441.1| caffeic acid 3-O-methyltransferase 1 [Populus trichocarpa]
 gb|EEE96058.1| Chain A family protein [Populus trichocarpa]
Length=364

 Score =   115 bits (289),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 72/195 (37%), Positives = 108/195 (55%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L   I L++ + + + G  A LS SEI +S LP+   DA
Sbjct  15   SDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-ASHLPTKNPDA  73

Query  228  P-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L SY I     + +     ER Y +  V K L  ++DG+S     L +  
Sbjct  74   PVMLDRILRLLASYSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSVSPLCLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +A++D  I PF K  G   + Y+G +P  N +  K MS  S   MK  L
Sbjct  134  KVLMESWYYLKDAILDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKLL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y+GF+G+T LVDV
Sbjct  193  ETYKGFEGLTSLVDV  207



>ref|XP_011043758.1| PREDICTED: caffeic acid 3-O-methyltransferase 1 [Populus euphratica]
Length=365

 Score =   115 bits (289),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 72/195 (37%), Positives = 108/195 (55%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L   I L++ + + + G  A LS SEI +S LP+   DA
Sbjct  15   SDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-ASHLPTKNPDA  73

Query  228  P-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L SY I     + +     ER Y +  V K L  ++DG+S     L +  
Sbjct  74   PVMLDRILRLLASYSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSVSPLCLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +A++D  I PF K  G   + Y+G +P  N +  K MS  S   MK  L
Sbjct  134  KVLMESWYYLKDAILDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y+GF+G+T LVDV
Sbjct  193  ETYKGFEGLTSLVDV  207



>sp|Q00763.1|COMT1_POPTM RecName: Full=Caffeic acid 3-O-methyltransferase 1; Short=CAOMT-1; 
Short=COMT-1; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase 1 [Populus tremuloides]
 emb|CAA44006.1| lignin bispecific acid/5-hydroxyferulic acid methyltransferase 
[Populus tremuloides]
 gb|AAB61731.1| caffeic acid/5-hydroxyferulic acid O-methyltransferase [Populus 
tremuloides]
Length=365

 Score =   115 bits (289),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 72/195 (37%), Positives = 108/195 (55%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L   I L++ + + + G  A LS SEI +S LP+   DA
Sbjct  15   SDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-ASHLPTKNPDA  73

Query  228  P-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L SY I     + +     ER Y +  V K L  ++DG+S     L +  
Sbjct  74   PVMLDRILRLLASYSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSVSPLCLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +A++D  I PF K  G   + Y+G +P  N +  K MS  S   MK  L
Sbjct  134  KVLMESWYYLKDAILDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y+GF+G+T LVDV
Sbjct  193  ETYKGFEGLTSLVDV  207



>gb|AFZ78575.1| caffeic acid O-methyltransferase [Populus tomentosa]
Length=365

 Score =   115 bits (289),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 72/195 (37%), Positives = 108/195 (55%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L   I L++ + + + G  A LS SEI +S LP+   DA
Sbjct  15   SDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-ASHLPTKNPDA  73

Query  228  P-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L SY I     + +     ER Y +  V K L  ++DG+S     L +  
Sbjct  74   PVMLDRILRLLASYSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSVSPLCLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +A++D  I PF K  G   + Y+G +P  N +  K MS  S   MK  L
Sbjct  134  KVLMESWYYLKDAILDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y+GF+G+T LVDV
Sbjct  193  ETYKGFEGLTSLVDV  207



>ref|XP_010241050.1| PREDICTED: caffeic acid 3-O-methyltransferase 1 [Nelumbo nucifera]
Length=364

 Score =   115 bits (289),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 108/187 (58%), Gaps = 8/187 (4%)
 Frame = +3

Query  75   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAP-NLERLLR  251
            M+LA+   VPM L A I L+V + I + G+ A +S SEI +S LP+   DAP  L+R+LR
Sbjct  23   MQLASASVVPMVLKAAIELDVLEIIAEAGAGAHISTSEI-ASHLPTQNPDAPVMLDRMLR  81

Query  252  MLTSYGIF----REHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWP  419
            +L S+ I     R H +    ER Y +  V K LV ++DG+S    VL +    +M++W 
Sbjct  82   LLASFSILTCSLRTHDDGRV-ERLYGLAPVCKFLVKNEDGVSMAPLVLMNQDKVLMESWY  140

Query  420  LVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQGFKG  599
             + +AV+D  I PF K  G   + Y+G +P  N +  + MS  S   MK  L++Y+GF+G
Sbjct  141  HLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTITMKKILETYKGFEG  199

Query  600  VTRLVDV  620
            +  +VDV
Sbjct  200  LNSVVDV  206



>ref|XP_003621323.1| Isoliquiritigenin 2'-O-methyltransferase [Medicago truncatula]
 gb|AES77541.1| caffeic acid O-methyltransferase [Medicago truncatula]
Length=370

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 75/195 (38%), Positives = 109/195 (56%), Gaps = 7/195 (4%)
 Frame = +3

Query  51   DNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAP  230
            D+   L ++  ANM+  P  L A I LN+ + I +  +   +SA EI +S LP+   D P
Sbjct  22   DSDTLLAMVLGANMV-FPAVLNAAIELNLFEIIAKESNGDFMSAFEI-ASKLPTQHSDLP  79

Query  231  N-LERLLRMLTSYGIFREHI---NADASERRYSVDEVGKTLVTDK-DGLSYGAYVLQHHQ  395
            N L+R+LRML SY +        + D++ R Y V   GK  V D+ DG   G++      
Sbjct  80   NRLDRMLRMLASYSLLSVSTRTNDDDSTVRVYGVTSSGKYFVNDENDGGYLGSFTSFMCH  139

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
             A++  W    EAV+D  I+ F KVNG + Y Y+GK+P++N L  K+M+      MK  L
Sbjct  140  RALLGVWLNFKEAVIDPEIDLFKKVNGISKYEYFGKDPQINQLFNKSMTDTCNVHMKRIL  199

Query  576  DSYQGFKGVTRLVDV  620
            D Y+GF+GV+ LVDV
Sbjct  200  DIYKGFEGVSTLVDV  214



>dbj|BAJ34520.1| unnamed protein product [Thellungiella halophila]
Length=364

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/196 (35%), Positives = 115/196 (59%), Gaps = 9/196 (5%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            +D+ A L  M+LA+   +PM+L + + L++ + + +  +  P+S SEI +S LP+   +A
Sbjct  15   TDDEAALFAMQLASASVLPMALKSALELDLLEIMAK--NTKPMSPSEI-ASHLPTKNPEA  71

Query  228  P-NLERLLRMLTSYGIF----REHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHH  392
            P  L+R+LR+LT+Y +     R   N D  ER Y +  V K L  ++DG+S  A  L + 
Sbjct  72   PVMLDRILRLLTAYSVLTCSNRTLPNGDGVERLYGLGPVCKYLTKNEDGVSIAALCLMNQ  131

Query  393  QAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAF  572
               +M++W  + +A++D  I PF K  G + + Y+GK+   N++    MS  S   MK  
Sbjct  132  DKVLMESWYHLKDAILDGGI-PFNKAYGMSAFEYHGKDLRFNTVFNNGMSNHSTITMKKI  190

Query  573  LDSYQGFKGVTRLVDV  620
            L++Y+GF+G+T LVDV
Sbjct  191  LETYKGFEGLTSLVDV  206



>gb|KDO39208.1| hypothetical protein CISIN_1g041308mg [Citrus sinensis]
Length=244

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +3

Query  405  MKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSY  584
            M AWPLVHEAV+D +IEPF KV+GE  YSYYGK P+MN LM+KAMS + VPFM + LD Y
Sbjct  1    MSAWPLVHEAVLDPTIEPFAKVHGEPAYSYYGKKPKMNGLMRKAMSRVFVPFMTSVLDGY  60

Query  585  QGFKGVTRLVDV  620
             GFKGV RLVDV
Sbjct  61   DGFKGVKRLVDV  72



>ref|XP_006401613.1| hypothetical protein EUTSA_v10013897mg [Eutrema salsugineum]
 gb|ESQ43066.1| hypothetical protein EUTSA_v10013897mg [Eutrema salsugineum]
Length=364

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/196 (35%), Positives = 115/196 (59%), Gaps = 9/196 (5%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            +D+ A L  M+LA+   +PM+L + + L++ + + +  +  P+S SEI +S LP+   +A
Sbjct  15   TDDEAALFAMQLASASVLPMALKSALELDLLEIMAK--NTKPMSPSEI-ASHLPTKNPEA  71

Query  228  P-NLERLLRMLTSYGIF----REHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHH  392
            P  L+R+LR+LT+Y +     R   N D  ER Y +  V K L  ++DG+S  A  L + 
Sbjct  72   PVMLDRILRLLTAYSVLTCSNRTLPNGDGVERLYGLGPVCKYLTKNEDGVSIAALCLMNQ  131

Query  393  QAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAF  572
               +M++W  + +A++D  I PF K  G + + Y+GK+   N++    MS  S   MK  
Sbjct  132  DKVLMESWYHLKDAILDGGI-PFNKAYGMSAFEYHGKDLRFNTVFNNGMSNHSTITMKKI  190

Query  573  LDSYQGFKGVTRLVDV  620
            L++Y+GF+G+T LVDV
Sbjct  191  LETYKGFEGLTSLVDV  206



>gb|KHF97637.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=308

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 71/208 (34%), Positives = 112/208 (54%), Gaps = 7/208 (3%)
 Frame = +3

Query  9    TGKLKEIGAMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASE  188
            TG  KE  +   + +   +L +  LAN + +PM L + + LN+ D I   G  A LS S+
Sbjct  16   TGAEKETMSQEDQEEEVGKLAV-RLANAVVLPMVLKSALELNIIDTILAAGDGAFLSPSQ  74

Query  189  ILSSVLPSGGGDAPNL-ERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKD  356
            I +S LPS   DAP L +R+LR+L S+ I +  + A   +  ER Y    + K LV ++D
Sbjct  75   I-ASALPSKNPDAPVLLDRMLRLLASHSILKCSVKAKEKEEIERLYGAGPLCKFLVKNQD  133

Query  357  GLSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKA  536
            G S    +L HH    M++W  +++A+++  + PF K  G   + Y G +   N +  +A
Sbjct  134  GGSIAPLLLLHHDQVFMQSWYHLNDAILEGGV-PFSKAYGMTAFEYPGTDQRFNRVFNQA  192

Query  537  MSGISVPFMKAFLDSYQGFKGVTRLVDV  620
            MS  +   M+  +D Y+GF G+  LVDV
Sbjct  193  MSNHTALIMREIVDVYKGFDGLKVLVDV  220



>gb|AAF63200.1| caffeic acid O-3-methyltransferase [Populus tomentosa]
Length=360

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 71/195 (36%), Positives = 108/195 (55%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L   I L++ + + + G  A LS SEI +S LP+   DA
Sbjct  15   SDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-ASHLPTKNPDA  73

Query  228  P-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L SY I     + +     ER Y +  V K L  ++DG+S     L +  
Sbjct  74   PVMLDRILRLLASYSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSVSPLCLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +A+++  I PF K  G   + Y+G +P  N +  K MS  S   MK  L
Sbjct  134  KVLMESWYYLKDAILEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y+GF+G+T LVDV
Sbjct  193  ETYKGFEGLTSLVDV  207



>ref|XP_007136428.1| hypothetical protein PHAVU_009G044400g [Phaseolus vulgaris]
 gb|ESW08422.1| hypothetical protein PHAVU_009G044400g [Phaseolus vulgaris]
Length=365

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/195 (38%), Positives = 109/195 (56%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L + I L++ + I +GG    LS S+I +S LP+   +A
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSAIELDLLEIIAKGGPGVHLSPSQI-ASQLPTRNPEA  73

Query  228  P-NLERLLRMLTSYGI--FREHINADAS-ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L SY I  F      D   ER Y +  V K LV ++DG+S  A  L +  
Sbjct  74   PVMLDRILRLLASYNILSFTLRTLPDGKVERLYGLAPVAKYLVKNEDGVSIAALNLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV+D  I PF K  G   + Y+G +P  N +  K M+  S   MK  L
Sbjct  134  KVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMADHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y GF+G+  LVDV
Sbjct  193  ETYTGFEGLKSLVDV  207



>sp|Q43046.1|COMT1_POPKI RecName: Full=Caffeic acid 3-O-methyltransferase 1; Short=CAOMT-1; 
Short=COMT-1; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase 1 [Populus sieboldii x Populus 
grandidentata]
 dbj|BAA08558.1| caffeic acid O-methyltransferase [Populus kitakamiensis]
Length=365

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 71/195 (36%), Positives = 108/195 (55%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L   I L++ + + + G  A LS SEI +S LP+   DA
Sbjct  15   SDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-ASHLPTKNPDA  73

Query  228  P-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L SY I     + +     ER Y +  V K L  ++DG+S     L +  
Sbjct  74   PVMLDRILRLLASYSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSVSPLCLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +A+++  I PF K  G   + Y+G +P  N +  K MS  S   MK  L
Sbjct  134  KVLMESWYYLKDAILEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y+GF+G+T LVDV
Sbjct  193  ETYKGFEGLTSLVDV  207



>gb|AIJ28474.1| O-methyltransferase [Vaccinium corymbosum]
Length=370

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 112/199 (56%), Gaps = 6/199 (3%)
 Frame = +3

Query  36   MGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSG  215
            +GSE +  A L  M+LA+   +PM L + I L++ + + + G  A +S +E L++ LP+ 
Sbjct  16   VGSEEEEEACLFAMQLASASVLPMVLKSAIELDLLETMAKAGPGAFVSPTE-LAAQLPTQ  74

Query  216  GGDAP-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVL  383
              DA   L+R+LR+LTSY +    + +      ER Y++  V K L  + DG+S    +L
Sbjct  75   NPDAAVMLDRILRLLTSYSVLNCSVKSLPGGGVERLYALAPVCKYLTRNSDGVSMAPLLL  134

Query  384  QHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFM  563
             +    +M++W  + +AV+D  I PF K  G   + Y+G +P  N +  + MS  S   M
Sbjct  135  MNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNQGMSNHSTITM  193

Query  564  KAFLDSYQGFKGVTRLVDV  620
            K  L+ YQGF+G+T LVDV
Sbjct  194  KKILEIYQGFEGLTSLVDV  212



>ref|XP_001762717.1| predicted protein [Physcomitrella patens]
 gb|EDQ72516.1| predicted protein [Physcomitrella patens]
Length=378

 Score =   113 bits (283),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 66/190 (35%), Positives = 107/190 (56%), Gaps = 4/190 (2%)
 Frame = +3

Query  63   RLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLER  242
            RL  +EL    ++P +L ++ RLNV +A+ + G    L+  E+ +  +P    +   L R
Sbjct  30   RLAAIELVGQAAIPGTLASLARLNVFEALARAGDGVELTPQELGNQAMPGKVINLSYLGR  89

Query  243  LLRMLTSYGIFRE--HINADAS-ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKA  413
            +LR+ +S  + RE   ++ D S E RY ++ +GK LV D +  S    +L +     +  
Sbjct  90   MLRLASSVKVLREVATMSEDGSTEHRYGLEPIGKFLVDDAEKGSLVHLLLMYQDPVFLST  149

Query  414  WPLVHEAVVDSSIEPFVKVNGEAPYSYYG-KNPEMNSLMQKAMSGISVPFMKAFLDSYQG  590
            W  + E+V+D S++PF + +G      YG +NPE +    KAM+G S  +M+AFLD YQG
Sbjct  150  WNHLPESVLDDSVQPFARAHGGLHAWEYGMQNPEFDEKFNKAMAGHSKLYMRAFLDVYQG  209

Query  591  FKGVTRLVDV  620
            F+GV  L+DV
Sbjct  210  FEGVRVLIDV  219



>gb|KDP30064.1| hypothetical protein JCGZ_18389 [Jatropha curcas]
Length=365

 Score =   112 bits (281),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 71/195 (36%), Positives = 108/195 (55%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L + I L++ + I + G  A LS  +I +S LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSAIELDLLEIIGKAGPGAFLSPYDI-ASQLPTKNPDA  73

Query  228  PN-LERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L SY I    +        E+ Y +  V K L  ++DG+S     L +  
Sbjct  74   PVVLDRILRLLASYSILTYSLRTLPDGKVEKLYGLAPVCKFLTKNEDGVSIAPLCLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + EAV++  I PF K  G   + Y+G +P  N++  K MS  S   MK  L
Sbjct  134  KVLMESWYHLKEAVLEGGI-PFNKAYGMTAFEYHGTDPRFNTVFNKGMSDHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y+GF+G+T LVDV
Sbjct  193  ETYKGFEGLTSLVDV  207



>gb|ACT32028.1| caffeic acid O-methyltransferase 1 [Gossypium hirsutum]
Length=366

 Score =   112 bits (280),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 107/195 (55%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD+ A L  M+LA+   +PM L + I L++ + + + G  A LS  E+ +S LP+   DA
Sbjct  15   SDDEANLFAMQLASASVLPMVLKSAIELDLLEIMAKAGPGAFLSPKEV-ASKLPTTNPDA  73

Query  228  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L SY +    +        ER Y +  V K L  ++DG++  A  L +  
Sbjct  74   PVMLDRILRLLASYNVLTCSLRTFPGGKVERLYGLGPVCKFLTRNEDGVTLSALSLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV+D  I PF K  G   + Y+G +P  N +  + MS  S   MK  L
Sbjct  134  KVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            D+Y GF+G+  LVDV
Sbjct  193  DTYDGFQGLKTLVDV  207



>ref|XP_009352092.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Pyrus x bretschneideri]
Length=269

 Score =   111 bits (277),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 111/195 (57%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA++  +PM L A I L++ + + + G    +S ++ LSS LP+   DA
Sbjct  15   SDEEASLFAMQLASVSVLPMVLKAAIELDLLEIMAKAGPGVFVSPAD-LSSQLPTKNPDA  73

Query  228  P-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L SY I       +     ER Y +  V K L T++DG+S  +  L +  
Sbjct  74   PVMLDRMLRLLASYSILTYSLRTLQDGKVERLYGLGPVCKFLTTNEDGVSIASLCLMNLD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
               +++W  + +AV++  I PF K  G   + Y+G +P  N +  +AM+ IS   MK  L
Sbjct  134  KVPVESWYHLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRAMADISTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y+GF+G+T +VDV
Sbjct  193  ETYKGFEGLTSVVDV  207



>gb|ACT87981.1| caffeic acid O-methyltransferase [Jatropha curcas]
Length=365

 Score =   112 bits (280),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 71/195 (36%), Positives = 108/195 (55%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L + I L++ + I + G  A LS  +I +S LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSAIELDLLEIIGKAGPGAFLSPYDI-ASQLPTKDPDA  73

Query  228  PN-LERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L SY I    +        E+ Y +  V K L  ++DG+S     L +  
Sbjct  74   PVVLDRILRLLASYSILTYSLRTLPDGKVEKLYGLAPVCKFLTKNEDGVSIAPLCLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + EAV++  I PF K  G   + Y+G +P  N++  K MS  S   MK  L
Sbjct  134  KVLMESWYHLKEAVLEGGI-PFNKAYGMTAFEYHGTDPRFNTVFNKGMSDHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y+GF+G+T LVDV
Sbjct  193  ETYKGFEGLTSLVDV  207



>ref|XP_010243879.1| PREDICTED: uncharacterized protein LOC104587837 [Nelumbo nucifera]
Length=130

 Score =   107 bits (268),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 69/89 (78%), Gaps = 2/89 (2%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  221
            +++ N  RL I+ELAN+I+VPMSL A++ L VADAI QG SN PLSASEIL+ VLP+G  
Sbjct  6    TKTQNNTRLAILELANIINVPMSLNAIVCLKVADAIQQGSSNVPLSASEILACVLPTGDP  65

Query  222  DAPNLERLLRMLTSYGIFREHINADASER  308
            D  NL+ +LRMLTSY +F EHI  D+S++
Sbjct  66   D--NLQCILRMLTSYDVFSEHIVDDSSKQ  92



>gb|AER35881.1| S-adenosyl-L-methionine:flavonoid O-methyltransferase [Ginkgo 
biloba]
Length=362

 Score =   112 bits (280),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 62/185 (34%), Positives = 100/185 (54%), Gaps = 4/185 (2%)
 Frame = +3

Query  75   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLERLLRM  254
            MEL N   +PM++ A + L+V   I   G  A +S  EI++ +  +    A  L+R+LR+
Sbjct  20   MELGNFSCLPMAMKAAVELDVLQIIANAGHGAQISPREIVTHIPTTNPDAAITLDRILRV  79

Query  255  LTSYGIFREHINAD---ASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLV  425
            L S+ +    +  D    + R Y +  + K LV +KDG+S    VL +     M++W  +
Sbjct  80   LASHSVLSSSVTTDENGKTGRVYGLTPLCKYLVQNKDGVSLAPLVLMNQDKVFMESWYYL  139

Query  426  HEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQGFKGVT  605
             +AV+D S +PF K +G   + Y  K+P  N++  +AM+  S   M+  LD+Y GFK V 
Sbjct  140  KDAVLDGS-QPFTKAHGVNAFEYPAKDPRFNNVFNRAMAEHSTMLMQKILDTYPGFKDVQ  198

Query  606  RLVDV  620
             +VDV
Sbjct  199  EIVDV  203



>gb|KHG13754.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=387

 Score =   112 bits (281),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 107/195 (55%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD+ A L  M+LA+   +PM L + I L++ + + + G  A LS  E+ +S LP+   DA
Sbjct  37   SDDEANLFAMQLASASVLPMVLKSAIELDLLEIMAKAGPGAFLSPKEV-ASKLPTTNPDA  95

Query  228  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L SY +    +        ER Y +  V K L  ++DG++  A  L +  
Sbjct  96   PVMLDRILRLLASYNVLTCSLRTFPGGKVERLYGLGPVCKFLTKNEDGVTLSALSLMNQD  155

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV+D  I PF K  G   + Y+G +P  N +  + MS  S   MK  L
Sbjct  156  KVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTITMKKIL  214

Query  576  DSYQGFKGVTRLVDV  620
            D+Y GF+G+  LVDV
Sbjct  215  DTYDGFQGLKTLVDV  229



>gb|KJB16304.1| hypothetical protein B456_002G222400 [Gossypium raimondii]
Length=404

 Score =   112 bits (281),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 71/208 (34%), Positives = 111/208 (53%), Gaps = 7/208 (3%)
 Frame = +3

Query  9    TGKLKEIGAMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASE  188
            TG  KE  +   + +   +L +  LAN + +PM L + + LN+ D I   G  A LS S+
Sbjct  40   TGAEKETMSQEDQEEEVGKLAV-RLANAVVLPMVLKSALELNIIDTISAAGDGAFLSPSQ  98

Query  189  ILSSVLPSGGGDAPNL-ERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKD  356
            I +S LPS   DAP L +R+LR+L S+ I +  + A      ER Y    + K LV ++D
Sbjct  99   I-ASALPSKNPDAPVLLDRMLRLLASHSILKCSVKAKEKGEIERLYGAGPLCKFLVKNQD  157

Query  357  GLSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKA  536
            G S    +L HH    M++W  +++A+++  + PF K  G   + Y G +   N +  +A
Sbjct  158  GGSIAPLLLLHHDQVFMQSWYHLNDAILEGGV-PFSKAYGMTAFEYPGTDQRFNRVFNQA  216

Query  537  MSGISVPFMKAFLDSYQGFKGVTRLVDV  620
            MS  +   M+  +D Y+GF G+  LVDV
Sbjct  217  MSNHTALIMRKIVDVYKGFDGLKVLVDV  244



>ref|XP_002864307.1| O-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40566.1| O-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
Length=362

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/195 (34%), Positives = 112/195 (57%), Gaps = 8/195 (4%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            +D+ A L  M+LA+   +PM+L + + L++ + + + GS  P+S +EI +S LP+    A
Sbjct  15   TDDEAALFAMQLASASVLPMALKSALELDLLEIMAKNGS--PMSPTEI-ASHLPTKNPGA  71

Query  228  P-NLERLLRMLTSYGIF---REHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+LTS+ +       ++ D  ER Y +  V K L  ++DG+S     L    
Sbjct  72   PVMLDRILRLLTSHSVLTCSNRKLSGDGVERIYGLGPVCKYLTKNEDGVSIAGLCLTSQD  131

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +A++D  I PF K  G + + Y+G +P  N +    MS  S   MK  L
Sbjct  132  KVLMESWYHLKDAILDGGI-PFNKAYGMSAFEYHGTDPRFNKVFNNGMSNHSTITMKKIL  190

Query  576  DSYQGFKGVTRLVDV  620
            ++Y+GF+G+T LVDV
Sbjct  191  ETYKGFEGLTSLVDV  205



>gb|ACN41351.2| putative caffeic acid O-methyltransferase [Betula pendula]
Length=365

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 71/195 (36%), Positives = 110/195 (56%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L + I L++ + + + G  A LS SEI +S LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMILKSAIELDLLEIMAKAGPGAYLSPSEI-ASQLPTTNPDA  73

Query  228  P-NLERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L SY +    +        ER Y +  V K L  ++DG+S  A  L +  
Sbjct  74   PVMLDRILRLLASYSVLTYSLRTLPDGRVERLYGLGPVCKFLTKNEDGVSIAALNLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV++  I PF K +G   + Y+GK+   N +  K MS  S   MK  L
Sbjct  134  KVLMESWYYLKDAVLEGGI-PFNKAHGMTSFEYHGKDLRFNKVFNKGMSDHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y+GF+G+T +VDV
Sbjct  193  ETYKGFEGLTSVVDV  207



>gb|KFK27028.1| hypothetical protein AALP_AA8G324800 [Arabis alpina]
Length=365

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 112/197 (57%), Gaps = 10/197 (5%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            +D+ A L  M+LA+   +PM+L   + L++ + + +  S  P+S SEI +S LP+   +A
Sbjct  15   TDDEAALFAMQLASASVLPMALKTALELDLLEIMAKNSS--PMSPSEI-ASHLPTKNLEA  71

Query  228  P-NLERLLRMLTSYGIFREHINA-----DASERRYSVDEVGKTLVTDKDGLSYGAYVLQH  389
            P  L+R+LR+LT+Y +            DA ER Y +  V K L  ++DG+S  A  L +
Sbjct  72   PVMLDRILRLLTAYSVLTCSNRTLPGGGDAVERTYGLGPVCKYLTKNEDGVSIAALCLMN  131

Query  390  HQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKA  569
                +M++W  + +A++D  I PF K  G + + Y+G +P  N +    MS  S   MK 
Sbjct  132  QDKVLMESWYHLKDAILDGGI-PFNKAYGMSAFEYHGTDPRFNKVFNNGMSNHSTITMKK  190

Query  570  FLDSYQGFKGVTRLVDV  620
             L++Y+GF+G+T LVDV
Sbjct  191  ILETYKGFEGLTSLVDV  207



>ref|XP_010671332.1| PREDICTED: caffeic acid 3-O-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=365

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 100/177 (56%), Gaps = 6/177 (3%)
 Frame = +3

Query  102  PMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPN-LERLLRMLTSYGIFR  278
            PM L AVI L+V + I + G NA LS +EI++  LPS   DA   L+R+LR+L SY I  
Sbjct  30   PMVLKAVIELDVLEIIKRAGPNAQLSPAEIVAQ-LPSKNPDAATMLDRMLRLLASYSILS  88

Query  279  EHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLVHEAVVDSS  449
              +        ER Y +  V + L  ++DG++ GA  L +    +M++W  + +AV+D  
Sbjct  89   YSLRTLPDGKVERLYGLAPVCQFLTKNQDGVTLGALSLMNQDKILMESWYHLKDAVLDGG  148

Query  450  IEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQGFKGVTRLVDV  620
            I PF K  G   + Y+G +P  N +    MS  S   MK  LD+Y+GF+G++ LVDV
Sbjct  149  I-PFNKAYGMTAFEYHGTDPRFNKVFNNGMSNHSTITMKRILDTYKGFEGLSTLVDV  204



>gb|KHF97352.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
 gb|KHG01818.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
 gb|KHG22578.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=286

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 103/186 (55%), Gaps = 6/186 (3%)
 Frame = +3

Query  75   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNL-ERLLR  251
            + LAN + +PM L + + LN+ D I   G  A LS S+I +S LPS   DAP L +R+LR
Sbjct  15   VRLANAVVLPMVLKSALELNIIDTILAAGDGAFLSPSQI-ASALPSKNPDAPVLLDRMLR  73

Query  252  MLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPL  422
            +L S+ I +  + A   +  ER Y    + K LV ++DG S    +L HH    M++W  
Sbjct  74   LLASHSILKCSVKAKEKEEIERLYGAGPLCKFLVKNQDGGSIAPLLLLHHDQVFMQSWYH  133

Query  423  VHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQGFKGV  602
            +++A+++  + PF K  G   + Y G +   N +  +AMS  +   M+  +D Y+GF G+
Sbjct  134  LNDAILEGGV-PFSKAYGMTAFEYPGTDQRFNRVFNQAMSNHTALIMREIVDVYKGFDGL  192

Query  603  TRLVDV  620
              LVDV
Sbjct  193  KVLVDV  198



>gb|ACY06328.1| S-adenosyl-L-methionine: caffeic acid 3-0-methyltransferase [Medicago 
sativa]
Length=365

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 70/195 (36%), Positives = 106/195 (54%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L + + L++ + I + G  A +S  EI +S LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMILKSALELDLLEIIAKAGPGAQISPIEI-ASQLPTTNPDA  73

Query  228  P-NLERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L  Y I    +        +R Y +  V K LV ++DG+S  A  L +  
Sbjct  74   PVMLDRMLRLLACYNILTCSVRTQQDGKVQRLYGLATVAKYLVKNEDGVSISALNLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV+D  I PF K  G   + Y+G +P  N +  K MS  S   MK  L
Sbjct  134  KVLMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y GF+G+  LVDV
Sbjct  193  ETYTGFEGLKSLVDV  207



>gb|AFK39562.1| unknown [Lotus japonicus]
Length=359

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/192 (36%), Positives = 99/192 (52%), Gaps = 4/192 (2%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  MELA   SVPM L + + L V + I + G  A LS SEI+S +      DA
Sbjct  13   SDEEALLFAMELAGASSVPMVLKSALDLGVIETIAKAGPGAYLSPSEIVSQIPSIKNPDA  72

Query  228  PN-LERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAM  404
            P+ L RLLR+L SY I          ER Y +    K  V ++DG+S  +  L  H   +
Sbjct  73   PSMLNRLLRLLASYNILT--FQGSEPERHYGLSPYAKYFVNNQDGVSMISSFLMQHDKVL  130

Query  405  MKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSY  584
               W  + +++ +  + PF    G   + ++GKNP  N++  K MS  S   MK  L++Y
Sbjct  131  KDMWYHLTDSIQEGGL-PFDNAYGMTSFEFHGKNPRFNNIFNKGMSDYSTIIMKKVLETY  189

Query  585  QGFKGVTRLVDV  620
             GF+G+  +VDV
Sbjct  190  TGFEGLGSVVDV  201



>gb|AGG91492.1| caffeic acid 3-O-methyltransferase [Betula platyphylla]
Length=365

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/195 (36%), Positives = 110/195 (56%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L + I L++ + + + G  A LS SE+ +S LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMILKSAIELDLLEIMAKAGPGAYLSPSEV-ASQLPTTNPDA  73

Query  228  P-NLERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L SY +    +        ER Y +  V K L  ++DG+S  A  L +  
Sbjct  74   PVMLDRILRLLASYSVLTYSLRTLPDGRVERLYGLGPVCKFLTKNEDGVSIAALNLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV++  I PF K +G   + Y+GK+   N +  K MS  S   MK  L
Sbjct  134  KVLMESWYYLKDAVLEGGI-PFNKAHGMTSFEYHGKDLRFNKVFNKGMSDHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y+GF+G+T +VDV
Sbjct  193  ETYKGFEGLTSVVDV  207



>ref|XP_003634161.1| PREDICTED: caffeic acid 3-O-methyltransferase [Vitis vinifera]
Length=364

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/196 (34%), Positives = 110/196 (56%), Gaps = 6/196 (3%)
 Frame = +3

Query  45   ESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGD  224
            ESD  A L  M+L +   +PM L + + L++ + I + G  A +S SEI + + P+   +
Sbjct  13   ESDEEASLFSMQLVSASVLPMVLKSALELDLLEIIAKAGPGAFVSTSEIAAQI-PTHNPE  71

Query  225  AP-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHH  392
            AP  L+R+LR+L +Y + +    ++     ER Y +  V K L  ++DG+S    +L + 
Sbjct  72   APVMLDRILRLLATYAVVKCSLRNLPDGGVERLYGLAPVCKYLTRNEDGVSVAPLLLMNQ  131

Query  393  QAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAF  572
               +M++W  + +AV+D  I PF K  G   + Y+G +P  N +    MSG S   MK  
Sbjct  132  DKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNNGMSGHSTITMKKI  190

Query  573  LDSYQGFKGVTRLVDV  620
            L++Y+GF+G+T +VDV
Sbjct  191  LEAYKGFEGLTSIVDV  206



>gb|ABR18380.1| unknown [Picea sitchensis]
Length=365

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/208 (33%), Positives = 108/208 (52%), Gaps = 14/208 (7%)
 Frame = +3

Query  36   MGSESDNGA-RLRI---------MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSAS  185
            MGS S+N    ++I         MEL N   +PM + A I L+V   I   G+   LS  
Sbjct  1    MGSASENSEMNMKIVNEDEWLLGMELGNFSCLPMGMKAAIELDVLQIIANAGNGVQLSPR  60

Query  186  EILSSVLPSGGGDAPNLERLLRMLTSYGIFREHINAD---ASERRYSVDEVGKTLVTDKD  356
            +I++ +  +    A  L+R+LR+L S+ +    +  D    +ER Y +  + K LV ++D
Sbjct  61   QIVAHIPTTNPDAAITLDRILRVLASHSVLSCSVTTDENGKAERLYGLTPLCKYLVNNQD  120

Query  357  GLSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKA  536
            G+S    VL +    +M+ W  + +AV++ S +PF K +G   + Y   +   N L  ++
Sbjct  121  GVSLAPLVLMNQDKVLMETWYYLKDAVLEGS-QPFTKAHGMNAFEYTAMDQRFNRLFNRS  179

Query  537  MSGISVPFMKAFLDSYQGFKGVTRLVDV  620
            MS  S+  M   +DSYQGFK V +LVDV
Sbjct  180  MSEYSIMLMNKIMDSYQGFKEVLKLVDV  207



>ref|XP_002525818.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF36570.1| o-methyltransferase, putative [Ricinus communis]
Length=365

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 109/195 (56%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L + I L++ + + + G +A LS SEI +S LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSAIELDLLEIMAKAGPSAFLSPSEI-ASQLPTKNPDA  73

Query  228  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L SY +    +        ER Y +  V K L+ ++DG+S     L +  
Sbjct  74   PVMLDRILRLLASYNVLTCSLRTLPDGKVERLYGLAPVCKFLIKNEDGVSIAPLCLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV+   I PF K  G   + Y+G +P  N +  + MS  S   MK  L
Sbjct  134  KVLMESWYYLKDAVLLGGI-PFNKAYGMTAFDYHGTDPRFNKVFNRGMSDHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y+GF+G+T +VDV
Sbjct  193  ETYKGFEGLTSVVDV  207



>gb|ABO41840.1| putative caffeic acid methyltransferase [Gossypium arboreum]
Length=358

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 103/186 (55%), Gaps = 6/186 (3%)
 Frame = +3

Query  75   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNL-ERLLR  251
            + LAN + +PM L + + LN+ D I   G  A LS S+I +S LPS   DAP L +R+LR
Sbjct  15   VRLANAVVLPMVLKSALELNIIDTILAAGDGAFLSPSQI-ASALPSKNPDAPVLLDRMLR  73

Query  252  MLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPL  422
            +L S+ I +  + A   +  ER Y    + K LV ++DG S    +L HH    M++W  
Sbjct  74   LLASHSILKCSVKAKEKEEIERLYGAGPLCKFLVKNQDGGSIAPLLLLHHDQVFMQSWYH  133

Query  423  VHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQGFKGV  602
            +++A+++  + PF K  G   + Y G +   N +  +AMS  +   M+  +D Y+GF G+
Sbjct  134  LNDAILEGGV-PFSKAYGMTAFEYPGTDQRFNRVFNQAMSNHTALIMRKIVDVYKGFDGL  192

Query  603  TRLVDV  620
              LVDV
Sbjct  193  KVLVDV  198



>sp|Q8W013.1|COMT1_CATRO RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Catharanthus roseus]
 gb|AAK20170.1| caffeic acid O-methyltransferase [Catharanthus roseus]
Length=363

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 111/197 (56%), Gaps = 6/197 (3%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  221
            ++ +  A L  M LA+   +PM L + I L++ + I + G  A +S SE L++ LP+   
Sbjct  13   TKEEEEACLSAMRLASASVLPMVLKSAIELDLLELIKKSGPGAYVSPSE-LAAQLPTQNP  71

Query  222  DAP-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQH  389
            DAP  L+R+LR+L SY +     + +     ER YS+  V K L  ++DG+S  A +L +
Sbjct  72   DAPVMLDRILRLLASYSVLNCTLKDLPDGGIERLYSLAPVCKFLTKNEDGVSMAALLLMN  131

Query  390  HQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKA  569
                +M++W  + +AV++  I PF K  G   + Y+GK+P  N +  + MS  S   MK 
Sbjct  132  QDKVLMESWYHLKDAVLEGGI-PFNKAYGMTAFEYHGKDPRFNKVFNQGMSNHSTIIMKK  190

Query  570  FLDSYQGFKGVTRLVDV  620
             L+ YQGF+G+  +VDV
Sbjct  191  ILEIYQGFQGLKTVVDV  207



>dbj|BAC78827.1| caffeic acid O-methyltransferase [Rosa chinensis var. spontanea]
Length=365

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 109/195 (56%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L A I L++ + + + G  A LS ++ L+S LP+   +A
Sbjct  15   SDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGAFLSPND-LASQLPTKNPEA  73

Query  228  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L SY I    +        ER Y +  V K L  ++DG+S  A  L +  
Sbjct  74   PVMLDRMLRLLASYSILTYSLRTLPDGKVERLYGLGPVCKFLTKNEDGVSIAALCLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              ++++W  + +AV+D  I PF K  G   + Y+G +P  N +  K M+  S   MK  L
Sbjct  134  KVLVESWYHLKDAVLDGGI-PFNKAYGMTAFDYHGTDPRFNKVFNKGMADHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y+GF+G+T +VDV
Sbjct  193  ETYKGFEGLTSIVDV  207



>gb|AEV93478.1| caffeic acid O-methyltransferase [Caragana korshinskii]
Length=365

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 107/195 (55%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L + + L++ + I + G  A LS ++I +S LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSALELDLLEIIAKAGPGAHLSPNDI-ASQLPTNNPDA  73

Query  228  P-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L  Y IF      +     +R Y +  V K L+ ++DG+S  A  L +  
Sbjct  74   PIMLDRMLRLLACYNIFTCSLRTLQDGKVQRLYGLAPVAKYLIKNEDGVSLSALNLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  K MS  S   MK  L
Sbjct  134  KVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            + Y GF+G+  LVDV
Sbjct  193  ELYTGFEGLKSLVDV  207



>sp|Q8GU25.1|COMT1_ROSCH RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Rosa chinensis]
 emb|CAD29457.1| caffeic acid O-methyltransferase [Rosa chinensis]
Length=365

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 109/195 (56%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L A I L++ + + + G  A LS ++ L+S LP+   +A
Sbjct  15   SDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGAFLSPND-LASQLPTKNPEA  73

Query  228  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L SY I    +        ER Y +  V K L  ++DG+S  A  L +  
Sbjct  74   PVMLDRMLRLLASYSILTYSLRTLPDGKVERLYGLGPVCKFLTKNEDGVSIAALCLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              ++++W  + +AV+D  I PF K  G   + Y+G +P  N +  K M+  S   MK  L
Sbjct  134  KVLVESWYHLKDAVLDGGI-PFNKAYGMTAFDYHGTDPRFNKVFNKGMADHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y+GF+G+T +VDV
Sbjct  193  ETYKGFEGLTSIVDV  207



>sp|P28002.1|COMT1_MEDSA RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Medicago sativa]
 pdb|1KYW|A Chain A, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase In Complex With 5- Hydroxyconiferaldehyde
 pdb|1KYW|C Chain C, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase In Complex With 5- Hydroxyconiferaldehyde
 pdb|1KYW|F Chain F, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase In Complex With 5- Hydroxyconiferaldehyde
 pdb|1KYZ|A Chain A, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase Ferulic Acid Complex
 pdb|1KYZ|C Chain C, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase Ferulic Acid Complex
 pdb|1KYZ|E Chain E, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase Ferulic Acid Complex
 gb|AAB46623.1| S-adenosyl-L-methionine: caffeic acid 3-0-methyltransferase [Medicago 
sativa]
Length=365

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 70/195 (36%), Positives = 106/195 (54%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L + + L++ + I + G  A +S  EI +S LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMILKSALELDLLEIIAKAGPGAQISPIEI-ASQLPTTNPDA  73

Query  228  P-NLERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L  Y I    +        +R Y +  V K LV ++DG+S  A  L +  
Sbjct  74   PVMLDRMLRLLACYIILTCSVRTQQDGKVQRLYGLATVAKYLVKNEDGVSISALNLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV+D  I PF K  G   + Y+G +P  N +  K MS  S   MK  L
Sbjct  134  KVLMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y GF+G+  LVDV
Sbjct  193  ETYTGFEGLKSLVDV  207



>gb|ABO41845.1| putative caffeic acid methyltransferase [Gossypium hirsutum]
Length=358

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 103/186 (55%), Gaps = 6/186 (3%)
 Frame = +3

Query  75   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNL-ERLLR  251
            + LAN + +PM L + + LN+ D I   G  A LS S+I +S LPS   DAP L +R+LR
Sbjct  15   VRLANAVVLPMVLKSALELNIIDTILAAGDGAFLSPSQI-ASALPSKNPDAPVLLDRMLR  73

Query  252  MLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPL  422
            +L S+ I +  + A   +  ER Y    + K LV ++DG S    +L HH    M++W  
Sbjct  74   LLASHSILKCAVKAKEKEEIERLYGAGPLCKFLVKNQDGGSIAPLLLLHHDQVFMQSWYH  133

Query  423  VHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQGFKGV  602
            +++A+++  + PF K  G   + Y G +   N +  +AMS  +   M+  +D Y+GF G+
Sbjct  134  LNDAILEGGV-PFSKAYGMTAFEYPGTDQRFNRVFNQAMSNHTALIMRKIVDVYKGFDGL  192

Query  603  TRLVDV  620
              LVDV
Sbjct  193  KVLVDV  198



>gb|AFK45226.1| unknown [Lotus japonicus]
Length=359

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 69/192 (36%), Positives = 98/192 (51%), Gaps = 4/192 (2%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  MELA   SVPM L + + L V + I + G  A LS SEI S +      DA
Sbjct  13   SDEEALLFAMELAGASSVPMVLKSALDLGVIETIAKAGPGAYLSPSEIASQIPSIKNPDA  72

Query  228  PN-LERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAM  404
            P+ L RLLR+L SY I          ER Y +    K  V ++DG+S  +  L  H   +
Sbjct  73   PSMLNRLLRLLASYNILT--FQGSEPERHYGLSPYAKYFVNNQDGVSMISSFLMQHDKVL  130

Query  405  MKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSY  584
               W  + +++ +  + PF    G   + ++GKNP  N++  K MS  S   MK  L++Y
Sbjct  131  KDMWYHLTDSIQEGGL-PFDNAYGMTSFEFHGKNPRFNNIFNKGMSDYSTIIMKKVLETY  189

Query  585  QGFKGVTRLVDV  620
             GF+G+  +VDV
Sbjct  190  TGFEGLGSVVDV  201



>gb|ABO41834.1| putative caffeic acid methyltransferase [Gossypium raimondii]
Length=358

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 102/186 (55%), Gaps = 6/186 (3%)
 Frame = +3

Query  75   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNL-ERLLR  251
            + LAN + +PM L + + LN+ D I   G  A LS S+I +S LPS   DAP L +R+LR
Sbjct  15   VRLANAVVLPMVLKSALELNIIDTISAAGDGAFLSPSQI-ASALPSKNPDAPVLLDRMLR  73

Query  252  MLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPL  422
            +L S+ I +  + A      ER Y    + K LV ++DG S    +L HH    M++W  
Sbjct  74   LLASHSILKCSVKAKEKGEIERLYGAGPLCKFLVKNQDGGSIAPLLLLHHDQVFMQSWYH  133

Query  423  VHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQGFKGV  602
            +++A+++  + PF K  G   + Y G +   N +  +AMS  +   M+  +D Y+GF G+
Sbjct  134  LNDAILEGGV-PFSKAYGMTAFEYPGTDQRFNRVFNQAMSNHTALIMRKIVDVYKGFDGL  192

Query  603  TRLVDV  620
              LVDV
Sbjct  193  KVLVDV  198



>gb|AFK39235.1| unknown [Medicago truncatula]
Length=365

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 106/195 (54%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L + + L++ + I + G  A +S  EI +S LP+   +A
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSALELDLLEIIAKAGPGAQISPIEI-ASQLPTTNPEA  73

Query  228  P-NLERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L  Y I    +        +R Y +  V K LV ++DG+S  A  L +  
Sbjct  74   PVMLDRILRLLACYNILTCSVRTQQDGKVQRLYGLATVAKYLVKNEDGVSISALNLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV+D  I PF K  G   + Y+G +P  N +  K MS  S   MK  L
Sbjct  134  KVLMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y GF+G+  LVDV
Sbjct  193  ETYTGFEGLKSLVDV  207



>ref|XP_003602396.1| Caffeic acid O-methyltransferase [Medicago truncatula]
 gb|AES72647.1| caffeic acid O-methyltransferase [Medicago truncatula]
Length=365

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 106/195 (54%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L + + L++ + I + G  A +S  EI +S LP+   +A
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSALELDLLEIIAKAGPGAQISPIEI-ASQLPTTNPEA  73

Query  228  P-NLERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L  Y I    +        +R Y +  V K LV ++DG+S  A  L +  
Sbjct  74   PVMLDRILRLLACYNILTCSVRTQQDGKVQRLYGLATVAKYLVKNEDGVSISALNLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV+D  I PF K  G   + Y+G +P  N +  K MS  S   MK  L
Sbjct  134  KVLMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y GF+G+  LVDV
Sbjct  193  ETYTGFEGLKSLVDV  207



>emb|CDY70033.1| BnaCnng66420D [Brassica napus]
Length=230

 Score =   108 bits (269),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +3

Query  405  MKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSY  584
            M+AWPLVH AVV+   EP+VK NGEA Y+ YGK  EMN LMQKAMSG+SVPFMKA LD Y
Sbjct  1    MRAWPLVHTAVVEPETEPYVKANGEAAYAQYGKCEEMNGLMQKAMSGVSVPFMKAILDGY  60

Query  585  QGFKGVTRLVDV  620
             GFK V  LVDV
Sbjct  61   DGFKYVEHLVDV  72



>gb|ABI54119.1| caffeic acid O-methyltransferase [Malus domestica]
Length=365

 Score =   110 bits (274),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 70/195 (36%), Positives = 107/195 (55%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L A I L++ + + + G  A +S ++ LSS LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGAFVSPAD-LSSQLPTKNPDA  73

Query  228  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L SY I    +        ER Y +  V K L   +DG S G+  L +  
Sbjct  74   PVMLDRMLRVLASYSILTYSLRTLPDGKVERLYGLGPVCKFLTKSEDGASIGSLCLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  K M+  S   MK  L
Sbjct  134  KVLMESWYNLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMADHSTITMKKLL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y GF+G+T +VDV
Sbjct  193  ENYNGFEGLTSIVDV  207



>dbj|BAA13683.1| O-methyltransferase [Glycyrrhiza echinata]
Length=367

 Score =   110 bits (274),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 70/195 (36%), Positives = 106/195 (54%), Gaps = 5/195 (3%)
 Frame = +3

Query  45   ESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGS-NAPLSASEILSSV-LPSGG  218
            ++++GA L  M L   +  P  L A I LN+ + I +     A +SASEI S + LP+  
Sbjct  19   QTEDGACLSAMRLVTNLVYPAVLNAAIDLNLFEIIAKATPPGAFMSASEIASKLPLPTQH  78

Query  219  GDAPN-LERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
             D PN L+R+LR+L SY +        ++ER Y + +VGK LV D       ++      
Sbjct  79   SDLPNRLDRMLRLLASYSVLT--CATRSTERVYGLSQVGKYLVPDGSRGYLASFTTFLCY  136

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
             A+M  W    EAVVD  I+ F K++G + Y Y   +P+MN +  K+M+ +    MK  L
Sbjct  137  PALMNVWLNFKEAVVDEDIDLFKKLHGVSKYEYMETDPKMNHIFNKSMADVCATEMKRIL  196

Query  576  DSYQGFKGVTRLVDV  620
              Y+GF+G++ LVDV
Sbjct  197  QIYKGFEGISTLVDV  211



>dbj|BAO79380.1| 5-hydroxyconiferylaldehyde O-methyltransferase [Anthriscus sylvestris]
Length=365

 Score =   110 bits (274),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 108/197 (55%), Gaps = 6/197 (3%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  221
            ++ +  A +  M+LA+   +PM L + I LN+ +AI + G  A +S SE L++ LPS   
Sbjct  15   NDEEEEACMFAMQLASASVLPMVLKSAIELNLLEAIAKAGPGAYVSPSE-LAAGLPSSQP  73

Query  222  DAP-NLERLLRMLTSYGIFREHIN---ADASERRYSVDEVGKTLVTDKDGLSYGAYVLQH  389
            D P  L+R+LR+L SY + +  +        ER Y +  V K L  + DG+S    +L +
Sbjct  74   DTPVMLDRILRLLASYSVLKCQLRDLPHGRVERLYGLAPVCKFLTKNSDGVSMAPLLLMN  133

Query  390  HQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKA  569
                +M++W  + +AV+D  I PF K  G   + Y+GK+P  N +  + MS  S   MK 
Sbjct  134  QDKILMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGKDPRFNKVFNQGMSNHSTITMKK  192

Query  570  FLDSYQGFKGVTRLVDV  620
             L++Y GF G+  LVDV
Sbjct  193  ILETYNGFGGLETLVDV  209



>gb|ABK21417.1| unknown [Picea sitchensis]
Length=365

 Score =   109 bits (273),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 62/185 (34%), Positives = 98/185 (53%), Gaps = 4/185 (2%)
 Frame = +3

Query  75   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLERLLRM  254
            MEL N   +PM++ A + L+V   I   G+   LS  +I++ +  +    A  L+R+LR+
Sbjct  25   MELGNFSCLPMAMKAAVELDVLQIIANAGNGVQLSPRQIVAHIPTTNPDAAITLDRILRV  84

Query  255  LTSYGIFREHINAD---ASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLV  425
            L S+ +    +  D    +ER Y +  + K LV ++DG+S    VL +     M+ W  +
Sbjct  85   LASHSVLSCSVTTDENGKAERLYGLTPLCKYLVKNQDGVSLAPLVLINQDKVFMETWYYL  144

Query  426  HEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQGFKGVT  605
             +AV++ S +PF K +G   + Y   +   N L  ++MSG S   M   +DSYQGFK V 
Sbjct  145  KDAVLEGS-QPFTKAHGMNAFEYTAMDQRFNRLFNRSMSGHSTMLMNKIMDSYQGFKEVQ  203

Query  606  RLVDV  620
             LVDV
Sbjct  204  ELVDV  208



>emb|CDY43839.1| BnaC03g14720D [Brassica napus]
Length=364

 Score =   109 bits (273),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 71/196 (36%), Positives = 113/196 (58%), Gaps = 9/196 (5%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            +D+ A L  M+LA+   +PM L + + L++ + + +  S  P+S SEI +S L +   +A
Sbjct  15   TDDEAALFAMQLASASVLPMVLKSALDLDLLEIMAKNSS--PMSPSEI-ASKLQTKNPEA  71

Query  228  P-NLERLLRMLTSYGIF----REHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHH  392
            P  L+R+LR+LTSY I     R     D+ ER Y +  V K L  ++DG+S  A  L + 
Sbjct  72   PVMLDRILRLLTSYSILTCSNRTIPGGDSVERIYGLGPVCKYLTKNEDGVSIAALCLMNQ  131

Query  393  QAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAF  572
               +M++W  + +AV+D  I PF K  G + + Y+GK+   N++    MS  S   MK  
Sbjct  132  DKVLMESWYHLKDAVLDGGI-PFNKAYGMSAFEYHGKDLRFNTVFNNGMSNHSTITMKKI  190

Query  573  LDSYQGFKGVTRLVDV  620
            L++Y+GF+G+T LVDV
Sbjct  191  LETYKGFEGLTSLVDV  206



>ref|XP_010482824.1| PREDICTED: flavone 3'-O-methyltransferase 1 [Camelina sativa]
Length=363

 Score =   109 bits (273),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 71/195 (36%), Positives = 115/195 (59%), Gaps = 8/195 (4%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            +D+ A L  M+LA+   +PM+L A + L++ + + +  S  P+S +EI +S LP+   +A
Sbjct  15   TDDEAALFAMQLASASVLPMALKAALDLDLLEIMAKNAS--PMSPTEI-ASQLPTKNPEA  71

Query  228  P-NLERLLRMLTSYGIF---REHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+LTSY I       ++ D+ ER Y +  V K L  ++DG+S  A  L +  
Sbjct  72   PVMLDRILRLLTSYSILTCSNRKLSGDSVERIYGLGPVCKYLTKNEDGVSIAALCLMNQD  131

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV+D  I PF K  G + + Y+G +P  N +    MS  S   MK  L
Sbjct  132  KVLMESWYHLKDAVLDGGI-PFNKAYGMSAFEYHGTDPRFNKVFNNGMSNHSTITMKKLL  190

Query  576  DSYQGFKGVTRLVDV  620
            ++Y+GF+G+T LVDV
Sbjct  191  ETYKGFEGLTSLVDV  205



>gb|ACD56610.1| putative caffeic acid protein [Gossypioides kirkii]
Length=358

 Score =   109 bits (272),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 65/186 (35%), Positives = 101/186 (54%), Gaps = 6/186 (3%)
 Frame = +3

Query  75   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNL-ERLLR  251
            + LAN + +PM L + + LN+ D I   G    LS S+I +S LPS   DAP L +R+LR
Sbjct  15   VRLANAVVLPMVLKSALELNIIDTISAAGDGTFLSPSQI-ASCLPSKNPDAPVLLDRMLR  73

Query  252  MLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPL  422
            +L S+ I +  + A      ER Y    + K LV ++DG S    +L HH    M++W  
Sbjct  74   LLASHSILKCSVKAKEKGEIERLYGAGPLCKFLVKNQDGGSIAPLLLLHHDQVFMQSWYH  133

Query  423  VHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQGFKGV  602
            +++A+++  + PF K  G   + Y G +   N +  +AMS  +   M+  +D Y+GF G+
Sbjct  134  LNDAILEGGV-PFSKAYGMTAFEYPGTDQRFNRVFNQAMSNHTTLIMRKIVDVYKGFDGL  192

Query  603  TRLVDV  620
              LVDV
Sbjct  193  KVLVDV  198



>ref|XP_007032646.1| Caffeic acid 3-O-methyltransferase 1 [Theobroma cacao]
 gb|EOY03572.1| Caffeic acid 3-O-methyltransferase 1 [Theobroma cacao]
Length=365

 Score =   109 bits (273),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 64/201 (32%), Positives = 112/201 (56%), Gaps = 6/201 (3%)
 Frame = +3

Query  30   GAMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLP  209
            G   +E D  +    M++ +   +PMS+ A I+L + D I + G NA  S  EI ++ LP
Sbjct  11   GNNNAEQDQESFSYAMQIVSSSVLPMSMHAAIQLELFDIIAKAGPNAKFSPKEI-AAQLP  69

Query  210  SGGGDAPN-LERLLRMLTSYGIFREHI---NADASERRYSVDEVGKTLVTDKDGLSYGAY  377
                +AP+ L+R+LR+L S+GI    +     +  +R YS+  V K  V ++DG+S+G  
Sbjct  70   CKNPEAPSMLDRILRVLASHGIVGCSVVDEEGNNPQRLYSLTPVSKFFVRNEDGVSFGPL  129

Query  378  VLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVP  557
            +        + +W  + +AV++  + PF +V+G   + Y+GK+P +N +   AM   +  
Sbjct  130  MALTQDKVSLDSWSHLKDAVLEGGV-PFDRVHGTHAFEYFGKDPRLNQVFNTAMINHATI  188

Query  558  FMKAFLDSYQGFKGVTRLVDV  620
             +K  L++Y+GFK + R+VDV
Sbjct  189  IVKKILETYKGFKQLNRVVDV  209



>ref|XP_009132451.1| PREDICTED: flavone 3'-O-methyltransferase 1 [Brassica rapa]
 emb|CDY43052.1| BnaA03g11990D [Brassica napus]
Length=364

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 70/196 (36%), Positives = 113/196 (58%), Gaps = 9/196 (5%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            +D+ A L  M+LA+   +PM L + + L++ + + +  S  P+S SEI +S L +   +A
Sbjct  15   TDDEAALFAMQLASASVLPMVLKSALDLDLLEIMAKNSS--PMSPSEI-ASKLQTKNPEA  71

Query  228  P-NLERLLRMLTSYGIF----REHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHH  392
            P  L+R+LR+LTSY I     R     D+ ER Y +  V K L  ++DG+S  A  L + 
Sbjct  72   PVMLDRILRLLTSYSILTCSNRTIPGGDSVERIYGLGPVCKYLTKNEDGVSIAALCLMNQ  131

Query  393  QAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAF  572
               +M++W  + +A++D  I PF K  G + + Y+GK+   N++    MS  S   MK  
Sbjct  132  DKVLMESWYHLKDAILDGGI-PFNKAYGMSAFEYHGKDLRFNTVFNNGMSNHSTITMKKI  190

Query  573  LDSYQGFKGVTRLVDV  620
            L++Y+GF+G+T LVDV
Sbjct  191  LETYKGFEGLTSLVDV  206



>gb|ACT32029.1| caffeic acid O-methyltransferase 2 [Gossypium hirsutum]
Length=365

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 68/195 (35%), Positives = 106/195 (54%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+L +   +PM L + I L++ + + + G  A LS  E L+S LP+   DA
Sbjct  15   SDEEANLFAMQLTSASVLPMVLKSAIELDLLEIMAKAGPGAFLSPKE-LASQLPTSNPDA  73

Query  228  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L +Y I    +        ER Y +  V K L  ++DG++  A  L +  
Sbjct  74   PVMLDRILRLLATYSILTCSLRTLPDGKVERLYGLGPVCKFLTKNEDGVTLSALSLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV++  I PF KV G   + Y+G +P  N +  + MS  S   MK  L
Sbjct  134  KVLMESWYYLKDAVLEGGI-PFNKVYGMTAFEYHGTDPRFNKVFNRGMSDHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y GF+G+  LVDV
Sbjct  193  ETYDGFEGLKTLVDV  207



>gb|AAC18863.1| caffeic acid 3-O-methyltransferase [Mesembryanthemum crystallinum]
Length=350

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/177 (38%), Positives = 100/177 (56%), Gaps = 6/177 (3%)
 Frame = +3

Query  102  PMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPN-LERLLRMLTSYGIFR  278
            PM L AVI L+V + I + G  A LS +EI ++ LP+   DA   L+R+LR+L SY I  
Sbjct  18   PMVLKAVIELDVLEIIKRAGPGAQLSPAEI-ANQLPTKNPDAATMLDRMLRLLASYSILS  76

Query  279  EHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLVHEAVVDSS  449
              +   +    ER Y +  V + L  ++DG++ GA  L +    +M++W  + +AV+D  
Sbjct  77   YSLRTLSDGRVERLYGLAPVCQFLTKNQDGVTLGALSLMNQDKILMESWYHLKDAVLDGG  136

Query  450  IEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQGFKGVTRLVDV  620
            I PF K  G + + Y+G +P  N +    MS  S   MK  LD YQGF+G++ LVDV
Sbjct  137  I-PFNKAYGMSAFEYHGTDPRFNKVFNSGMSNHSTITMKKILDDYQGFEGLSTLVDV  192



>gb|AHM25237.1| noraucuparin O-methyltransferase [Sorbus aucuparia]
Length=365

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 107/195 (55%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L A I L++ + + + G  A +S ++ L+S LP+   DA
Sbjct  15   SDEEANLFAMQLASGSILPMVLKAAIELDLLEVMAKAGPGAFVSPAD-LASQLPTKNPDA  73

Query  228  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L SY I    +        ER Y +  V K L  ++DG S G+  L +  
Sbjct  74   PVMLDRMLRLLASYSILTYSLRTLPDGKVERLYGLGPVCKFLTKNEDGASIGSLCLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  K M+  S   MK  L
Sbjct  134  KVLMESWYHLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMADHSTITMKKLL  192

Query  576  DSYQGFKGVTRLVDV  620
            + Y GF+G+T +VDV
Sbjct  193  EIYNGFEGLTSIVDV  207



>ref|XP_010446534.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Camelina sativa]
Length=363

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 70/195 (36%), Positives = 115/195 (59%), Gaps = 8/195 (4%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            +D+ A L  M+LA+   +PM+L A + L++ + + +  S  P+S +EI +S LP+   +A
Sbjct  15   TDDEAALFAMQLASASVLPMALKAALDLDLLEIMAKNAS--PMSPTEI-ASQLPTKNPEA  71

Query  228  P-NLERLLRMLTSYGIF---REHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+LTSY +       ++ D+ ER Y +  V K L  ++DG+S  A  L +  
Sbjct  72   PVMLDRILRLLTSYSVLTCSNRKLSGDSVERIYGLGPVCKYLTKNEDGVSIAALCLMNQD  131

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV+D  I PF K  G + + Y+G +P  N +    MS  S   MK  L
Sbjct  132  KVLMESWYHLKDAVLDGGI-PFNKAYGMSAFEYHGTDPRFNKVFNNGMSNHSTITMKKLL  190

Query  576  DSYQGFKGVTRLVDV  620
            ++Y+GF+G+T LVDV
Sbjct  191  ETYKGFEGLTSLVDV  205



>gb|AAF28353.1|AF220491_1 O-methyltransferase [Fragaria x ananassa]
Length=365

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 68/195 (35%), Positives = 108/195 (55%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L A I L++ + + + G  + LS S+ L+S LP+   +A
Sbjct  15   SDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGSFLSPSD-LASQLPTKNPEA  73

Query  228  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L SY I    +        ER Y +  V K L  ++DG+S  A  L +  
Sbjct  74   PVMLDRMLRLLASYSILTCSLRTLPDGKVERLYCLGPVCKFLTKNEDGVSIAALCLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              ++++W  + +AV+D  I PF K  G   + Y+G +P  N +  K M+  S   MK  L
Sbjct  134  KVLVESWYHLKDAVLDGGI-PFNKAYGMTAFDYHGTDPRFNKVFNKGMADHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y+GF+G+  +VDV
Sbjct  193  ETYKGFEGLKSIVDV  207



>gb|ABO41846.1| putative caffeic acid methyltransferase [Gossypium hirsutum]
Length=345

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/186 (35%), Positives = 102/186 (55%), Gaps = 6/186 (3%)
 Frame = +3

Query  75   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNL-ERLLR  251
            + LAN + +PM L + + LN+ D I   G  A LS S+I +S LPS   DAP L +R+LR
Sbjct  15   VRLANAVILPMVLKSALELNIIDTILAAGDGAFLSPSQI-ASALPSKNPDAPVLLDRMLR  73

Query  252  MLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPL  422
            +L S+ I +  + A   +  ER Y    + K LV ++DG S    ++ HH    M++W  
Sbjct  74   LLASHSILKCSVKAKEKEEIERLYGAGPLCKFLVKNQDGGSIAPLLVLHHDQVFMQSWYH  133

Query  423  VHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQGFKGV  602
            +++A+++    PF K  G   + Y G +   N +  +AMS  +   M+  +D Y+GF G+
Sbjct  134  LNDAILEGGF-PFSKAYGMTAFEYPGTDQRFNRVFNQAMSNHTALIMREIVDVYKGFDGL  192

Query  603  TRLVDV  620
              LVDV
Sbjct  193  KVLVDV  198



>ref|XP_010442991.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Camelina sativa]
Length=363

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 70/195 (36%), Positives = 115/195 (59%), Gaps = 8/195 (4%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            +D+ A L  M+LA+   +PM+L A + L++ + + +  S  P+S +EI +S LP+   +A
Sbjct  15   TDDEAALFAMQLASASVLPMALKAALDLDLLEIMAKNAS--PMSPTEI-ASQLPTKNPEA  71

Query  228  P-NLERLLRMLTSYGIF---REHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+LTSY +       ++ D+ ER Y +  V K L  ++DG+S  A  L +  
Sbjct  72   PVMLDRILRLLTSYSVLTCSNRKLSGDSVERIYGLGPVCKYLTKNEDGVSIAALCLMNQD  131

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV+D  I PF K  G + + Y+G +P  N +    MS  S   MK  L
Sbjct  132  KVLMESWYHLKDAVLDGGI-PFNKAYGMSAFEYHGTDPRFNKVFNNGMSNHSTITMKKLL  190

Query  576  DSYQGFKGVTRLVDV  620
            ++Y+GF+G+T LVDV
Sbjct  191  ETYKGFEGLTSLVDV  205



>ref|XP_003526767.1| PREDICTED: caffeic acid 3-O-methyltransferase isoform 1 [Glycine 
max]
 gb|KHN23294.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=365

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 71/195 (36%), Positives = 106/195 (54%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L + + L++ + I + G    LS ++I SS LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSALELDLLEIIAKAGPGVHLSPTDI-SSQLPTQNPDA  73

Query  228  P-NLERLLRMLTSYGI--FREHINADAS-ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L  Y I  F      D   ER Y +  V K LV  +DG+S  A  L +  
Sbjct  74   PVMLDRILRLLACYNILSFSLRTLPDGKVERLYGLAPVAKYLVKTEDGVSIAALNLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  K M+  S   MK  L
Sbjct  134  KVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMADHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y GF+G+  LVDV
Sbjct  193  ETYTGFEGLKSLVDV  207



>ref|XP_008376825.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=365

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/195 (34%), Positives = 108/195 (55%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            +D    L  M+LAN   +PM L   + L++ + + + G  A +S+++ LSS LP+   DA
Sbjct  15   TDKETNLFAMQLANAPVLPMVLKTALELDLLEIMVKAGPGAFVSSAD-LSSQLPTKNPDA  73

Query  228  P-NLERLLRMLTSYGIFREHINA--DAS-ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L SY I    +    D + ER Y +  V K L  ++DG+S     L    
Sbjct  74   PVMLDRMLRLLASYSILTYSLRTLPDGNVERLYGLGPVCKFLTKNEDGVSIAPLCLMSQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  + M+  S   MK  L
Sbjct  134  KVLMESWYHLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMAAQSTIIMKKLL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y+GF+G+T +VDV
Sbjct  193  ETYKGFEGLTSVVDV  207



>gb|ABI54117.1| caffeic acid O-methyltransferase [Malus domestica]
Length=365

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 70/195 (36%), Positives = 106/195 (54%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L A I L++ + + + G  A +S ++ LSS LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGAFVSPAD-LSSQLPTKNPDA  73

Query  228  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L SY I    +        ER Y +  V K L    DG S G+  L +  
Sbjct  74   PVMLDRMLRVLASYSILTYSLRTLPDGKVERLYGLGPVCKFLTKSVDGASIGSLCLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  K M+  S   MK  L
Sbjct  134  KVLMESWYNLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNRVFNKGMADHSTITMKKLL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y GF+G+T +VDV
Sbjct  193  ENYNGFEGLTSIVDV  207



>ref|NP_001240003.1| uncharacterized protein LOC100780100 [Glycine max]
 gb|ACU22737.1| unknown [Glycine max]
 gb|KHN19570.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=365

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 106/195 (54%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L + + L++ + I + G    LS S+I +S LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSALELDLLEIIAKAGPGVHLSPSDI-ASRLPTHNPDA  73

Query  228  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L  Y I    +        ER Y +  V K LV ++DG+S  A  L +  
Sbjct  74   PVMLDRILRLLACYNILSFSLRTLPHGKVERLYGLAPVAKYLVRNEDGVSIAALNLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  K M+  S   MK  L
Sbjct  134  KILMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMADHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y GF+G+  LVDV
Sbjct  193  ETYTGFEGLKSLVDV  207



>gb|AAD29845.1|AF064697_1 O-methyltransferase [Thalictrum tuberosum]
Length=362

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/195 (34%), Positives = 104/195 (53%), Gaps = 4/195 (2%)
 Frame = +3

Query  45   ESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGD  224
            E +  A L  M+LA+   +PM L A I L+V + I + G  A ++ SEI S +  S    
Sbjct  13   EEEEEACLHAMQLASASVLPMVLKAAIELDVLEIIAKAGQGAYVAPSEIASQLSTSNSQA  72

Query  225  APNLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
               L+R+LR+L SY +   ++        ER Y +  V K LV ++DG+S    VL +  
Sbjct  73   PIILDRILRLLASYKVLTCNLRTLEDGGVERLYGLAPVCKFLVKNEDGVSMAPLVLMNQD  132

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV+D  I PF K  G   + Y+G +P  N +  + MS  S   MK  L
Sbjct  133  KVLMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTITMKKLL  191

Query  576  DSYQGFKGVTRLVDV  620
            + Y+GF+G+  +VDV
Sbjct  192  ELYKGFEGLKSVVDV  206



>emb|CAI30878.1| caffeate O-methyltransferase [Picea abies]
 gb|ABK23738.1| unknown [Picea sitchensis]
Length=364

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/185 (34%), Positives = 97/185 (52%), Gaps = 4/185 (2%)
 Frame = +3

Query  75   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLERLLRM  254
            MEL N   +PM + A I L+V   I   G+   LS  +I++ +  +    A  L+R+LR+
Sbjct  24   MELGNFSCLPMGMKAAIELDVLQIIANAGNGVQLSPRQIVAHIPTTNPDAAITLDRILRV  83

Query  255  LTSYGIFREHINAD---ASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLV  425
            L S+ +    +  D    +ER Y +  + K LV ++DG+S    VL +    +M +W  +
Sbjct  84   LASHSVLSCSVTTDENGKAERLYGLTPLCKYLVKNQDGVSLAPLVLMNQDKVLMDSWYYL  143

Query  426  HEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQGFKGVT  605
             +AV++ S +PF K +G   + Y  K+   N +  + MS  S   M   LD+YQGFK V 
Sbjct  144  KDAVLEGS-QPFTKAHGMNAFEYPAKDQRFNRVFNRGMSEHSTMLMNKILDTYQGFKEVQ  202

Query  606  RLVDV  620
             LVDV
Sbjct  203  ELVDV  207



>gb|KJB52493.1| hypothetical protein B456_008G264900 [Gossypium raimondii]
 gb|KJB52494.1| hypothetical protein B456_008G264900 [Gossypium raimondii]
Length=275

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 68/195 (35%), Positives = 104/195 (53%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A    M+LA+   +PM L + I L++ + + + G  A LS  E+ +S LP+   DA
Sbjct  37   SDEEANSFAMQLASASVLPMVLKSAIELDLLEIMAKAGPGAFLSPKEV-ASKLPTTNPDA  95

Query  228  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L SY +    +        ER Y +  V K L  ++DG++  A  L +  
Sbjct  96   PVMLDRILRLLASYNVLTCSLRTLPDGKVERLYGLGPVCKFLTKNEDGVTLSALSLMNQD  155

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV+D  I PF K  G   + Y+G +   N +  K MS  S   MK  L
Sbjct  156  KVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDTRFNKVFNKGMSDHSTITMKKIL  214

Query  576  DSYQGFKGVTRLVDV  620
            D+Y GF+G+  LVDV
Sbjct  215  DTYDGFQGLKTLVDV  229



>ref|XP_008381500.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=433

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 70/195 (36%), Positives = 105/195 (54%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L A I L++ + + + G  A +S ++ LSS LP+   DA
Sbjct  83   SDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGAFVSPAD-LSSQLPTKNPDA  141

Query  228  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR L SY I    +        ER Y +  V K L    DG S G+  L +  
Sbjct  142  PVMLDRMLRXLASYSILTYSLRTLPDGKVERLYGLGPVCKFLTKXXDGASIGSLCLMNQD  201

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  K M+  S   MK  L
Sbjct  202  KVLMESWYNLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMADHSTITMKKLL  260

Query  576  DSYQGFKGVTRLVDV  620
            ++Y GF+G+T +VDV
Sbjct  261  ENYNGFEGLTSIVDV  275



>sp|P59049.1|OMT1_CHRAE RecName: Full=Quercetin 3-O-methyltransferase 1; AltName: Full=Flavonol 
3-O-methyltransferase 1 [Chrysosplenium americanum]
Length=343

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 105/186 (56%), Gaps = 5/186 (3%)
 Frame = +3

Query  66   LRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNL-ER  242
            L  M+LA+   +PM L + I L++ + I   G +  +S +EI +S LP+   DAP + +R
Sbjct  2    LFAMQLASASVLPMVLKSAIELDLLEII--RGQDTCMSPTEI-ASHLPTTNPDAPAMVDR  58

Query  243  LLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPL  422
            +LR+L+ Y +    + +   +R Y +  V K L  ++DG+S  A  L +    +M++W  
Sbjct  59   ILRLLSCYSVVTCSVRSVDDQRVYGLAPVCKYLTKNQDGVSIAALCLMNQDKVLMESWYH  118

Query  423  VHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQGFKGV  602
            + +AV+D  I PF K  G + + Y+G +P  N +  + MS  S   MK    +YQGF+G+
Sbjct  119  LKDAVLDGGI-PFNKAYGMSSFEYHGTDPRFNKVFNRGMSDHSTITMKKVFQAYQGFQGL  177

Query  603  TRLVDV  620
            T LVDV
Sbjct  178  TSLVDV  183



>gb|KDP35860.1| hypothetical protein JCGZ_10599 [Jatropha curcas]
Length=365

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 108/195 (55%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+L++   +PM L + I L++ + I + G  A LS  +I +S LP+   DA
Sbjct  15   SDEEAILFAMQLSSAPLLPMVLKSAIELDLLEIIAKAGPGAFLSTYDI-ASQLPTKSADA  73

Query  228  PN-LERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L SY I       +N    ER Y +  V K L  ++DG+S     L +  
Sbjct  74   PVVLDRILRLLASYSILTCSLRKLNDGKVERLYGLAPVCKFLTKNEDGVSIAPLCLLNLD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV++  I PF K +G   + Y G +P  + +  K MS  S+  MK  L
Sbjct  134  KVLMESWYHLKDAVLEGVI-PFNKAHGMDAFEYQGTDPRFSKVFNKGMSNHSIVTMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y+GF+G+T L DV
Sbjct  193  ETYKGFEGLTSLADV  207



>gb|ABK22490.1| unknown [Picea sitchensis]
Length=364

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 62/185 (34%), Positives = 97/185 (52%), Gaps = 4/185 (2%)
 Frame = +3

Query  75   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLERLLRM  254
            MEL N   +PM + A I L+V   I   G+   LS  +I++ +  +    A  L+R+LR+
Sbjct  24   MELGNFSCLPMGMKAAIELDVLQIIANAGNGVQLSPRQIVAHIPTTNPDAAITLDRILRV  83

Query  255  LTSYGIFREHINAD---ASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLV  425
            L S+ +    +  D    +ER Y +  + K LV ++DG+S    VL +    +M +W  +
Sbjct  84   LASHSVLSCSVTTDENGKAERLYGLTPLCKYLVMNQDGVSLAPLVLMNQDKVLMDSWYYL  143

Query  426  HEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQGFKGVT  605
             +AV++ S +PF K +G   + Y  K+   N +  + MS  S   M   LD+YQGFK V 
Sbjct  144  KDAVLEGS-QPFTKAHGMNAFEYPAKDQRFNRVFNRGMSEHSTMLMNKILDTYQGFKEVQ  202

Query  606  RLVDV  620
             LVDV
Sbjct  203  ELVDV  207



>dbj|BAD83867.1| Caffeic acid O-methyltransferase [Iris x hollandica]
Length=365

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/190 (35%), Positives = 103/190 (54%), Gaps = 7/190 (4%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+L +   +PM+L A I L++ + I + G  A LS +EI SS LP+   +A
Sbjct  16   SDEEACLYAMQLRSFSVLPMTLKAAIELDLLEIIAKAGPGAYLSPAEI-SSQLPTENPEA  74

Query  228  PNL-ERLLRMLTSYGIFREHINADASE----RRYSVDEVGKTLVTDKDGLSYGAYVLQHH  392
            P + +R+LR+L  Y +    ++A   +    RRY  + V K L  ++DG+S  A  L + 
Sbjct  75   PAMIDRMLRLLACYSVVSCRVDAAGDDGKPRRRYGAERVVKYLTKNEDGVSMAALTLMNQ  134

Query  393  QAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAF  572
                M++W  + +AV++  I PF K  G +P+ Y G +P  N +  + M   S   MK  
Sbjct  135  DKVFMESWYHLKDAVLEGGI-PFKKAFGMSPFEYQGTDPRFNKVFNEGMRNHSAFIMKKI  193

Query  573  LDSYQGFKGV  602
            L++YQGF  V
Sbjct  194  LETYQGFDSV  203



>ref|XP_008376828.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=365

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/195 (34%), Positives = 109/195 (56%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            +D    L  M+LAN   +PM L   + L++ + + + G  A +S+++ LSS LP+   DA
Sbjct  15   TDKETNLFAMQLANAPVLPMVLKTALELDLLEIMVKAGPGAFVSSAD-LSSQLPTKNPDA  73

Query  228  P-NLERLLRMLTSYGIFREHINA--DAS-ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L SY I    +    D + ER Y +  V K L  ++DG+S     L    
Sbjct  74   PVMLDRMLRLLASYSILTYSLRTLPDGNVERLYGLGPVCKFLTKNEDGVSIAPLCLMSQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV++  I PF K  G + + Y+G +P  N +  + M+  S   MK  L
Sbjct  134  KVLMESWYHLKDAVLEGGI-PFNKAYGMSAFEYHGTDPRFNKVFNRGMAAQSTITMKKLL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y+GF+G+T +VDV
Sbjct  193  ETYKGFEGLTSVVDV  207



>ref|XP_004502769.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cicer arietinum]
Length=365

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 70/195 (36%), Positives = 106/195 (54%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L + + L++ + I + G  A LS  EI +S LP+   DA
Sbjct  15   SDEEAALFAMQLASASVLPMVLKSALELDLLEIIAKAGPAAHLSPYEI-ASQLPTNNPDA  73

Query  228  P-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L  Y I       ++    +R Y +  V K LV ++DG+S  A  L +  
Sbjct  74   PVMLDRILRLLACYNILTCSLTTLHDGKVQRLYGLATVAKYLVKNEDGVSISALNLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  K MS  S   MK  L
Sbjct  134  KILMESWYHLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            + Y GF+G+  LVDV
Sbjct  193  EIYTGFEGLKSLVDV  207



>ref|XP_006478241.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like [Citrus 
sinensis]
Length=432

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 65/208 (31%), Positives = 113/208 (54%), Gaps = 3/208 (1%)
 Frame = +3

Query  3    QITGKLKEIGAMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSA  182
            +I G L     M +E  +       EL     + M++ AVI+L + + I + G  A LSA
Sbjct  70   RILGLLASYENMANEQRDENFAYACELVTGSVLHMTMKAVIKLGLFEIIAKAGPGAKLSA  129

Query  183  SEILSSVLPSGGGDAPN-LERLLRMLTSYGIFREHIN-ADASERRYSVDEVGKTLVTDKD  356
            SEI + +  +   DAP  L+R+LR+L SYGI +  ++  D S R Y +++V K  V+++D
Sbjct  130  SEIAAQLPATKNKDAPMMLDRILRLLASYGIVQCSLDDVDGSHRLYGLNDVSKYFVSNQD  189

Query  357  GLSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKA  536
            G+S G  +      A + +W  + E +++  + PF +V+G   + Y G +P  N +   A
Sbjct  190  GVSLGPVLALIQDKAFLDSWSQLKETIIEGGV-PFDRVHGTHAFEYLGLDPRFNEVYSTA  248

Query  537  MSGISVPFMKAFLDSYQGFKGVTRLVDV  620
            M   +   ++  L++Y+GF+ + +LVDV
Sbjct  249  MYNHTTLVIQKILEAYKGFEHIKQLVDV  276



>gb|KJB23956.1| hypothetical protein B456_004G125600 [Gossypium raimondii]
Length=251

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/195 (34%), Positives = 105/195 (54%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+L +   +PM L + I L++ + + + G  A LS  E L+S LP+   DA
Sbjct  15   SDEEANLFAMQLTSASVLPMVLKSAIELDLLEIMAKAGPGAFLSPKE-LASQLPTSNPDA  73

Query  228  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L +Y I    +        ER Y +  V K +  ++DG++  A  L +  
Sbjct  74   PVMLDRILRLLATYSILTCSLRTLPDGKVERLYGLGPVCKFVTKNEDGVTLSALSLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  + MS  S   MK  L
Sbjct  134  KVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y GF+G+  LVDV
Sbjct  193  ETYDGFEGLKTLVDV  207



>ref|NP_001289246.1| caffeic acid 3-O-methyltransferase [Pyrus x bretschneideri]
 gb|AGS44640.1| caffeic acid-O-methyltransferase [Pyrus x bretschneideri]
Length=365

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 68/195 (35%), Positives = 107/195 (55%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L A I L++ + + + G  A +S ++I +S LP+   DA
Sbjct  15   SDEEANLFAMQLASGSILPMVLKAAIELDLLEVMAKAGPGAFVSPADI-ASQLPTKNPDA  73

Query  228  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L SY I    +        +R Y +  V K L  ++DG S G+  L +  
Sbjct  74   PVMLDRILRLLASYSILTYSLRTLPDGKVQRLYGLGPVCKFLTKNEDGASIGSLCLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + E+V++  I PF K  G   + Y+G +P  N +  K M+  S   MK  L
Sbjct  134  KVLMESWYHLKESVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMADHSTITMKKLL  192

Query  576  DSYQGFKGVTRLVDV  620
            + Y GF+G+T +VDV
Sbjct  193  EIYNGFEGLTSIVDV  207



>ref|XP_008234634.1| PREDICTED: caffeic acid 3-O-methyltransferase [Prunus mume]
Length=365

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 67/195 (34%), Positives = 108/195 (55%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L A I L++ + + + G    LS ++I +S LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGVFLSPADI-ASQLPTKNPDA  73

Query  228  P-NLERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L SY I    +   A    ER Y +  V K L  ++DG+S     L +  
Sbjct  74   PVMLDRMLRLLASYSILTYSLRTLADGKVERLYGLGPVCKFLTKNEDGVSIAPLCLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              ++++W  + +AV++  I PF K  G   + Y+G +P  N +  + M+  S   MK  L
Sbjct  134  KVLVESWYHLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMADHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y+GF+G+T +VDV
Sbjct  193  ETYKGFEGLTSVVDV  207



>dbj|BAE94403.1| Caffeic acid 3-O-methyltransferase [Ipomoea nil]
Length=364

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 68/196 (35%), Positives = 107/196 (55%), Gaps = 6/196 (3%)
 Frame = +3

Query  45   ESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGD  224
            +SD  A L  M+LA+   +PM L + I L++ + I + G  A +S SE L++ LP+   D
Sbjct  15   DSDEEASLFAMQLASASVLPMVLKSAIELDLLELIAKAGPGAAVSPSE-LAAQLPTTNPD  73

Query  225  AP-NLERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHH  392
            A   L+R+LR+L +Y +    +        ER YS+  V K L  + DG+S    +L + 
Sbjct  74   AAVMLDRILRLLCTYSVLNCSLRTLPDGRVERLYSLAPVCKYLTKNGDGVSMAPLLLMNQ  133

Query  393  QAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAF  572
               +M++W  + +AV++  I PF K  G   + Y+G +P  N +  + MS  S   MK  
Sbjct  134  DKVLMESWYHLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTITMKKI  192

Query  573  LDSYQGFKGVTRLVDV  620
            LD Y+GF+G+  LVDV
Sbjct  193  LDDYKGFEGLKSLVDV  208



>sp|Q42653.1|OMT2_CHRAE RecName: Full=Quercetin 3-O-methyltransferase 2; AltName: Full=Flavonol 
3-O-methyltransferase 2 [Chrysosplenium americanum]
 gb|AAA86982.1| caffeic acid O-methyl transferase [Chrysosplenium americanum]
Length=343

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 104/186 (56%), Gaps = 5/186 (3%)
 Frame = +3

Query  66   LRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNL-ER  242
            L  M+LA    +PM L + I L++ + I   G +  +S +EI +S LP+   DAP + +R
Sbjct  2    LFAMQLACASVLPMVLKSAIELDLLEII--RGQDTCMSPTEI-ASHLPTTNPDAPAMVDR  58

Query  243  LLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPL  422
            +LR+L+ Y +    + +   +R Y +  V K L  ++DG+S  A  L +    +M++W  
Sbjct  59   ILRLLSCYSVVTCSVRSVDDQRVYGLAPVCKYLTKNQDGVSIAALCLMNQDKVLMESWYH  118

Query  423  VHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQGFKGV  602
            + +AV+D  I PF K  G + + Y+G +P  N +  + MS  S   MK    +YQGF+G+
Sbjct  119  LKDAVLDGGI-PFNKAYGMSSFEYHGTDPRFNKVFNRGMSDHSTITMKKVFQTYQGFQGL  177

Query  603  TRLVDV  620
            T LVDV
Sbjct  178  TSLVDV  183



>dbj|BAE94400.1| Caffeic acid 3-O-methyltransferase [Ipomoea nil]
 dbj|BAE94406.1| Caffeic acid 3-O-methyltransferase [Ipomoea nil]
Length=364

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 68/196 (35%), Positives = 107/196 (55%), Gaps = 6/196 (3%)
 Frame = +3

Query  45   ESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGD  224
            +SD  A L  M+LA+   +PM L + I L++ + I + G  A +S SE L++ LP+   D
Sbjct  15   DSDEEASLFAMQLASASVLPMVLKSAIELDLLELIAKAGPGAAVSPSE-LAAQLPTTNPD  73

Query  225  AP-NLERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHH  392
            A   L+R+LR+L +Y +    +        ER YS+  V K L  + DG+S    +L + 
Sbjct  74   AAVMLDRILRLLCTYSVLNCSLRTLPDGRVERLYSLAPVCKYLTKNGDGVSMAPLLLMNQ  133

Query  393  QAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAF  572
               +M++W  + +AV++  I PF K  G   + Y+G +P  N +  + MS  S   MK  
Sbjct  134  DKVLMESWYHLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTITMKKI  192

Query  573  LDSYQGFKGVTRLVDV  620
            LD Y+GF+G+  LVDV
Sbjct  193  LDDYKGFEGLKSLVDV  208



>gb|KHG13289.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=365

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 67/195 (34%), Positives = 105/195 (54%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+L +   +PM L + I L++ + + + G  A LS  E L+S LP+   DA
Sbjct  15   SDEEANLFAMQLTSASVLPMVLKSAIELDLLEIMAKAGPGAFLSPKE-LASQLPTNNPDA  73

Query  228  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L +Y I    +        ER Y +  V K L  ++DG++  A  L +  
Sbjct  74   PVMLDRILRLLATYSILTCSLRTLPDGKVERLYGLGPVCKFLTKNEDGVTLSALSLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  + MS  S   MK  L
Sbjct  134  KVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y GF+G+  LVDV
Sbjct  193  ETYDGFEGLKTLVDV  207



>ref|XP_009418616.1| PREDICTED: tricetin 3',4',5'-O-trimethyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=362

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 64/206 (31%), Positives = 106/206 (51%), Gaps = 4/206 (2%)
 Frame = +3

Query  12   GKLKEIGAMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEI  191
            G LK    +  E D  A +  M+LA+   +PM+L A I L++ + + + G  A LS +++
Sbjct  2    GSLKNALQLTPEEDEDACMYAMQLASASILPMTLKAAIELDLLEILVRAGPGAQLSPADV  61

Query  192  LSSVLPSGGGDAPNLERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGL  362
            ++ +       A  ++R+LR+L +Y +    +  DA     R+Y      K L  ++DG+
Sbjct  62   VAQLPTENPQAAVMVDRMLRLLAAYNVVSCTVGTDADGKPSRKYGAAPACKYLTKNEDGV  121

Query  363  SYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMS  542
            S  A  L +    +M++W  + +AV+D  I PF K  G + + YYG +   N +  + M 
Sbjct  122  SMAALTLMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMSAFEYYGADARFNKVFNEGMR  180

Query  543  GISVPFMKAFLDSYQGFKGVTRLVDV  620
              S    K  LD Y+GF+GV  LVDV
Sbjct  181  NHSTILTKKLLDIYRGFEGVKVLVDV  206



>gb|KJB23955.1| hypothetical protein B456_004G125600 [Gossypium raimondii]
Length=269

 Score =   106 bits (265),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 66/195 (34%), Positives = 105/195 (54%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+L +   +PM L + I L++ + + + G  A LS  E L+S LP+   DA
Sbjct  15   SDEEANLFAMQLTSASVLPMVLKSAIELDLLEIMAKAGPGAFLSPKE-LASQLPTSNPDA  73

Query  228  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L +Y I    +        ER Y +  V K +  ++DG++  A  L +  
Sbjct  74   PVMLDRILRLLATYSILTCSLRTLPDGKVERLYGLGPVCKFVTKNEDGVTLSALSLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  + MS  S   MK  L
Sbjct  134  KVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y GF+G+  LVDV
Sbjct  193  ETYDGFEGLKTLVDV  207



>gb|ABO41852.1| putative caffeic acid methyltransferase [Gossypium hirsutum]
Length=358

 Score =   107 bits (267),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 65/186 (35%), Positives = 101/186 (54%), Gaps = 6/186 (3%)
 Frame = +3

Query  75   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNL-ERLLR  251
            + LAN + +PM L + + LN+ D I   G  A LS S+I +S LPS    AP L +R+LR
Sbjct  15   VRLANAVVLPMVLKSALELNIIDTISAAGDGAFLSPSQI-ASALPSKNPGAPVLLDRMLR  73

Query  252  MLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPL  422
            +L S+ I +  + A      ER Y    + K LV ++DG S    +L HH    M++W  
Sbjct  74   LLASHSILKCSVKAKEKGEIERLYGAGPLCKFLVKNQDGGSIAPLLLLHHDQVFMQSWYH  133

Query  423  VHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQGFKGV  602
            +++A+++  + PF K  G   + Y G +   N +  +AMS  +   M+  +D Y+GF G+
Sbjct  134  LNDAILEGGV-PFSKAYGMTAFEYPGTDQRFNRVFNQAMSNHTALIMRKIVDVYKGFDGL  192

Query  603  TRLVDV  620
              LVDV
Sbjct  193  KVLVDV  198



>gb|AGJ84131.1| putative caffeic acid O-methyltransferase [Hibiscus cannabinus]
Length=365

 Score =   107 bits (266),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 67/195 (34%), Positives = 105/195 (54%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L + I L++ + + + G  A LS  E+ +S LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSAIELDLLEIMAKAGPGAFLSPMEV-ASQLPTANPDA  73

Query  228  P-NLERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L +Y I    +        ER Y +  V K L  ++DG++  A  L +  
Sbjct  74   PVMLDRILRLLATYSILTCSLRTLPDGRVERLYGLGPVCKFLTKNQDGVALSALSLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  + MS  S   MK  L
Sbjct  134  KVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y GF G+  LVDV
Sbjct  193  ETYDGFDGLKTLVDV  207



>sp|P46484.1|COMT1_EUCGU RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Eucalyptus gunnii]
 emb|CAA52814.1| 0-Methyltransferase [Eucalyptus gunnii]
Length=366

 Score =   107 bits (266),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 70/210 (33%), Positives = 114/210 (54%), Gaps = 14/210 (7%)
 Frame = +3

Query  27   IGAMGSE--------SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSA  182
            +G+ GSE        SD  A L  M+LA+   +PM L A I L++ + + + G  A LS 
Sbjct  1    MGSTGSETQMTPTQVSDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGAFLSP  60

Query  183  SEILSSVLPSGGGDAP-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTD  350
             E+ ++ LP+   +AP  L+R+ R+L SY +      ++     ER Y +  V K LV +
Sbjct  61   GEV-AAQLPTQNPEAPVMLDRIFRLLASYSVLTCTLRNLPDGKVERLYGLAPVCKFLVKN  119

Query  351  KDGLSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQ  530
            +DG+S  A  L +    +M++W  + +AV++  I PF K  G   + Y+G +P  N +  
Sbjct  120  EDGVSIAALNLMNQDKILMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKIFN  178

Query  531  KAMSGISVPFMKAFLDSYQGFKGVTRLVDV  620
            + MS  S   MK  L++Y+GF+G+  +VDV
Sbjct  179  RGMSDHSTITMKKILETYKGFEGLETVVDV  208



>gb|AGR85824.1| caffeic acid O-methyltransferase [Hibiscus cannabinus]
Length=306

 Score =   106 bits (265),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 66/195 (34%), Positives = 106/195 (54%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L + I L++ + + + G  A LS  E+ ++ LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSAIELDLLEIMAKAGPGASLSPKEV-AAQLPTTNPDA  73

Query  228  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L SY I    + +      ER Y +  V K L  ++DG++  A  L +  
Sbjct  74   PVMLDRILRLLASYSILTCSLRSLPDGKVERLYGLGPVCKFLTKNEDGVTLSALSLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  + M+  S   MK  L
Sbjct  134  KVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMNDHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y GF G+  LVDV
Sbjct  193  ETYDGFDGLKTLVDV  207



>ref|XP_004307899.1| PREDICTED: caffeic acid 3-O-methyltransferase [Fragaria vesca 
subsp. vesca]
Length=365

 Score =   107 bits (266),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 67/195 (34%), Positives = 108/195 (55%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L A I L++ + + + G  + LS ++ L+S LP+   +A
Sbjct  15   SDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGSFLSPND-LASQLPTENPEA  73

Query  228  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L SY I    +        ER Y +  V K L  ++DG+S  A  L +  
Sbjct  74   PVMLDRMLRLLASYSILTYSLRTLPDGKVERLYGLGPVCKFLTKNEDGVSIAALCLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              ++++W  + +AV+D  I PF K  G   + Y+G +P  N +  K M+  S   MK  L
Sbjct  134  KVLVESWYHLKDAVLDGGI-PFNKAYGMTAFDYHGTDPRFNKVFNKGMADHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y+GF+G+  +VDV
Sbjct  193  ETYKGFEGLKSIVDV  207



>ref|NP_001242325.1| uncharacterized protein LOC100805999 [Glycine max]
 gb|ACU21012.1| unknown [Glycine max]
Length=365

 Score =   107 bits (266),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 70/195 (36%), Positives = 106/195 (54%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L + + L++ + I + G    LS ++I SS LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMILKSALELDLLEIIAKAGPGVHLSPTDI-SSQLPTQNPDA  73

Query  228  P-NLERLLRMLTSYGI--FREHINADAS-ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L  Y I  F      D   ER Y +  V K LV ++DG+S  A  L +  
Sbjct  74   PVMLDRILRLLACYNILSFSLRTLPDGKVERLYGLAPVAKYLVKNEDGVSIAALNLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  K M+  S   MK  L
Sbjct  134  KVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMADHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y GF+ +  LVDV
Sbjct  193  ETYTGFESLKSLVDV  207



>gb|KHN23296.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=365

 Score =   107 bits (266),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 70/195 (36%), Positives = 106/195 (54%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L + + L++ + I + G    LS ++I SS LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMILKSALELDLLEIIAKAGPGVHLSPTDI-SSQLPTQNPDA  73

Query  228  P-NLERLLRMLTSYGI--FREHINADAS-ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L  Y I  F      D   ER Y +  V K LV ++DG+S  A  L +  
Sbjct  74   PVMLDRILRLLACYNILSFSLRTLPDGKVERLYGLAPVAKYLVKNEDGVSIAALNLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  K M+  S   MK  L
Sbjct  134  KVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMADHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y GF+ +  LVDV
Sbjct  193  ETYTGFESLKSLVDV  207



>gb|KJB23957.1| hypothetical protein B456_004G125600 [Gossypium raimondii]
Length=290

 Score =   106 bits (264),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 66/195 (34%), Positives = 105/195 (54%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+L +   +PM L + I L++ + + + G  A LS  E L+S LP+   DA
Sbjct  15   SDEEANLFAMQLTSASVLPMVLKSAIELDLLEIMAKAGPGAFLSPKE-LASQLPTSNPDA  73

Query  228  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L +Y I    +        ER Y +  V K +  ++DG++  A  L +  
Sbjct  74   PVMLDRILRLLATYSILTCSLRTLPDGKVERLYGLGPVCKFVTKNEDGVTLSALSLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  + MS  S   MK  L
Sbjct  134  KVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y GF+G+  LVDV
Sbjct  193  ETYDGFEGLKTLVDV  207



>gb|AAD29841.1|AF064693_1 catechol O-methyltransferase [Thalictrum tuberosum]
Length=364

 Score =   107 bits (266),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 67/191 (35%), Positives = 105/191 (55%), Gaps = 6/191 (3%)
 Frame = +3

Query  60   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPN-L  236
            A L  M+LA+   +PM L A I L+V + I + G  A ++ SEI +S L +    AP  L
Sbjct  20   AYLHAMQLASASVLPMVLKAAIELDVLEIIAKAGKGAYVAPSEI-ASQLSTSNSQAPTVL  78

Query  237  ERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMM  407
            +R+LR+L SY +      ++     ER Y +  V K LV ++DG+S    VL +    +M
Sbjct  79   DRMLRLLASYKVLTCNLRNLEDGGVERLYGLAPVCKFLVKNEDGVSMAPLVLMNQDKVLM  138

Query  408  KAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQ  587
            ++W  + +AV+D  I PF K  G   + Y+G +P  N +  + M+  S   MK  L+ Y+
Sbjct  139  ESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMADHSTITMKKLLELYK  197

Query  588  GFKGVTRLVDV  620
            GF+G+  +VDV
Sbjct  198  GFEGLKSVVDV  208



>sp|Q43609.1|COMT1_PRUDU RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Prunus dulcis]
 emb|CAA58218.1| caffeic O-methyltransferase [Prunus dulcis]
Length=365

 Score =   107 bits (266),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 66/195 (34%), Positives = 108/195 (55%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L A I L++ + + + G    LS ++I +S LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGVFLSPTDI-ASQLPTKNPDA  73

Query  228  P-NLERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L SY I    +   A    ER Y +  V K L  +++G+S     L +  
Sbjct  74   PVMLDRMLRLLASYSILTYSLRTLADGKVERLYGLGPVCKFLTKNEEGVSIAPLCLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              ++++W  + +AV++  I PF K  G   + Y+G +P  N +  + M+  S   MK  L
Sbjct  134  KVLLESWYHLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMADHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y+GF+G+T +VDV
Sbjct  193  ETYKGFEGLTSVVDV  207



>gb|ABK25932.1| unknown [Picea sitchensis]
Length=353

 Score =   107 bits (266),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 102/188 (54%), Gaps = 4/188 (2%)
 Frame = +3

Query  66   LRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLERL  245
            L  MEL N   +PM++ A I L+V   I   G+   L++++I++ +  +    A +L+R+
Sbjct  10   LLCMELGNFSCLPMAMKAAIELDVFQIIANAGNGVQLASTQIVARIPTTNPDAAISLDRI  69

Query  246  LRMLTSYGIFREHINAD---ASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAW  416
            L++L S+ +    +  D    +E  Y +  + K LV ++DG+S   +VL +     M++W
Sbjct  70   LKVLASHSVLSCSVTMDENGKAEGLYGLTPLCKYLVKNRDGISLAPWVLMNQDKVFMESW  129

Query  417  PLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQGFK  596
              + +AV++ S +PF K +G   + Y   +   N ++ + MS  S   M   LD YQGFK
Sbjct  130  HYLKDAVLEGS-QPFTKAHGMNVFEYLAMDRRFNKVLNRTMSEHSTTLMNKILDMYQGFK  188

Query  597  GVTRLVDV  620
             V +LVDV
Sbjct  189  DVQKLVDV  196



>dbj|BAD18975.1| phloroglucinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=371

 Score =   107 bits (266),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 66/188 (35%), Positives = 103/188 (55%), Gaps = 8/188 (4%)
 Frame = +3

Query  75   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPN-LERLLR  251
            + LAN++ +PM L + + LNV D IW  G    LS S+I ++ LP+   +AP  L+R+LR
Sbjct  30   IRLANVVILPMVLKSALELNVIDIIWGAGDGESLSPSDI-AAQLPTKNSNAPAVLDRMLR  88

Query  252  MLTSYGIFR--EHINADAS-ERRYSVDEVGKTLVTDKDG--LSYGAYVLQHHQAAMMKAW  416
            +L S+ I +      +D   ER YS   + K LV D++G   S G   L HH    M+ W
Sbjct  89   LLASHSILKCSARTGSDGQVERLYSAGPICKFLVKDQNGGTRSVGPLFLLHHDKVFMEGW  148

Query  417  PLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQGFK  596
              +++A+++  I PF +  G   + Y   +   N +  +AMS  +   +K  LD Y+GF+
Sbjct  149  FHLNDAILEGGI-PFNRAYGMTAFEYPETDERFNRVFNQAMSNHTTLILKKILDVYRGFE  207

Query  597  GVTRLVDV  620
            G+  LVDV
Sbjct  208  GINVLVDV  215



>gb|AAD29844.1|AF064696_1 catechol O-methyltransferase [Thalictrum tuberosum]
Length=364

 Score =   107 bits (266),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 67/191 (35%), Positives = 105/191 (55%), Gaps = 6/191 (3%)
 Frame = +3

Query  60   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPN-L  236
            A L  M+LA+   +PM L A I L+V + I + G  A ++ SEI +S L +    AP  L
Sbjct  20   ACLHAMQLASASVLPMVLKAAIELDVLEIIAKAGKGAYVAPSEI-ASQLSTSNSQAPTVL  78

Query  237  ERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMM  407
            +R+LR+L SY +      ++     ER Y +  V K LV ++DG+S    VL +    +M
Sbjct  79   DRMLRLLASYKVLTCNLRNLEDGGVERLYGLAPVCKFLVKNEDGVSMAPLVLMNQDKVLM  138

Query  408  KAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQ  587
            ++W  + +AV+D  I PF K  G   + Y+G +P  N +  + M+  S   MK  L+ Y+
Sbjct  139  ESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMADHSTITMKKLLELYK  197

Query  588  GFKGVTRLVDV  620
            GF+G+  +VDV
Sbjct  198  GFEGLKSVVDV  208



>gb|ADB82906.1| caffeic O-methyltransferase1 [Eucalyptus camaldulensis]
Length=366

 Score =   106 bits (265),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 70/210 (33%), Positives = 113/210 (54%), Gaps = 14/210 (7%)
 Frame = +3

Query  27   IGAMGSE--------SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSA  182
            +G+ GSE        SD  A L  M+LA+   +PM L A I L++ + + + G  A LS 
Sbjct  1    MGSTGSETQMTPTQVSDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGAFLSP  60

Query  183  SEILSSVLPSGGGDAPN-LERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTD  350
             E+ ++ LP+   +AP  L+R+ R+L SY +       +     ER Y +  V K LV +
Sbjct  61   GEV-AAQLPTQNPEAPAMLDRIFRLLASYSVLTCTLRDLPDGKVERLYGLAPVCKFLVKN  119

Query  351  KDGLSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQ  530
            +DG+S  A  L +    +M++W  + +AV++  I PF K  G   + Y+G +P  N +  
Sbjct  120  EDGVSIAALNLMNQDKILMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKIFN  178

Query  531  KAMSGISVPFMKAFLDSYQGFKGVTRLVDV  620
            + MS  S   MK  L++Y+GF+G+  +VDV
Sbjct  179  RGMSDHSTITMKKILETYKGFEGLETVVDV  208



>gb|KJB52492.1| hypothetical protein B456_008G264900 [Gossypium raimondii]
Length=387

 Score =   107 bits (266),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 68/195 (35%), Positives = 104/195 (53%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A    M+LA+   +PM L + I L++ + + + G  A LS  E+ +S LP+   DA
Sbjct  37   SDEEANSFAMQLASASVLPMVLKSAIELDLLEIMAKAGPGAFLSPKEV-ASKLPTTNPDA  95

Query  228  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L SY +    +        ER Y +  V K L  ++DG++  A  L +  
Sbjct  96   PVMLDRILRLLASYNVLTCSLRTLPDGKVERLYGLGPVCKFLTKNEDGVTLSALSLMNQD  155

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV+D  I PF K  G   + Y+G +   N +  K MS  S   MK  L
Sbjct  156  KVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDTRFNKVFNKGMSDHSTITMKKIL  214

Query  576  DSYQGFKGVTRLVDV  620
            D+Y GF+G+  LVDV
Sbjct  215  DTYDGFQGLKTLVDV  229



>sp|Q6T1F5.1|COMT1_AMMMJ RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Ammi majus]
 gb|AAR24097.1| caffeic acid O-methyltransferase [Ammi majus]
Length=365

 Score =   106 bits (265),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 68/197 (35%), Positives = 108/197 (55%), Gaps = 6/197 (3%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  221
            ++ +  A +  M+LA+   +PM L + I LN+ ++I + G  A +S S+ L++ LPS   
Sbjct  15   NDDEEEACMFAMQLASASVLPMVLKSAIELNLLESIAKAGPGAYVSPSQ-LAAALPSSQP  73

Query  222  DAP-NLERLLRMLTSYGIFREHIN--ADAS-ERRYSVDEVGKTLVTDKDGLSYGAYVLQH  389
            D P  L+R+LR+L SY +    +    DA  ER Y +  V K L  + DG+S    +L +
Sbjct  74   DTPVMLDRILRLLASYSVLNCKLRDLPDARVERLYGLAPVCKFLTKNSDGVSMAPLLLMN  133

Query  390  HQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKA  569
                +M++W  + +AV+D  I PF K  G   + Y+GK+P  N +  + MS  S   MK 
Sbjct  134  QDKILMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGKDPRFNKVFNQGMSNHSTITMKK  192

Query  570  FLDSYQGFKGVTRLVDV  620
             L +Y GF G+  +VDV
Sbjct  193  ILQTYDGFGGLKTVVDV  209



>ref|XP_009119951.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Brassica rapa]
 emb|CDY14328.1| BnaA10g07270D [Brassica napus]
Length=364

 Score =   106 bits (265),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 69/196 (35%), Positives = 111/196 (57%), Gaps = 9/196 (5%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            +D+ A L  M+LA+   +PM L   + L++ + + +  S   +S SEI +S L +   +A
Sbjct  15   TDDEAALFAMQLASASVLPMVLKTALDLDLLEIMAKNSSQ--MSPSEI-ASQLQTKNPEA  71

Query  228  P-NLERLLRMLTSYGIF----REHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHH  392
            P  L+R+LR+LTSY I     R     D+ ER Y +  V K L  ++DG+S  A  L + 
Sbjct  72   PIMLDRILRLLTSYSILTCSSRTIPGGDSVERIYGLGPVCKYLTKNEDGVSIAALCLMNQ  131

Query  393  QAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAF  572
               +M++W  + +A++D  I PF K  G + + Y+GK+   N++    MS  S   MK  
Sbjct  132  DKVLMESWYHLKDAILDGGI-PFNKAYGMSAFEYHGKDLRFNTVFNNGMSNHSTITMKKI  190

Query  573  LDSYQGFKGVTRLVDV  620
            L++Y+GF+G+T LVDV
Sbjct  191  LETYKGFEGLTSLVDV  206



>gb|ACY66932.1| caffeic O-methyltransferase 1 [Eucalyptus camaldulensis]
Length=366

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 70/210 (33%), Positives = 113/210 (54%), Gaps = 14/210 (7%)
 Frame = +3

Query  27   IGAMGSE--------SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSA  182
            +G+ GSE        SD  A L  M+LA+   +PM L A I L++ + + + G  A LS 
Sbjct  1    MGSTGSETQMTPTQVSDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGAFLSP  60

Query  183  SEILSSVLPSGGGDAP-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTD  350
             E+ ++ LP+   +AP  L+R+ R+L SY +       +     ER Y +  V K LV +
Sbjct  61   GEV-AAQLPTQNPEAPVMLDRIFRLLASYSVLTCTLRDLPDGKVERLYGLAPVCKFLVKN  119

Query  351  KDGLSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQ  530
            +DG+S  A  L +    +M++W  + +AV++  I PF K  G   + Y+G +P  N +  
Sbjct  120  EDGVSIAALNLMNQDKILMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKIFN  178

Query  531  KAMSGISVPFMKAFLDSYQGFKGVTRLVDV  620
            + MS  S   MK  L++Y+GF+G+  +VDV
Sbjct  179  RGMSDHSTITMKKILETYKGFEGLETVVDV  208



>ref|XP_007039215.1| Caffeic acid 3-O-methyltransferase 1 [Theobroma cacao]
 gb|EOY23716.1| Caffeic acid 3-O-methyltransferase 1 [Theobroma cacao]
Length=365

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 65/195 (33%), Positives = 106/195 (54%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD    L  M+L +   +PM L + I L++ + + + G  A LS +E L+S LP+   DA
Sbjct  15   SDEELNLFAMQLTSASVLPMVLTSAIELDLFEIMAKAGPGAFLSPNE-LASQLPTKNPDA  73

Query  228  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L SY +    +        ER YS+  V K L  ++DG++  +  L +  
Sbjct  74   PVMLDRILRLLASYSVLNCSLRTLPDGKVERLYSLGPVCKFLTKNEDGVTLSSLSLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  + M+  S   M+  L
Sbjct  134  KVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMNDHSTTTMRKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y GF+GV  LVDV
Sbjct  193  ETYDGFEGVKTLVDV  207



>ref|XP_009119948.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Brassica rapa]
 emb|CDY14330.1| BnaA10g07250D [Brassica napus]
Length=362

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 108/194 (56%), Gaps = 7/194 (4%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            +D+   L  ++LA+   +PM+L + I L++ + + +  S  P+SASEI SS LP+   +A
Sbjct  15   TDDETALFAIQLASASVLPMALKSAIELDLLEIMARNCS--PMSASEI-SSHLPTKNPEA  71

Query  228  P-NLERLLRMLTSYGIFREHINA--DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQA  398
            P  L+R+LR+LT+Y +    +    D  +R Y +  V K  + ++DG+S     L +H  
Sbjct  72   PVMLDRILRLLTAYSVLTCSVRTLPDGVDRLYGLGPVCKYFIKNEDGVSIAPLCLLNHDK  131

Query  399  AMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLD  578
              M +W  + +AV+D  I PF K  G + + Y+G +   N +    MS  S   MK  L+
Sbjct  132  VFMGSWYYLKDAVLDGGI-PFNKAYGMSAFEYHGTDLRFNKVFNNGMSNHSTITMKKILE  190

Query  579  SYQGFKGVTRLVDV  620
            +Y GF+G+  LVDV
Sbjct  191  TYNGFEGLVSLVDV  204



>ref|XP_010048429.1| PREDICTED: caffeic acid 3-O-methyltransferase [Eucalyptus grandis]
Length=366

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 70/210 (33%), Positives = 113/210 (54%), Gaps = 14/210 (7%)
 Frame = +3

Query  27   IGAMGSE--------SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSA  182
            +G+ GSE        SD  A L  M+LA+   +PM L A I L++ + + + G  A LS 
Sbjct  1    MGSTGSETQMTPTQVSDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGAFLSP  60

Query  183  SEILSSVLPSGGGDAP-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTD  350
             E+ ++ LP+   +AP  L+R+ R+L SY +       +     ER Y +  V K LV +
Sbjct  61   GEV-AAQLPTQNPEAPVMLDRIFRLLASYSVLTCTLRDLPDGKVERLYGLAPVCKFLVKN  119

Query  351  KDGLSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQ  530
            +DG+S  A  L +    +M++W  + +AV++  I PF K  G   + Y+G +P  N +  
Sbjct  120  EDGVSIAALNLMNQDKILMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKIFN  178

Query  531  KAMSGISVPFMKAFLDSYQGFKGVTRLVDV  620
            + MS  S   MK  L++Y+GF+G+  +VDV
Sbjct  179  RGMSDHSTITMKKILETYKGFEGLETVVDV  208



>gb|KHN23295.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=350

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 106/195 (54%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L + + L++ + I + G    LS ++I +S LP+   +A
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSALELDLLEIIAKAGPGVHLSPTDI-ASQLPTHNPNA  73

Query  228  P-NLERLLRMLTSYGI--FREHINADAS-ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L  Y I  F      D   ER Y +  V K LV ++DG+S  A  L +  
Sbjct  74   PVMLDRILRLLACYNILSFSLRTLPDCKIERLYGLAPVAKYLVKNEDGVSIAALNLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  K M+  S   MK  L
Sbjct  134  KVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMADHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y GF G+  LVDV
Sbjct  193  ETYTGFGGLKSLVDV  207



>emb|CCC55423.1| caffeic acid O-3-methyltransferase [Pinus pinaster]
Length=364

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/185 (33%), Positives = 97/185 (52%), Gaps = 4/185 (2%)
 Frame = +3

Query  75   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLERLLRM  254
            MEL N   +PM++ A I L+V   I   G+   LS  +I++ +  +    A  L+R+LR 
Sbjct  24   MELGNFSCLPMAMKAAIELDVLQIIANAGNGVQLSPRQIVAHIPTTNPDAAITLDRILRA  83

Query  255  LTSYGIFREHINAD---ASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLV  425
            L S+ +    +  D    +ER Y +  + K LV ++DG+S    VL +    +M++W  +
Sbjct  84   LASHSVLSCSVTTDENGKAERLYGLTPLCKYLVKNQDGVSLAPLVLMNQDKVLMESWYYL  143

Query  426  HEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQGFKGVT  605
             +AV+D S +PF K +G   + Y   +   N +  + MS  S   M   LD+Y+GFK V 
Sbjct  144  KDAVLDGS-QPFTKAHGMNAFEYPAMDQRFNRVFNRGMSEHSTLLMNKILDTYEGFKEVQ  202

Query  606  RLVDV  620
             LVDV
Sbjct  203  ELVDV  207



>ref|XP_007218167.1| hypothetical protein PRUPE_ppa007511mg [Prunus persica]
 gb|EMJ19366.1| hypothetical protein PRUPE_ppa007511mg [Prunus persica]
Length=365

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/195 (34%), Positives = 108/195 (55%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L A I L++ + + + G    LS ++I +S LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGVFLSPTDI-ASQLPTKNPDA  73

Query  228  P-NLERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L SY I    +   A    ER Y +  V K L  +++G+S     L +  
Sbjct  74   PVMLDRMLRLLASYSILTYSLRTLADGKVERLYGLGPVCKFLTKNEEGVSIAPLCLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              ++++W  + +AV++  I PF K  G   + Y+G +P  N +  + M+  S   MK  L
Sbjct  134  KVLVESWYHLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMADHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y+GF+G+T +VDV
Sbjct  193  ETYKGFEGLTSVVDV  207



>gb|KCW89068.1| hypothetical protein EUGRSUZ_A01397 [Eucalyptus grandis]
Length=429

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 70/212 (33%), Positives = 114/212 (54%), Gaps = 14/212 (7%)
 Frame = +3

Query  21   KEIGAMGSE--------SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPL  176
            + +G+ GSE        SD  A L  M+LA+   +PM L A I L++ + + + G  A L
Sbjct  62   ERMGSTGSETQMTPTQVSDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGAFL  121

Query  177  SASEILSSVLPSGGGDAP-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLV  344
            S  E+ ++ LP+   +AP  L+R+ R+L SY +       +     ER Y +  V K LV
Sbjct  122  SPGEV-AAQLPTQNPEAPVMLDRIFRLLASYSVLTCTLRDLPDGKVERLYGLAPVCKFLV  180

Query  345  TDKDGLSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSL  524
             ++DG+S  A  L +    +M++W  + +AV++  I PF K  G   + Y+G +P  N +
Sbjct  181  KNEDGVSIAALNLMNQDKILMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKI  239

Query  525  MQKAMSGISVPFMKAFLDSYQGFKGVTRLVDV  620
              + MS  S   MK  L++Y+GF+G+  +VDV
Sbjct  240  FNRGMSDHSTITMKKILETYKGFEGLETVVDV  271



>ref|XP_007218166.1| hypothetical protein PRUPE_ppa007511mg [Prunus persica]
 gb|EMJ19365.1| hypothetical protein PRUPE_ppa007511mg [Prunus persica]
Length=365

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/195 (34%), Positives = 108/195 (55%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L A I L++ + + + G    LS ++I +S LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGVFLSPTDI-ASQLPTKNPDA  73

Query  228  P-NLERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L SY I    +   A    ER Y +  V K L  +++G+S     L +  
Sbjct  74   PVMLDRMLRLLASYSILTYSLRTLADGKVERLYGLGPVCKFLTKNEEGVSIAPLCLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              ++++W  + +AV++  I PF K  G   + Y+G +P  N +  + M+  S   MK  L
Sbjct  134  KVLVESWYHLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMADHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y+GF+G+T +VDV
Sbjct  193  ETYKGFEGLTSVVDV  207



>gb|AEI54336.1| S-adenosyl-L-methionine: caffeic acid 3-0-methyltransferase [Glycine 
max]
Length=365

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 70/195 (36%), Positives = 105/195 (54%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L + + L++ + I + G    LS ++I SS LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSALELDLLEIIAKAGPGVHLSPTDI-SSQLPTQNPDA  73

Query  228  P-NLERLLRMLTSYGI--FREHINADAS-ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+   Y I  F      D   ER Y +  V K LV  +DG+S  A  L +  
Sbjct  74   PVMLDRILRLSACYNILSFSLRTLPDGKVERLYGLAPVAKYLVKTEDGVSIAALNLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  K M+  S   MK  L
Sbjct  134  KVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMADHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y GF+G+  LVDV
Sbjct  193  ETYTGFEGLKSLVDV  207



>gb|AAD29843.1|AF064695_1 catechol O-methyltransferase [Thalictrum tuberosum]
Length=362

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 65/195 (33%), Positives = 104/195 (53%), Gaps = 4/195 (2%)
 Frame = +3

Query  45   ESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGD  224
            E +  A L  M+LA+   +PM L A I L+V + I + G  A ++ +EI S +  S    
Sbjct  13   EEEEEACLHAMQLASASVLPMVLKAAIELDVLEIIAKAGQGAYVAPTEIASQLSTSNSQA  72

Query  225  APNLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
               L+R+LR+L SY +   ++        ER Y +  V K LV ++DG+S    VL +  
Sbjct  73   PIILDRVLRLLASYKVLTCNLRTLEDGGVERLYGLAPVCKFLVKNEDGVSIAPLVLMNQD  132

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV+D  I PF K  G   + Y+G +P  N +  + M+  S   MK  L
Sbjct  133  KVLMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMADHSTITMKKLL  191

Query  576  DSYQGFKGVTRLVDV  620
            + Y+GF+G+  +VDV
Sbjct  192  ELYKGFEGLKSVVDV  206



>gb|ABG27066.1| caffeic acid O-methyltransferase [Boehmeria nivea]
Length=365

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/195 (34%), Positives = 105/195 (54%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L   I L++ + I + G  A LS +EI ++ LP+    A
Sbjct  15   SDEEANLFAMQLASASVLPMVLKTAIELDLLEIIAKAGPGAWLSPAEI-AAQLPTTNPAA  73

Query  228  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L  Y +    +      A+ER Y +  V K L  + DG+S     L +  
Sbjct  74   PVMLDRILRLLACYSVVACQLRTLPGGAAERLYGLAPVCKFLTKNNDGVSISPLCLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  + MS  S   MK  L
Sbjct  134  KVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTITMKKLL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y+GF+G+  +VDV
Sbjct  193  ETYKGFEGLNSVVDV  207



>gb|AHA44835.1| caffeate O-methyltransferase [Larix kaempferi]
Length=364

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 98/185 (53%), Gaps = 4/185 (2%)
 Frame = +3

Query  75   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLERLLRM  254
            MEL N   +PM++ A I L+V   I   G+   LS  +I++ +  +    A  L+R+LR+
Sbjct  24   MELGNFSCLPMAMKAAIELDVLQIIANAGNGVQLSPRQIVAHIPTTNPDAAITLDRILRV  83

Query  255  LTSYGIFREHINAD---ASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLV  425
            L S+ +    +  D    +ER Y +  + K LV ++DG+S    VL +    +M+ W  +
Sbjct  84   LASHSVLSCSVTTDENGKAERLYGLTALCKYLVKNQDGVSLAPLVLMNQDKVLMECWYYL  143

Query  426  HEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQGFKGVT  605
             +AV++ + +PF+K +G   + Y   +   N +  + MS  S   M   LD+YQGFK V 
Sbjct  144  KDAVLEGA-QPFIKAHGMNAFEYPAMDQRYNRVFNRGMSEHSTMLMNKILDTYQGFKEVQ  202

Query  606  RLVDV  620
             LVDV
Sbjct  203  ELVDV  207



>gb|AAD29842.1|AF064694_1 catechol O-methyltransferase [Thalictrum tuberosum]
Length=362

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 65/195 (33%), Positives = 104/195 (53%), Gaps = 4/195 (2%)
 Frame = +3

Query  45   ESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGD  224
            E +  A L  M+LA+   +PM L A I L+V + I + G  A ++ +EI S +  S    
Sbjct  13   EEEEEACLHAMQLASASVLPMVLKAAIELSVLEIIAKAGQGAYVAPTEIASQLSTSNSQA  72

Query  225  APNLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
               L+R+LR+L SY +   ++        ER Y +  V K LV ++DG+S    VL +  
Sbjct  73   PIILDRILRLLASYKVLTCNLRTLEDGGVERLYGLAPVCKFLVKNEDGVSIAPLVLMNQD  132

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV+D  I PF K  G   + Y+G +P  N +  + M+  S   MK  L
Sbjct  133  KVLMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMADHSTITMKKLL  191

Query  576  DSYQGFKGVTRLVDV  620
            + Y+GF+G+  +VDV
Sbjct  192  ELYKGFEGLKSVVDV  206



>gb|ABK23795.1| unknown [Picea sitchensis]
Length=365

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 101/188 (54%), Gaps = 4/188 (2%)
 Frame = +3

Query  66   LRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLERL  245
            L  MEL N   +PM++ A I L+V   I   G+   L++++I++ +  +    A +L R+
Sbjct  22   LLCMELGNFSCLPMAMKAAIELDVFQIIANAGNGVQLASTQIVARIQTTNPDAAISLNRI  81

Query  246  LRMLTSYGIFREHINAD---ASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAW  416
            L++L S+ +    +  D    +E  Y +  + K LV ++DG+S   +VL +     M++W
Sbjct  82   LKVLASHSVLSCSVTMDENGKAECLYGLTSLCKYLVKNRDGISLAPWVLMNQDKVFMESW  141

Query  417  PLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDSYQGFK  596
              + +AV++ S +PF K +G   + Y   +   N ++ + MS  S   M   LD YQGFK
Sbjct  142  HYLKDAVLEGS-QPFTKAHGMNVFEYLAMDRRFNKVLNRTMSEHSTTLMCKILDMYQGFK  200

Query  597  GVTRLVDV  620
             V +LVDV
Sbjct  201  YVQKLVDV  208



>ref|XP_008788729.1| PREDICTED: tricetin 3',4',5'-O-trimethyltransferase [Phoenix 
dactylifera]
Length=367

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/194 (33%), Positives = 102/194 (53%), Gaps = 4/194 (2%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            +D  A +  ++LA+   +PM+L   I L+V + I + GS A LS +E+ + +       A
Sbjct  19   ADEEACMYALQLASASILPMTLKNAIELDVLEIIAKAGSAAKLSPAEVAAQLPTKNPMAA  78

Query  228  PNLERLLRMLTSYGIFREHINADASE---RRYSVDEVGKTLVTDKDGLSYGAYVLQHHQA  398
              L+R+LR+L SY +    +  DA     RRY    V K L  ++DG+S  A  L +   
Sbjct  79   AMLDRMLRLLASYNVLTCSVEVDADGKPLRRYGPAPVCKWLTKNEDGVSMAALTLMNQDK  138

Query  399  AMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLD  578
             +M++W  + +AV+D  I PF K  G   + Y+G +P  N +  + M   S+   K  L+
Sbjct  139  ILMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNRVFNEGMKNHSIIITKKLLE  197

Query  579  SYQGFKGVTRLVDV  620
             Y+GF+ V  LVDV
Sbjct  198  FYKGFEDVNVLVDV  211



>gb|KJB23954.1| hypothetical protein B456_004G125600 [Gossypium raimondii]
Length=365

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/195 (34%), Positives = 105/195 (54%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+L +   +PM L + I L++ + + + G  A LS  E L+S LP+   DA
Sbjct  15   SDEEANLFAMQLTSASVLPMVLKSAIELDLLEIMAKAGPGAFLSPKE-LASQLPTSNPDA  73

Query  228  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L +Y I    +        ER Y +  V K +  ++DG++  A  L +  
Sbjct  74   PVMLDRILRLLATYSILTCSLRTLPDGKVERLYGLGPVCKFVTKNEDGVTLSALSLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  + MS  S   MK  L
Sbjct  134  KVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y GF+G+  LVDV
Sbjct  193  ETYDGFEGLKTLVDV  207



>ref|XP_003528001.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Glycine max]
Length=366

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 106/195 (54%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+   +PM L + + L++ + I + G    LS ++I +S LP+   +A
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSALELDLLEIIAKAGPGVHLSPTDI-ASQLPTHNPNA  73

Query  228  P-NLERLLRMLTSYGI--FREHINADAS-ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L  Y I  F      D   ER Y +  V K LV ++DG+S  A  L +  
Sbjct  74   PVMLDRILRLLACYNILSFSLRTLPDCKIERLYGLAPVAKYLVKNEDGVSIAALNLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  K M+  S   MK  L
Sbjct  134  KVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMADHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y GF G+  LVDV
Sbjct  193  ETYTGFGGLKSLVDV  207



>ref|XP_008462913.1| PREDICTED: caffeic acid 3-O-methyltransferase 1 [Cucumis melo]
Length=359

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 68/200 (34%), Positives = 110/200 (55%), Gaps = 11/200 (6%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  221
            S+ +  A+L  M+LA+   +PM L   I L++ + I +GG  A LS S+I S +    G 
Sbjct  6    SDDEEEAQLFAMQLASASVLPMVLKTAIELDLLEIIGRGGEGALLSPSQIASQL---SGL  62

Query  222  DAPN----LERLLRMLTSYGIFREHINA--DAS-ERRYSVDEVGKTLVTDKDGLSYGAYV  380
              P     L+R+LR+L SY I    +N   D S +R Y +  V K L+ ++DG+S     
Sbjct  63   KNPEAHVMLDRMLRLLASYSILTCSLNPLPDGSLQRLYGLAPVSKFLIKNQDGVSIAPLC  122

Query  381  LQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPF  560
            L +    +M++W  + +AV++  I PF +  G + + Y+G +P  N +  K MS  S   
Sbjct  123  LMNQDKVLMESWYHLKDAVLEGGI-PFNRAYGISAFEYHGTDPRFNKVFNKGMSDHSTIT  181

Query  561  MKAFLDSYQGFKGVTRLVDV  620
            MK  L++Y+GF+G+  +VDV
Sbjct  182  MKKILETYKGFEGLNSVVDV  201



>ref|XP_010934913.1| PREDICTED: tricetin 3',4',5'-O-trimethyltransferase-like [Elaeis 
guineensis]
Length=367

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/193 (32%), Positives = 100/193 (52%), Gaps = 4/193 (2%)
 Frame = +3

Query  51   DNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAP  230
            D  A L  ++L +   +PM+L A I L+V + I + G    LS +++ + +       A 
Sbjct  20   DEAACLYALQLVSSSILPMTLKAAIELDVLEIIAKAGPEGKLSPAQVAAQLPTENSMAAT  79

Query  231  NLERLLRMLTSYGIFREHINADASE---RRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  401
             L+R+LR+L SY I    +  DA     RRY    V K L  ++DG+S     L +    
Sbjct  80   MLDRMLRLLASYNILTCSVEVDADGKPLRRYGPAPVCKWLTKNEDGVSMAPLTLMNQDKV  139

Query  402  MMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFLDS  581
            +M++W  + +AV+D  I PF K  G   + Y+G +P  N++  + M   S+   K  L+S
Sbjct  140  LMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNNVFNEGMKNHSIVITKKLLES  198

Query  582  YQGFKGVTRLVDV  620
            Y+GF+ +  LVDV
Sbjct  199  YKGFEDINVLVDV  211



>emb|CDY18306.1| BnaC09g30560D [Brassica napus]
Length=364

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 69/196 (35%), Positives = 110/196 (56%), Gaps = 9/196 (5%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            +D+ A L  M+LA+   +PM L   + L++ + + +  S   +S SEI +S L +   +A
Sbjct  15   TDDEAALFAMQLASASVLPMVLKTALDLDLLEIMAKNSSQ--MSPSEI-ASQLQTKNPEA  71

Query  228  P-NLERLLRMLTSYGIF----REHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHH  392
            P  L+R+LR+LTSY I     R     D+ ER Y +  V K L  ++DG+S  A  L + 
Sbjct  72   PIMLDRILRLLTSYSILTCSSRAIPGGDSVERIYGLGPVCKYLTKNEDGVSIAALCLMNQ  131

Query  393  QAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAF  572
               +M++W  + +A++D  I PF K  G   + Y+GK+   N++    MS  S   MK  
Sbjct  132  DKVLMESWYHLKDAILDGGI-PFNKAYGMTAFEYHGKDLRFNTVFNNGMSNHSTITMKKI  190

Query  573  LDSYQGFKGVTRLVDV  620
            L++Y+GF+G+T LVDV
Sbjct  191  LETYKGFEGLTSLVDV  206



>gb|KDP36008.1| hypothetical protein JCGZ_10407 [Jatropha curcas]
Length=365

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/195 (33%), Positives = 108/195 (55%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            SD  A L  M+LA+  ++PM L + I L++ + I + G  A LS  +I +S LP+   DA
Sbjct  15   SDEEANLFAMQLASASTLPMVLKSAIELDLLEIIAKAGPGAFLSPHDI-ASQLPTKNPDA  73

Query  228  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
            P  L+R+LR+L SY I    +     +  ER Y +  V K L  ++DG+S+ +  +    
Sbjct  74   PLVLDRILRLLASYSILTCSLRTLPDEKFERLYGLAPVCKFLTKNEDGVSFASICVMIQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + + V++  +  F K  G   + Y+G +P  N +  + MS  S   M+  L
Sbjct  134  KVLMESWYHLKDVVLEGGVA-FNKAYGMTLFEYHGTDPRFNKVFNEGMSYHSTIIMRKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y+GF+G+T LVDV
Sbjct  193  ETYKGFEGLTSLVDV  207



>gb|AEO14871.1| caffeic acid O-methyltransferase [Salvia miltiorrhiza]
Length=364

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/207 (31%), Positives = 111/207 (54%), Gaps = 5/207 (2%)
 Frame = +3

Query  9    TGKLKEIGAMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASE  188
            T K  +  A+ S+ +  + L  M+LA+   +PM L + I L++ + I + G+ A +S +E
Sbjct  4    TTKNPQTAAVNSDEEE-SFLFAMQLASASVLPMVLKSAIELDLLEIIKKAGAGAFVSPAE  62

Query  189  ILSSVLPSGGGDAPNLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDG  359
            + + +  +  G A  L+R+LR+L SY I    +        +R Y +  V K L  + DG
Sbjct  63   VAAQLPTTNEGAAVMLDRILRLLASYAILECRLKTLPDGGVQRLYGLAPVCKFLTKNDDG  122

Query  360  LSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAM  539
            +S     L +    +M++W  + +AV+D  I PF K  G + + Y+G +P  N +  + M
Sbjct  123  VSVAPLALMNQDKVLMESWYHLKDAVLDGEI-PFNKAYGMSAFEYHGTDPRFNKVFNQGM  181

Query  540  SGISVPFMKAFLDSYQGFKGVTRLVDV  620
            SG S   MK  L++Y+GF G+  +VDV
Sbjct  182  SGHSTITMKKILETYKGFDGLNSVVDV  208



>gb|AEO14870.1| caffeic acid O-methyltransferase [Salvia miltiorrhiza]
Length=364

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/207 (31%), Positives = 111/207 (54%), Gaps = 5/207 (2%)
 Frame = +3

Query  9    TGKLKEIGAMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASE  188
            T K  +  A+ S+ +  + L  M+LA+   +PM L + I L++ + I + G+ A +S +E
Sbjct  4    TTKNPQTAAVNSDEEE-SFLFAMQLASASVLPMVLKSAIELDLLEIIKKAGAGAFVSPAE  62

Query  189  ILSSVLPSGGGDAPNLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDG  359
            + + +  +  G A  L+R+LR+L SY I    +        +R Y +  V K L  + DG
Sbjct  63   VAAQLPTTNEGAAVMLDRILRLLASYAILECRLKTLPDGGVQRLYGLAPVCKFLTKNDDG  122

Query  360  LSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAM  539
            +S     L +    +M++W  + +AV+D  I PF K  G + + Y+G +P  N +  + M
Sbjct  123  VSVAPLALMNQDKVLMESWYHLKDAVLDGEI-PFNKAYGMSAFEYHGTDPRFNKVFNQGM  181

Query  540  SGISVPFMKAFLDSYQGFKGVTRLVDV  620
            SG S   MK  L++Y+GF G+  +VDV
Sbjct  182  SGHSTITMKKILETYKGFDGLNSVVDV  208



>gb|AAY86361.1| caffeic acid O-methyltransferase [Acacia auriculiformis x Acacia 
mangium]
 gb|ADQ53456.1| caffeic acid O-methyltransferase [Acacia auriculiformis x Acacia 
mangium]
Length=365

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/195 (34%), Positives = 106/195 (54%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            +D  A L  M+LA+   +PM L + + L++ + I + G NA LS S+I +S LP+   DA
Sbjct  15   NDEEANLFAMQLASASVLPMILKSALELDLLEIIAKAGPNAQLSPSDI-ASQLPTKNPDA  73

Query  228  P-NLERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
               L+R++R+L  Y +    +        ER Y +  V K LV ++DG+S     L +  
Sbjct  74   AVMLDRMMRLLACYNVLSSSLRTLPDGKIERLYGLAPVAKYLVKNEDGVSIAPLNLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + E V++  I PF K +G   + Y+GK+   N +  K M+  S   MK  L
Sbjct  134  KVLMESWYYLTETVLEGGI-PFNKAHGMTSFEYHGKDARFNKVFNKGMADHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y GF+G+  LVDV
Sbjct  193  ETYTGFEGLKSLVDV  207



>ref|XP_007015114.1| Caffeic acid 3-O-methyltransferase 1 isoform 2 [Theobroma cacao]
 gb|EOY32733.1| Caffeic acid 3-O-methyltransferase 1 isoform 2 [Theobroma cacao]
Length=427

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/198 (32%), Positives = 108/198 (55%), Gaps = 7/198 (4%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  221
            SE D  +    M+L N  ++PMSL A I+L + + I + G +A LS  EI  + LP+   
Sbjct  75   SEQDEESFSCAMQLVNSTALPMSLHAAIQLEIFEIIAKAGPDAKLSPQEI-GAHLPTQNP  133

Query  222  DAPN-LERLLRMLTSYGIFREHI----NADASERRYSVDEVGKTLVTDKDGLSYGAYVLQ  386
            DAP  L+ +LR+L S+ +    +      D+ +R YS+  V K  + ++DG+S    V  
Sbjct  134  DAPMMLDSILRLLASHSVLACSLAVVEQGDSPQRLYSLTPVTKFFIRNEDGVSLAPLVSL  193

Query  387  HHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMK  566
                  + +W  + +A+++  I PF +V+G   + Y GK+P  N +   AM   +   MK
Sbjct  194  VQDKIFLDSWCQLKDAILEGGI-PFNRVHGTHAFEYPGKDPRFNKIFNTAMMNQTTIVMK  252

Query  567  AFLDSYQGFKGVTRLVDV  620
              L++Y+GF+ +++LVDV
Sbjct  253  KILEAYKGFEHLSQLVDV  270



>ref|XP_007015113.1| Caffeic acid 3-O-methyltransferase 1 isoform 1 [Theobroma cacao]
 gb|EOY32732.1| Caffeic acid 3-O-methyltransferase 1 isoform 1 [Theobroma cacao]
Length=426

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/198 (32%), Positives = 108/198 (55%), Gaps = 7/198 (4%)
 Frame = +3

Query  42   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  221
            SE D  +    M+L N  ++PMSL A I+L + + I + G +A LS  EI  + LP+   
Sbjct  75   SEQDEESFSCAMQLVNSTALPMSLHAAIQLEIFEIIAKAGPDAKLSPQEI-GAHLPTQNP  133

Query  222  DAPN-LERLLRMLTSYGIFREHI----NADASERRYSVDEVGKTLVTDKDGLSYGAYVLQ  386
            DAP  L+ +LR+L S+ +    +      D+ +R YS+  V K  + ++DG+S    V  
Sbjct  134  DAPMMLDSILRLLASHSVLACSLAVVEQGDSPQRLYSLTPVTKFFIRNEDGVSLAPLVSL  193

Query  387  HHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMK  566
                  + +W  + +A+++  I PF +V+G   + Y GK+P  N +   AM   +   MK
Sbjct  194  VQDKIFLDSWCQLKDAILEGGI-PFNRVHGTHAFEYPGKDPRFNKIFNTAMMNQTTIVMK  252

Query  567  AFLDSYQGFKGVTRLVDV  620
              L++Y+GF+ +++LVDV
Sbjct  253  KILEAYKGFEHLSQLVDV  270



>dbj|BAO79382.1| hypothetical plant O-methyltransferase [Anthriscus sylvestris]
Length=365

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 65/196 (33%), Positives = 106/196 (54%), Gaps = 6/196 (3%)
 Frame = +3

Query  45   ESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGD  224
            + +  A +  M+LA+   +PM L + I L++ ++I Q G  A +S +E L++ LPS   D
Sbjct  16   DEEEEACMFAMQLASASVLPMVLKSAIELDLLESIAQAGPGAYVSPAE-LAAKLPSSQPD  74

Query  225  AP-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHH  392
             P  L+R+LR+L SY + +     +     ER Y++  V K L  + DG+S    +L + 
Sbjct  75   TPVMLDRILRLLASYSVLKCKLRDLPQGGVERLYALAPVCKFLTKNSDGVSMAPLLLMNQ  134

Query  393  QAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAF  572
               +M++W  + + V+D  I PF K  G   + Y+GK+P  N +    MS  S   MK  
Sbjct  135  DKILMESWYHLKDTVLDGGI-PFNKAYGMTAFEYHGKDPRFNKVFNLGMSNHSTITMKKI  193

Query  573  LDSYQGFKGVTRLVDV  620
            L++Y GF G+  +VDV
Sbjct  194  LETYNGFAGLKTVVDV  209



>gb|ABS57468.1| caffeic acid O-methyl transferase [Leucaena leucocephala]
 gb|ABU41320.1| caffeic acid o-methyl transferase [Leucaena leucocephala]
Length=365

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 66/195 (34%), Positives = 107/195 (55%), Gaps = 6/195 (3%)
 Frame = +3

Query  48   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  227
            +D  A L  M+LA+   +PM L + + L++ + I + G NA LS S I ++ LP+   DA
Sbjct  15   NDEEANLFAMQLASASVLPMILKSALELDLLEIIAKAGPNAQLSPSNI-AAQLPTKNPDA  73

Query  228  P-NLERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  395
               L+R++R+L  Y +    +        ER Y +  V K LV ++DG+S     L +  
Sbjct  74   AVMLDRMMRLLACYNVLSCSVRTLPDGKIERLYGLAPVAKYLVKNEDGVSIAPLNLMNQD  133

Query  396  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  575
              +M++W  + +AV++  I PF K +G   + Y+GK+   N +  K M+  S   MK  L
Sbjct  134  KVLMESWYYLKDAVLEGGI-PFNKAHGMTSFEYHGKDLRFNKVFNKGMADHSTITMKKIL  192

Query  576  DSYQGFKGVTRLVDV  620
            ++Y GF+G+T LVDV
Sbjct  193  ETYTGFEGLTSLVDV  207



>ref|XP_009392797.1| PREDICTED: flavone O-methyltransferase 1-like [Musa acuminata 
subsp. malaccensis]
Length=362

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/206 (31%), Positives = 105/206 (51%), Gaps = 4/206 (2%)
 Frame = +3

Query  12   GKLKEIGAMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEI  191
            G +K    +  E D  A +  M+LA+   +PM+L A I L++ + + +    A LS +++
Sbjct  2    GSVKNAVQLTPEEDEEACMYAMQLASGSILPMTLKAAIELDLLEILTKASPGARLSPADV  61

Query  192  LSSVLPSGGGDAPNLERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGL  362
             + +       A  ++R+LR+L +Y +    + ADA     R Y    V K L  ++DG+
Sbjct  62   AARLPTKNPHAAVMVDRMLRLLAAYNVVSCTVEADAEGRPSRTYGAAPVCKYLTKNEDGV  121

Query  363  SYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMS  542
            S  A  L +    +M++W  + +AV+D  I PF +  G   + Y+G +P  N++    M 
Sbjct  122  SMAALALMNQDKVLMESWYYLKDAVLDGGI-PFNRAYGMTAFEYHGTDPRFNAVFNDGMK  180

Query  543  GISVPFMKAFLDSYQGFKGVTRLVDV  620
              S+   K  LD Y+GF  V RLVDV
Sbjct  181  NHSIIITKKLLDIYRGFDDVNRLVDV  206



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520