BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS085H08

Length=610
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009587222.1|  PREDICTED: multiple C2 and transmembrane dom...    128   2e-30   Nicotiana tomentosiformis
ref|XP_004249277.1|  PREDICTED: extended synaptotagmin-1-like           128   2e-30   Solanum lycopersicum
ref|XP_009614150.1|  PREDICTED: multiple C2 and transmembrane dom...    128   3e-30   Nicotiana tomentosiformis
ref|XP_009785357.1|  PREDICTED: multiple C2 and transmembrane dom...    128   3e-30   Nicotiana sylvestris
ref|XP_009594768.1|  PREDICTED: multiple C2 and transmembrane dom...    128   3e-30   Nicotiana tomentosiformis
ref|XP_009799235.1|  PREDICTED: extended synaptotagmin-1-like           127   3e-30   Nicotiana sylvestris
ref|XP_004249278.1|  PREDICTED: multiple C2 and transmembrane dom...    127   5e-30   Solanum lycopersicum
ref|XP_006351338.1|  PREDICTED: multiple C2 and transmembrane dom...    127   6e-30   Solanum tuberosum [potatoes]
ref|XP_006351337.1|  PREDICTED: multiple C2 and transmembrane dom...    126   8e-30   
ref|XP_006362239.1|  PREDICTED: multiple C2 and transmembrane dom...    126   1e-29   Solanum tuberosum [potatoes]
ref|XP_004249163.1|  PREDICTED: extended synaptotagmin-1-like           126   1e-29   Solanum lycopersicum
ref|XP_011078851.1|  PREDICTED: multiple C2 and transmembrane dom...    125   3e-29   Sesamum indicum [beniseed]
ref|XP_008360635.1|  PREDICTED: multiple C2 and transmembrane dom...    124   4e-29   
ref|XP_006381053.1|  C2 domain-containing family protein                124   4e-29   Populus trichocarpa [western balsam poplar]
ref|XP_009376104.1|  PREDICTED: multiple C2 and transmembrane dom...    124   4e-29   Pyrus x bretschneideri [bai li]
emb|CDP10110.1|  unnamed protein product                                124   4e-29   Coffea canephora [robusta coffee]
gb|EYU20709.1|  hypothetical protein MIMGU_mgv1a001689mg                124   7e-29   Erythranthe guttata [common monkey flower]
ref|XP_009766493.1|  PREDICTED: multiple C2 and transmembrane dom...    124   8e-29   Nicotiana sylvestris
gb|KEH16148.1|  C2 calcium/lipid-binding and GRAM domain protein        123   1e-28   Medicago truncatula
ref|XP_007201936.1|  hypothetical protein PRUPE_ppa001850mg             123   1e-28   
ref|XP_008240960.1|  PREDICTED: multiple C2 and transmembrane dom...    123   1e-28   Prunus mume [ume]
ref|XP_009369854.1|  PREDICTED: multiple C2 and transmembrane dom...    123   1e-28   Pyrus x bretschneideri [bai li]
ref|XP_003535846.1|  PREDICTED: multiple C2 and transmembrane dom...    123   1e-28   Glycine max [soybeans]
ref|XP_008443079.1|  PREDICTED: extended synaptotagmin-1                123   2e-28   Cucumis melo [Oriental melon]
ref|XP_004136579.1|  PREDICTED: multiple C2 and transmembrane dom...    123   2e-28   Cucumis sativus [cucumbers]
ref|XP_003554197.1|  PREDICTED: multiple C2 and transmembrane dom...    123   2e-28   Glycine max [soybeans]
ref|XP_008387239.1|  PREDICTED: multiple C2 and transmembrane dom...    122   2e-28   
ref|XP_007162297.1|  hypothetical protein PHAVU_001G140200g             122   2e-28   Phaseolus vulgaris [French bean]
ref|XP_003521201.1|  PREDICTED: multiple C2 and transmembrane dom...    122   2e-28   Glycine max [soybeans]
gb|KHN07409.1|  Multiple C2 and transmembrane domain-containing p...    122   2e-28   Glycine soja [wild soybean]
ref|XP_004493560.1|  PREDICTED: multiple C2 and transmembrane dom...    122   2e-28   Cicer arietinum [garbanzo]
emb|CDY47660.1|  BnaC04g23970D                                          122   2e-28   Brassica napus [oilseed rape]
ref|XP_011020270.1|  PREDICTED: multiple C2 and transmembrane dom...    122   3e-28   Populus euphratica
ref|XP_010463385.1|  PREDICTED: multiple C2 and transmembrane dom...    119   3e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010111396.1|  Multiple C2 and transmembrane domain-contain...    122   4e-28   Morus notabilis
ref|XP_006437045.1|  hypothetical protein CICLE_v10030764mg             121   5e-28   Citrus clementina [clementine]
gb|KDO57727.1|  hypothetical protein CISIN_1g004109mg                   121   5e-28   Citrus sinensis [apfelsine]
emb|CBI30044.3|  unnamed protein product                                118   6e-28   Vitis vinifera
ref|XP_007145661.1|  hypothetical protein PHAVU_007G257800g             121   6e-28   Phaseolus vulgaris [French bean]
ref|XP_011033252.1|  PREDICTED: extended synaptotagmin-1                121   8e-28   Populus euphratica
gb|EPS67145.1|  hypothetical protein M569_07629                         120   8e-28   Genlisea aurea
ref|XP_002894324.1|  C2 domain-containing protein                       120   8e-28   
ref|XP_004497931.1|  PREDICTED: uncharacterized protein LOC101499...    120   9e-28   Cicer arietinum [garbanzo]
ref|XP_002322682.2|  hypothetical protein POPTR_0016s04960g             120   1e-27   
ref|XP_006306818.1|  hypothetical protein CARUB_v10008360mg             120   1e-27   Capsella rubella
ref|XP_004304385.1|  PREDICTED: multiple C2 and transmembrane dom...    120   1e-27   Fragaria vesca subsp. vesca
ref|XP_010554852.1|  PREDICTED: multiple C2 and transmembrane dom...    120   1e-27   
ref|XP_002532333.1|  synaptotagmin, putative                            120   1e-27   
ref|XP_006393033.1|  hypothetical protein EUTSA_v10011254mg             120   1e-27   Eutrema salsugineum [saltwater cress]
gb|KDP24596.1|  hypothetical protein JCGZ_25512                         119   2e-27   Jatropha curcas
emb|CDX98254.1|  BnaC06g16150D                                          119   2e-27   
ref|XP_009104078.1|  PREDICTED: multiple C2 and transmembrane dom...    119   2e-27   Brassica rapa
emb|CDX67712.1|  BnaA07g17520D                                          119   3e-27   
ref|XP_010479644.1|  PREDICTED: extended synaptotagmin-1-like iso...    119   3e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010500735.1|  PREDICTED: extended synaptotagmin-1-like           119   3e-27   Camelina sativa [gold-of-pleasure]
ref|XP_009139005.1|  PREDICTED: extended synaptotagmin-1-like           119   3e-27   Brassica rapa
emb|CDY69710.1|  BnaAnng31280D                                          119   3e-27   Brassica napus [oilseed rape]
ref|NP_175568.1|  calcium-dependent lipid-binding (CaLB domain) p...    119   3e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006290627.1|  hypothetical protein CARUB_v10016719mg             119   3e-27   Capsella rubella
ref|XP_002278165.1|  PREDICTED: extended synaptotagmin-1                119   3e-27   Vitis vinifera
ref|XP_010516424.1|  PREDICTED: multiple C2 and transmembrane dom...    119   3e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010504727.1|  PREDICTED: multiple C2 and transmembrane dom...    119   3e-27   Camelina sativa [gold-of-pleasure]
emb|CAN80955.1|  hypothetical protein VITISV_013781                     119   3e-27   Vitis vinifera
ref|XP_002878177.1|  C2 domain-containing protein                       119   4e-27   
ref|XP_010672701.1|  PREDICTED: multiple C2 and transmembrane dom...    118   6e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006402831.1|  hypothetical protein EUTSA_v10005798mg             118   7e-27   Eutrema salsugineum [saltwater cress]
ref|XP_010057953.1|  PREDICTED: extended synaptotagmin-1-like           118   7e-27   Eucalyptus grandis [rose gum]
gb|KJB36100.1|  hypothetical protein B456_006G141200                    118   8e-27   Gossypium raimondii
dbj|BAF01685.1|  anthranilate phosphoribosyltransferase-like protein    118   9e-27   Arabidopsis thaliana [mouse-ear cress]
ref|NP_191347.1|  C2 domain-containing plant phosphoribosyltransf...    117   1e-26   Arabidopsis thaliana [mouse-ear cress]
gb|AAK53020.1|AF375436_1  AT3g57880/T10K17_90                           117   1e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008442250.1|  PREDICTED: multiple C2 and transmembrane dom...    117   1e-26   Cucumis melo [Oriental melon]
gb|KFK35840.1|  hypothetical protein AALP_AA4G043900                    117   2e-26   Arabis alpina [alpine rockcress]
ref|XP_004144665.1|  PREDICTED: uncharacterized protein LOC101203...    115   4e-26   Cucumis sativus [cucumbers]
ref|XP_003625221.1|  Anthranilate phosphoribosyltransferase-like ...    115   5e-26   Medicago truncatula
ref|XP_010548191.1|  PREDICTED: multiple C2 and transmembrane dom...    115   1e-25   Tarenaya hassleriana [spider flower]
ref|XP_008778691.1|  PREDICTED: multiple C2 and transmembrane dom...    114   2e-25   Phoenix dactylifera
ref|XP_007028941.1|  Calcium-dependent lipid-binding (CaLB domain...    113   4e-25   
ref|XP_007028942.1|  Calcium-dependent lipid-binding (CaLB domain...    113   5e-25   Theobroma cacao [chocolate]
ref|XP_006386096.1|  hypothetical protein POPTR_0003s22060g             110   4e-24   
ref|XP_010265829.1|  PREDICTED: multiple C2 and transmembrane dom...    110   4e-24   Nelumbo nucifera [Indian lotus]
ref|XP_009395864.1|  PREDICTED: extended synaptotagmin-1-like           110   6e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010928839.1|  PREDICTED: extended synaptotagmin-1-like           108   2e-23   Elaeis guineensis
ref|XP_008243596.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    108   2e-23   Prunus mume [ume]
ref|XP_007208351.1|  hypothetical protein PRUPE_ppa001743mg             108   2e-23   Prunus persica
ref|XP_008782885.1|  PREDICTED: multiple C2 and transmembrane dom...    108   2e-23   Phoenix dactylifera
ref|XP_009364713.1|  PREDICTED: multiple C2 and transmembrane dom...    107   4e-23   Pyrus x bretschneideri [bai li]
ref|XP_009364728.1|  PREDICTED: multiple C2 and transmembrane dom...    107   4e-23   Pyrus x bretschneideri [bai li]
ref|XP_008358865.1|  PREDICTED: multiple C2 and transmembrane dom...    107   4e-23   
ref|XP_011025253.1|  PREDICTED: multiple C2 and transmembrane dom...    107   4e-23   Populus euphratica
ref|XP_007014901.1|  Calcium-dependent lipid-binding (CaLB domain...    107   5e-23   
ref|XP_008787291.1|  PREDICTED: extended synaptotagmin-1-like           107   6e-23   Phoenix dactylifera
ref|XP_004295231.1|  PREDICTED: multiple C2 and transmembrane dom...    107   6e-23   Fragaria vesca subsp. vesca
ref|XP_002297795.1|  C2 domain-containing family protein                107   6e-23   Populus trichocarpa [western balsam poplar]
emb|CBI16433.3|  unnamed protein product                                105   8e-23   Vitis vinifera
ref|XP_010913922.1|  PREDICTED: multiple C2 and transmembrane dom...    106   9e-23   
gb|KJB83485.1|  hypothetical protein B456_013G250100                    106   1e-22   Gossypium raimondii
ref|XP_002513446.1|  synaptotagmin, putative                            106   1e-22   Ricinus communis
ref|XP_009374817.1|  PREDICTED: multiple C2 and transmembrane dom...    106   1e-22   Pyrus x bretschneideri [bai li]
ref|XP_002285588.1|  PREDICTED: multiple C2 and transmembrane dom...    105   1e-22   Vitis vinifera
gb|KJB83481.1|  hypothetical protein B456_013G250100                    105   1e-22   Gossypium raimondii
gb|KHG04257.1|  Multiple C2 and transmembrane domain-containing 1       105   1e-22   Gossypium arboreum [tree cotton]
ref|XP_006850074.1|  hypothetical protein AMTR_s00022p00214560          104   3e-22   
gb|KDP20200.1|  hypothetical protein JCGZ_07920                         104   4e-22   Jatropha curcas
ref|XP_010091994.1|  Multiple C2 and transmembrane domain-contain...    104   5e-22   Morus notabilis
ref|XP_006445975.1|  hypothetical protein CICLE_v10014352mg             104   5e-22   Citrus clementina [clementine]
ref|XP_006494723.1|  PREDICTED: multiple C2 and transmembrane dom...    104   6e-22   Citrus sinensis [apfelsine]
ref|XP_011037883.1|  PREDICTED: multiple C2 and transmembrane dom...    103   1e-21   Populus euphratica
gb|KHG19030.1|  Multiple C2 and transmembrane domain-containing 1       103   1e-21   Gossypium arboreum [tree cotton]
gb|KJB66120.1|  hypothetical protein B456_010G128400                    103   1e-21   Gossypium raimondii
ref|XP_010519731.1|  PREDICTED: multiple C2 and transmembrane dom...    102   2e-21   Tarenaya hassleriana [spider flower]
ref|XP_010238001.1|  PREDICTED: LOW QUALITY PROTEIN: extended syn...    102   3e-21   
ref|XP_006654319.1|  PREDICTED: multiple C2 and transmembrane dom...    101   4e-21   Oryza brachyantha
ref|NP_001055351.1|  Os05g0370600                                       101   5e-21   
gb|KEH30271.1|  C2 calcium/lipid-binding and GRAM domain protein        101   6e-21   Medicago truncatula
ref|NP_196801.1|  calcium-dependent lipid-binding domain-containi...    100   7e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007131979.1|  hypothetical protein PHAVU_011G056600g           99.8    2e-20   Phaseolus vulgaris [French bean]
emb|CDX78498.1|  BnaA03g04100D                                        99.8    2e-20   
ref|XP_002438680.1|  hypothetical protein SORBIDRAFT_10g024200        99.8    2e-20   Sorghum bicolor [broomcorn]
ref|XP_009131306.1|  PREDICTED: multiple C2 and transmembrane dom...  99.8    2e-20   Brassica rapa
ref|XP_008658284.1|  PREDICTED: uncharacterized protein LOC100273...  99.4    3e-20   
ref|XP_003537951.1|  PREDICTED: multiple C2 and transmembrane dom...  99.0    4e-20   Glycine max [soybeans]
ref|XP_002871539.1|  C2 domain-containing protein                     98.2    6e-20   
ref|XP_010673580.1|  PREDICTED: multiple C2 and transmembrane dom...  97.8    8e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010044995.1|  PREDICTED: multiple C2 and transmembrane dom...  97.8    8e-20   Eucalyptus grandis [rose gum]
ref|XP_009121819.1|  PREDICTED: extended synaptotagmin-1-like         97.8    9e-20   Brassica rapa
ref|XP_010492034.1|  PREDICTED: multiple C2 and transmembrane dom...  97.4    1e-19   Camelina sativa [gold-of-pleasure]
emb|CDX97214.1|  BnaC09g44110D                                        97.1    1e-19   
gb|EMS45217.1|  Multiple C2 and transmembrane domain-containing p...  97.1    2e-19   Triticum urartu
ref|XP_006289947.1|  hypothetical protein CARUB_v10003573mg           97.1    2e-19   Capsella rubella
ref|XP_006399782.1|  hypothetical protein EUTSA_v10012747mg           97.1    2e-19   Eutrema salsugineum [saltwater cress]
gb|EMT24491.1|  Multiple C2 and transmembrane domain-containing p...  96.7    2e-19   
ref|XP_010227498.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...  97.1    2e-19   
ref|XP_010419857.1|  PREDICTED: multiple C2 and transmembrane dom...  96.7    2e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010419856.1|  PREDICTED: multiple C2 and transmembrane dom...  96.7    2e-19   
emb|CDY68091.1|  BnaAnng26150D                                        96.3    3e-19   Brassica napus [oilseed rape]
emb|CDX70485.1|  BnaC03g05690D                                        95.5    5e-19   
ref|XP_004142139.1|  PREDICTED: multiple C2 and transmembrane dom...  94.7    1e-18   Cucumis sativus [cucumbers]
ref|XP_007150401.1|  hypothetical protein PHAVU_005G150300g           94.7    1e-18   Phaseolus vulgaris [French bean]
ref|XP_003543552.1|  PREDICTED: multiple C2 and transmembrane dom...  94.7    1e-18   Glycine max [soybeans]
gb|KHN33324.1|  Multiple C2 and transmembrane domain-containing p...  94.0    2e-18   Glycine soja [wild soybean]
ref|XP_008647970.1|  PREDICTED: phosphoribosylanthranilate transf...  93.6    2e-18   
ref|NP_001152102.1|  phosphoribosylanthranilate transferase           93.6    2e-18   
ref|XP_008449758.1|  PREDICTED: multiple C2 and transmembrane dom...  93.6    2e-18   Cucumis melo [Oriental melon]
ref|XP_003546988.1|  PREDICTED: multiple C2 and transmembrane dom...  93.6    2e-18   Glycine max [soybeans]
emb|CDP14088.1|  unnamed protein product                              93.6    2e-18   Coffea canephora [robusta coffee]
gb|KDP28646.1|  hypothetical protein JCGZ_14417                       93.2    4e-18   Jatropha curcas
ref|XP_002511838.1|  synaptotagmin, putative                          92.0    9e-18   Ricinus communis
ref|XP_009417304.1|  PREDICTED: multiple C2 and transmembrane dom...  91.7    1e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010105960.1|  Multiple C2 and transmembrane domain-contain...  91.3    2e-17   Morus notabilis
ref|XP_010255412.1|  PREDICTED: multiple C2 and transmembrane dom...  91.3    2e-17   Nelumbo nucifera [Indian lotus]
gb|KJB41306.1|  hypothetical protein B456_007G098200                  90.5    4e-17   Gossypium raimondii
ref|XP_010940465.1|  PREDICTED: multiple C2 and transmembrane dom...  90.1    5e-17   Elaeis guineensis
ref|XP_006349900.1|  PREDICTED: multiple C2 and transmembrane dom...  89.7    5e-17   Solanum tuberosum [potatoes]
emb|CBI40337.3|  unnamed protein product                              89.4    5e-17   Vitis vinifera
ref|XP_008806876.1|  PREDICTED: multiple C2 and transmembrane dom...  89.7    5e-17   Phoenix dactylifera
ref|XP_009383872.1|  PREDICTED: multiple C2 and transmembrane dom...  89.7    6e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002271590.1|  PREDICTED: uncharacterized protein LOC100253432  89.7    6e-17   Vitis vinifera
emb|CAN79812.1|  hypothetical protein VITISV_018822                   89.7    7e-17   Vitis vinifera
ref|XP_009386410.1|  PREDICTED: multiple C2 and transmembrane dom...  88.6    1e-16   
ref|XP_008778754.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...  88.6    1e-16   
ref|XP_006445078.1|  hypothetical protein CICLE_v10018672mg           88.6    2e-16   Citrus clementina [clementine]
gb|KDO86111.1|  hypothetical protein CISIN_1g001835mg                 88.6    2e-16   Citrus sinensis [apfelsine]
ref|XP_010660813.1|  PREDICTED: uncharacterized protein LOC100264973  88.6    2e-16   Vitis vinifera
ref|XP_010934752.1|  PREDICTED: multiple C2 and transmembrane dom...  88.2    2e-16   Elaeis guineensis
ref|XP_007051845.1|  C2 calcium/lipid-binding plant phosphoribosy...  87.4    3e-16   
ref|XP_007051844.1|  C2 calcium/lipid-binding plant phosphoribosy...  87.4    3e-16   
ref|XP_007052594.1|  C2 calcium/lipid-binding plant phosphoribosy...  87.0    5e-16   
ref|XP_002320122.2|  hypothetical protein POPTR_0014s07750g           87.0    5e-16   Populus trichocarpa [western balsam poplar]
gb|EMT30716.1|  hypothetical protein F775_31640                       87.0    5e-16   
dbj|BAK04937.1|  predicted protein                                    86.7    6e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003580853.1|  PREDICTED: multiple C2 and transmembrane dom...  86.7    7e-16   
gb|KDO83486.1|  hypothetical protein CISIN_1g004208mg                 85.9    9e-16   Citrus sinensis [apfelsine]
ref|XP_007220279.1|  hypothetical protein PRUPE_ppa000771mg           86.3    9e-16   Prunus persica
ref|XP_008244912.1|  PREDICTED: uncharacterized protein LOC103343020  86.3    1e-15   Prunus mume [ume]
ref|XP_006483675.1|  PREDICTED: multiple C2 and transmembrane dom...  85.9    1e-15   Citrus sinensis [apfelsine]
ref|XP_006439066.1|  hypothetical protein CICLE_v10033918mg           85.9    1e-15   Citrus clementina [clementine]
emb|CBI24845.3|  unnamed protein product                              85.5    1e-15   Vitis vinifera
ref|XP_010053272.1|  PREDICTED: uncharacterized protein LOC104441758  85.9    1e-15   
ref|XP_011023361.1|  PREDICTED: multiple C2 and transmembrane dom...  85.9    1e-15   Populus euphratica
ref|XP_006342310.1|  PREDICTED: multiple C2 and transmembrane dom...  85.5    1e-15   Solanum tuberosum [potatoes]
ref|XP_004235089.1|  PREDICTED: multiple C2 and transmembrane dom...  85.5    2e-15   Solanum lycopersicum
ref|XP_010659323.1|  PREDICTED: multiple C2 and transmembrane dom...  85.1    2e-15   Vitis vinifera
ref|XP_011015655.1|  PREDICTED: multiple C2 and transmembrane dom...  85.1    2e-15   Populus euphratica
ref|XP_002301353.2|  hypothetical protein POPTR_0002s15950g           85.1    2e-15   Populus trichocarpa [western balsam poplar]
ref|XP_002509788.1|  synaptotagmin, putative                          84.7    3e-15   
emb|CDP08834.1|  unnamed protein product                              84.7    3e-15   Coffea canephora [robusta coffee]
emb|CDY01973.1|  BnaC02g27540D                                        84.7    3e-15   
ref|XP_008458254.1|  PREDICTED: uncharacterized protein LOC103497726  84.3    4e-15   Cucumis melo [Oriental melon]
ref|XP_004299880.1|  PREDICTED: multiple C2 and transmembrane dom...  84.3    4e-15   Fragaria vesca subsp. vesca
ref|XP_004166328.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  84.3    4e-15   
gb|KDP24593.1|  hypothetical protein JCGZ_25509                       84.0    4e-15   Jatropha curcas
ref|XP_004138509.1|  PREDICTED: uncharacterized protein LOC101203632  84.3    4e-15   
gb|EYU23487.1|  hypothetical protein MIMGU_mgv1a000757mg              84.3    4e-15   Erythranthe guttata [common monkey flower]
ref|XP_007217305.1|  hypothetical protein PRUPE_ppa015370mg           84.0    5e-15   
gb|EMS48196.1|  Multiple C2 and transmembrane domain-containing p...  83.2    7e-15   Triticum urartu
ref|XP_009379435.1|  PREDICTED: multiple C2 and transmembrane dom...  83.6    7e-15   Pyrus x bretschneideri [bai li]
ref|XP_009128492.1|  PREDICTED: uncharacterized protein LOC103853319  82.8    1e-14   Brassica rapa
ref|XP_009393442.1|  PREDICTED: uncharacterized protein LOC103979123  82.4    2e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011078852.1|  PREDICTED: multiple C2 and transmembrane dom...  82.0    2e-14   Sesamum indicum [beniseed]
emb|CDY54062.1|  BnaA02g36480D                                        81.6    3e-14   Brassica napus [oilseed rape]
ref|XP_007052573.1|  Calcium-dependent lipid-binding (CaLB domain...  81.3    3e-14   
ref|XP_009763246.1|  PREDICTED: uncharacterized protein LOC104215187  81.3    3e-14   Nicotiana sylvestris
ref|XP_009611365.1|  PREDICTED: uncharacterized protein LOC104104885  81.3    3e-14   Nicotiana tomentosiformis
ref|XP_010930774.1|  PREDICTED: multiple C2 and transmembrane dom...  81.3    4e-14   Elaeis guineensis
gb|AFN53655.1|  putative synaptotagmin protein                        80.9    4e-14   Linum usitatissimum
gb|KDO57729.1|  hypothetical protein CISIN_1g003882mg                 80.9    4e-14   Citrus sinensis [apfelsine]
ref|XP_006483676.1|  PREDICTED: multiple C2 and transmembrane dom...  81.3    4e-14   Citrus sinensis [apfelsine]
ref|XP_006439068.1|  hypothetical protein CICLE_v10030600mg           80.9    5e-14   
gb|KDO83484.1|  hypothetical protein CISIN_1g001696mg                 80.9    5e-14   Citrus sinensis [apfelsine]
gb|AES80126.2|  calcium-dependent lipid-binding (CaLB domain) fam...  80.9    5e-14   Medicago truncatula
ref|XP_003623908.1|  Extended synaptotagmin-2                         80.9    5e-14   
gb|EMT11702.1|  hypothetical protein F775_07618                       80.5    5e-14   
gb|ABD33426.2|  C2                                                    80.9    6e-14   Medicago truncatula
gb|KFK44354.1|  hypothetical protein AALP_AA1G246600                  80.5    6e-14   Arabis alpina [alpine rockcress]
ref|XP_004497937.1|  PREDICTED: multiple C2 and transmembrane dom...  80.5    7e-14   Cicer arietinum [garbanzo]
ref|XP_004309445.1|  PREDICTED: multiple C2 and transmembrane dom...  80.5    7e-14   Fragaria vesca subsp. vesca
ref|XP_010104492.1|  Multiple C2 and transmembrane domain-contain...  80.5    8e-14   
gb|KJB25055.1|  hypothetical protein B456_004G174500                  80.1    9e-14   Gossypium raimondii
ref|XP_006850085.1|  hypothetical protein AMTR_s00022p00218970        80.1    1e-13   Amborella trichopoda
ref|XP_006437049.1|  hypothetical protein CICLE_v10033973mg           79.7    1e-13   Citrus clementina [clementine]
emb|CDX81021.1|  BnaC03g02750D                                        77.0    1e-13   
ref|XP_003518076.1|  PREDICTED: multiple C2 and transmembrane dom...  79.7    1e-13   Glycine max [soybeans]
ref|XP_011080250.1|  PREDICTED: multiple C2 and transmembrane dom...  79.7    1e-13   Sesamum indicum [beniseed]
gb|EYU20710.1|  hypothetical protein MIMGU_mgv1a023485mg              79.7    1e-13   Erythranthe guttata [common monkey flower]
ref|XP_008231335.1|  PREDICTED: multiple C2 and transmembrane dom...  79.7    1e-13   
ref|XP_008231338.1|  PREDICTED: multiple C2 and transmembrane dom...  79.7    1e-13   
ref|XP_007220593.1|  hypothetical protein PRUPE_ppa000616mg           79.7    1e-13   Prunus persica
ref|XP_008231337.1|  PREDICTED: multiple C2 and transmembrane dom...  79.7    1e-13   Prunus mume [ume]
ref|XP_010273065.1|  PREDICTED: uncharacterized protein LOC104608707  79.7    1e-13   Nelumbo nucifera [Indian lotus]
ref|XP_009362439.1|  PREDICTED: uncharacterized protein LOC103952559  79.7    1e-13   Pyrus x bretschneideri [bai li]
ref|XP_008231334.1|  PREDICTED: multiple C2 and transmembrane dom...  79.7    1e-13   Prunus mume [ume]
ref|XP_007145658.1|  hypothetical protein PHAVU_007G257600g           79.3    1e-13   Phaseolus vulgaris [French bean]
gb|KDP43429.1|  hypothetical protein JCGZ_16716                       79.3    1e-13   Jatropha curcas
ref|XP_008383982.1|  PREDICTED: multiple C2 and transmembrane dom...  79.3    2e-13   
ref|XP_008368132.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...  79.3    2e-13   
gb|EPS70383.1|  hypothetical protein M569_04376                       79.3    2e-13   Genlisea aurea
ref|XP_003537180.1|  PREDICTED: multiple C2 and transmembrane dom...  79.3    2e-13   Glycine max [soybeans]
ref|XP_009339918.1|  PREDICTED: multiple C2 and transmembrane dom...  79.3    2e-13   Pyrus x bretschneideri [bai li]
gb|EYU46304.1|  hypothetical protein MIMGU_mgv1a001691mg              79.0    2e-13   Erythranthe guttata [common monkey flower]
gb|KHN15528.1|  Multiple C2 and transmembrane domain-containing p...  79.0    2e-13   Glycine soja [wild soybean]
ref|XP_011035993.1|  PREDICTED: multiple C2 and transmembrane dom...  79.3    2e-13   Populus euphratica
ref|XP_008781559.1|  PREDICTED: multiple C2 and transmembrane dom...  79.3    2e-13   Phoenix dactylifera
ref|XP_009588959.1|  PREDICTED: multiple C2 and transmembrane dom...  79.0    2e-13   
ref|XP_008350856.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...  79.0    2e-13   
gb|KHN49030.1|  Putative Ras GTPase-activating protein 4B             78.6    3e-13   Glycine soja [wild soybean]
ref|XP_006598248.1|  PREDICTED: multiple C2 and transmembrane dom...  78.6    3e-13   Glycine max [soybeans]
ref|XP_007204276.1|  hypothetical protein PRUPE_ppa001596mg           78.6    3e-13   Prunus persica
ref|XP_008378754.1|  PREDICTED: uncharacterized protein LOC103441820  78.6    3e-13   Malus domestica [apple tree]
ref|XP_010928529.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...  78.6    3e-13   
ref|XP_006304546.1|  hypothetical protein CARUB_v10011531mg           78.6    3e-13   Capsella rubella
ref|XP_002532394.1|  synaptotagmin, putative                          78.2    3e-13   Ricinus communis
ref|XP_008238857.1|  PREDICTED: multiple C2 and transmembrane dom...  78.6    3e-13   Prunus mume [ume]
ref|XP_008460787.1|  PREDICTED: multiple C2 and transmembrane dom...  78.2    4e-13   Cucumis melo [Oriental melon]
ref|XP_009354691.1|  PREDICTED: multiple C2 and transmembrane dom...  78.2    4e-13   Pyrus x bretschneideri [bai li]
ref|XP_007210407.1|  hypothetical protein PRUPE_ppa000781mg           78.2    4e-13   Prunus persica
ref|XP_004150160.1|  PREDICTED: multiple C2 and transmembrane dom...  78.2    4e-13   Cucumis sativus [cucumbers]
gb|KDP35107.1|  hypothetical protein JCGZ_10949                       78.2    4e-13   Jatropha curcas
ref|XP_008460789.1|  PREDICTED: multiple C2 and transmembrane dom...  78.2    4e-13   Cucumis melo [Oriental melon]
ref|XP_008795741.1|  PREDICTED: multiple C2 and transmembrane dom...  78.2    4e-13   
gb|KJB14262.1|  hypothetical protein B456_002G116500                  78.2    4e-13   Gossypium raimondii
ref|XP_010672799.1|  PREDICTED: multiple C2 and transmembrane dom...  78.2    4e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007225292.1|  hypothetical protein PRUPE_ppa001339mg           77.8    4e-13   
ref|XP_002513191.1|  synaptotagmin, putative                          78.2    4e-13   Ricinus communis
ref|XP_010908865.1|  PREDICTED: uncharacterized protein LOC105035134  77.8    5e-13   Elaeis guineensis
ref|XP_009418126.1|  PREDICTED: uncharacterized protein LOC103998104  77.8    5e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003607066.1|  Anthranilate phosphoribosyltransferase-like ...  77.8    5e-13   
ref|XP_006416181.1|  hypothetical protein EUTSA_v10006627mg           77.8    6e-13   
ref|XP_008219001.1|  PREDICTED: multiple C2 and transmembrane dom...  77.8    6e-13   Prunus mume [ume]
emb|CDY70344.1|  BnaA03g55080D                                        77.0    6e-13   Brassica napus [oilseed rape]
gb|KJB12302.1|  hypothetical protein B456_002G010600                  77.4    6e-13   Gossypium raimondii
ref|XP_011093374.1|  PREDICTED: multiple C2 and transmembrane dom...  77.8    6e-13   
ref|XP_010534658.1|  PREDICTED: multiple C2 and transmembrane dom...  77.4    6e-13   Tarenaya hassleriana [spider flower]
ref|XP_008240964.1|  PREDICTED: multiple C2 and transmembrane dom...  77.4    6e-13   Prunus mume [ume]
ref|XP_011093373.1|  PREDICTED: multiple C2 and transmembrane dom...  77.8    6e-13   Sesamum indicum [beniseed]
ref|XP_010111400.1|  Multiple C2 and transmembrane domain-contain...  77.4    6e-13   Morus notabilis
ref|XP_009130968.1|  PREDICTED: multiple C2 and transmembrane dom...  77.4    6e-13   Brassica rapa
emb|CAN75086.1|  hypothetical protein VITISV_010815                   77.4    7e-13   Vitis vinifera
ref|XP_002277970.2|  PREDICTED: multiple C2 and transmembrane dom...  77.4    7e-13   Vitis vinifera
ref|XP_008393597.1|  PREDICTED: uncharacterized protein LOC103455751  77.4    7e-13   
gb|AAC25524.1|  Strong similarity to phosphoribosylanthranilate t...  77.4    7e-13   
ref|XP_008387247.1|  PREDICTED: multiple C2 and transmembrane dom...  77.4    7e-13   
ref|NP_173675.1|  C2 calcium/lipid-binding plant phosphoribosyltr...  77.4    7e-13   
ref|XP_007131292.1|  hypothetical protein PHAVU_011G001600g           77.4    7e-13   
ref|XP_008228363.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  77.4    7e-13   
ref|XP_002521817.1|  synaptotagmin, putative                          77.4    7e-13   
ref|XP_011033255.1|  PREDICTED: multiple C2 and transmembrane dom...  77.0    8e-13   
gb|KHM98828.1|  Multiple C2 and transmembrane domain-containing p...  77.4    8e-13   
ref|XP_006585748.1|  PREDICTED: multiple C2 and transmembrane dom...  77.4    8e-13   
ref|XP_010460017.1|  PREDICTED: multiple C2 and transmembrane dom...  77.4    8e-13   
ref|XP_002265157.2|  PREDICTED: multiple C2 and transmembrane dom...  77.4    8e-13   
ref|XP_007040201.1|  C2 calcium/lipid-binding plant phosphoribosy...  77.0    9e-13   
ref|XP_010477520.1|  PREDICTED: multiple C2 and transmembrane dom...  77.0    9e-13   
gb|KEH16165.1|  calcium-dependent lipid-binding (CaLB domain) fam...  77.0    9e-13   
ref|XP_009419170.1|  PREDICTED: multiple C2 and transmembrane dom...  77.0    9e-13   
ref|XP_009391825.1|  PREDICTED: uncharacterized protein LOC103977897  77.0    9e-13   
ref|XP_010498740.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...  77.0    1e-12   
ref|XP_002890521.1|  C2 domain-containing protein                     77.0    1e-12   
ref|XP_002299538.2|  hypothetical protein POPTR_0001s09250g           77.0    1e-12   
ref|XP_011029251.1|  PREDICTED: multiple C2 and transmembrane dom...  77.0    1e-12   
emb|CDY21373.1|  BnaA09g30540D                                        77.0    1e-12   
ref|XP_010695175.1|  PREDICTED: multiple C2 and transmembrane dom...  77.0    1e-12   
ref|XP_011007360.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...  77.0    1e-12   
ref|XP_004306799.1|  PREDICTED: uncharacterized protein LOC101305880  77.0    1e-12   
emb|CDY04800.1|  BnaC05g17890D                                        77.0    1e-12   
gb|EMS45806.1|  Multiple C2 and transmembrane domain-containing p...  77.0    1e-12   
ref|XP_009115621.1|  PREDICTED: multiple C2 and transmembrane dom...  77.0    1e-12   
ref|XP_010063756.1|  PREDICTED: multiple C2 and transmembrane dom...  76.6    1e-12   
emb|CDP07720.1|  unnamed protein product                              76.6    1e-12   
gb|ACN88792.1|  putative C2 domain-containing protein                 73.2    1e-12   
emb|CDP07723.1|  unnamed protein product                              76.6    1e-12   
ref|XP_009350731.1|  PREDICTED: extended synaptotagmin-1-like         76.6    1e-12   
ref|XP_008392066.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...  76.6    1e-12   
ref|XP_010032396.1|  PREDICTED: multiple C2 and transmembrane dom...  76.6    1e-12   
gb|KCW51799.1|  hypothetical protein EUGRSUZ_J01251                   76.6    1e-12   
ref|XP_008799189.1|  PREDICTED: uncharacterized protein LOC103713915  76.6    1e-12   
ref|XP_010544470.1|  PREDICTED: LOW QUALITY PROTEIN: extended syn...  76.6    1e-12   
ref|XP_004298739.1|  PREDICTED: uncharacterized protein LOC101313...  76.3    2e-12   
ref|XP_004250430.1|  PREDICTED: multiple C2 and transmembrane dom...  76.3    2e-12   
ref|XP_004960016.1|  PREDICTED: uncharacterized protein LOC101781...  76.3    2e-12   
gb|EEC78281.1|  hypothetical protein OsI_17979                        76.3    2e-12   
ref|XP_009781014.1|  PREDICTED: uncharacterized protein LOC104229981  76.3    2e-12   
gb|EEE61934.1|  hypothetical protein OsJ_16678                        76.3    2e-12   
emb|CAJ86177.1|  H0306F12.8                                           76.3    2e-12   
ref|XP_009587334.1|  PREDICTED: uncharacterized protein LOC104085087  76.3    2e-12   
ref|NP_001168012.1|  uncharacterized protein LOC100381735             76.3    2e-12   
ref|NP_001054305.1|  Os04g0683800                                     76.3    2e-12   
ref|XP_009773349.1|  PREDICTED: multiple C2 and transmembrane dom...  75.9    2e-12   
dbj|BAK01357.1|  predicted protein                                    75.9    2e-12   
gb|KJB36093.1|  hypothetical protein B456_006G140900                  75.9    2e-12   
ref|XP_010672707.1|  PREDICTED: multiple C2 and transmembrane dom...  75.9    2e-12   
ref|XP_009420494.1|  PREDICTED: uncharacterized protein LOC104000227  75.9    2e-12   
ref|XP_009369878.1|  PREDICTED: multiple C2 and transmembrane dom...  75.9    2e-12   
ref|XP_006379108.1|  C2 domain-containing family protein              75.9    2e-12   
gb|KHG05718.1|  Multiple C2 and transmembrane domain-containing 1     75.9    2e-12   
ref|XP_007028936.1|  C2 calcium/lipid-binding plant phosphoribosy...  75.9    2e-12   
ref|XP_006399161.1|  hypothetical protein EUTSA_v10012726mg           75.9    2e-12   
ref|XP_010244838.1|  PREDICTED: multiple C2 and transmembrane dom...  75.9    2e-12   
ref|XP_009399173.1|  PREDICTED: multiple C2 and transmembrane dom...  75.9    2e-12   
gb|KDP25449.1|  hypothetical protein JCGZ_20605                       75.9    2e-12   
ref|XP_006381052.1|  hypothetical protein POPTR_0006s05760g           75.5    3e-12   
ref|XP_006376235.1|  hypothetical protein POPTR_0013s11220g           75.9    3e-12   
gb|KJB24703.1|  hypothetical protein B456_004G157900                  75.5    3e-12   
ref|XP_007020084.1|  C2 calcium/lipid-binding plant phosphoribosy...  75.9    3e-12   
ref|XP_008461778.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...  75.5    3e-12   
ref|XP_011020275.1|  PREDICTED: multiple C2 and transmembrane dom...  75.5    3e-12   
ref|XP_011468807.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...  75.5    3e-12   
ref|XP_003563116.1|  PREDICTED: uncharacterized protein LOC100824776  75.5    3e-12   
gb|KJB24704.1|  hypothetical protein B456_004G157900                  75.5    3e-12   
ref|XP_010535240.1|  PREDICTED: multiple C2 and transmembrane dom...  75.5    3e-12   
ref|XP_010534142.1|  PREDICTED: multiple C2 and transmembrane dom...  75.5    3e-12   
ref|XP_008375143.1|  PREDICTED: multiple C2 and transmembrane dom...  75.5    3e-12   
ref|XP_011001083.1|  PREDICTED: multiple C2 and transmembrane dom...  75.5    3e-12   
ref|XP_010057923.1|  PREDICTED: multiple C2 and transmembrane dom...  75.1    3e-12   
emb|CDP10669.1|  unnamed protein product                              75.5    3e-12   
ref|XP_008663748.1|  PREDICTED: uncharacterized protein LOC103642209  75.1    4e-12   
ref|XP_006348415.1|  PREDICTED: multiple C2 and transmembrane dom...  75.1    4e-12   
ref|XP_002323292.2|  hypothetical protein POPTR_0016s04980g           75.1    4e-12   
ref|XP_006287093.1|  hypothetical protein CARUB_v10000256mg           75.1    4e-12   
gb|ADT92187.1|  unknown                                               75.1    4e-12   
ref|XP_004228622.1|  PREDICTED: multiple C2 and transmembrane dom...  75.1    4e-12   
ref|XP_010491269.1|  PREDICTED: multiple C2 and transmembrane dom...  75.1    4e-12   
ref|XP_010452629.1|  PREDICTED: multiple C2 and transmembrane dom...  75.1    4e-12   
ref|XP_002873282.1|  hypothetical protein ARALYDRAFT_908616           75.1    4e-12   
ref|NP_568175.2|  FT-interacting protein 1                            75.1    4e-12   
ref|XP_010423287.1|  PREDICTED: multiple C2 and transmembrane dom...  75.1    4e-12   
emb|CDP10108.1|  unnamed protein product                              74.7    4e-12   
ref|XP_006851306.1|  hypothetical protein AMTR_s00050p00157870        75.1    5e-12   
ref|XP_008225796.1|  PREDICTED: uncharacterized protein LOC103325419  74.7    5e-12   
ref|XP_006653047.1|  PREDICTED: uncharacterized protein LOC102701166  74.7    5e-12   
ref|XP_010053690.1|  PREDICTED: multiple C2 and transmembrane dom...  74.7    5e-12   
ref|XP_006366512.1|  PREDICTED: multiple C2 and transmembrane dom...  74.7    5e-12   
ref|XP_004231110.1|  PREDICTED: multiple C2 and transmembrane dom...  74.3    6e-12   
ref|XP_003538346.1|  PREDICTED: uncharacterized protein LOC100777...  74.7    6e-12   
emb|CBI18160.3|  unnamed protein product                              74.3    7e-12   
gb|KHN35016.1|  Multiple C2 and transmembrane domain-containing p...  74.3    7e-12   
ref|XP_002273003.1|  PREDICTED: multiple C2 and transmembrane dom...  74.3    7e-12   
gb|KJB10065.1|  hypothetical protein B456_001G183000                  74.3    7e-12   
emb|CDP03821.1|  unnamed protein product                              74.3    7e-12   
gb|KDO65760.1|  hypothetical protein CISIN_1g046822mg                 74.3    7e-12   
ref|XP_010324263.1|  PREDICTED: multiple C2 and transmembrane dom...  74.3    8e-12   
ref|XP_006443696.1|  hypothetical protein CICLE_v10024404mg           74.3    8e-12   
ref|XP_008775338.1|  PREDICTED: uncharacterized protein LOC103695724  74.3    8e-12   
ref|XP_008649064.1|  PREDICTED: uncharacterized protein LOC103629...  73.9    9e-12   
ref|XP_010910862.1|  PREDICTED: uncharacterized protein LOC105036827  73.9    9e-12   
ref|XP_010943582.1|  PREDICTED: multiple C2 and transmembrane dom...  73.9    1e-11   
ref|XP_009774741.1|  PREDICTED: multiple C2 and transmembrane dom...  73.6    1e-11   
ref|XP_008356954.1|  PREDICTED: uncharacterized protein LOC103420681  73.6    1e-11   
ref|XP_008376022.1|  PREDICTED: uncharacterized protein LOC103439257  73.6    1e-11   
ref|XP_009346959.1|  PREDICTED: uncharacterized protein LOC103938656  73.6    1e-11   
ref|XP_007214091.1|  hypothetical protein PRUPE_ppa015408mg           73.6    1e-11   
ref|XP_010241420.1|  PREDICTED: multiple C2 and transmembrane dom...  73.6    1e-11   
ref|XP_009607021.1|  PREDICTED: multiple C2 and transmembrane dom...  73.6    1e-11   
gb|KEH29978.1|  anthranilate phosphoribosyltransferase-like protein   73.6    1e-11   
emb|CAB39932.1|  putative phosphoribosylanthranilate transferase      73.6    1e-11   
gb|EMT16292.1|  hypothetical protein F775_12047                       73.2    1e-11   
gb|KHN32471.1|  Multiple C2 and transmembrane domain-containing p...  73.6    1e-11   
gb|KEH18888.1|  calcium-dependent lipid-binding (CaLB domain) fam...  73.6    1e-11   
ref|XP_003539945.1|  PREDICTED: multiple C2 and transmembrane dom...  73.6    1e-11   
ref|NP_192898.2|  C2 calcium/lipid-binding plant phosphoribosyltr...  73.6    1e-11   
ref|XP_007158492.1|  hypothetical protein PHAVU_002G157000g           73.6    1e-11   
ref|XP_010434689.1|  PREDICTED: multiple C2 and transmembrane dom...  73.6    1e-11   
ref|XP_010455572.1|  PREDICTED: multiple C2 and transmembrane dom...  73.6    1e-11   
ref|XP_004161406.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...  73.6    1e-11   
ref|XP_006289911.1|  hypothetical protein CARUB_v10003526mg           73.2    2e-11   
ref|XP_006574306.1|  PREDICTED: uncharacterized protein LOC100817962  73.2    2e-11   
ref|XP_004149608.1|  PREDICTED: multiple C2 and transmembrane dom...  73.2    2e-11   
ref|XP_003635987.1|  Multiple C2 and transmembrane domain-contain...  73.6    2e-11   
gb|KJB25820.1|  hypothetical protein B456_004G210900                  73.2    2e-11   
gb|KHG10339.1|  Multiple C2 and transmembrane domain-containing 1     73.2    2e-11   
gb|EYU31344.1|  hypothetical protein MIMGU_mgv1a023675mg              72.8    2e-11   
ref|XP_010113221.1|  Multiple C2 and transmembrane domain-contain...  72.8    2e-11   
gb|EMT19394.1|  hypothetical protein F775_16907                       72.8    2e-11   
ref|XP_006657700.1|  PREDICTED: uncharacterized protein LOC102709856  72.8    2e-11   
ref|XP_011025029.1|  PREDICTED: uncharacterized protein LOC105126...  72.8    2e-11   
ref|XP_010682327.1|  PREDICTED: multiple C2 and transmembrane dom...  72.8    2e-11   
ref|XP_006585342.1|  PREDICTED: multiple C2 and transmembrane dom...  72.4    3e-11   
ref|XP_002298449.2|  C2 domain-containing family protein              72.8    3e-11   
ref|XP_004506488.1|  PREDICTED: uncharacterized protein LOC101502479  72.8    3e-11   
ref|XP_011025028.1|  PREDICTED: multiple C2 and transmembrane dom...  72.4    3e-11   
ref|XP_006439584.1|  hypothetical protein CICLE_v10023869mg           72.4    3e-11   
gb|KDO76164.1|  hypothetical protein CISIN_1g045058mg                 72.4    3e-11   
ref|XP_004511581.1|  PREDICTED: multiple C2 and transmembrane dom...  72.4    3e-11   
ref|XP_010918556.1|  PREDICTED: uncharacterized protein LOC105042892  72.4    3e-11   
ref|XP_006476597.1|  PREDICTED: multiple C2 and transmembrane dom...  72.4    3e-11   
ref|XP_002325538.2|  hypothetical protein POPTR_0019s10910g           72.4    3e-11   
gb|KJB60077.1|  hypothetical protein B456_009G288400                  72.0    3e-11   
ref|XP_002874704.1|  NADPH-dependent thioredoxin reductase B          72.4    3e-11   
gb|EMT09637.1|  hypothetical protein F775_18960                       71.6    4e-11   
ref|XP_003580895.1|  PREDICTED: multiple C2 and transmembrane dom...  72.0    5e-11   
ref|XP_010521156.1|  PREDICTED: multiple C2 and transmembrane dom...  71.6    5e-11   
ref|XP_009591465.1|  PREDICTED: multiple C2 and transmembrane dom...  71.6    5e-11   
ref|XP_009775267.1|  PREDICTED: multiple C2 and transmembrane dom...  71.6    5e-11   
ref|XP_011087213.1|  PREDICTED: extended synaptotagmin-1-like         71.2    6e-11   
gb|EYU27088.1|  hypothetical protein MIMGU_mgv1a020431mg              71.2    6e-11   
gb|EAZ01666.1|  hypothetical protein OsI_23701                        71.2    6e-11   
gb|EAZ37635.1|  hypothetical protein OsJ_21968                        71.2    6e-11   
ref|XP_009116796.1|  PREDICTED: multiple C2 and transmembrane dom...  71.2    6e-11   
ref|XP_006350321.1|  PREDICTED: extended synaptotagmin-1-like         71.2    6e-11   
ref|XP_008800662.1|  PREDICTED: multiple C2 and transmembrane dom...  71.2    7e-11   
ref|XP_011031493.1|  PREDICTED: multiple C2 and transmembrane dom...  71.2    7e-11   
ref|XP_007212656.1|  hypothetical protein PRUPE_ppa018242mg           71.2    7e-11   
ref|NP_191689.1|  C2 calcium/lipid-binding and phosphoribosyltran...  71.2    7e-11   
ref|XP_004486232.1|  PREDICTED: uncharacterized protein LOC101498310  71.2    7e-11   
ref|XP_008226140.1|  PREDICTED: multiple C2 and transmembrane dom...  71.2    7e-11   
gb|KDO38276.1|  hypothetical protein CISIN_1g045512mg                 71.2    7e-11   
emb|CAN71789.1|  hypothetical protein VITISV_004288                   71.2    7e-11   
gb|EYU28228.1|  hypothetical protein MIMGU_mgv1a000659mg              71.2    8e-11   
ref|XP_011003982.1|  PREDICTED: multiple C2 and transmembrane dom...  71.2    8e-11   
ref|XP_006473257.1|  PREDICTED: multiple C2 and transmembrane dom...  71.2    8e-11   
ref|XP_009386055.1|  PREDICTED: uncharacterized protein LOC103973268  71.2    8e-11   
ref|XP_011074957.1|  PREDICTED: multiple C2 and transmembrane dom...  71.2    8e-11   
ref|XP_002303582.2|  C2 domain-containing family protein              70.9    9e-11   
ref|XP_006396881.1|  hypothetical protein EUTSA_v10028390mg           70.9    9e-11   
ref|XP_011022713.1|  PREDICTED: multiple C2 and transmembrane dom...  70.5    1e-10   
ref|XP_003611102.1|  Glutathione peroxidase                           70.9    1e-10   
ref|XP_011022711.1|  PREDICTED: multiple C2 and transmembrane dom...  70.9    1e-10   
ref|XP_006402497.1|  hypothetical protein EUTSA_v10005769mg           70.9    1e-10   
dbj|BAK05655.1|  predicted protein                                    70.9    1e-10   
dbj|BAK04620.1|  predicted protein                                    70.5    1e-10   
ref|XP_011096361.1|  PREDICTED: multiple C2 and transmembrane dom...  70.5    1e-10   
ref|XP_010062431.1|  PREDICTED: uncharacterized protein LOC104449847  70.5    1e-10   
gb|EPS58331.1|  hypothetical protein M569_16484                       70.5    1e-10   
ref|XP_002876605.1|  C2 domain-containing protein                     70.5    1e-10   
ref|XP_002875019.1|  C2 domain-containing protein                     70.5    1e-10   
ref|XP_006586753.1|  PREDICTED: multiple C2 and transmembrane dom...  70.5    2e-10   
emb|CDP09751.1|  unnamed protein product                              70.1    2e-10   
ref|XP_002268191.1|  PREDICTED: multiple C2 and transmembrane dom...  70.1    2e-10   
emb|CAN83208.1|  hypothetical protein VITISV_009141                   70.1    2e-10   
ref|XP_004514073.1|  PREDICTED: multiple C2 and transmembrane dom...  70.1    2e-10   
gb|EYU22793.1|  hypothetical protein MIMGU_mgv1a000783mg              70.1    2e-10   
gb|KEH29293.1|  calcium-dependent lipid-binding (CaLB domain) fam...  70.1    2e-10   
dbj|BAJ90708.1|  predicted protein                                    69.7    2e-10   
ref|XP_004957702.1|  PREDICTED: uncharacterized protein LOC101764...  70.1    2e-10   
ref|XP_006827676.1|  hypothetical protein AMTR_s00009p00255480        70.1    2e-10   
gb|KJB71785.1|  hypothetical protein B456_011G142300                  69.7    2e-10   
gb|EMS62772.1|  Multiple C2 and transmembrane domain-containing p...  69.7    2e-10   
gb|KFK31920.1|  hypothetical protein AALP_AA6G176000                  69.7    2e-10   
ref|XP_009375492.1|  PREDICTED: multiple C2 and transmembrane dom...  69.7    2e-10   
emb|CBI37224.3|  unnamed protein product                              69.7    2e-10   
ref|XP_007149059.1|  hypothetical protein PHAVU_005G037500g           69.7    2e-10   
ref|XP_010419620.1|  PREDICTED: uncharacterized protein LOC104705332  69.7    2e-10   
gb|KFK31919.1|  hypothetical protein AALP_AA6G176000                  69.7    2e-10   
gb|EYU46376.1|  hypothetical protein MIMGU_mgv1a022974mg              69.7    2e-10   
emb|CDX91899.1|  BnaC03g32010D                                        69.7    2e-10   
ref|XP_008783369.1|  PREDICTED: uncharacterized protein LOC103702639  69.7    2e-10   
emb|CDX74344.1|  BnaA03g27030D                                        69.7    2e-10   
emb|CDY13273.1|  BnaC09g23830D                                        68.9    2e-10   
ref|XP_009134537.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  69.7    2e-10   
ref|XP_010928846.1|  PREDICTED: multiple C2 and transmembrane dom...  69.3    2e-10   
ref|XP_006286982.1|  hypothetical protein CARUB_v10000130mg           69.7    2e-10   
ref|XP_008653084.1|  PREDICTED: multiple C2 and transmembrane dom...  69.7    3e-10   
gb|KHN19431.1|  Multiple C2 and transmembrane domain-containing p...  69.7    3e-10   
ref|XP_006286981.1|  hypothetical protein CARUB_v10000130mg           69.3    3e-10   
ref|XP_004506399.1|  PREDICTED: uncharacterized protein LOC101494825  69.7    3e-10   
ref|XP_010682530.1|  PREDICTED: uncharacterized protein LOC104897368  69.3    3e-10   
ref|XP_006434690.1|  hypothetical protein CICLE_v10000127mg           69.3    3e-10   
emb|CDY48929.1|  BnaA09g39080D                                        69.3    3e-10   
ref|XP_010038326.1|  PREDICTED: multiple C2 and transmembrane dom...  69.3    3e-10   
emb|CDX71747.1|  BnaC08g31270D                                        68.9    3e-10   



>ref|XP_009587222.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana tomentosiformis]
 ref|XP_009587223.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana tomentosiformis]
Length=773

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/65 (94%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPPQEDF LKETKPHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKARDLP KDVTGSL
Sbjct  1    MQRPPQEDFSLKETKPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKARDLPGKDVTGSL  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_004249277.1| PREDICTED: extended synaptotagmin-1-like [Solanum lycopersicum]
Length=775

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/65 (94%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPPQEDF LKETKPHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1    MQRPPQEDFSLKETKPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSL  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_009614150.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana tomentosiformis]
Length=774

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/65 (94%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPPQEDF LKETKPHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1    MQRPPQEDFSLKETKPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSL  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_009785357.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana sylvestris]
 ref|XP_009785358.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana sylvestris]
 ref|XP_009785359.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana sylvestris]
Length=774

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/65 (94%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPPQEDF LKETKPHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1    MQRPPQEDFSLKETKPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSL  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_009594768.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana tomentosiformis]
Length=774

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/65 (94%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPPQEDF LKETKPHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1    MQRPPQEDFSLKETKPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSL  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_009799235.1| PREDICTED: extended synaptotagmin-1-like [Nicotiana sylvestris]
Length=776

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/65 (94%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPPQEDF LKETKPHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1    MQRPPQEDFSLKETKPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSL  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_004249278.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Solanum lycopersicum]
Length=774

 Score =   127 bits (319),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 60/65 (92%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPPQEDF+LKETKPHLGGGK+ GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1    MQRPPQEDFLLKETKPHLGGGKVMGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSL  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_006351338.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Solanum tuberosum]
Length=773

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 60/65 (92%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPPQEDF+LKETKPHLGGGK+ GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1    MQRPPQEDFLLKETKPHLGGGKVMGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSL  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_006351337.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Solanum tuberosum]
Length=774

 Score =   126 bits (317),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 60/65 (92%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPPQEDF LKETKPHLGGGK+ GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1    MQRPPQEDFSLKETKPHLGGGKVMGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSL  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_006362239.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Solanum tuberosum]
Length=773

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/65 (94%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRP QEDF LKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1    MQRPHQEDFSLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSL  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_004249163.1| PREDICTED: extended synaptotagmin-1-like [Solanum lycopersicum]
Length=772

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/65 (94%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRP QEDF LKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1    MQRPHQEDFSLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSL  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_011078851.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Sesamum indicum]
Length=772

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPPQEDF LKET PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPQEDFSLKETNPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSC  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_008360635.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Malus domestica]
Length=774

 Score =   124 bits (312),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP EDF LKETKPHLGGG+I+GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPSEDFALKETKPHLGGGRISGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSC  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_006381053.1| C2 domain-containing family protein [Populus trichocarpa]
 gb|ERP58850.1| C2 domain-containing family protein [Populus trichocarpa]
Length=775

 Score =   124 bits (312),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQ+PPQ+DF+LKET PHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  2    MQKPPQDDFLLKETNPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSC  61

Query  596  DPYVE  610
            DPYVE
Sbjct  62   DPYVE  66



>ref|XP_009376104.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Pyrus x bretschneideri]
Length=771

 Score =   124 bits (312),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP EDF LKETKPHLGGG+I+GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPSEDFALKETKPHLGGGRISGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSC  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>emb|CDP10110.1| unnamed protein product [Coffea canephora]
Length=775

 Score =   124 bits (312),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 60/65 (92%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPPQEDF LKETKPHLGG KITGDKLTST+DLVEQMQYLYVRVVKARDLP KDVTGS 
Sbjct  1    MQRPPQEDFQLKETKPHLGGVKITGDKLTSTHDLVEQMQYLYVRVVKARDLPAKDVTGSC  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>gb|EYU20709.1| hypothetical protein MIMGU_mgv1a001689mg [Erythranthe guttata]
Length=772

 Score =   124 bits (310),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP EDF LKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDV GS 
Sbjct  1    MQRPPHEDFSLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVAGSC  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_009766493.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana sylvestris]
Length=774

 Score =   124 bits (310),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 61/66 (92%), Positives = 63/66 (95%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPP-QEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQRPP QEDF LKETKPHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKARDLP KDVTGS
Sbjct  1    MQRPPPQEDFSLKETKPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKARDLPGKDVTGS  60

Query  593  LDPYVE  610
            LDPYVE
Sbjct  61   LDPYVE  66



>gb|KEH16148.1| C2 calcium/lipid-binding and GRAM domain protein [Medicago truncatula]
Length=774

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP EDF+LKETKPHLGGGKI+GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPPEDFLLKETKPHLGGGKISGDKLTSTYDLVEQMQYLYVRVVKAKDLPSKDVTGSC  60

Query  596  DPYVE  610
            DPY E
Sbjct  61   DPYAE  65



>ref|XP_007201936.1| hypothetical protein PRUPE_ppa001850mg [Prunus persica]
 gb|EMJ03135.1| hypothetical protein PRUPE_ppa001850mg [Prunus persica]
Length=756

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP EDF LKETKPHLGGG+I+GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPPEDFALKETKPHLGGGRISGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSC  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_008240960.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Prunus mume]
Length=774

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP EDF LKETKPHLGGG+I+GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPPEDFALKETKPHLGGGRISGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSC  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_009369854.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Pyrus x bretschneideri]
Length=774

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP EDF LKETKPHLGGG+I+GDKLTSTYDLVEQMQYLYVRVVKARDLP KD TGS 
Sbjct  1    MQRPPPEDFALKETKPHLGGGRISGDKLTSTYDLVEQMQYLYVRVVKARDLPAKDATGSC  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_003535846.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X1 [Glycine max]
 ref|XP_006588908.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X2 [Glycine max]
 ref|XP_006588909.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X3 [Glycine max]
Length=773

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP EDF+LKETKPHLGGGK++GD+LTSTYDLVEQMQYLYVRVVKA+DLP KD+TGS 
Sbjct  1    MQRPPPEDFLLKETKPHLGGGKVSGDRLTSTYDLVEQMQYLYVRVVKAKDLPAKDITGSC  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_008443079.1| PREDICTED: extended synaptotagmin-1 [Cucumis melo]
Length=774

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP EDF+LKET PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPPEDFLLKETNPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSC  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_004136579.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Cucumis sativus]
 ref|XP_004161488.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Cucumis sativus]
 gb|KGN59322.1| hypothetical protein Csa_3G809980 [Cucumis sativus]
Length=774

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP EDF+LKET PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPPEDFLLKETNPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSC  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_003554197.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Glycine max]
Length=775

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP EDF+LKETKPHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPPEDFLLKETKPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSC  60

Query  596  DPYVE  610
            DPY E
Sbjct  61   DPYTE  65



>ref|XP_008387239.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Malus domestica]
 ref|XP_008387240.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Malus domestica]
 ref|XP_008387241.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Malus domestica]
 ref|XP_008387242.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Malus domestica]
Length=774

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP EDF LKETKPHLGGG+I+GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPPEDFALKETKPHLGGGRISGDKLTSTYDLVEQMQYLYVRVVKAKDLPXKDVTGSC  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_007162297.1| hypothetical protein PHAVU_001G140200g [Phaseolus vulgaris]
 gb|ESW34291.1| hypothetical protein PHAVU_001G140200g [Phaseolus vulgaris]
Length=775

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP EDF+LKETKPHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPPEDFLLKETKPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSC  60

Query  596  DPYVE  610
            DPY E
Sbjct  61   DPYTE  65



>ref|XP_003521201.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoformX1 [Glycine max]
 ref|XP_003521202.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoformX2 [Glycine max]
 ref|XP_006576848.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoform X3 [Glycine max]
 ref|XP_006576849.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoform X4 [Glycine max]
Length=775

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP EDF+LKETKPHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPPEDFLLKETKPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSC  60

Query  596  DPYVE  610
            DPY E
Sbjct  61   DPYTE  65



>gb|KHN07409.1| Multiple C2 and transmembrane domain-containing protein 2 [Glycine 
soja]
Length=775

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP EDF+LKETKPHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPPEDFLLKETKPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSC  60

Query  596  DPYVE  610
            DPY E
Sbjct  61   DPYTE  65



>ref|XP_004493560.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Cicer arietinum]
Length=776

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP EDF+LKETKPHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA++LP KDVTGS 
Sbjct  1    MQRPPPEDFLLKETKPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKELPSKDVTGSC  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>emb|CDY47660.1| BnaC04g23970D [Brassica napus]
Length=828

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 71/94 (76%), Gaps = 6/94 (6%)
 Frame = +2

Query  347  FNSD*GLEGCLVF---VVLWKK---NNHKMQRPPQEDFMLKETKPHLGGGKITGDKLTST  508
             NS   L+ C  F   V+ W       + MQRPP EDF LKET+PHLGGGKITGDKLTST
Sbjct  25   LNSLILLQWCSCFRSSVLKWSNVFLEANMMQRPPPEDFSLKETRPHLGGGKITGDKLTST  84

Query  509  YDLVEQMQYLYVRVVKARDLPPKDVTGSLDPYVE  610
            YDLVEQMQYLYVRVVKA++LP KD+TGS DPYVE
Sbjct  85   YDLVEQMQYLYVRVVKAKELPGKDLTGSCDPYVE  118



>ref|XP_011020270.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Populus euphratica]
 ref|XP_011020271.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Populus euphratica]
Length=775

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQ+PPQ+DF+LKET PHLGGGKITGDKLTSTYDLVEQM YLYVRVVKA+DLP KDVTGS 
Sbjct  2    MQKPPQDDFLLKETYPHLGGGKITGDKLTSTYDLVEQMHYLYVRVVKAKDLPAKDVTGSC  61

Query  596  DPYVE  610
            DPYVE
Sbjct  62   DPYVE  66



>ref|XP_010463385.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
Length=431

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP EDF LKETKPHLGGGK+TGDKLT+TYDLVEQMQYLY RVVKA+DLP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETKPHLGGGKVTGDKLTTTYDLVEQMQYLYARVVKAKDLPGKDLTGSC  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_010111396.1| Multiple C2 and transmembrane domain-containing protein 2 [Morus 
notabilis]
 gb|EXC30874.1| Multiple C2 and transmembrane domain-containing protein 2 [Morus 
notabilis]
Length=774

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP EDF LKET PHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKA++LP KDVTGS 
Sbjct  1    MQRPPPEDFSLKETNPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKAKELPAKDVTGSC  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_006437045.1| hypothetical protein CICLE_v10030764mg [Citrus clementina]
 ref|XP_006485025.1| PREDICTED: extended synaptotagmin-1-like isoform X1 [Citrus sinensis]
 ref|XP_006485026.1| PREDICTED: extended synaptotagmin-1-like isoform X2 [Citrus sinensis]
 gb|ESR50285.1| hypothetical protein CICLE_v10030764mg [Citrus clementina]
 gb|KDO57725.1| hypothetical protein CISIN_1g004109mg [Citrus sinensis]
 gb|KDO57726.1| hypothetical protein CISIN_1g004109mg [Citrus sinensis]
Length=773

 Score =   121 bits (304),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/63 (92%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  422  RPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLDP  601
            RPP E+F LKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKA+DLPPKDVTGS DP
Sbjct  2    RPPLEEFSLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKAKDLPPKDVTGSCDP  61

Query  602  YVE  610
            YVE
Sbjct  62   YVE  64



>gb|KDO57727.1| hypothetical protein CISIN_1g004109mg [Citrus sinensis]
Length=763

 Score =   121 bits (304),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/63 (92%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  422  RPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLDP  601
            RPP E+F LKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKA+DLPPKDVTGS DP
Sbjct  2    RPPLEEFSLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKAKDLPPKDVTGSCDP  61

Query  602  YVE  610
            YVE
Sbjct  62   YVE  64



>emb|CBI30044.3| unnamed protein product [Vitis vinifera]
Length=374

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            M RPP +DF LKET PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MHRPPPDDFSLKETSPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPSKDVTGSC  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_007145661.1| hypothetical protein PHAVU_007G257800g [Phaseolus vulgaris]
 ref|XP_007145662.1| hypothetical protein PHAVU_007G257800g [Phaseolus vulgaris]
 gb|ESW17655.1| hypothetical protein PHAVU_007G257800g [Phaseolus vulgaris]
 gb|ESW17656.1| hypothetical protein PHAVU_007G257800g [Phaseolus vulgaris]
Length=774

 Score =   121 bits (303),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP EDF+LKETKPHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA++LP KDVTGS 
Sbjct  1    MQRPPPEDFLLKETKPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKELPAKDVTGSC  60

Query  596  DPYVE  610
            DPY E
Sbjct  61   DPYAE  65



>ref|XP_011033252.1| PREDICTED: extended synaptotagmin-1 [Populus euphratica]
 ref|XP_011033253.1| PREDICTED: extended synaptotagmin-1 [Populus euphratica]
 ref|XP_011033254.1| PREDICTED: extended synaptotagmin-1 [Populus euphratica]
Length=774

 Score =   121 bits (303),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRP  EDF+LKET PHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKA++LP KDVTGS 
Sbjct  1    MQRPLHEDFLLKETNPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKAKELPAKDVTGSC  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>gb|EPS67145.1| hypothetical protein M569_07629 [Genlisea aurea]
Length=772

 Score =   120 bits (302),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP EDF LKET P LGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1    MQRPPPEDFALKETNPRLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSL  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_002894324.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70583.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=776

 Score =   120 bits (302),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP EDF LKETKPHLGGGK+TGDKLT+TYDLVEQMQYLYVRVVKA+DLP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETKPHLGGGKVTGDKLTTTYDLVEQMQYLYVRVVKAKDLPGKDLTGSC  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_004497931.1| PREDICTED: uncharacterized protein LOC101499168 isoform X1 [Cicer 
arietinum]
 ref|XP_004497932.1| PREDICTED: uncharacterized protein LOC101499168 isoform X2 [Cicer 
arietinum]
 ref|XP_004497933.1| PREDICTED: uncharacterized protein LOC101499168 isoform X3 [Cicer 
arietinum]
 ref|XP_004497934.1| PREDICTED: uncharacterized protein LOC101499168 isoform X4 [Cicer 
arietinum]
Length=774

 Score =   120 bits (302),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP +DF+LKETKPHLGGGKI+GDKLTSTYDLVEQMQYLYVRVVKA++LP KDVTGS 
Sbjct  1    MQRPPPDDFLLKETKPHLGGGKISGDKLTSTYDLVEQMQYLYVRVVKAKELPSKDVTGSC  60

Query  596  DPYVE  610
            DPY E
Sbjct  61   DPYAE  65



>ref|XP_002322682.2| hypothetical protein POPTR_0016s04960g [Populus trichocarpa]
 ref|XP_006373765.1| hypothetical protein POPTR_0016s04960g [Populus trichocarpa]
 ref|XP_006373766.1| hypothetical protein POPTR_0016s04960g [Populus trichocarpa]
 ref|XP_006373767.1| C2 domain-containing family protein [Populus trichocarpa]
 gb|EEF04443.2| hypothetical protein POPTR_0016s04960g [Populus trichocarpa]
 gb|ERP51562.1| hypothetical protein POPTR_0016s04960g [Populus trichocarpa]
 gb|ERP51563.1| hypothetical protein POPTR_0016s04960g [Populus trichocarpa]
 gb|ERP51564.1| C2 domain-containing family protein [Populus trichocarpa]
Length=774

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRP  EDF+LKET PHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKA++LP KDVTGS 
Sbjct  1    MQRPLHEDFLLKETNPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKAKELPAKDVTGSC  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_006306818.1| hypothetical protein CARUB_v10008360mg [Capsella rubella]
 gb|EOA39716.1| hypothetical protein CARUB_v10008360mg [Capsella rubella]
Length=774

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP EDF LKETKPHLGGGK+TGDKLT+TYDLVEQMQYLY RVVKA+DLP KD+TGS 
Sbjct  1    MQRPPHEDFSLKETKPHLGGGKVTGDKLTTTYDLVEQMQYLYARVVKAKDLPGKDLTGSC  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_004304385.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Fragaria vesca subsp. vesca]
 ref|XP_011468070.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Fragaria vesca subsp. vesca]
Length=774

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP EDF LKETKPHLGGG+I+GDK TSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPPEDFALKETKPHLGGGRISGDKHTSTYDLVEQMQYLYVRVVKAKDLPSKDVTGSC  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_010554852.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Tarenaya hassleriana]
 ref|XP_010554853.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Tarenaya hassleriana]
 ref|XP_010554854.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Tarenaya hassleriana]
 ref|XP_010554855.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Tarenaya hassleriana]
Length=773

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP EDF LKETKPHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETKPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDMTGSC  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_002532333.1| synaptotagmin, putative [Ricinus communis]
 gb|EEF30035.1| synaptotagmin, putative [Ricinus communis]
Length=681

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP E+F+LKET PHLGGGK+TGDKLT+TYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPPEEFVLKETNPHLGGGKVTGDKLTTTYDLVEQMQYLYVRVVKAKDLPGKDVTGSC  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_006393033.1| hypothetical protein EUTSA_v10011254mg [Eutrema salsugineum]
 gb|ESQ30319.1| hypothetical protein EUTSA_v10011254mg [Eutrema salsugineum]
Length=778

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP EDF LKETKPHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETKPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDLTGSC  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>gb|KDP24596.1| hypothetical protein JCGZ_25512 [Jatropha curcas]
Length=776

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  413  KMQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            +MQRPP E+++LKET PHLGGGK+TGDKLT+TYDLVEQMQYLYVRVVKA+DLP KDVTGS
Sbjct  2    QMQRPPPEEYVLKETNPHLGGGKVTGDKLTTTYDLVEQMQYLYVRVVKAKDLPAKDVTGS  61

Query  593  LDPYVE  610
             DPYVE
Sbjct  62   CDPYVE  67



>emb|CDX98254.1| BnaC06g16150D [Brassica napus]
Length=774

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP EDF LKET+PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  2    MQRPPPEDFSLKETRPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDLTGSC  61

Query  596  DPYVE  610
            DPYVE
Sbjct  62   DPYVE  66



>ref|XP_009104078.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Brassica rapa]
 ref|XP_009104079.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Brassica rapa]
Length=774

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP EDF LKET+PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  2    MQRPPPEDFSLKETRPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDLTGSC  61

Query  596  DPYVE  610
            DPYVE
Sbjct  62   DPYVE  66



>emb|CDX67712.1| BnaA07g17520D [Brassica napus]
Length=774

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP EDF LKET+PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  2    MQRPPPEDFSLKETRPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDLTGSC  61

Query  596  DPYVE  610
            DPYVE
Sbjct  62   DPYVE  66



>ref|XP_010479644.1| PREDICTED: extended synaptotagmin-1-like isoform X1 [Camelina 
sativa]
 ref|XP_010479645.1| PREDICTED: extended synaptotagmin-1-like isoform X2 [Camelina 
sativa]
Length=776

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP EDF LKETKPHLGGGK+TGDKLT+TYDLVEQMQYLY RVVKA+DLP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETKPHLGGGKVTGDKLTTTYDLVEQMQYLYARVVKAKDLPGKDLTGSC  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_010500735.1| PREDICTED: extended synaptotagmin-1-like [Camelina sativa]
Length=776

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP EDF LKETKPHLGGGK+TGDKLT+TYDLVEQMQYLY RVVKA+DLP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETKPHLGGGKVTGDKLTTTYDLVEQMQYLYARVVKAKDLPGKDLTGSC  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_009139005.1| PREDICTED: extended synaptotagmin-1-like [Brassica rapa]
 ref|XP_009139006.1| PREDICTED: extended synaptotagmin-1-like [Brassica rapa]
Length=778

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP EDF LKET+PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  2    MQRPPPEDFSLKETRPHLGGGKLTGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDLTGSC  61

Query  596  DPYVE  610
            DPYVE
Sbjct  62   DPYVE  66



>emb|CDY69710.1| BnaAnng31280D [Brassica napus]
Length=779

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP EDF LKET+PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  2    MQRPPPEDFSLKETRPHLGGGKLTGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDLTGSC  61

Query  596  DPYVE  610
            DPYVE
Sbjct  62   DPYVE  66



>ref|NP_175568.1| calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein [Arabidopsis thaliana]
 gb|AAG50882.1|AC025294_20 unknown protein [Arabidopsis thaliana]
 gb|AEE32684.1| calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein [Arabidopsis thaliana]
Length=776

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP EDF LKETKPHLGGGK+TGDKLT+TYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETKPHLGGGKVTGDKLTTTYDLVEQMQYLYVRVVKAKELPGKDLTGSC  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_006290627.1| hypothetical protein CARUB_v10016719mg [Capsella rubella]
 ref|XP_006290628.1| hypothetical protein CARUB_v10016719mg [Capsella rubella]
 gb|EOA23525.1| hypothetical protein CARUB_v10016719mg [Capsella rubella]
 gb|EOA23526.1| hypothetical protein CARUB_v10016719mg [Capsella rubella]
Length=773

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP EDF LKET+PHLGGGKI+GDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETRPHLGGGKISGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDLTGSC  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_002278165.1| PREDICTED: extended synaptotagmin-1 [Vitis vinifera]
 ref|XP_010653909.1| PREDICTED: extended synaptotagmin-1 [Vitis vinifera]
 ref|XP_010653910.1| PREDICTED: extended synaptotagmin-1 [Vitis vinifera]
Length=777

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            M RPP +DF LKET PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MHRPPPDDFSLKETSPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPSKDVTGSC  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_010516424.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X1 [Camelina sativa]
 ref|XP_010516425.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X2 [Camelina sativa]
 ref|XP_010516426.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X1 [Camelina sativa]
 ref|XP_010427678.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
 ref|XP_010427679.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
 ref|XP_010427680.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
 ref|XP_010427681.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
Length=773

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP EDF LKET+PHLGGGKI+GDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETRPHLGGGKISGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDLTGSC  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_010504727.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
Length=773

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP EDF LKET+PHLGGGKI+GDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETRPHLGGGKISGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDLTGSC  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>emb|CAN80955.1| hypothetical protein VITISV_013781 [Vitis vinifera]
Length=752

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            M RPP +DF LKET PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MHRPPPDDFSLKETSPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPSKDVTGSC  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_002878177.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54436.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=773

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP EDF LKET+PHLGGGKI+GDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETRPHLGGGKISGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDMTGSC  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_010672701.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Beta vulgaris subsp. vulgaris]
Length=775

 Score =   118 bits (296),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQ+PP EDF LKET PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP  DVTG  
Sbjct  1    MQKPPHEDFSLKETNPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPSMDVTGGC  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_006402831.1| hypothetical protein EUTSA_v10005798mg [Eutrema salsugineum]
 ref|XP_006402832.1| hypothetical protein EUTSA_v10005798mg [Eutrema salsugineum]
 gb|ESQ44284.1| hypothetical protein EUTSA_v10005798mg [Eutrema salsugineum]
 gb|ESQ44285.1| hypothetical protein EUTSA_v10005798mg [Eutrema salsugineum]
Length=774

 Score =   118 bits (296),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP EDF LKET+PHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETRPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDMTGSC  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_010057953.1| PREDICTED: extended synaptotagmin-1-like [Eucalyptus grandis]
 ref|XP_010057962.1| PREDICTED: extended synaptotagmin-1-like [Eucalyptus grandis]
 ref|XP_010057968.1| PREDICTED: extended synaptotagmin-1-like [Eucalyptus grandis]
 gb|KCW90293.1| hypothetical protein EUGRSUZ_A02437 [Eucalyptus grandis]
Length=777

 Score =   118 bits (295),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 61/66 (92%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            M RPP  EDF LKETKPHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA++LP KDVTGS
Sbjct  2    MHRPPHLEDFALKETKPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKELPAKDVTGS  61

Query  593  LDPYVE  610
            LDPYVE
Sbjct  62   LDPYVE  67



>gb|KJB36100.1| hypothetical protein B456_006G141200 [Gossypium raimondii]
 gb|KJB36101.1| hypothetical protein B456_006G141200 [Gossypium raimondii]
 gb|KJB36102.1| hypothetical protein B456_006G141200 [Gossypium raimondii]
 gb|KJB36103.1| hypothetical protein B456_006G141200 [Gossypium raimondii]
Length=775

 Score =   118 bits (295),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            M RPP EDF LKET PHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  2    MPRPPPEDFALKETNPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSC  61

Query  596  DPYVE  610
            DPYVE
Sbjct  62   DPYVE  66



>dbj|BAF01685.1| anthranilate phosphoribosyltransferase-like protein [Arabidopsis 
thaliana]
Length=773

 Score =   118 bits (295),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP EDF LKET+PHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETRPHLGGGKLSGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDMTGSC  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|NP_191347.1| C2 domain-containing plant phosphoribosyltransferase-like protein 
[Arabidopsis thaliana]
 emb|CAB67616.1| anthranilate phosphoribosyltransferase-like protein [Arabidopsis 
thaliana]
 gb|AEE79712.1| C2 domain-containing plant phosphoribosyltransferase-like protein 
[Arabidopsis thaliana]
Length=773

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP EDF LKET+PHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETRPHLGGGKLSGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDMTGSC  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>gb|AAK53020.1|AF375436_1 AT3g57880/T10K17_90 [Arabidopsis thaliana]
 gb|AAM52232.1| AT3g57880/T10K17_90 [Arabidopsis thaliana]
Length=773

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP EDF LKET+PHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETRPHLGGGKLSGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDMTGSC  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_008442250.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Cucumis melo]
 ref|XP_008442251.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Cucumis melo]
 ref|XP_008442253.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Cucumis melo]
Length=776

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQ+PP EDF+LKET PHLGGGK+TGDKL STYDLVEQM YLYVRVVKA+DLP KDVTGS 
Sbjct  2    MQKPPPEDFLLKETNPHLGGGKVTGDKLASTYDLVEQMYYLYVRVVKAKDLPGKDVTGSC  61

Query  596  DPYVE  610
            DPYVE
Sbjct  62   DPYVE  66



>gb|KFK35840.1| hypothetical protein AALP_AA4G043900 [Arabis alpina]
Length=775

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP EDF LKETKP LGGGKI+GDKLT+TYDLVEQMQYLYVRVVKA+DLP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETKPFLGGGKISGDKLTTTYDLVEQMQYLYVRVVKAKDLPGKDLTGSC  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_004144665.1| PREDICTED: uncharacterized protein LOC101203090 isoform 1 [Cucumis 
sativus]
 ref|XP_004144666.1| PREDICTED: uncharacterized protein LOC101203090 isoform 2 [Cucumis 
sativus]
 ref|XP_004168423.1| PREDICTED: uncharacterized LOC101203090 [Cucumis sativus]
 gb|KGN54869.1| hypothetical protein Csa_4G567200 [Cucumis sativus]
Length=776

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQ+PP EDF+LKET PHLGGGK+ GDKL STYDLVEQM YLYVRVVKA+DLP KDVTGS 
Sbjct  2    MQKPPPEDFLLKETNPHLGGGKVAGDKLASTYDLVEQMYYLYVRVVKAKDLPGKDVTGSC  61

Query  596  DPYVE  610
            DPYVE
Sbjct  62   DPYVE  66



>ref|XP_003625221.1| Anthranilate phosphoribosyltransferase-like protein [Medicago 
truncatula]
 gb|ABN08649.1| C2 [Medicago truncatula]
 gb|AES81439.1| C2 calcium/lipid-binding and GRAM domain protein [Medicago truncatula]
Length=775

 Score =   115 bits (289),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 61/65 (94%), Gaps = 1/65 (2%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPP EDF+LKETKPHLGG K++GDKLTSTYDLVEQMQYLYVRVVKA++LP KDVTGS 
Sbjct  1    MQRPPPEDFLLKETKPHLGG-KVSGDKLTSTYDLVEQMQYLYVRVVKAKELPSKDVTGSC  59

Query  596  DPYVE  610
            DPYVE
Sbjct  60   DPYVE  64



>ref|XP_010548191.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Tarenaya hassleriana]
 ref|XP_010548275.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Tarenaya hassleriana]
Length=774

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            M RPP EDF LKETKP LGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA++LP KDVTG  
Sbjct  2    MHRPPPEDFSLKETKPQLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDVTGGC  61

Query  596  DPYVE  610
            DPYVE
Sbjct  62   DPYVE  66



>ref|XP_008778691.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Phoenix dactylifera]
 ref|XP_008778692.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Phoenix dactylifera]
 ref|XP_008778693.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Phoenix dactylifera]
 ref|XP_008778694.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Phoenix dactylifera]
 ref|XP_008778695.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Phoenix dactylifera]
Length=773

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 58/66 (88%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRP-PQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQRP  QED+ LK T PHLGGG I GDKLTSTYDLVEQMQYLYVRVVKA+DLPPKDVTGS
Sbjct  1    MQRPLSQEDYSLKATSPHLGGGGIAGDKLTSTYDLVEQMQYLYVRVVKAKDLPPKDVTGS  60

Query  593  LDPYVE  610
             DPYVE
Sbjct  61   CDPYVE  66



>ref|XP_007028941.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
 gb|EOY09443.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
Length=877

 Score =   113 bits (283),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 59/66 (89%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            M RPP  +DF LKET PHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS
Sbjct  2    MHRPPPPDDFALKETNPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGS  61

Query  593  LDPYVE  610
             DPYVE
Sbjct  62   CDPYVE  67



>ref|XP_007028942.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 2 [Theobroma cacao]
 ref|XP_007028943.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 2 [Theobroma cacao]
 ref|XP_007028944.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 2 [Theobroma cacao]
 gb|EOY09444.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 2 [Theobroma cacao]
 gb|EOY09445.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 2 [Theobroma cacao]
 gb|EOY09446.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 2 [Theobroma cacao]
Length=776

 Score =   113 bits (282),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 59/66 (89%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            M RPP  +DF LKET PHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS
Sbjct  2    MHRPPPPDDFALKETNPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGS  61

Query  593  LDPYVE  610
             DPYVE
Sbjct  62   CDPYVE  67



>ref|XP_006386096.1| hypothetical protein POPTR_0003s22060g [Populus trichocarpa]
 gb|ERP63893.1| hypothetical protein POPTR_0003s22060g [Populus trichocarpa]
Length=772

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 58/66 (88%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQ+PPQ  DF LKET P++G G +TGDKL+ TYDLVEQMQYLYVRVVKA+DLPPKD+TGS
Sbjct  1    MQKPPQSVDFALKETSPNIGAGSVTGDKLSCTYDLVEQMQYLYVRVVKAKDLPPKDITGS  60

Query  593  LDPYVE  610
             DPYVE
Sbjct  61   CDPYVE  66



>ref|XP_010265829.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nelumbo nucifera]
 ref|XP_010265830.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nelumbo nucifera]
Length=776

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 59/66 (89%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRP-PQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQRP P E++ LKET PHLGGG +TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTG+
Sbjct  1    MQRPLPPEEYSLKETSPHLGGGGVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGT  60

Query  593  LDPYVE  610
             DPYVE
Sbjct  61   CDPYVE  66



>ref|XP_009395864.1| PREDICTED: extended synaptotagmin-1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009395871.1| PREDICTED: extended synaptotagmin-1-like [Musa acuminata subsp. 
malaccensis]
Length=776

 Score =   110 bits (274),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 60/66 (91%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQRP + E++ LKET PHLGGG ++GDKLT+TYDLVEQMQYLYVRVVKA+DLPPKDVTGS
Sbjct  2    MQRPLRPEEYSLKETSPHLGGGGVSGDKLTTTYDLVEQMQYLYVRVVKAKDLPPKDVTGS  61

Query  593  LDPYVE  610
             DPYVE
Sbjct  62   CDPYVE  67



>ref|XP_010928839.1| PREDICTED: extended synaptotagmin-1-like [Elaeis guineensis]
 ref|XP_010928840.1| PREDICTED: extended synaptotagmin-1-like [Elaeis guineensis]
Length=774

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 58/66 (88%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQRP Q +++ LKET PHLGGG + GDKLT+TYDLVEQMQYLYVRVVKARDLP KDVTGS
Sbjct  1    MQRPLQPQEYSLKETSPHLGGGGVAGDKLTTTYDLVEQMQYLYVRVVKARDLPTKDVTGS  60

Query  593  LDPYVE  610
             DPYVE
Sbjct  61   CDPYVE  66



>ref|XP_008243596.1| PREDICTED: LOW QUALITY PROTEIN: multiple C2 and transmembrane 
domain-containing protein 2 [Prunus mume]
Length=755

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 58/66 (88%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQ+PPQ +DF LKET P++G G +TGDKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTGS
Sbjct  1    MQKPPQPQDFALKETSPNIGAGSVTGDKLSCTYDLVEQMQYLYVRVVKAKDLPAKDVTGS  60

Query  593  LDPYVE  610
             DPYVE
Sbjct  61   CDPYVE  66



>ref|XP_007208351.1| hypothetical protein PRUPE_ppa001743mg [Prunus persica]
 gb|EMJ09550.1| hypothetical protein PRUPE_ppa001743mg [Prunus persica]
Length=772

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 58/66 (88%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQ+PPQ +DF LKET P++G G +TGDKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTGS
Sbjct  1    MQKPPQPQDFALKETSPNIGAGSVTGDKLSCTYDLVEQMQYLYVRVVKAKDLPAKDVTGS  60

Query  593  LDPYVE  610
             DPYVE
Sbjct  61   CDPYVE  66



>ref|XP_008782885.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Phoenix dactylifera]
 ref|XP_008782886.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Phoenix dactylifera]
 ref|XP_008782888.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Phoenix dactylifera]
Length=775

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 58/67 (87%), Gaps = 3/67 (4%)
 Frame = +2

Query  416  MQRP--PQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  589
            MQRP  PQE + LKET PHLGGG + GDKLT+TYDLVEQMQYLYVRVVKARDLP KDVTG
Sbjct  1    MQRPLHPQE-YSLKETSPHLGGGGVAGDKLTTTYDLVEQMQYLYVRVVKARDLPAKDVTG  59

Query  590  SLDPYVE  610
            S DPYVE
Sbjct  60   SCDPYVE  66



>ref|XP_009364713.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Pyrus x bretschneideri]
Length=772

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQ+PPQ +DF LKET P++G G ITGDKL+ TYDLVEQM YLYVRVVKA+DLP KDVTGS
Sbjct  1    MQKPPQSQDFALKETSPNIGAGSITGDKLSCTYDLVEQMHYLYVRVVKAKDLPAKDVTGS  60

Query  593  LDPYVE  610
             DPYVE
Sbjct  61   CDPYVE  66



>ref|XP_009364728.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Pyrus x bretschneideri]
Length=772

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQ+PPQ +DF LKET P++G G ITGDKL+ TYDLVEQM YLYVRVVKA+DLP KDVTGS
Sbjct  1    MQKPPQSQDFALKETSPNIGAGSITGDKLSCTYDLVEQMHYLYVRVVKAKDLPAKDVTGS  60

Query  593  LDPYVE  610
             DPYVE
Sbjct  61   CDPYVE  66



>ref|XP_008358865.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Malus domestica]
Length=772

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQ+PPQ +DF LKET P++G G ITGDKL+ TYDLVEQM YLYVRVVKA+DLP KDVTGS
Sbjct  1    MQKPPQSQDFALKETSPNIGAGSITGDKLSCTYDLVEQMHYLYVRVVKAKDLPAKDVTGS  60

Query  593  LDPYVE  610
             DPYVE
Sbjct  61   CDPYVE  66



>ref|XP_011025253.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Populus euphratica]
Length=772

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 57/66 (86%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQ+PPQ  DF LKET P++G G +TGDKL+ TYDLVEQMQYLYVRVVKA+DLP KD+TGS
Sbjct  1    MQKPPQSVDFALKETSPNIGAGSVTGDKLSCTYDLVEQMQYLYVRVVKAKDLPSKDITGS  60

Query  593  LDPYVE  610
             DPYVE
Sbjct  61   CDPYVE  66



>ref|XP_007014901.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
 ref|XP_007014902.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
 ref|XP_007014903.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
 ref|XP_007014904.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
 gb|EOY32520.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
 gb|EOY32521.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
 gb|EOY32522.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
 gb|EOY32523.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
Length=771

 Score =   107 bits (267),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQ+PPQ  DF LKET P++G G +TGDKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTGS
Sbjct  1    MQKPPQSVDFALKETSPNIGAGAVTGDKLSCTYDLVEQMQYLYVRVVKAKDLPGKDVTGS  60

Query  593  LDPYVE  610
             DPYVE
Sbjct  61   CDPYVE  66



>ref|XP_008787291.1| PREDICTED: extended synaptotagmin-1-like [Phoenix dactylifera]
Length=776

 Score =   107 bits (266),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 58/66 (88%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRP-PQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQRP P +++ LKET PHLGGG + GDKLT+TYDLVEQMQYLYVRVVKA+DLP KDVTGS
Sbjct  2    MQRPLPPQEYSLKETSPHLGGGGVAGDKLTTTYDLVEQMQYLYVRVVKAKDLPVKDVTGS  61

Query  593  LDPYVE  610
             DPYVE
Sbjct  62   CDPYVE  67



>ref|XP_004295231.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Fragaria vesca subsp. vesca]
 ref|XP_011461911.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Fragaria vesca subsp. vesca]
Length=772

 Score =   107 bits (266),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQ+PPQ  DF LKET P++G G ITGDKL+ TYDLVEQMQYLYVRVVKA+DLP KDV+GS
Sbjct  1    MQKPPQSTDFALKETSPNIGAGSITGDKLSCTYDLVEQMQYLYVRVVKAKDLPGKDVSGS  60

Query  593  LDPYVE  610
             DPYVE
Sbjct  61   CDPYVE  66



>ref|XP_002297795.1| C2 domain-containing family protein [Populus trichocarpa]
 gb|EEE82600.1| C2 domain-containing family protein [Populus trichocarpa]
Length=772

 Score =   107 bits (266),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQ+ PQ  DF LKET P++G G +TG+KL+ TYDLVEQMQYLYVRVVKARDLPPKDVTGS
Sbjct  1    MQKLPQSVDFALKETSPNIGAGSVTGNKLSCTYDLVEQMQYLYVRVVKARDLPPKDVTGS  60

Query  593  LDPYVE  610
             DPYVE
Sbjct  61   CDPYVE  66



>emb|CBI16433.3| unnamed protein product [Vitis vinifera]
Length=605

 Score =   105 bits (263),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 55/66 (83%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPP-QEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQ+PP   +F LKETKP LGGG + GDKLT  YDLVEQM YLYVRVVKA+DLPPKDVTGS
Sbjct  1    MQKPPPSVEFALKETKPQLGGGSVIGDKLTCAYDLVEQMHYLYVRVVKAKDLPPKDVTGS  60

Query  593  LDPYVE  610
             DPY+E
Sbjct  61   CDPYIE  66



>ref|XP_010913922.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Elaeis guineensis]
Length=776

 Score =   106 bits (265),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 58/67 (87%), Gaps = 3/67 (4%)
 Frame = +2

Query  416  MQRP--PQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  589
            MQRP  PQE + LKET PHLGGG + GDKLT+TYDLVEQMQYLYVRVVKA+DLP KDVTG
Sbjct  2    MQRPLHPQE-YSLKETSPHLGGGGVAGDKLTTTYDLVEQMQYLYVRVVKAKDLPTKDVTG  60

Query  590  SLDPYVE  610
            S DPYVE
Sbjct  61   SCDPYVE  67



>gb|KJB83485.1| hypothetical protein B456_013G250100 [Gossypium raimondii]
Length=737

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 56/66 (85%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQ+PPQ  DF LKET P +G G +TGDKL+STYDLVEQMQYLYVRVVKA+DLP KDVTG 
Sbjct  1    MQKPPQSIDFALKETSPKIGAGAVTGDKLSSTYDLVEQMQYLYVRVVKAKDLPGKDVTGG  60

Query  593  LDPYVE  610
             DPYVE
Sbjct  61   CDPYVE  66



>ref|XP_002513446.1| synaptotagmin, putative [Ricinus communis]
 gb|EEF48849.1| synaptotagmin, putative [Ricinus communis]
Length=772

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 56/66 (85%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQ+PPQ  DF LKET P++G   +TGDKL+ TYDLVEQMQYLYVRVVKARDLP KDVTGS
Sbjct  1    MQKPPQAVDFALKETSPNIGAAAVTGDKLSCTYDLVEQMQYLYVRVVKARDLPGKDVTGS  60

Query  593  LDPYVE  610
             DPY+E
Sbjct  61   CDPYIE  66



>ref|XP_009374817.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Pyrus x bretschneideri]
Length=774

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPP-QEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQ+PP  +DF LKET P++G G ITGDKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTGS
Sbjct  1    MQKPPPSQDFALKETSPNIGAGSITGDKLSCTYDLVEQMQYLYVRVVKAKDLPAKDVTGS  60

Query  593  LDPYVE  610
             DPYVE
Sbjct  61   SDPYVE  66



>ref|XP_002285588.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Vitis vinifera]
 ref|XP_010651282.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Vitis vinifera]
Length=774

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 55/66 (83%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPP-QEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQ+PP   +F LKETKP LGGG + GDKLT  YDLVEQM YLYVRVVKA+DLPPKDVTGS
Sbjct  1    MQKPPPSVEFALKETKPQLGGGSVIGDKLTCAYDLVEQMHYLYVRVVKAKDLPPKDVTGS  60

Query  593  LDPYVE  610
             DPY+E
Sbjct  61   CDPYIE  66



>gb|KJB83481.1| hypothetical protein B456_013G250100 [Gossypium raimondii]
 gb|KJB83482.1| hypothetical protein B456_013G250100 [Gossypium raimondii]
 gb|KJB83483.1| hypothetical protein B456_013G250100 [Gossypium raimondii]
 gb|KJB83484.1| hypothetical protein B456_013G250100 [Gossypium raimondii]
 gb|KJB83486.1| hypothetical protein B456_013G250100 [Gossypium raimondii]
 gb|KJB83487.1| hypothetical protein B456_013G250100 [Gossypium raimondii]
 gb|KJB83488.1| hypothetical protein B456_013G250100 [Gossypium raimondii]
Length=771

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 56/66 (85%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQ+PPQ  DF LKET P +G G +TGDKL+STYDLVEQMQYLYVRVVKA+DLP KDVTG 
Sbjct  1    MQKPPQSIDFALKETSPKIGAGAVTGDKLSSTYDLVEQMQYLYVRVVKAKDLPGKDVTGG  60

Query  593  LDPYVE  610
             DPYVE
Sbjct  61   CDPYVE  66



>gb|KHG04257.1| Multiple C2 and transmembrane domain-containing 1 [Gossypium 
arboreum]
Length=771

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 56/66 (85%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQ+PPQ  DF LKET P +G G +TGDKL+STYDLVEQMQYLYVRVVKA+DLP KDVTG 
Sbjct  1    MQKPPQSIDFALKETSPKIGAGAVTGDKLSSTYDLVEQMQYLYVRVVKAKDLPGKDVTGG  60

Query  593  LDPYVE  610
             DPYVE
Sbjct  61   CDPYVE  66



>ref|XP_006850074.1| hypothetical protein AMTR_s00022p00214560 [Amborella trichopoda]
 gb|ERN11655.1| hypothetical protein AMTR_s00022p00214560 [Amborella trichopoda]
Length=772

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 57/66 (86%), Gaps = 2/66 (3%)
 Frame = +2

Query  416  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQRP Q ED+ LKET PHLGGG + GDKLTSTYDLVEQMQYLYVRVVKA+DL P DVTGS
Sbjct  1    MQRPLQSEDYSLKETSPHLGGGGVHGDKLTSTYDLVEQMQYLYVRVVKAKDL-PTDVTGS  59

Query  593  LDPYVE  610
             DPYVE
Sbjct  60   CDPYVE  65



>gb|KDP20200.1| hypothetical protein JCGZ_07920 [Jatropha curcas]
Length=773

 Score =   104 bits (260),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 55/66 (83%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQ+PPQ  DF LKET P++G G +T DKL  TYDLVEQMQYLYVRVVKA+DLP KDVTGS
Sbjct  1    MQKPPQAIDFALKETSPNIGAGAVTADKLACTYDLVEQMQYLYVRVVKAKDLPGKDVTGS  60

Query  593  LDPYVE  610
             DPYVE
Sbjct  61   CDPYVE  66



>ref|XP_010091994.1| Multiple C2 and transmembrane domain-containing protein 2 [Morus 
notabilis]
 gb|EXB48400.1| Multiple C2 and transmembrane domain-containing protein 2 [Morus 
notabilis]
Length=772

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  425  PPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLDPY  604
            P Q DF LKET P++G G ITGDKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTGS DPY
Sbjct  5    PQQVDFALKETSPNIGAGSITGDKLSCTYDLVEQMQYLYVRVVKAKDLPAKDVTGSCDPY  64

Query  605  VE  610
            VE
Sbjct  65   VE  66



>ref|XP_006445975.1| hypothetical protein CICLE_v10014352mg [Citrus clementina]
 gb|ESR59215.1| hypothetical protein CICLE_v10014352mg [Citrus clementina]
Length=772

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 55/66 (83%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQ+ PQ  DF LKET P +G G ITGDKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTGS
Sbjct  1    MQKSPQAIDFALKETSPKIGAGSITGDKLSCTYDLVEQMQYLYVRVVKAKDLPGKDVTGS  60

Query  593  LDPYVE  610
             DPYVE
Sbjct  61   CDPYVE  66



>ref|XP_006494723.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Citrus sinensis]
 gb|KDO64911.1| hypothetical protein CISIN_1g004127mg [Citrus sinensis]
Length=772

 Score =   104 bits (259),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 55/66 (83%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQ+ PQ  DF LKET P +G G ITGDKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTGS
Sbjct  1    MQKSPQAIDFALKETSPKIGAGSITGDKLSCTYDLVEQMQYLYVRVVKAKDLPGKDVTGS  60

Query  593  LDPYVE  610
             DPYVE
Sbjct  61   CDPYVE  66



>ref|XP_011037883.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 isoform X1 [Populus euphratica]
 ref|XP_011037884.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 isoform X2 [Populus euphratica]
Length=772

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 56/66 (85%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQ+ PQ  DF LKET P++G G +TG+KL+ TYDLVEQMQYLYVRVVKARDLP KDVTGS
Sbjct  1    MQKLPQSVDFALKETSPNIGAGSVTGNKLSCTYDLVEQMQYLYVRVVKARDLPLKDVTGS  60

Query  593  LDPYVE  610
             DPYVE
Sbjct  61   CDPYVE  66



>gb|KHG19030.1| Multiple C2 and transmembrane domain-containing 1 [Gossypium 
arboreum]
Length=772

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 57/67 (85%), Gaps = 2/67 (3%)
 Frame = +2

Query  416  MQRPPQE--DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  589
            MQ+PP +  DF LK+T P++G G +TGDKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTG
Sbjct  1    MQKPPPQSVDFALKQTSPNIGAGAVTGDKLSCTYDLVEQMQYLYVRVVKAKDLPGKDVTG  60

Query  590  SLDPYVE  610
            S DPYVE
Sbjct  61   SCDPYVE  67



>gb|KJB66120.1| hypothetical protein B456_010G128400 [Gossypium raimondii]
 gb|KJB66121.1| hypothetical protein B456_010G128400 [Gossypium raimondii]
 gb|KJB66122.1| hypothetical protein B456_010G128400 [Gossypium raimondii]
Length=772

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 57/67 (85%), Gaps = 2/67 (3%)
 Frame = +2

Query  416  MQRPPQE--DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  589
            MQ+PP +  DF LK+T P++G G +TGDKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTG
Sbjct  1    MQKPPPQSVDFALKQTSPNIGAGAVTGDKLSCTYDLVEQMQYLYVRVVKAKDLPGKDVTG  60

Query  590  SLDPYVE  610
            S DPYVE
Sbjct  61   SCDPYVE  67



>ref|XP_010519731.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Tarenaya hassleriana]
 ref|XP_010519732.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Tarenaya hassleriana]
Length=768

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQ+PPQ  DF LKET P +G G + GDKL+ TYDLVEQM YLYVRVVKA+DLP KDVTGS
Sbjct  1    MQKPPQNIDFALKETSPKIGAGAVAGDKLSCTYDLVEQMHYLYVRVVKAKDLPGKDVTGS  60

Query  593  LDPYVE  610
             DPYVE
Sbjct  61   CDPYVE  66



>ref|XP_010238001.1| PREDICTED: LOW QUALITY PROTEIN: extended synaptotagmin-1-like 
[Brachypodium distachyon]
Length=771

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRP  E+++LK+T PHLGG    GDKLT TYDLVEQMQYLYV VVKA+DLP KD+TGS 
Sbjct  1    MQRPRSEEYLLKDTSPHLGGFMAAGDKLTRTYDLVEQMQYLYVHVVKAKDLPFKDLTGSC  60

Query  596  DPYVE  610
            DPYVE
Sbjct  61   DPYVE  65



>ref|XP_006654319.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Oryza brachyantha]
Length=774

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 2/66 (3%)
 Frame = +2

Query  416  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQRP + E++ LKET PHLGGG   GDKLT+TYDLVEQMQYLYVRVVKA+DLP KD+TGS
Sbjct  2    MQRPFRPEEYSLKETSPHLGGGA-AGDKLTTTYDLVEQMQYLYVRVVKAKDLPSKDITGS  60

Query  593  LDPYVE  610
             DPYVE
Sbjct  61   CDPYVE  66



>ref|NP_001055351.1| Os05g0370600 [Oryza sativa Japonica Group]
 gb|AAV31232.1| putative anthranilate phosphoribosyltransferase [Oryza sativa 
Japonica Group]
 dbj|BAF17265.1| Os05g0370600 [Oryza sativa Japonica Group]
 gb|EAY97780.1| hypothetical protein OsI_19693 [Oryza sativa Indica Group]
 gb|EEE63479.1| hypothetical protein OsJ_18293 [Oryza sativa Japonica Group]
Length=774

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 2/66 (3%)
 Frame = +2

Query  416  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQRP + E++ LKET PHLGGG   GDKLT+TYDLVEQMQYLYVRVVKA+DLP KD+TGS
Sbjct  2    MQRPFRPEEYSLKETSPHLGGGA-AGDKLTTTYDLVEQMQYLYVRVVKAKDLPSKDITGS  60

Query  593  LDPYVE  610
             DPYVE
Sbjct  61   CDPYVE  66



>gb|KEH30271.1| C2 calcium/lipid-binding and GRAM domain protein [Medicago truncatula]
Length=770

 Score =   101 bits (251),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 56/66 (85%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQ+PP   +F LKET P++G G +T DKL+ TYDLVEQMQYLYVRVVKA++LP KDVTGS
Sbjct  1    MQKPPNSHEFALKETTPNIGAGAVTRDKLSCTYDLVEQMQYLYVRVVKAKELPTKDVTGS  60

Query  593  LDPYVE  610
            LDPYVE
Sbjct  61   LDPYVE  66



>ref|NP_196801.1| calcium-dependent lipid-binding domain-containing plant phosphoribosyltransferase-like 
protein [Arabidopsis thaliana]
 emb|CAB88261.1| anthranilate phosphoribosyltransferase-like protein [Arabidopsis 
thaliana]
 gb|AED91836.1| calcium-dependent lipid-binding domain-containing plant phosphoribosyltransferase-like 
protein [Arabidopsis thaliana]
Length=769

 Score =   100 bits (250),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQ+P Q  DF LKET P +G G +TGDKL STYDLVEQM YLYVRVVKA++LP KDVTGS
Sbjct  1    MQKPGQNIDFALKETSPKIGAGSVTGDKLCSTYDLVEQMHYLYVRVVKAKELPGKDVTGS  60

Query  593  LDPYVE  610
             DPYVE
Sbjct  61   CDPYVE  66



>ref|XP_007131979.1| hypothetical protein PHAVU_011G056600g [Phaseolus vulgaris]
 gb|ESW03973.1| hypothetical protein PHAVU_011G056600g [Phaseolus vulgaris]
Length=775

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 54/68 (79%), Gaps = 3/68 (4%)
 Frame = +2

Query  416  MQRPP---QEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVT  586
            MQR P     +F LKET P++G G +T DKL+ TYDLVEQMQYLYVRVVKA DLP KDVT
Sbjct  1    MQRAPLAHSHEFALKETSPNIGAGAVTRDKLSCTYDLVEQMQYLYVRVVKAMDLPAKDVT  60

Query  587  GSLDPYVE  610
            GSLDPYVE
Sbjct  61   GSLDPYVE  68



>emb|CDX78498.1| BnaA03g04100D [Brassica napus]
Length=769

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQ+P Q  DF LKET P +G G +TGDKL+ TYDLVEQM YLYVRVVKA++LP KDVTGS
Sbjct  1    MQKPGQNIDFALKETSPKIGAGAVTGDKLSCTYDLVEQMHYLYVRVVKAKELPGKDVTGS  60

Query  593  LDPYVE  610
             DPYVE
Sbjct  61   CDPYVE  66



>ref|XP_002438680.1| hypothetical protein SORBIDRAFT_10g024200 [Sorghum bicolor]
 gb|EER90047.1| hypothetical protein SORBIDRAFT_10g024200 [Sorghum bicolor]
Length=775

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 56/67 (84%), Gaps = 3/67 (4%)
 Frame = +2

Query  416  MQRPPQ--EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  589
            MQRPP   E++ LKET PHLGG    GDKLT+TYDLVEQMQYLYVRVVKA++LP KD+TG
Sbjct  2    MQRPPLRPEEYSLKETSPHLGGAA-AGDKLTTTYDLVEQMQYLYVRVVKAKELPNKDITG  60

Query  590  SLDPYVE  610
            S DPYVE
Sbjct  61   SCDPYVE  67



>ref|XP_009131306.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Brassica rapa]
 ref|XP_009131307.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Brassica rapa]
 ref|XP_009131308.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Brassica rapa]
Length=769

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQ+P Q  DF LKET P +G G +TGDKL+ TYDLVEQM YLYVRVVKA++LP KDVTGS
Sbjct  1    MQKPGQNIDFALKETSPKIGAGAVTGDKLSCTYDLVEQMHYLYVRVVKAKELPGKDVTGS  60

Query  593  LDPYVE  610
             DPYVE
Sbjct  61   CDPYVE  66



>ref|XP_008658284.1| PREDICTED: uncharacterized protein LOC100273873 isoform X1 [Zea 
mays]
 ref|XP_008658285.1| PREDICTED: uncharacterized protein LOC100273873 isoform X1 [Zea 
mays]
 ref|XP_008658286.1| PREDICTED: uncharacterized protein LOC100273873 isoform X1 [Zea 
mays]
 gb|AFW87459.1| hypothetical protein ZEAMMB73_550028 [Zea mays]
 gb|AFW87460.1| hypothetical protein ZEAMMB73_550028 [Zea mays]
Length=775

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 56/67 (84%), Gaps = 3/67 (4%)
 Frame = +2

Query  416  MQRPPQ--EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  589
            MQRPP   E++ LKET PHLGG    GDKLT+TYDLVEQMQYLYVRVVKA++LP KD+TG
Sbjct  2    MQRPPLRPEEYSLKETTPHLGGAA-AGDKLTTTYDLVEQMQYLYVRVVKAKELPNKDITG  60

Query  590  SLDPYVE  610
            S DPYVE
Sbjct  61   SCDPYVE  67



>ref|XP_003537951.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X1 [Glycine max]
 ref|XP_006590953.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X2 [Glycine max]
 gb|KHN21877.1| Multiple C2 and transmembrane domain-containing protein 1 [Glycine 
soja]
Length=777

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 54/68 (79%), Gaps = 3/68 (4%)
 Frame = +2

Query  416  MQRPP---QEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVT  586
            MQ+ P     +F LKET P +G G +T DKL+ TYDLVEQMQYLYVRVVKA+DLP KDVT
Sbjct  1    MQKAPLAHSNEFALKETSPKIGAGAVTRDKLSCTYDLVEQMQYLYVRVVKAKDLPSKDVT  60

Query  587  GSLDPYVE  610
            GSLDPYVE
Sbjct  61   GSLDPYVE  68



>ref|XP_002871539.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47798.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=769

 Score = 98.2 bits (243),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQ+P Q  +F LKET P +G G +TGDKL+ TYDLVEQM YLYVRVVKA++LP KDVTGS
Sbjct  1    MQKPGQNIEFALKETSPKIGAGAVTGDKLSCTYDLVEQMHYLYVRVVKAKELPGKDVTGS  60

Query  593  LDPYVE  610
             DPYVE
Sbjct  61   CDPYVE  66



>ref|XP_010673580.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010673581.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010673582.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Beta vulgaris subsp. vulgaris]
Length=770

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  425  PPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLDPY  604
            PP+E+F L+ET P +G   I GDKL STYDLVEQMQYLYVRVVKA++LP KDVTGS DPY
Sbjct  5    PPREEFALRETSPAIGVAGIAGDKLNSTYDLVEQMQYLYVRVVKAKELPGKDVTGSCDPY  64

Query  605  VE  610
            VE
Sbjct  65   VE  66



>ref|XP_010044995.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Eucalyptus grandis]
 gb|KCW87135.1| hypothetical protein EUGRSUZ_B03663 [Eucalyptus grandis]
Length=775

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 57/67 (85%), Gaps = 2/67 (3%)
 Frame = +2

Query  416  MQRPPQ-EDFMLKETKPHLGGGKIT-GDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  589
            MQ+PPQ +DF L+ET P++G G++T  DKL  TYDLVEQMQYLYVRVVKA++LP KDVTG
Sbjct  1    MQKPPQPQDFALRETSPNIGAGQVTPADKLACTYDLVEQMQYLYVRVVKAKELPGKDVTG  60

Query  590  SLDPYVE  610
            + DPYVE
Sbjct  61   TCDPYVE  67



>ref|XP_009121819.1| PREDICTED: extended synaptotagmin-1-like [Brassica rapa]
 ref|XP_009121820.1| PREDICTED: extended synaptotagmin-1-like [Brassica rapa]
Length=769

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQ+P Q  DF LKET P +G G +TGDKL+ TYDLVEQM YLYV+VVKA++LP KDVTGS
Sbjct  1    MQKPGQNIDFALKETSPKIGAGAVTGDKLSCTYDLVEQMHYLYVQVVKAKELPGKDVTGS  60

Query  593  LDPYVE  610
             DPYVE
Sbjct  61   CDPYVE  66



>ref|XP_010492034.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
 ref|XP_010492035.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
 ref|XP_010492036.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
 ref|XP_010492037.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
Length=769

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQ+P Q  +F LKET P +G G +TGDKL+ TYDLVEQM YLYVRV+KA++LP KDVTGS
Sbjct  1    MQKPGQNIEFALKETSPKIGAGAVTGDKLSCTYDLVEQMHYLYVRVMKAKELPAKDVTGS  60

Query  593  LDPYVE  610
             DPYVE
Sbjct  61   CDPYVE  66



>emb|CDX97214.1| BnaC09g44110D [Brassica napus]
Length=769

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQ+P Q  DF LKET P +G G +TGDKL+ TYDLVEQM YLYV+VVKA++LP KDVTGS
Sbjct  1    MQKPGQNIDFALKETSPKIGAGALTGDKLSCTYDLVEQMHYLYVQVVKAKELPGKDVTGS  60

Query  593  LDPYVE  610
             DPYVE
Sbjct  61   CDPYVE  66



>gb|EMS45217.1| Multiple C2 and transmembrane domain-containing protein 1 [Triticum 
urartu]
Length=774

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 56/66 (85%), Gaps = 2/66 (3%)
 Frame = +2

Query  416  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQRP + E++ LKET PHLGG    GDKLT+TYDLVEQMQYLYVRVVKA++LP KD+TGS
Sbjct  2    MQRPFRPEEYSLKETTPHLGGAA-AGDKLTTTYDLVEQMQYLYVRVVKAKELPAKDLTGS  60

Query  593  LDPYVE  610
             DPYVE
Sbjct  61   CDPYVE  66



>ref|XP_006289947.1| hypothetical protein CARUB_v10003573mg [Capsella rubella]
 gb|EOA22845.1| hypothetical protein CARUB_v10003573mg [Capsella rubella]
Length=769

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 55/66 (83%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQ+P Q  +F LKET P +G G +TGDKL++TYDLVEQM YLYVRV+KA++LP KDVTGS
Sbjct  1    MQKPGQNIEFALKETSPKIGAGAVTGDKLSNTYDLVEQMHYLYVRVMKAKELPGKDVTGS  60

Query  593  LDPYVE  610
             DPYVE
Sbjct  61   CDPYVE  66



>ref|XP_006399782.1| hypothetical protein EUTSA_v10012747mg [Eutrema salsugineum]
 gb|ESQ41235.1| hypothetical protein EUTSA_v10012747mg [Eutrema salsugineum]
Length=769

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQ+P Q  DF LKET P +G G +TGDKL+ TYDLVEQM YLYVRV+KA++LP KD+TGS
Sbjct  1    MQKPGQNIDFALKETSPKIGAGAVTGDKLSCTYDLVEQMHYLYVRVMKAKELPGKDMTGS  60

Query  593  LDPYVE  610
             DPYVE
Sbjct  61   CDPYVE  66



>gb|EMT24491.1| Multiple C2 and transmembrane domain-containing protein 1 [Aegilops 
tauschii]
Length=703

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 56/66 (85%), Gaps = 2/66 (3%)
 Frame = +2

Query  416  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQRP + E++ LKET PHLGG    GDKLT+TYDLVEQMQYLYVRVVKA++LP KD+TGS
Sbjct  2    MQRPFRPEEYSLKETTPHLGGAA-AGDKLTTTYDLVEQMQYLYVRVVKAKELPAKDLTGS  60

Query  593  LDPYVE  610
             DPYVE
Sbjct  61   CDPYVE  66



>ref|XP_010227498.1| PREDICTED: LOW QUALITY PROTEIN: multiple C2 and transmembrane 
domain-containing protein 2-like [Brachypodium distachyon]
Length=774

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 56/66 (85%), Gaps = 2/66 (3%)
 Frame = +2

Query  416  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQRP + E++ LKET PHLGG    GDKLT+TYDLVEQMQYLYVRVVKA++LP KD++GS
Sbjct  2    MQRPFRPEEYSLKETSPHLGGAA-AGDKLTTTYDLVEQMQYLYVRVVKAKELPSKDISGS  60

Query  593  LDPYVE  610
             DPYVE
Sbjct  61   CDPYVE  66



>ref|XP_010419857.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 isoform X2 [Camelina sativa]
Length=769

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQ+P Q  +F LKET P +G G +TGDKL+ TYDLVEQM YLYVRV+KA++LP KDVTGS
Sbjct  1    MQKPGQNIEFALKETSPKIGAGAVTGDKLSCTYDLVEQMHYLYVRVMKAKELPGKDVTGS  60

Query  593  LDPYVE  610
             DPYVE
Sbjct  61   CDPYVE  66



>ref|XP_010419856.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 isoform X1 [Camelina sativa]
 ref|XP_010419858.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 isoform X1 [Camelina sativa]
Length=769

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQ+P Q  +F LKET P +G G +TGDKL+ TYDLVEQM YLYVRV+KA++LP KDVTGS
Sbjct  1    MQKPGQNIEFALKETSPKIGAGAVTGDKLSCTYDLVEQMHYLYVRVMKAKELPGKDVTGS  60

Query  593  LDPYVE  610
             DPYVE
Sbjct  61   CDPYVE  66



>emb|CDY68091.1| BnaAnng26150D [Brassica napus]
Length=769

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQ+P Q  DF LKET P +G G +TGDKL+ TYDLVEQM YLYV+VVKA++LP KDVTGS
Sbjct  1    MQKPGQNIDFALKETSPKIGAGAVTGDKLSCTYDLVEQMHYLYVQVVKAKELPGKDVTGS  60

Query  593  LDPYVE  610
             +PYVE
Sbjct  61   CNPYVE  66



>emb|CDX70485.1| BnaC03g05690D [Brassica napus]
Length=769

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 53/66 (80%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            M++P Q  DF LKET P +G G +TGDKL+ TYDLVEQM YLYVRVVKA++L  KDVTGS
Sbjct  1    MEKPGQNIDFALKETSPKIGAGAVTGDKLSCTYDLVEQMHYLYVRVVKAKELSGKDVTGS  60

Query  593  LDPYVE  610
             DPYVE
Sbjct  61   CDPYVE  66



>ref|XP_004142139.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Cucumis sativus]
 ref|XP_004162018.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Cucumis sativus]
 gb|KGN54116.1| hypothetical protein Csa_4G286400 [Cucumis sativus]
Length=771

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 53/66 (80%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQ+  Q  DF LKET P +G   ITGDKL+STYDLVEQMQYLYV VVKA+DLP KDVTGS
Sbjct  1    MQKILQPHDFALKETYPKIGAVSITGDKLSSTYDLVEQMQYLYVYVVKAKDLPGKDVTGS  60

Query  593  LDPYVE  610
             DPYVE
Sbjct  61   CDPYVE  66



>ref|XP_007150401.1| hypothetical protein PHAVU_005G150300g [Phaseolus vulgaris]
 ref|XP_007150402.1| hypothetical protein PHAVU_005G150300g [Phaseolus vulgaris]
 gb|ESW22395.1| hypothetical protein PHAVU_005G150300g [Phaseolus vulgaris]
 gb|ESW22396.1| hypothetical protein PHAVU_005G150300g [Phaseolus vulgaris]
Length=774

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 54/67 (81%), Gaps = 2/67 (3%)
 Frame = +2

Query  410  HKMQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  589
            HK + PP+  F LKET P++G G +  DKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTG
Sbjct  2    HKPEGPPE--FALKETSPNIGAGAVMRDKLSCTYDLVEQMQYLYVRVVKAKDLPGKDVTG  59

Query  590  SLDPYVE  610
             +DPYVE
Sbjct  60   GVDPYVE  66



>ref|XP_003543552.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoform X1 [Glycine max]
 ref|XP_006595053.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoform X2 [Glycine max]
 gb|KHN30112.1| Multiple C2 and transmembrane domain-containing protein 2 [Glycine 
soja]
Length=775

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 53/66 (80%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            M +P +  DF LKET P++G G +  DKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTG 
Sbjct  1    MHKPAEALDFALKETSPNIGAGAVMRDKLSCTYDLVEQMQYLYVRVVKAKDLPGKDVTGG  60

Query  593  LDPYVE  610
            +DPYVE
Sbjct  61   VDPYVE  66



>gb|KHN33324.1| Multiple C2 and transmembrane domain-containing protein 1 [Glycine 
soja]
Length=774

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 53/66 (80%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            M +P +  DF L+ET P++G G +  DKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTG 
Sbjct  1    MHKPAEALDFALRETSPNIGAGAVMRDKLSCTYDLVEQMQYLYVRVVKAKDLPGKDVTGG  60

Query  593  LDPYVE  610
            +DPYVE
Sbjct  61   VDPYVE  66



>ref|XP_008647970.1| PREDICTED: phosphoribosylanthranilate transferase isoform X1 
[Zea mays]
 ref|XP_008647971.1| PREDICTED: phosphoribosylanthranilate transferase isoform X1 
[Zea mays]
 gb|AFW76297.1| phosphoribosylanthranilate transferase isoform 1 [Zea mays]
 gb|AFW76298.1| phosphoribosylanthranilate transferase isoform 2 [Zea mays]
 gb|AFW76299.1| phosphoribosylanthranilate transferase isoform 3 [Zea mays]
Length=774

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 54/67 (81%), Gaps = 3/67 (4%)
 Frame = +2

Query  416  MQRP--PQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  589
            MQRP    E++ LKET PHLGG    GDKLT+TYDLVEQMQYLYVRVVKA++LP  D+TG
Sbjct  2    MQRPLLRPEEYSLKETSPHLGGAA-AGDKLTTTYDLVEQMQYLYVRVVKAKELPNMDITG  60

Query  590  SLDPYVE  610
            S DPYVE
Sbjct  61   SCDPYVE  67



>ref|NP_001152102.1| phosphoribosylanthranilate transferase [Zea mays]
 gb|ACG45776.1| phosphoribosylanthranilate transferase [Zea mays]
Length=774

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 54/67 (81%), Gaps = 3/67 (4%)
 Frame = +2

Query  416  MQRP--PQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  589
            MQRP    E++ LKET PHLGG    GDKLT+TYDLVEQMQYLYVRVVKA++LP  D+TG
Sbjct  2    MQRPLLRPEEYSLKETSPHLGGAA-AGDKLTTTYDLVEQMQYLYVRVVKAKELPNMDITG  60

Query  590  SLDPYVE  610
            S DPYVE
Sbjct  61   SCDPYVE  67



>ref|XP_008449758.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Cucumis melo]
Length=771

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 52/66 (79%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            MQ+  Q  DF LKET P +G   ITGDKL+ TYDLVEQMQYLYV VVKA+DLP KDVTGS
Sbjct  1    MQKTLQPHDFALKETYPKIGAVSITGDKLSCTYDLVEQMQYLYVYVVKAKDLPGKDVTGS  60

Query  593  LDPYVE  610
             DPYVE
Sbjct  61   CDPYVE  66



>ref|XP_003546988.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Glycine max]
Length=774

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 53/66 (80%), Gaps = 1/66 (2%)
 Frame = +2

Query  416  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            M +P +  DF L+ET P++G G +  DKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTG 
Sbjct  1    MHKPAEALDFALRETSPNIGAGAVMRDKLSCTYDLVEQMQYLYVRVVKAKDLPGKDVTGG  60

Query  593  LDPYVE  610
            +DPYVE
Sbjct  61   VDPYVE  66



>emb|CDP14088.1| unnamed protein product [Coffea canephora]
Length=762

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 51/67 (76%), Gaps = 2/67 (3%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGG--GKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  589
            M+ P  E+F LKET P + G    I GDKLT TYDLVEQMQYLYVRVVKARDLP KDVTG
Sbjct  1    MKLPQPEEFALKETAPKIAGSGAIIDGDKLTCTYDLVEQMQYLYVRVVKARDLPGKDVTG  60

Query  590  SLDPYVE  610
            S DPY E
Sbjct  61   SCDPYAE  67



>gb|KDP28646.1| hypothetical protein JCGZ_14417 [Jatropha curcas]
Length=1025

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 52/64 (81%), Gaps = 6/64 (9%)
 Frame = +2

Query  437  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  598
            D+ LKET P LGGG+I G      D++TSTYDLVEQM+YL+VRVVKARDLP  DVTGSLD
Sbjct  250  DYALKETSPFLGGGQIVGGRVIRGDRMTSTYDLVEQMRYLFVRVVKARDLPTMDVTGSLD  309

Query  599  PYVE  610
            PYVE
Sbjct  310  PYVE  313



>ref|XP_002511838.1| synaptotagmin, putative [Ricinus communis]
 gb|EEF50507.1| synaptotagmin, putative [Ricinus communis]
Length=1017

 Score = 92.0 bits (227),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 52/64 (81%), Gaps = 6/64 (9%)
 Frame = +2

Query  437  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  598
            D+ LKET P LGGG+I G      D++ STYDLVEQM+YL+VRVVKAR+LP KDVTGSLD
Sbjct  244  DYALKETSPFLGGGQIVGGRVIRRDRIASTYDLVEQMKYLFVRVVKARELPSKDVTGSLD  303

Query  599  PYVE  610
            PYVE
Sbjct  304  PYVE  307



>ref|XP_009417304.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Musa acuminata subsp. malaccensis]
Length=777

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 58/69 (84%), Gaps = 4/69 (6%)
 Frame = +2

Query  416  MQRP---PQEDFMLKETKPHLGGGKITG-DKLTSTYDLVEQMQYLYVRVVKARDLPPKDV  583
            MQRP   PQEDF LKET P LGGG + G DKLT+TYDLVEQMQYLYVRVVKA+DLP KDV
Sbjct  1    MQRPFPLPQEDFSLKETAPRLGGGGLGGGDKLTNTYDLVEQMQYLYVRVVKAKDLPAKDV  60

Query  584  TGSLDPYVE  610
            TGS DPYVE
Sbjct  61   TGSCDPYVE  69



>ref|XP_010105960.1| Multiple C2 and transmembrane domain-containing protein 1 [Morus 
notabilis]
 gb|EXC06842.1| Multiple C2 and transmembrane domain-containing protein 1 [Morus 
notabilis]
Length=1006

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 52/64 (81%), Gaps = 6/64 (9%)
 Frame = +2

Query  437  DFMLKETKPHLGGGKITGDKL------TSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  598
            D+ LKET P LGGG+I G ++      TSTYDLVE+MQYL++RVVKARDLP KDVTGSLD
Sbjct  232  DYSLKETSPFLGGGQIIGGRVIPGNRPTSTYDLVEKMQYLFIRVVKARDLPAKDVTGSLD  291

Query  599  PYVE  610
            PYVE
Sbjct  292  PYVE  295



>ref|XP_010255412.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Nelumbo nucifera]
 ref|XP_010255414.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Nelumbo nucifera]
 ref|XP_010255415.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Nelumbo nucifera]
Length=1011

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 51/64 (80%), Gaps = 6/64 (9%)
 Frame = +2

Query  437  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  598
            D+ LKET P LGGG+I G      DK  STYDLVEQMQ+L+VRVVKAR+LPP D+TGSLD
Sbjct  235  DYALKETSPFLGGGQIVGGRVIRADKPASTYDLVEQMQFLFVRVVKARELPPMDITGSLD  294

Query  599  PYVE  610
            PYVE
Sbjct  295  PYVE  298



>gb|KJB41306.1| hypothetical protein B456_007G098200 [Gossypium raimondii]
Length=1005

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 51/64 (80%), Gaps = 6/64 (9%)
 Frame = +2

Query  437  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  598
            DF LKET P LG G+I G      D+ TSTYDLVEQM+YL+VRVVKARDLP KD+TGSLD
Sbjct  232  DFALKETSPFLGEGRIIGGRVIRGDRPTSTYDLVEQMRYLFVRVVKARDLPSKDLTGSLD  291

Query  599  PYVE  610
            PYVE
Sbjct  292  PYVE  295



>ref|XP_010940465.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Elaeis guineensis]
 ref|XP_010940466.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Elaeis guineensis]
 ref|XP_010940467.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Elaeis guineensis]
Length=1004

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 51/64 (80%), Gaps = 6/64 (9%)
 Frame = +2

Query  437  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  598
            D+ LKET P LGGG+I G      +K TSTYDLVEQMQYL+VRVVKARDLP  DV+GSLD
Sbjct  232  DYALKETSPFLGGGQIVGGRVIRAEKPTSTYDLVEQMQYLFVRVVKARDLPAMDVSGSLD  291

Query  599  PYVE  610
            PYVE
Sbjct  292  PYVE  295



>ref|XP_006349900.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Solanum tuberosum]
Length=771

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 49/65 (75%), Gaps = 9/65 (14%)
 Frame = +2

Query  416  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            MQRPPQEDF       HL GGK+TGD  T TYDLVEQMQYLYVRVVKA+DLP KD    L
Sbjct  1    MQRPPQEDF-----SAHLDGGKVTGDMFTRTYDLVEQMQYLYVRVVKAKDLPGKD----L  51

Query  596  DPYVE  610
            DPYVE
Sbjct  52   DPYVE  56



>emb|CBI40337.3| unnamed protein product [Vitis vinifera]
Length=640

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 50/64 (78%), Gaps = 6/64 (9%)
 Frame = +2

Query  437  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  598
            D+ LKET P LGGG+I G      DK  STYDLVEQM YL+VRVVKARDLP KDVTGSLD
Sbjct  164  DYQLKETSPILGGGQIVGGRVIRADKPASTYDLVEQMHYLFVRVVKARDLPTKDVTGSLD  223

Query  599  PYVE  610
            P+VE
Sbjct  224  PFVE  227



>ref|XP_008806876.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Phoenix dactylifera]
 ref|XP_008806877.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Phoenix dactylifera]
Length=1002

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 50/64 (78%), Gaps = 6/64 (9%)
 Frame = +2

Query  437  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  598
            D+ LKET P LGGG+I G      +K  STYDLVEQMQYL+VRVVKARDLP  DVTGSLD
Sbjct  230  DYALKETSPFLGGGQIVGGRVIRAEKPASTYDLVEQMQYLFVRVVKARDLPAMDVTGSLD  289

Query  599  PYVE  610
            PYVE
Sbjct  290  PYVE  293



>ref|XP_009383872.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Musa acuminata subsp. malaccensis]
Length=1012

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 50/64 (78%), Gaps = 6/64 (9%)
 Frame = +2

Query  437  DFMLKETKPHLGGGKITGDKL------TSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  598
            D+ LKET P LGGG+I G ++       STYDLVEQMQYL+VRVVKARDLP  DVTGSLD
Sbjct  241  DYALKETSPFLGGGQIVGGRVIRAEKPASTYDLVEQMQYLFVRVVKARDLPAMDVTGSLD  300

Query  599  PYVE  610
            PYVE
Sbjct  301  PYVE  304



>ref|XP_002271590.1| PREDICTED: uncharacterized protein LOC100253432 [Vitis vinifera]
Length=1018

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 50/64 (78%), Gaps = 6/64 (9%)
 Frame = +2

Query  437  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  598
            D+ LKET P LGGG+I G      DK  STYDLVEQM YL+VRVVKARDLP KDVTGSLD
Sbjct  238  DYQLKETSPILGGGQIVGGRVIRADKPASTYDLVEQMHYLFVRVVKARDLPTKDVTGSLD  297

Query  599  PYVE  610
            P+VE
Sbjct  298  PFVE  301



>emb|CAN79812.1| hypothetical protein VITISV_018822 [Vitis vinifera]
Length=1020

 Score = 89.7 bits (221),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 50/64 (78%), Gaps = 6/64 (9%)
 Frame = +2

Query  437  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  598
            D+ LKET P LGGG+I G      DK  STYDLVEQM YL+VRVVKARDLP KDVTGSLD
Sbjct  240  DYQLKETSPILGGGQIVGGRVIRADKPASTYDLVEQMHYLFVRVVKARDLPTKDVTGSLD  299

Query  599  PYVE  610
            P+VE
Sbjct  300  PFVE  303



>ref|XP_009386410.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009386411.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009386412.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009386413.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009386414.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009386415.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Musa acuminata subsp. malaccensis]
Length=1004

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 50/64 (78%), Gaps = 6/64 (9%)
 Frame = +2

Query  437  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  598
            D+ LKET P LGGG+I G      DK  STYDLVEQMQYL+VRVVKA+DLP  DVTGSLD
Sbjct  232  DYALKETSPFLGGGQIVGGRVIRADKPASTYDLVEQMQYLFVRVVKAKDLPAMDVTGSLD  291

Query  599  PYVE  610
            P+VE
Sbjct  292  PFVE  295



>ref|XP_008778754.1| PREDICTED: LOW QUALITY PROTEIN: multiple C2 and transmembrane 
domain-containing protein 1-like [Phoenix dactylifera]
Length=1005

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 50/64 (78%), Gaps = 6/64 (9%)
 Frame = +2

Query  437  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  598
            D+ LKET P LGGG+I G      +K  STYDLVEQMQYL+VRVVKARDLP  DV+GSLD
Sbjct  232  DYALKETNPFLGGGQIVGGRVIRAEKPASTYDLVEQMQYLFVRVVKARDLPAMDVSGSLD  291

Query  599  PYVE  610
            PYVE
Sbjct  292  PYVE  295



>ref|XP_006445078.1| hypothetical protein CICLE_v10018672mg [Citrus clementina]
 ref|XP_006491075.1| PREDICTED: uncharacterized protein LOC102617920 [Citrus sinensis]
 gb|ESR58318.1| hypothetical protein CICLE_v10018672mg [Citrus clementina]
Length=1008

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 51/64 (80%), Gaps = 6/64 (9%)
 Frame = +2

Query  437  DFMLKETKPHLGGGKITGDKL------TSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  598
            D+ LKET P LGGG++ G ++       STYDLVEQM+YL+VRVVKARDLP KDVTGSLD
Sbjct  235  DYALKETSPFLGGGQVIGGRVVRGDLRASTYDLVEQMRYLFVRVVKARDLPSKDVTGSLD  294

Query  599  PYVE  610
            P+VE
Sbjct  295  PFVE  298



>gb|KDO86111.1| hypothetical protein CISIN_1g001835mg [Citrus sinensis]
 gb|KDO86112.1| hypothetical protein CISIN_1g001835mg [Citrus sinensis]
Length=1008

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 51/64 (80%), Gaps = 6/64 (9%)
 Frame = +2

Query  437  DFMLKETKPHLGGGKITGDKL------TSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  598
            D+ LKET P LGGG++ G ++       STYDLVEQM+YL+VRVVKARDLP KDVTGSLD
Sbjct  235  DYALKETSPFLGGGQVIGGRVVRGDLRASTYDLVEQMRYLFVRVVKARDLPSKDVTGSLD  294

Query  599  PYVE  610
            P+VE
Sbjct  295  PFVE  298



>ref|XP_010660813.1| PREDICTED: uncharacterized protein LOC100264973 [Vitis vinifera]
 ref|XP_010660820.1| PREDICTED: uncharacterized protein LOC100264973 [Vitis vinifera]
 ref|XP_010660822.1| PREDICTED: uncharacterized protein LOC100264973 [Vitis vinifera]
Length=1002

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 49/64 (77%), Gaps = 6/64 (9%)
 Frame = +2

Query  437  DFMLKETKPHLGGGK------ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  598
            DF LKET P LGGG+      I  DK  STYDLVEQMQ+L+VRVVKAR+LP  DVTGSLD
Sbjct  229  DFALKETSPFLGGGQVVRGRVIRSDKTASTYDLVEQMQFLFVRVVKARELPAMDVTGSLD  288

Query  599  PYVE  610
            PYVE
Sbjct  289  PYVE  292



>ref|XP_010934752.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Elaeis guineensis]
 ref|XP_010934753.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Elaeis guineensis]
 ref|XP_010934755.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Elaeis guineensis]
Length=1004

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 50/64 (78%), Gaps = 6/64 (9%)
 Frame = +2

Query  437  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  598
            D+ LKET P LGGG+I G      +K  STYDLVEQMQYL+VRVVKARDLP  DVTGSLD
Sbjct  232  DYALKETSPFLGGGQIVGGRVIRAEKPASTYDLVEQMQYLFVRVVKARDLPAMDVTGSLD  291

Query  599  PYVE  610
            P+VE
Sbjct  292  PFVE  295



>ref|XP_007051845.1| C2 calcium/lipid-binding plant phosphoribosyltransferase family 
protein isoform 2 [Theobroma cacao]
 gb|EOX96002.1| C2 calcium/lipid-binding plant phosphoribosyltransferase family 
protein isoform 2 [Theobroma cacao]
Length=949

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 6/64 (9%)
 Frame = +2

Query  437  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  598
            D+ LKET P LGGG+I G      D+  STYDLVEQM+YL+VRVVKA+DLP KDV GSLD
Sbjct  230  DYALKETSPFLGGGQIVGGRVIRGDRPASTYDLVEQMRYLFVRVVKAQDLPSKDVAGSLD  289

Query  599  PYVE  610
            PYVE
Sbjct  290  PYVE  293



>ref|XP_007051844.1| C2 calcium/lipid-binding plant phosphoribosyltransferase family 
protein isoform 1 [Theobroma cacao]
 gb|EOX96001.1| C2 calcium/lipid-binding plant phosphoribosyltransferase family 
protein isoform 1 [Theobroma cacao]
Length=1001

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 6/64 (9%)
 Frame = +2

Query  437  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  598
            D+ LKET P LGGG+I G      D+  STYDLVEQM+YL+VRVVKA+DLP KDV GSLD
Sbjct  230  DYALKETSPFLGGGQIVGGRVIRGDRPASTYDLVEQMRYLFVRVVKAQDLPSKDVAGSLD  289

Query  599  PYVE  610
            PYVE
Sbjct  290  PYVE  293



>ref|XP_007052594.1| C2 calcium/lipid-binding plant phosphoribosyltransferase family 
protein [Theobroma cacao]
 gb|EOX96751.1| C2 calcium/lipid-binding plant phosphoribosyltransferase family 
protein [Theobroma cacao]
Length=1050

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 55/79 (70%), Gaps = 11/79 (14%)
 Frame = +2

Query  407  NHKMQRPPQEDFMLKETKPHLG---------GGK--ITGDKLTSTYDLVEQMQYLYVRVV  553
            N + Q   QED+ LK+T P LG         GG+  I+G++ TSTYDLVEQM YLYVRVV
Sbjct  257  NAQAQPGYQEDYNLKDTNPQLGERWPNGGAYGGRGWISGERFTSTYDLVEQMFYLYVRVV  316

Query  554  KARDLPPKDVTGSLDPYVE  610
            KA+DLPP  VTGS DPYVE
Sbjct  317  KAKDLPPSSVTGSCDPYVE  335



>ref|XP_002320122.2| hypothetical protein POPTR_0014s07750g [Populus trichocarpa]
 gb|EEE98437.2| hypothetical protein POPTR_0014s07750g [Populus trichocarpa]
Length=1008

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 6/64 (9%)
 Frame = +2

Query  437  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  598
            D+ LKET P LGGG+I G      D+ +S+YDLVEQM+YLYVRVVKA DLP  DVTGSLD
Sbjct  236  DYALKETSPFLGGGQIVGGRVIRGDRPSSSYDLVEQMKYLYVRVVKAHDLPTMDVTGSLD  295

Query  599  PYVE  610
            PYVE
Sbjct  296  PYVE  299



>gb|EMT30716.1| hypothetical protein F775_31640 [Aegilops tauschii]
Length=983

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 50/64 (78%), Gaps = 6/64 (9%)
 Frame = +2

Query  437  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  598
            D+ LKET P LGGG+I G      +K  STYDLVE+MQYL+VRVVKARDLP  D+TGSLD
Sbjct  242  DYALKETSPFLGGGQIVGGRVIGGEKHASTYDLVERMQYLFVRVVKARDLPNMDITGSLD  301

Query  599  PYVE  610
            P+VE
Sbjct  302  PFVE  305



>dbj|BAK04937.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1016

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 50/64 (78%), Gaps = 6/64 (9%)
 Frame = +2

Query  437  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  598
            D+ LKET P LGGG+I G      +K  STYDLVE+MQYL+VRVVKARDLP  D+TGSLD
Sbjct  242  DYALKETSPFLGGGQIVGGRVIGGEKHASTYDLVERMQYLFVRVVKARDLPNMDITGSLD  301

Query  599  PYVE  610
            P+VE
Sbjct  302  PFVE  305



>ref|XP_003580853.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Brachypodium distachyon]
Length=1009

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 50/64 (78%), Gaps = 6/64 (9%)
 Frame = +2

Query  437  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  598
            D+ LKET P LGGG+I G      +K  STYDLVE+MQYL+VRVVKARDLP  D+TGSLD
Sbjct  235  DYALKETSPFLGGGQIVGGRVIRGEKHASTYDLVERMQYLFVRVVKARDLPDMDITGSLD  294

Query  599  PYVE  610
            P+VE
Sbjct  295  PFVE  298



>gb|KDO83486.1| hypothetical protein CISIN_1g004208mg [Citrus sinensis]
Length=768

 Score = 85.9 bits (211),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 52/61 (85%), Gaps = 1/61 (2%)
 Frame = +2

Query  431  QEDFMLKETKPHLGGGKITG-DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLDPYV  607
            +EDF LKET P +GGG+++G ++LTS++DLVEQM++LYVR+V+ARDL    VTG+ DPYV
Sbjct  5    KEDFSLKETSPKIGGGRVSGRERLTSSFDLVEQMEFLYVRIVRARDLQVNQVTGTCDPYV  64

Query  608  E  610
            E
Sbjct  65   E  65



>ref|XP_007220279.1| hypothetical protein PRUPE_ppa000771mg [Prunus persica]
 gb|EMJ21478.1| hypothetical protein PRUPE_ppa000771mg [Prunus persica]
Length=1009

 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 51/64 (80%), Gaps = 6/64 (9%)
 Frame = +2

Query  437  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  598
            D+ LKET P+LGGG+I G      D+ + TYDLV++MQYL+VRVVKARDLP  DVTGSLD
Sbjct  233  DYSLKETSPYLGGGQIVGGRVIRADRPSGTYDLVQKMQYLFVRVVKARDLPHMDVTGSLD  292

Query  599  PYVE  610
            PYVE
Sbjct  293  PYVE  296



>ref|XP_008244912.1| PREDICTED: uncharacterized protein LOC103343020 [Prunus mume]
Length=1009

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 51/64 (80%), Gaps = 6/64 (9%)
 Frame = +2

Query  437  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  598
            D+ LKET P+LGGG+I G      D+ + TYDLV++MQYL+VRVVKARDLP  DVTGSLD
Sbjct  233  DYSLKETSPYLGGGQIVGGRVIRADRPSGTYDLVQKMQYLFVRVVKARDLPHMDVTGSLD  292

Query  599  PYVE  610
            PYVE
Sbjct  293  PYVE  296



>ref|XP_006483675.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Citrus sinensis]
Length=768

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 52/61 (85%), Gaps = 1/61 (2%)
 Frame = +2

Query  431  QEDFMLKETKPHLGGGKITG-DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLDPYV  607
            +EDF LKET P +GGG+++G ++LTS++DLVEQM++LYVR+V+ARDL    VTG+ DPYV
Sbjct  5    KEDFSLKETSPKIGGGRVSGRERLTSSFDLVEQMEFLYVRIVRARDLQVNQVTGTCDPYV  64

Query  608  E  610
            E
Sbjct  65   E  65



>ref|XP_006439066.1| hypothetical protein CICLE_v10033918mg [Citrus clementina]
 gb|ESR52306.1| hypothetical protein CICLE_v10033918mg [Citrus clementina]
Length=768

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 52/61 (85%), Gaps = 1/61 (2%)
 Frame = +2

Query  431  QEDFMLKETKPHLGGGKITG-DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLDPYV  607
            +EDF LKET P +GGG+++G ++LTS++DLVEQM++LYVR+V+ARDL    VTG+ DPYV
Sbjct  5    KEDFSLKETSPKIGGGRVSGRERLTSSFDLVEQMEFLYVRIVRARDLQVNQVTGTCDPYV  64

Query  608  E  610
            E
Sbjct  65   E  65



>emb|CBI24845.3| unnamed protein product [Vitis vinifera]
Length=621

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 52/61 (85%), Gaps = 1/61 (2%)
 Frame = +2

Query  431  QEDFMLKETKPHLGGGKIT-GDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLDPYV  607
            ++D+ LKET P+LGGG+++ GDKLT+ +DLVEQM YLYVRVVKA++LP KD + S DPYV
Sbjct  120  EDDYCLKETSPNLGGGRLSRGDKLTTAFDLVEQMHYLYVRVVKAKELPGKDGSESCDPYV  179

Query  608  E  610
            E
Sbjct  180  E  180



>ref|XP_010053272.1| PREDICTED: uncharacterized protein LOC104441758 [Eucalyptus grandis]
 ref|XP_010053273.1| PREDICTED: uncharacterized protein LOC104441758 [Eucalyptus grandis]
 ref|XP_010053274.1| PREDICTED: uncharacterized protein LOC104441758 [Eucalyptus grandis]
 ref|XP_010053275.1| PREDICTED: uncharacterized protein LOC104441758 [Eucalyptus grandis]
 ref|XP_010053276.1| PREDICTED: uncharacterized protein LOC104441758 [Eucalyptus grandis]
 ref|XP_010053277.1| PREDICTED: uncharacterized protein LOC104441758 [Eucalyptus grandis]
 ref|XP_010053278.1| PREDICTED: uncharacterized protein LOC104441758 [Eucalyptus grandis]
 gb|KCW77541.1| hypothetical protein EUGRSUZ_D01859 [Eucalyptus grandis]
Length=1009

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 50/64 (78%), Gaps = 6/64 (9%)
 Frame = +2

Query  437  DFMLKETKPHLGGGK------ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  598
            ++ LKET P+LGGG+      I GDK  STYDLVEQM +LYVRVVKAR+LP  D++GS+D
Sbjct  236  EYALKETSPYLGGGRVVAGRVIRGDKTASTYDLVEQMHFLYVRVVKARELPAMDISGSID  295

Query  599  PYVE  610
            PYVE
Sbjct  296  PYVE  299



>ref|XP_011023361.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Populus euphratica]
Length=1007

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 6/64 (9%)
 Frame = +2

Query  437  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  598
            D+  KET P LGGG+I G      D+ +S+YDLVEQM+YLYVRVVKARDLP  DVTGSLD
Sbjct  235  DYTPKETSPFLGGGQIVGGRVIRGDRPSSSYDLVEQMKYLYVRVVKARDLPTMDVTGSLD  294

Query  599  PYVE  610
            PYVE
Sbjct  295  PYVE  298



>ref|XP_006342310.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Solanum tuberosum]
Length=791

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 52/72 (72%), Gaps = 11/72 (15%)
 Frame = +2

Query  428  PQEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPP  574
            PQ+D+  KETKP LG           GG I+ D++TSTYDLVEQM +LYVRVVKARDLPP
Sbjct  9    PQDDYKAKETKPQLGERWPHGGFRGGGGWISSDRVTSTYDLVEQMHFLYVRVVKARDLPP  68

Query  575  KDVTGSLDPYVE  610
              VTGS DPYVE
Sbjct  69   NPVTGSCDPYVE  80



>ref|XP_004235089.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Solanum lycopersicum]
Length=789

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 52/72 (72%), Gaps = 11/72 (15%)
 Frame = +2

Query  428  PQEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPP  574
            PQ+D+  KETKP LG           GG I+ D++TSTYDLVEQM +LYVRVVKARDLPP
Sbjct  9    PQDDYKAKETKPQLGERWPHGGFRGGGGWISSDRVTSTYDLVEQMHFLYVRVVKARDLPP  68

Query  575  KDVTGSLDPYVE  610
              VTGS DPYVE
Sbjct  69   NPVTGSCDPYVE  80



>ref|XP_010659323.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Vitis vinifera]
Length=776

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 52/61 (85%), Gaps = 1/61 (2%)
 Frame = +2

Query  431  QEDFMLKETKPHLGGGKIT-GDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLDPYV  607
            ++D+ LKET P+LGGG+++ GDKLT+ +DLVEQM YLYVRVVKA++LP KD + S DPYV
Sbjct  13   EDDYCLKETSPNLGGGRLSRGDKLTTAFDLVEQMHYLYVRVVKAKELPGKDGSESCDPYV  72

Query  608  E  610
            E
Sbjct  73   E  73



>ref|XP_011015655.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Populus euphratica]
Length=1007

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 49/64 (77%), Gaps = 6/64 (9%)
 Frame = +2

Query  437  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  598
            D+  KET P LGGG+I G      D+  STYDLVEQM+YL+VRVVKARDLP  DVTGSLD
Sbjct  235  DYTPKETSPFLGGGQIVGGRVIRGDRPASTYDLVEQMKYLFVRVVKARDLPTMDVTGSLD  294

Query  599  PYVE  610
            PYVE
Sbjct  295  PYVE  298



>ref|XP_002301353.2| hypothetical protein POPTR_0002s15950g [Populus trichocarpa]
 gb|EEE80626.2| hypothetical protein POPTR_0002s15950g [Populus trichocarpa]
Length=1008

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 49/64 (77%), Gaps = 6/64 (9%)
 Frame = +2

Query  437  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  598
            D+  KET P LGGG+I G      D+  STYDLVEQM+YL+VRVVKARDLP  DVTGSLD
Sbjct  236  DYTPKETSPFLGGGQIVGGRVIRGDRPASTYDLVEQMKYLFVRVVKARDLPTMDVTGSLD  295

Query  599  PYVE  610
            PYVE
Sbjct  296  PYVE  299



>ref|XP_002509788.1| synaptotagmin, putative [Ricinus communis]
 gb|EEF51175.1| synaptotagmin, putative [Ricinus communis]
Length=980

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 49/64 (77%), Gaps = 6/64 (9%)
 Frame = +2

Query  437  DFMLKETKPHLGGGK------ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  598
            D+ LKET P LGGG+      I GDK  STYDLVE+M +LYVRVVKARDLP  DVTGS+D
Sbjct  235  DYALKETSPLLGGGRVVHGRVIHGDKTASTYDLVERMFFLYVRVVKARDLPAMDVTGSID  294

Query  599  PYVE  610
            P+VE
Sbjct  295  PFVE  298



>emb|CDP08834.1| unnamed protein product [Coffea canephora]
Length=1004

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 49/64 (77%), Gaps = 6/64 (9%)
 Frame = +2

Query  437  DFMLKETKPHLGGGK------ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  598
            ++ LKET P LGGG+      I  DK  STYDLVE MQ+L+VRVVKARDLP KDVTGSLD
Sbjct  235  EYALKETSPVLGGGQVVQGRVIRADKPASTYDLVEPMQFLFVRVVKARDLPSKDVTGSLD  294

Query  599  PYVE  610
            PYVE
Sbjct  295  PYVE  298



>emb|CDY01973.1| BnaC02g27540D [Brassica napus]
Length=991

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 52/69 (75%), Gaps = 8/69 (12%)
 Frame = +2

Query  428  PQEDFMLKETKPHLGGGKITGDKL--------TSTYDLVEQMQYLYVRVVKARDLPPKDV  583
            P  DF +KET P LGGG+I G ++        + TYDLVE+M++L+VRVVKARDLP +D+
Sbjct  213  PPSDFSVKETSPFLGGGQIIGGRVVRGTKRPASGTYDLVEEMRFLFVRVVKARDLPDRDL  272

Query  584  TGSLDPYVE  610
            TGSLDPYVE
Sbjct  273  TGSLDPYVE  281



>ref|XP_008458254.1| PREDICTED: uncharacterized protein LOC103497726 [Cucumis melo]
 ref|XP_008458255.1| PREDICTED: uncharacterized protein LOC103497726 [Cucumis melo]
Length=1018

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 50/65 (77%), Gaps = 6/65 (9%)
 Frame = +2

Query  434  EDFMLKETKPHLGGGKITGDKL------TSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
             D+ ++ET P+LGGG + G +L      T+TYDLVE+M YL+VRVVKARDLP KD+TG L
Sbjct  238  NDYSIRETSPYLGGGMVVGGRLALRDRPTNTYDLVEKMHYLFVRVVKARDLPTKDLTGGL  297

Query  596  DPYVE  610
            DPYVE
Sbjct  298  DPYVE  302



>ref|XP_004299880.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Fragaria vesca subsp. vesca]
Length=1036

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 51/75 (68%), Gaps = 8/75 (11%)
 Frame = +2

Query  410  HKMQRPPQED--FMLKETKPHLGG------GKITGDKLTSTYDLVEQMQYLYVRVVKARD  565
            H  Q PP+++  F L ET P L        G  TGDK +STYDLVEQM YLYV VVKARD
Sbjct  254  HMQQGPPRQNPEFALVETSPPLAARLRYRPGGFTGDKTSSTYDLVEQMHYLYVSVVKARD  313

Query  566  LPPKDVTGSLDPYVE  610
            LP  DV+GSLDPYVE
Sbjct  314  LPTMDVSGSLDPYVE  328



>ref|XP_004166328.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101203632 
[Cucumis sativus]
Length=1018

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 50/65 (77%), Gaps = 6/65 (9%)
 Frame = +2

Query  434  EDFMLKETKPHLGGGKITGDKL------TSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
             D+ ++ET P+LGGG + G +L      T+TYDLVE+M YL+VRVVKARDLP KD+TG L
Sbjct  238  NDYSIRETSPYLGGGMVVGGRLALRDRPTNTYDLVEKMHYLFVRVVKARDLPTKDLTGGL  297

Query  596  DPYVE  610
            DPYVE
Sbjct  298  DPYVE  302



>gb|KDP24593.1| hypothetical protein JCGZ_25509 [Jatropha curcas]
Length=788

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 50/71 (70%), Gaps = 11/71 (15%)
 Frame = +2

Query  431  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  577
            +EDF LK+TKP LG           GG I+ D+ TSTYDLVEQM YLYVRV KARDLP  
Sbjct  7    KEDFKLKDTKPQLGERWPHGGLRSGGGWISSDRATSTYDLVEQMFYLYVRVEKARDLPTN  66

Query  578  DVTGSLDPYVE  610
             VTG+LDPYVE
Sbjct  67   PVTGNLDPYVE  77



>ref|XP_004138509.1| PREDICTED: uncharacterized protein LOC101203632 [Cucumis sativus]
 gb|KGN45648.1| hypothetical protein Csa_6G003400 [Cucumis sativus]
Length=1018

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 50/65 (77%), Gaps = 6/65 (9%)
 Frame = +2

Query  434  EDFMLKETKPHLGGGKITGDKL------TSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
             D+ ++ET P+LGGG + G +L      T+TYDLVE+M YL+VRVVKARDLP KD+TG L
Sbjct  238  NDYSIRETSPYLGGGMVVGGRLALRDRPTNTYDLVEKMHYLFVRVVKARDLPTKDLTGGL  297

Query  596  DPYVE  610
            DPYVE
Sbjct  298  DPYVE  302



>gb|EYU23487.1| hypothetical protein MIMGU_mgv1a000757mg [Erythranthe guttata]
Length=993

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 48/66 (73%), Gaps = 8/66 (12%)
 Frame = +2

Query  437  DFMLKETKPHLGGGKITGDKLT--------STYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            DF LKET P LGGG+I G K+          TYDLVE+M +L+VRVVKAR+LP  DVTGS
Sbjct  221  DFALKETSPFLGGGRIVGGKVVKTDRTTAGGTYDLVEKMHFLFVRVVKARELPAMDVTGS  280

Query  593  LDPYVE  610
            LDPYVE
Sbjct  281  LDPYVE  286



>ref|XP_007217305.1| hypothetical protein PRUPE_ppa015370mg [Prunus persica]
 gb|EMJ18504.1| hypothetical protein PRUPE_ppa015370mg [Prunus persica]
Length=929

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 50/74 (68%), Gaps = 7/74 (9%)
 Frame = +2

Query  407  NHKMQRPPQEDFMLKETKPHLGGGKIT------GDKLTSTYDLVEQMQYLYVRVVKARDL  568
            N +++ PP E F L ET P LGGG++       G+K  S YDLVEQM +LYVRVVKARDL
Sbjct  171  NAEVEIPPHE-FSLTETSPKLGGGRVASGRVIHGEKTASAYDLVEQMYFLYVRVVKARDL  229

Query  569  PPKDVTGSLDPYVE  610
            P  DVTG L PY E
Sbjct  230  PAMDVTGRLAPYTE  243



>gb|EMS48196.1| Multiple C2 and transmembrane domain-containing protein 1 [Triticum 
urartu]
Length=750

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 49/66 (74%), Gaps = 3/66 (5%)
 Frame = +2

Query  422  RPPQ---EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            +PPQ   ED++LKET P LGG    GDK TSTYDLVEQM YLYVR VKA+DL  KD +GS
Sbjct  2    QPPQPRPEDYLLKETTPCLGGFMAAGDKRTSTYDLVEQMPYLYVRAVKAKDLRAKDGSGS  61

Query  593  LDPYVE  610
             DP VE
Sbjct  62   CDPSVE  67



>ref|XP_009379435.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Pyrus x bretschneideri]
Length=1026

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 49/71 (69%), Gaps = 4/71 (6%)
 Frame = +2

Query  410  HKMQRPPQE-DFMLKETKPHLGGGKITG---DKLTSTYDLVEQMQYLYVRVVKARDLPPK  577
            H  Q PPQ  +F L ET P L   +  G   DK +STYDLVEQM YLYV VVKARDLP  
Sbjct  248  HMQQTPPQNPEFSLVETSPPLAARRYRGFGVDKTSSTYDLVEQMHYLYVSVVKARDLPTM  307

Query  578  DVTGSLDPYVE  610
            DVTGSLDPYVE
Sbjct  308  DVTGSLDPYVE  318



>ref|XP_009128492.1| PREDICTED: uncharacterized protein LOC103853319 [Brassica rapa]
 ref|XP_009128493.1| PREDICTED: uncharacterized protein LOC103853319 [Brassica rapa]
Length=995

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 51/69 (74%), Gaps = 8/69 (12%)
 Frame = +2

Query  428  PQEDFMLKETKPHLGGGKITGDKL--------TSTYDLVEQMQYLYVRVVKARDLPPKDV  583
            P  DF +KET P LGGG+I G ++        +  YDLVE+M++L+VRVVKARDLP +D+
Sbjct  217  PPSDFSVKETSPFLGGGQIIGGRVVRGTKRPASGAYDLVEEMRFLFVRVVKARDLPDRDL  276

Query  584  TGSLDPYVE  610
            TGSLDPYVE
Sbjct  277  TGSLDPYVE  285



>ref|XP_009393442.1| PREDICTED: uncharacterized protein LOC103979123 [Musa acuminata 
subsp. malaccensis]
Length=1041

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 48/63 (76%), Gaps = 2/63 (3%)
 Frame = +2

Query  428  PQEDFMLKETKPHLGG--GKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLDP  601
            P  DF + ET P L G  G  +GDK+ STYDLVEQM+YLYV VVKARDLP  D+TGSLDP
Sbjct  269  PGPDFGIVETAPPLAGRLGYRSGDKIASTYDLVEQMRYLYVNVVKARDLPTMDLTGSLDP  328

Query  602  YVE  610
            YVE
Sbjct  329  YVE  331



>ref|XP_011078852.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Sesamum indicum]
Length=789

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 52/72 (72%), Gaps = 11/72 (15%)
 Frame = +2

Query  428  PQEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPP  574
            PQ+D+ +K+TKP LG           GG I+ D++TSTYDLVEQM YLYVRVVKARDLP 
Sbjct  6    PQDDYKIKDTKPQLGERWPHGGVRGGGGWISSDRVTSTYDLVEQMYYLYVRVVKARDLPT  65

Query  575  KDVTGSLDPYVE  610
              VTGS DPYVE
Sbjct  66   NPVTGSCDPYVE  77



>emb|CDY54062.1| BnaA02g36480D [Brassica napus]
Length=995

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 51/69 (74%), Gaps = 8/69 (12%)
 Frame = +2

Query  428  PQEDFMLKETKPHLGGGKITGDKL--------TSTYDLVEQMQYLYVRVVKARDLPPKDV  583
            P  DF +KET P LGGG+I G ++        +  YDLVE+M++L+VRVVKARDLP +D+
Sbjct  217  PPLDFSVKETSPFLGGGQIIGGRVVRGTKRPASGAYDLVEEMRFLFVRVVKARDLPDRDL  276

Query  584  TGSLDPYVE  610
            TGSLDPYVE
Sbjct  277  TGSLDPYVE  285



>ref|XP_007052573.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein [Theobroma cacao]
 gb|EOX96730.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein [Theobroma cacao]
Length=695

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 52/65 (80%), Gaps = 3/65 (5%)
 Frame = +2

Query  425  PPQE--DFMLKETKPHLGGGKITG-DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  595
            PP+E  DF LKETKP++GGG+++G  KLTS++DLVE+  +L+VRVVKARDLP  +   + 
Sbjct  2    PPEEEPDFSLKETKPNIGGGRVSGGAKLTSSFDLVEETHFLFVRVVKARDLPWNNARSTC  61

Query  596  DPYVE  610
            DP+VE
Sbjct  62   DPFVE  66



>ref|XP_009763246.1| PREDICTED: uncharacterized protein LOC104215187 [Nicotiana sylvestris]
 ref|XP_009763247.1| PREDICTED: uncharacterized protein LOC104215187 [Nicotiana sylvestris]
Length=785

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 51/71 (72%), Gaps = 11/71 (15%)
 Frame = +2

Query  431  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  577
            ++D+  KETKP LG           GG I+ D++TSTYDLVEQM +LYVRVVKARDLPP 
Sbjct  4    EDDYKAKETKPQLGERWPHGGFRGGGGWISSDRVTSTYDLVEQMHFLYVRVVKARDLPPN  63

Query  578  DVTGSLDPYVE  610
             VTGS DPYVE
Sbjct  64   PVTGSCDPYVE  74



>ref|XP_009611365.1| PREDICTED: uncharacterized protein LOC104104885 [Nicotiana tomentosiformis]
Length=785

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 51/71 (72%), Gaps = 11/71 (15%)
 Frame = +2

Query  431  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  577
            ++D+  KETKP LG           GG I+ D++TSTYDLVEQM +LYVRVVKARDLPP 
Sbjct  4    EDDYKAKETKPQLGERWPHGGFRGGGGWISSDRVTSTYDLVEQMHFLYVRVVKARDLPPN  63

Query  578  DVTGSLDPYVE  610
             VTGS DPYVE
Sbjct  64   PVTGSCDPYVE  74



>ref|XP_010930774.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Elaeis guineensis]
Length=1006

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
 Frame = +2

Query  410  HKMQRP-PQEDFMLKETKPHLGG--GKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKD  580
            H   RP P+ D++LKET+P +    G   G K+ STYDLVEQM+YLYV +VKAR+LP  D
Sbjct  215  HVEARPQPKSDYVLKETQPPVAARRGYRGGAKIASTYDLVEQMEYLYVNIVKARNLPAMD  274

Query  581  VTGSLDPYVE  610
            +TGS+DPYVE
Sbjct  275  ITGSVDPYVE  284



>gb|AFN53655.1| putative synaptotagmin protein [Linum usitatissimum]
Length=793

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 51/71 (72%), Gaps = 11/71 (15%)
 Frame = +2

Query  431  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  577
            +EDF LK+TKP LG           GG I+ ++ TSTYDLVEQM YLYVRVVKARDLPP 
Sbjct  10   KEDFKLKDTKPQLGERWPHGGSRGGGGWISSERATSTYDLVEQMFYLYVRVVKARDLPPN  69

Query  578  DVTGSLDPYVE  610
             V+GS DPYVE
Sbjct  70   PVSGSCDPYVE  80



>gb|KDO57729.1| hypothetical protein CISIN_1g003882mg [Citrus sinensis]
Length=789

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 49/71 (69%), Gaps = 11/71 (15%)
 Frame = +2

Query  431  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  577
            QED+ LK+TKP LG           GG I+ ++ TSTYDLVEQM YLYVRV KARDLP  
Sbjct  10   QEDYKLKDTKPQLGERWPHGGIRGAGGWISSERATSTYDLVEQMFYLYVRVEKARDLPTN  69

Query  578  DVTGSLDPYVE  610
             V+GS DPYVE
Sbjct  70   PVSGSCDPYVE  80



>ref|XP_006483676.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Citrus sinensis]
Length=1035

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 50/71 (70%), Gaps = 11/71 (15%)
 Frame = +2

Query  431  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  577
            QE++ LK+T P LG            G ++G++ TSTYDLVEQM YLYVRVVKA+DLPP 
Sbjct  250  QEEYNLKDTNPQLGERWLNGGGYGGRGWMSGERFTSTYDLVEQMSYLYVRVVKAKDLPPS  309

Query  578  DVTGSLDPYVE  610
             +TGS DPYVE
Sbjct  310  SITGSCDPYVE  320



>ref|XP_006439068.1| hypothetical protein CICLE_v10030600mg [Citrus clementina]
 gb|ESR52308.1| hypothetical protein CICLE_v10030600mg [Citrus clementina]
Length=1026

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 50/71 (70%), Gaps = 11/71 (15%)
 Frame = +2

Query  431  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  577
            QE++ LK+T P LG            G ++G++ TSTYDLVEQM YLYVRVVKA+DLPP 
Sbjct  241  QEEYNLKDTNPQLGERWPNGGGYGGRGWMSGERFTSTYDLVEQMSYLYVRVVKAKDLPPS  300

Query  578  DVTGSLDPYVE  610
             +TGS DPYVE
Sbjct  301  SITGSCDPYVE  311



>gb|KDO83484.1| hypothetical protein CISIN_1g001696mg [Citrus sinensis]
Length=1026

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 50/71 (70%), Gaps = 11/71 (15%)
 Frame = +2

Query  431  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  577
            QE++ LK+T P LG            G ++G++ TSTYDLVEQM YLYVRVVKA+DLPP 
Sbjct  241  QEEYNLKDTNPQLGERWPNGGGYGGRGWMSGERFTSTYDLVEQMSYLYVRVVKAKDLPPS  300

Query  578  DVTGSLDPYVE  610
             +TGS DPYVE
Sbjct  301  SITGSCDPYVE  311



>gb|AES80126.2| calcium-dependent lipid-binding (CaLB domain) family protein 
[Medicago truncatula]
Length=1013

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 49/65 (75%), Gaps = 8/65 (12%)
 Frame = +2

Query  437  DFMLKETKPHLGGGKITGDKL--------TSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            D+++KET P LGGGK+ G ++        +STYDLVE M YL++RVVKARDLP  D+TGS
Sbjct  235  DYVIKETNPSLGGGKVVGGRILRGSNNSPSSTYDLVEPMDYLFIRVVKARDLPRMDLTGS  294

Query  593  LDPYV  607
            LDPYV
Sbjct  295  LDPYV  299



>ref|XP_003623908.1| Extended synaptotagmin-2 [Medicago truncatula]
Length=1088

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 49/65 (75%), Gaps = 8/65 (12%)
 Frame = +2

Query  437  DFMLKETKPHLGGGKITGDKL--------TSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            D+++KET P LGGGK+ G ++        +STYDLVE M YL++RVVKARDLP  D+TGS
Sbjct  310  DYVIKETNPSLGGGKVVGGRILRGSNNSPSSTYDLVEPMDYLFIRVVKARDLPRMDLTGS  369

Query  593  LDPYV  607
            LDPYV
Sbjct  370  LDPYV  374



>gb|EMT11702.1| hypothetical protein F775_07618 [Aegilops tauschii]
Length=773

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +2

Query  422  RPPQ---EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            +PPQ   ED+ LKE  P LGG    GDK TSTYDLVEQM YLYVR VKA+DL  KD +GS
Sbjct  2    QPPQPRPEDYTLKEITPRLGGFMAAGDKRTSTYDLVEQMPYLYVRAVKAKDLHAKDGSGS  61

Query  593  LDPYVE  610
             DP VE
Sbjct  62   CDPSVE  67



>gb|ABD33426.2| C2 [Medicago truncatula]
Length=1076

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 49/65 (75%), Gaps = 8/65 (12%)
 Frame = +2

Query  437  DFMLKETKPHLGGGKITGDKL--------TSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            D+++KET P LGGGK+ G ++        +STYDLVE M YL++RVVKARDLP  D+TGS
Sbjct  298  DYVIKETNPSLGGGKVVGGRILRGSNNSPSSTYDLVEPMDYLFIRVVKARDLPRMDLTGS  357

Query  593  LDPYV  607
            LDPYV
Sbjct  358  LDPYV  362



>gb|KFK44354.1| hypothetical protein AALP_AA1G246600 [Arabis alpina]
Length=1000

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 51/76 (67%), Gaps = 10/76 (13%)
 Frame = +2

Query  413  KMQRPPQE---DFMLKETKPHLGGG-------KITGDKLTSTYDLVEQMQYLYVRVVKAR  562
            +MQ PPQ    +F L ET P L          + +GDK +STYDLVEQM YLYV VVKAR
Sbjct  216  QMQVPPQRQNPEFQLIETSPPLAARMRQSYYYRSSGDKTSSTYDLVEQMHYLYVNVVKAR  275

Query  563  DLPPKDVTGSLDPYVE  610
            DLP  DV+GSLDPYVE
Sbjct  276  DLPVMDVSGSLDPYVE  291



>ref|XP_004497937.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Cicer arietinum]
Length=798

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 53/77 (69%), Gaps = 11/77 (14%)
 Frame = +2

Query  413  KMQRPPQEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKA  559
            K  +P Q+D+ LK+TKP LG            G I  ++ TSTYDLVEQM YLYVRVVKA
Sbjct  6    KDSKPNQDDYKLKDTKPELGEKWPHGGQRGGTGWIYTERATSTYDLVEQMFYLYVRVVKA  65

Query  560  RDLPPKDVTGSLDPYVE  610
            ++LPP  VTG++DPYVE
Sbjct  66   KELPPNPVTGNVDPYVE  82



>ref|XP_004309445.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Fragaria vesca subsp. vesca]
Length=796

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 51/72 (71%), Gaps = 11/72 (15%)
 Frame = +2

Query  428  PQEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPP  574
            PQED+ LK+TKP LG           GG I+ ++ TSTYDLVEQM YLYVRVVKA+DLP 
Sbjct  9    PQEDYKLKDTKPQLGERWPHGGVRGGGGWISNERATSTYDLVEQMFYLYVRVVKAKDLPT  68

Query  575  KDVTGSLDPYVE  610
              VTGS DPYVE
Sbjct  69   NPVTGSCDPYVE  80



>ref|XP_010104492.1| Multiple C2 and transmembrane domain-containing protein 2 [Morus 
notabilis]
 gb|EXC01093.1| Multiple C2 and transmembrane domain-containing protein 2 [Morus 
notabilis]
Length=1024

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 49/67 (73%), Gaps = 3/67 (4%)
 Frame = +2

Query  413  KMQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  589
            +MQ P Q  +F L ET+P +   +  GDK  STYDLVEQM YLYV VVKARDLP  D++G
Sbjct  252  RMQVPSQNPEFALVETRPPVAARR--GDKTASTYDLVEQMHYLYVSVVKARDLPVMDISG  309

Query  590  SLDPYVE  610
            SLDPYVE
Sbjct  310  SLDPYVE  316



>gb|KJB25055.1| hypothetical protein B456_004G174500 [Gossypium raimondii]
Length=805

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 48/72 (67%), Gaps = 12/72 (17%)
 Frame = +2

Query  431  QEDFMLKETKPHLG------------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPP  574
            QED+ LK+T P LG            G    GD+ TSTYDLVEQM YLYVRVVKA++LPP
Sbjct  20   QEDYNLKDTSPQLGERWPNGGTFGGRGWMNGGDRFTSTYDLVEQMFYLYVRVVKAKELPP  79

Query  575  KDVTGSLDPYVE  610
              +TGS DPYVE
Sbjct  80   SSLTGSCDPYVE  91



>ref|XP_006850085.1| hypothetical protein AMTR_s00022p00218970 [Amborella trichopoda]
 gb|ERN11666.1| hypothetical protein AMTR_s00022p00218970 [Amborella trichopoda]
Length=1036

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 48/75 (64%), Gaps = 7/75 (9%)
 Frame = +2

Query  404  NNHKMQRPP------QEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARD  565
            NN++   PP        DF LK T PHLG G  +  +  STYDLVEQM YLYVRVVKA+D
Sbjct  253  NNYQNIVPPPPGTHHHGDFGLKNTSPHLGTG-WSNREFASTYDLVEQMHYLYVRVVKAKD  311

Query  566  LPPKDVTGSLDPYVE  610
            LP   VTGS DPY E
Sbjct  312  LPASSVTGSCDPYAE  326



>ref|XP_006437049.1| hypothetical protein CICLE_v10033973mg [Citrus clementina]
 ref|XP_006485020.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Citrus sinensis]
 gb|ESR50289.1| hypothetical protein CICLE_v10033973mg [Citrus clementina]
Length=789

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 49/71 (69%), Gaps = 11/71 (15%)
 Frame = +2

Query  431  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  577
            QED+ LK+TKP LG           GG I+ ++ TSTYDLVEQM YLYVRV KARDLP  
Sbjct  10   QEDYKLKDTKPQLGERWPHGGIRGAGGWISSERATSTYDLVEQMFYLYVRVEKARDLPTN  69

Query  578  DVTGSLDPYVE  610
             ++GS DPYVE
Sbjct  70   PMSGSCDPYVE  80



>emb|CDX81021.1| BnaC03g02750D [Brassica napus]
Length=287

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 48/71 (68%), Gaps = 11/71 (15%)
 Frame = +2

Query  431  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  577
            QED+ LK+ KP LG            G I+ +++ STYDLVEQM YLYVRVVKA+DLPP 
Sbjct  9    QEDYKLKDMKPDLGEKWPHGGQRGGSGWISSERVASTYDLVEQMFYLYVRVVKAKDLPPN  68

Query  578  DVTGSLDPYVE  610
             VT + DPYVE
Sbjct  69   PVTSNCDPYVE  79



>ref|XP_003518076.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Glycine max]
 gb|KHM98983.1| Multiple C2 and transmembrane domain-containing protein 1 [Glycine 
soja]
Length=796

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 49/71 (69%), Gaps = 11/71 (15%)
 Frame = +2

Query  431  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  577
            QED+ LK+TKP LG            G I  ++ TSTYDLVEQM YLYVRVVKA+DLPP 
Sbjct  12   QEDYKLKDTKPELGEKWPHGGQRGGSGWIYNERATSTYDLVEQMFYLYVRVVKAKDLPPN  71

Query  578  DVTGSLDPYVE  610
             VT ++DPYVE
Sbjct  72   PVTSNVDPYVE  82



>ref|XP_011080250.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Sesamum indicum]
Length=770

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 50/68 (74%), Gaps = 3/68 (4%)
 Frame = +2

Query  416  MQR-PPQEDFMLKETKPHLGGGK--ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVT  586
            MQ+ P  E+F LK+T P + G    I GDK+   YDLVEQM+Y YVRVV+A++LP KDVT
Sbjct  1    MQKFPVPEEFALKQTAPKIAGSGVIIGGDKVVCAYDLVEQMEYFYVRVVRAKELPGKDVT  60

Query  587  GSLDPYVE  610
            G+ DPYVE
Sbjct  61   GTCDPYVE  68



>gb|EYU20710.1| hypothetical protein MIMGU_mgv1a023485mg [Erythranthe guttata]
Length=785

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 51/72 (71%), Gaps = 11/72 (15%)
 Frame = +2

Query  428  PQEDFMLKETKPHLG-----GGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPP  574
            PQ+D+ +KETKP LG     GG   G      +++TSTYDLVEQM YLYVRVVKA+DLP 
Sbjct  3    PQDDYKIKETKPQLGERWPHGGARGGLWWTGSERITSTYDLVEQMYYLYVRVVKAKDLPT  62

Query  575  KDVTGSLDPYVE  610
              V+GS DPYVE
Sbjct  63   NPVSGSCDPYVE  74



>ref|XP_008231335.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoform X2 [Prunus mume]
Length=1054

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 52/71 (73%), Gaps = 11/71 (15%)
 Frame = +2

Query  431  QEDFMLKETKPHLG---------GGK--ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  577
            Q+D+ LK+T P LG         GG+  ++G++ TSTYDLVEQM YL+VRVVKA++LPP 
Sbjct  267  QDDYELKDTNPQLGERWPNGGAHGGRGWMSGERFTSTYDLVEQMFYLFVRVVKAKELPPS  326

Query  578  DVTGSLDPYVE  610
             +TGS DPYVE
Sbjct  327  SITGSCDPYVE  337



>ref|XP_008231338.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoform X4 [Prunus mume]
Length=1029

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 52/71 (73%), Gaps = 11/71 (15%)
 Frame = +2

Query  431  QEDFMLKETKPHLG---------GGK--ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  577
            Q+D+ LK+T P LG         GG+  ++G++ TSTYDLVEQM YL+VRVVKA++LPP 
Sbjct  242  QDDYELKDTNPQLGERWPNGGAHGGRGWMSGERFTSTYDLVEQMFYLFVRVVKAKELPPS  301

Query  578  DVTGSLDPYVE  610
             +TGS DPYVE
Sbjct  302  SITGSCDPYVE  312



>ref|XP_007220593.1| hypothetical protein PRUPE_ppa000616mg [Prunus persica]
 gb|EMJ21792.1| hypothetical protein PRUPE_ppa000616mg [Prunus persica]
Length=1070

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 52/71 (73%), Gaps = 11/71 (15%)
 Frame = +2

Query  431  QEDFMLKETKPHLG---------GGK--ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  577
            Q+++ LK+T P LG         GG+  ++G++ TSTYDLVEQM YL+VRVVKA+DLPP 
Sbjct  283  QDEYELKDTNPQLGERWPNGGAHGGRGWMSGERFTSTYDLVEQMFYLFVRVVKAKDLPPS  342

Query  578  DVTGSLDPYVE  610
             +TGS DPYVE
Sbjct  343  SITGSCDPYVE  353



>ref|XP_008231337.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoform X3 [Prunus mume]
Length=1047

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 52/71 (73%), Gaps = 11/71 (15%)
 Frame = +2

Query  431  QEDFMLKETKPHLG---------GGK--ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  577
            Q+D+ LK+T P LG         GG+  ++G++ TSTYDLVEQM YL+VRVVKA++LPP 
Sbjct  260  QDDYELKDTNPQLGERWPNGGAHGGRGWMSGERFTSTYDLVEQMFYLFVRVVKAKELPPS  319

Query  578  DVTGSLDPYVE  610
             +TGS DPYVE
Sbjct  320  SITGSCDPYVE  330



>ref|XP_010273065.1| PREDICTED: uncharacterized protein LOC104608707 [Nelumbo nucifera]
Length=1009

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 52/64 (81%), Gaps = 6/64 (9%)
 Frame = +2

Query  437  DFMLKETKPHLGGGK------ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  598
            D+ LKET P LGGG+      I  DKL+STYDLVE+MQ+L+VRVVKAR+LP KD+TGSLD
Sbjct  236  DYALKETSPFLGGGQVVGGRVIRVDKLSSTYDLVEKMQFLFVRVVKARELPAKDITGSLD  295

Query  599  PYVE  610
            PYVE
Sbjct  296  PYVE  299



>ref|XP_009362439.1| PREDICTED: uncharacterized protein LOC103952559 [Pyrus x bretschneideri]
Length=1055

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 50/74 (68%), Gaps = 7/74 (9%)
 Frame = +2

Query  410  HKMQRPPQED--FMLKETKPHLG-----GGKITGDKLTSTYDLVEQMQYLYVRVVKARDL  568
            H  Q+ P+++  F L ET P L      G    GDK +STYDLVEQM +LYV VVKARDL
Sbjct  272  HMQQQAPRQNPEFALVETSPPLAARRYRGFGFGGDKTSSTYDLVEQMHFLYVSVVKARDL  331

Query  569  PPKDVTGSLDPYVE  610
            P  DVTGSLDPYVE
Sbjct  332  PAMDVTGSLDPYVE  345



>ref|XP_008231334.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoform X1 [Prunus mume]
Length=1070

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 52/71 (73%), Gaps = 11/71 (15%)
 Frame = +2

Query  431  QEDFMLKETKPHLG---------GGK--ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  577
            Q+D+ LK+T P LG         GG+  ++G++ TSTYDLVEQM YL+VRVVKA++LPP 
Sbjct  283  QDDYELKDTNPQLGERWPNGGAHGGRGWMSGERFTSTYDLVEQMFYLFVRVVKAKELPPS  342

Query  578  DVTGSLDPYVE  610
             +TGS DPYVE
Sbjct  343  SITGSCDPYVE  353



>ref|XP_007145658.1| hypothetical protein PHAVU_007G257600g [Phaseolus vulgaris]
 gb|ESW17652.1| hypothetical protein PHAVU_007G257600g [Phaseolus vulgaris]
Length=796

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 49/71 (69%), Gaps = 11/71 (15%)
 Frame = +2

Query  431  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  577
            QED+ LK+TKP LG            G +  ++ TSTYDLVEQM YLYVRVVKA+DLPP 
Sbjct  11   QEDYKLKDTKPDLGERWPHGGQRGGSGWLYSERATSTYDLVEQMFYLYVRVVKAKDLPPN  70

Query  578  DVTGSLDPYVE  610
             VT +LDPYVE
Sbjct  71   PVTSNLDPYVE  81



>gb|KDP43429.1| hypothetical protein JCGZ_16716 [Jatropha curcas]
Length=1030

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 48/71 (68%), Gaps = 11/71 (15%)
 Frame = +2

Query  431  QEDFMLKETKPHLG-----GGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPK  577
            Q+D+ LK+T P LG     GG   G      ++  STYDLVEQM YLYVRVVKA+DLPP 
Sbjct  245  QDDYSLKDTNPQLGERWPAGGAFGGRGWMNSERYASTYDLVEQMSYLYVRVVKAKDLPPS  304

Query  578  DVTGSLDPYVE  610
             +TGS DPYVE
Sbjct  305  SITGSCDPYVE  315



>ref|XP_008383982.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Malus domestica]
Length=1011

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 50/64 (78%), Gaps = 6/64 (9%)
 Frame = +2

Query  437  DFMLKETKPHLGGGK------ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  598
            DF LKET P+LGGG+      I GDK  STYDLVE+M +LYVRVVKAR+LP  DVTGSLD
Sbjct  238  DFALKETSPYLGGGRVVGGRVIHGDKTASTYDLVERMYFLYVRVVKARELPAMDVTGSLD  297

Query  599  PYVE  610
            PYVE
Sbjct  298  PYVE  301



>ref|XP_008368132.1| PREDICTED: LOW QUALITY PROTEIN: multiple C2 and transmembrane 
domain-containing protein 1-like [Malus domestica]
Length=1044

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 50/74 (68%), Gaps = 7/74 (9%)
 Frame = +2

Query  410  HKMQRPPQED--FMLKETKPHLG-----GGKITGDKLTSTYDLVEQMQYLYVRVVKARDL  568
            H  Q+ P+++  F L ET P L      G    GDK +STYDLVEQM +LYV VVKARDL
Sbjct  270  HMQQQAPRQNPEFALVETSPPLAARRYRGFGFGGDKTSSTYDLVEQMHFLYVSVVKARDL  329

Query  569  PPKDVTGSLDPYVE  610
            P  DVTGSLDPYVE
Sbjct  330  PTMDVTGSLDPYVE  343



>gb|EPS70383.1| hypothetical protein M569_04376, partial [Genlisea aurea]
Length=780

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 47/70 (67%), Gaps = 12/70 (17%)
 Frame = +2

Query  437  DFMLKETKPHLG-----------GGKI-TGDKLTSTYDLVEQMQYLYVRVVKARDLPPKD  580
            D+ +K+TKP LG            G I  GD+ TSTYDLVEQM YLYVRVVKARDLPP  
Sbjct  1    DYSVKDTKPELGEKWPHGGIRGGAGWIPVGDRATSTYDLVEQMHYLYVRVVKARDLPPSP  60

Query  581  VTGSLDPYVE  610
            VTGS DPY E
Sbjct  61   VTGSCDPYAE  70



>ref|XP_003537180.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Glycine max]
Length=797

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 49/71 (69%), Gaps = 11/71 (15%)
 Frame = +2

Query  431  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  577
            QED+ LK+TKP LG            G I  ++ TSTYD+VEQM YLYVRVVKA+DLPP 
Sbjct  12   QEDYKLKDTKPELGEKWPHGGQRGGSGWIYSERATSTYDMVEQMFYLYVRVVKAKDLPPN  71

Query  578  DVTGSLDPYVE  610
             VT ++DPYVE
Sbjct  72   PVTSNVDPYVE  82



>ref|XP_009339918.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Pyrus x bretschneideri]
Length=1011

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 50/64 (78%), Gaps = 6/64 (9%)
 Frame = +2

Query  437  DFMLKETKPHLGGGK------ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  598
            DF LKET P+LGGG+      I GDK  STYDLVE+M +LYVRVVKAR+LP  DVTGSLD
Sbjct  238  DFALKETSPYLGGGRVVGGRVIHGDKTASTYDLVERMYFLYVRVVKARELPAMDVTGSLD  297

Query  599  PYVE  610
            PYVE
Sbjct  298  PYVE  301



>gb|EYU46304.1| hypothetical protein MIMGU_mgv1a001691mg [Erythranthe guttata]
Length=772

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 52/68 (76%), Gaps = 3/68 (4%)
 Frame = +2

Query  416  MQR-PPQEDFMLKETKPHLGG-GKITG-DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVT  586
            MQ+ P  E+F LK+T P + G G ITG DK+   YDLVEQM+YLYVRVVKA++LP KD+T
Sbjct  1    MQKYPVPEEFALKQTAPKIAGSGVITGGDKVNCAYDLVEQMEYLYVRVVKAKELPVKDIT  60

Query  587  GSLDPYVE  610
            G+  PYVE
Sbjct  61   GTCHPYVE  68



>gb|KHN15528.1| Multiple C2 and transmembrane domain-containing protein 1 [Glycine 
soja]
Length=797

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 49/71 (69%), Gaps = 11/71 (15%)
 Frame = +2

Query  431  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  577
            QED+ LK+TKP LG            G I  ++ TSTYD+VEQM YLYVRVVKA+DLPP 
Sbjct  12   QEDYKLKDTKPELGEKWPHGGQRGGSGWIYSERATSTYDMVEQMFYLYVRVVKAKDLPPN  71

Query  578  DVTGSLDPYVE  610
             VT ++DPYVE
Sbjct  72   PVTSNVDPYVE  82



>ref|XP_011035993.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Populus euphratica]
 ref|XP_011036001.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Populus euphratica]
Length=1004

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 51/64 (80%), Gaps = 6/64 (9%)
 Frame = +2

Query  437  DFMLKETKPHLGGGK------ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  598
            D+ LKET P LGGG+      I GD+ +S+YDLVEQM+YLYVRVVKARDLP  DVTGSLD
Sbjct  232  DYALKETSPFLGGGQVVGGRVIRGDRPSSSYDLVEQMKYLYVRVVKARDLPTMDVTGSLD  291

Query  599  PYVE  610
            PYVE
Sbjct  292  PYVE  295



>ref|XP_008781559.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Phoenix dactylifera]
Length=997

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 52/69 (75%), Gaps = 4/69 (6%)
 Frame = +2

Query  416  MQRPPQE--DFMLKETKPHLGG--GKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDV  583
            M+ PPQ   D+ LKET+P +    G   G K+T+TYDLVEQM+YLYV +VKAR+LP  D+
Sbjct  210  MEAPPQPKPDYGLKETQPPVAARTGYRGGTKITTTYDLVEQMEYLYVNIVKARNLPAMDI  269

Query  584  TGSLDPYVE  610
            TGS+DPYVE
Sbjct  270  TGSVDPYVE  278



>ref|XP_009588959.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana tomentosiformis]
Length=768

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 52/68 (76%), Gaps = 4/68 (6%)
 Frame = +2

Query  416  MQRPP-QEDFMLKETKPHLGGG--KITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVT  586
            MQ+ P QE+F LK+T P + G    I GDK+T  YDLVEQM+YLYVRVVKA++L  KDVT
Sbjct  1    MQKGPIQEEFALKQTAPKIVGSGVMIGGDKVTVAYDLVEQMEYLYVRVVKAKEL-TKDVT  59

Query  587  GSLDPYVE  610
            GS DPYVE
Sbjct  60   GSCDPYVE  67



>ref|XP_008350856.1| PREDICTED: LOW QUALITY PROTEIN: multiple C2 and transmembrane 
domain-containing protein 2 [Malus domestica]
Length=1029

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 48/72 (67%), Gaps = 12/72 (17%)
 Frame = +2

Query  431  QEDFMLKETKPHLG------------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPP  574
            Q+D+ LK+T P LG            G    G++ TSTYDLVEQM YLYVRVVKA+DLPP
Sbjct  241  QDDYDLKDTSPQLGERWPNGGEYGGRGWMSGGERFTSTYDLVEQMFYLYVRVVKAKDLPP  300

Query  575  KDVTGSLDPYVE  610
              +TGS DPYVE
Sbjct  301  SSITGSCDPYVE  312



>gb|KHN49030.1| Putative Ras GTPase-activating protein 4B [Glycine soja]
Length=796

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 47/67 (70%), Gaps = 8/67 (12%)
 Frame = +2

Query  434  EDFMLKETKPHLGG--------GKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  589
            ED+ L+ET P LGG        G I G++ +STYDLVEQM YLYVRVVKA+DL P  +T 
Sbjct  15   EDYNLRETDPQLGGDRWPNARRGWIGGERFSSTYDLVEQMFYLYVRVVKAKDLSPSTLTS  74

Query  590  SLDPYVE  610
            S DPYVE
Sbjct  75   SCDPYVE  81



>ref|XP_006598248.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Glycine max]
Length=810

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 47/67 (70%), Gaps = 8/67 (12%)
 Frame = +2

Query  434  EDFMLKETKPHLGG--------GKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  589
            ED+ L+ET P LGG        G I G++ +STYDLVEQM YLYVRVVKA+DL P  +T 
Sbjct  29   EDYNLRETDPQLGGDRWPNARRGWIGGERFSSTYDLVEQMFYLYVRVVKAKDLSPSTLTS  88

Query  590  SLDPYVE  610
            S DPYVE
Sbjct  89   SCDPYVE  95



>ref|XP_007204276.1| hypothetical protein PRUPE_ppa001596mg [Prunus persica]
 gb|EMJ05475.1| hypothetical protein PRUPE_ppa001596mg [Prunus persica]
Length=795

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 50/72 (69%), Gaps = 11/72 (15%)
 Frame = +2

Query  425  PPQEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLP  571
            P QED+ LK+TKPHLG           GG I+ ++ TSTYDLVEQM YLYVRVVKA+DLP
Sbjct  7    PNQEDYKLKDTKPHLGERWPHGGIRGGGGWISSERATSTYDLVEQMFYLYVRVVKAKDLP  66

Query  572  PKDVTGSLDPYV  607
               VTG  DPYV
Sbjct  67   TNPVTGICDPYV  78



>ref|XP_008378754.1| PREDICTED: uncharacterized protein LOC103441820 [Malus domestica]
Length=1036

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 48/70 (69%), Gaps = 5/70 (7%)
 Frame = +2

Query  410  HKMQRPPQEDFMLKETKPHLGGGK---ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKD  580
            H  Q+ P+  F L ET P L   +     GDK +STYDLVEQM YLYV VVKARDLP  D
Sbjct  260  HMQQQNPE--FSLVETDPPLAARRYRGFGGDKTSSTYDLVEQMHYLYVSVVKARDLPTMD  317

Query  581  VTGSLDPYVE  610
            VTGSLDPYVE
Sbjct  318  VTGSLDPYVE  327



>ref|XP_010928529.1| PREDICTED: LOW QUALITY PROTEIN: multiple C2 and transmembrane 
domain-containing protein 1 [Elaeis guineensis]
Length=1012

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 46/66 (70%), Gaps = 7/66 (11%)
 Frame = +2

Query  434  EDFMLKETKPHLG-------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  592
            E++ LK+T P LG        GK  GDK TSTYDLVEQM YLYVRVVKA+DLP   +TGS
Sbjct  234  EEYKLKDTSPQLGERWPAGAHGKGDGDKFTSTYDLVEQMYYLYVRVVKAKDLPTNAITGS  293

Query  593  LDPYVE  610
             DPY E
Sbjct  294  CDPYAE  299



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 829366762230