BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS085D06

Length=611
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009592686.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    137   4e-51   Nicotiana tomentosiformis
ref|XP_009592687.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    137   7e-51   Nicotiana tomentosiformis
gb|AIM41271.1|  chloroplast ATP-dependent Clp protease chaperone ...    137   6e-50   Nicotiana benthamiana
gb|AIM41270.1|  chloroplast ATP-dependent Clp protease chaperone ...    137   6e-50   Nicotiana benthamiana
ref|XP_009615664.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    137   1e-49   Nicotiana tomentosiformis
ref|XP_009769540.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    137   2e-49   Nicotiana sylvestris
ref|XP_009798134.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    137   2e-49   Nicotiana sylvestris
gb|AIM41268.1|  chloroplast ATP-dependent Clp protease chaperone ...    137   5e-49   Nicotiana benthamiana
ref|XP_006346636.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    137   2e-48   Solanum tuberosum [potatoes]
ref|XP_004252280.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    137   2e-48   
sp|P31542.1|CLPAB_SOLLC  RecName: Full=ATP-dependent Clp protease...    137   4e-48   Solanum lycopersicum
ref|XP_004297496.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    137   1e-46   Fragaria vesca subsp. vesca
gb|ADN33858.1|  ATP-dependent clp protease                              137   2e-46   Cucumis melo subsp. melo
ref|XP_008464372.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    137   2e-46   Cucumis melo [Oriental melon]
gb|AIM41269.1|  chloroplast ATP-dependent Clp protease chaperone ...    127   5e-46   Nicotiana benthamiana
ref|XP_007210385.1|  hypothetical protein PRUPE_ppa001062mg             137   1e-45   Prunus persica
emb|CBI15747.3|  unnamed protein product                                137   2e-45   Vitis vinifera
ref|XP_004171086.1|  PREDICTED: chaperone protein ClpC, chloropla...    137   2e-45   
ref|XP_004138021.1|  PREDICTED: chaperone protein ClpC, chloropla...    137   2e-45   
ref|XP_008239551.1|  PREDICTED: chaperone protein ClpC, chloropla...    137   5e-45   Prunus mume [ume]
emb|CDO98310.1|  unnamed protein product                                137   8e-45   Coffea canephora [robusta coffee]
ref|XP_010099042.1|  Chaperone protein ClpC                             137   9e-45   
ref|XP_008457503.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    135   3e-44   Cucumis melo [Oriental melon]
ref|XP_004235839.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    137   4e-44   
ref|XP_010663794.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    137   4e-44   Vitis vinifera
sp|P31541.1|CLPAA_SOLLC  RecName: Full=ATP-dependent Clp protease...    137   4e-44   Solanum lycopersicum
ref|XP_004152900.1|  PREDICTED: chaperone protein ClpC, chloropla...    135   5e-44   Cucumis sativus [cucumbers]
ref|XP_006341485.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    137   6e-44   Solanum tuberosum [potatoes]
gb|KDP22549.1|  hypothetical protein JCGZ_26380                         137   2e-43   Jatropha curcas
gb|KHG07735.1|  Chaperone ClpC, chloroplastic                           137   4e-43   Gossypium arboreum [tree cotton]
gb|KJB19710.1|  hypothetical protein B456_003G116200                    137   1e-42   Gossypium raimondii
gb|KJB19712.1|  hypothetical protein B456_003G116200                    137   1e-42   Gossypium raimondii
ref|XP_007038115.1|  CLPC                                               137   2e-42   
gb|KJB19711.1|  hypothetical protein B456_003G116200                    137   2e-42   Gossypium raimondii
ref|XP_002511102.1|  ATP-dependent clp protease, putative               137   2e-42   Ricinus communis
gb|AAD02267.1|  ClpC protease                                           137   7e-42   Spinacia oleracea
ref|XP_010678345.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    137   2e-41   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB07945.1|  hypothetical protein B456_001G054700                    137   2e-41   Gossypium raimondii
gb|KEH35688.1|  ATP-dependent Clp protease ATP-binding subunit          137   3e-41   Medicago truncatula
ref|XP_004501745.1|  PREDICTED: chaperone protein ClpC, chloropla...    137   6e-41   Cicer arietinum [garbanzo]
ref|XP_006367832.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    123   6e-41   Solanum tuberosum [potatoes]
ref|XP_010036862.1|  PREDICTED: chaperone protein ClpC, chloropla...    137   8e-41   Eucalyptus grandis [rose gum]
ref|XP_010036860.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    137   9e-41   Eucalyptus grandis [rose gum]
ref|XP_003630582.1|  ATP-dependent Clp protease ATP-binding subun...    137   2e-40   Medicago truncatula
gb|EPS63111.1|  hypothetical protein M569_11677                         138   3e-40   Genlisea aurea
ref|XP_011083076.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    124   3e-40   
ref|XP_007159971.1|  hypothetical protein PHAVU_002G282500g             137   4e-40   Phaseolus vulgaris [French bean]
ref|XP_010249192.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    137   4e-40   Nelumbo nucifera [Indian lotus]
gb|KCW48520.1|  hypothetical protein EUGRSUZ_K02198                     137   5e-40   Eucalyptus grandis [rose gum]
sp|P35100.1|CLPC_PEA  RecName: Full=Chaperone protein ClpC, chlor...    137   7e-40   Pisum sativum [garden pea]
ref|XP_003526929.1|  PREDICTED: chaperone protein ClpC, chloropla...    137   1e-39   Glycine max [soybeans]
ref|XP_002322299.1|  ATP-dependent clp protease ATP-binding subun...    137   1e-39   
gb|EYU24516.1|  hypothetical protein MIMGU_mgv1a0010411mg               138   1e-39   Erythranthe guttata [common monkey flower]
gb|KEH35794.1|  ATP-dependent Clp protease ATP-binding subunit          135   2e-39   Medicago truncatula
ref|XP_010250552.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    137   3e-39   Nelumbo nucifera [Indian lotus]
ref|XP_003523172.1|  PREDICTED: chaperone protein ClpC, chloropla...    137   3e-39   Glycine max [soybeans]
gb|KHN31263.1|  Chaperone protein ClpC, chloroplastic                   137   3e-39   Glycine soja [wild soybean]
ref|XP_009368798.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    137   3e-39   Pyrus x bretschneideri [bai li]
ref|XP_008374277.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    137   3e-39   
ref|XP_003525431.1|  PREDICTED: chaperone protein ClpC, chloropla...    137   4e-39   Glycine max [soybeans]
ref|XP_009337515.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    137   4e-39   Pyrus x bretschneideri [bai li]
ref|XP_011042955.1|  PREDICTED: chaperone protein ClpC, chloropla...    137   5e-39   Populus euphratica
ref|XP_006376920.1|  hypothetical protein POPTR_0012s10770g             137   6e-39   
ref|XP_010250553.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    137   7e-39   Nelumbo nucifera [Indian lotus]
ref|XP_010519480.1|  PREDICTED: chaperone protein ClpC1, chloropl...    137   1e-38   Tarenaya hassleriana [spider flower]
ref|XP_007137864.1|  hypothetical protein PHAVU_009G162100g             137   2e-38   Phaseolus vulgaris [French bean]
ref|XP_010942381.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    137   3e-38   Elaeis guineensis
ref|XP_008392716.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    137   3e-38   Malus domestica [apple tree]
ref|XP_006402040.1|  hypothetical protein EUTSA_v10012603mg             137   8e-38   Eutrema salsugineum [saltwater cress]
ref|XP_011040255.1|  PREDICTED: chaperone protein ClpC, chloropla...    137   1e-37   Populus euphratica
ref|NP_568746.1|  ATP-dependent Clp protease ATP-binding subunit ...    137   1e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004503801.1|  PREDICTED: chaperone protein ClpC, chloropla...    137   2e-37   Cicer arietinum [garbanzo]
ref|XP_001690745.1|  hypothetical protein CHLREDRAFT_110360             136   4e-37   Chlamydomonas reinhardtii
ref|XP_002865831.1|  heat shock protein 93-V                            137   4e-37   
gb|EYU21822.1|  hypothetical protein MIMGU_mgv1a000973mg                135   5e-37   Erythranthe guttata [common monkey flower]
gb|KHN16879.1|  Chaperone protein ClpC, chloroplastic                   134   5e-37   Glycine soja [wild soybean]
ref|XP_003532383.1|  PREDICTED: chaperone protein ClpC, chloropla...    134   5e-37   Glycine max [soybeans]
ref|XP_009151567.1|  PREDICTED: chaperone protein ClpC2, chloropl...    137   7e-37   Brassica rapa
emb|CDX83052.1|  BnaA01g20520D                                          137   8e-37   
ref|XP_011073186.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    137   1e-36   Sesamum indicum [beniseed]
tpg|DAA38057.1|  TPA: hypothetical protein ZEAMMB73_563254              137   1e-36   
ref|XP_008778670.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    137   1e-36   Phoenix dactylifera
ref|XP_006279971.1|  hypothetical protein CARUB_v10025837mg             137   2e-36   Capsella rubella
ref|XP_008791045.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    137   2e-36   Phoenix dactylifera
emb|CDX68504.1|  BnaC01g25820D                                          135   2e-36   
gb|AAC04687.1|  ClpC                                                    137   2e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010536587.1|  PREDICTED: chaperone protein ClpC1, chloropl...    137   3e-36   Tarenaya hassleriana [spider flower]
ref|XP_010536586.1|  PREDICTED: chaperone protein ClpC1, chloropl...    137   3e-36   Tarenaya hassleriana [spider flower]
ref|XP_010482409.1|  PREDICTED: chaperone protein ClpC1, chloropl...    137   3e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010442575.1|  PREDICTED: chaperone protein ClpC1, chloropl...    137   3e-36   Camelina sativa [gold-of-pleasure]
ref|WP_032554674.1|  hypothetical protein                               133   4e-36   
ref|XP_010555578.1|  PREDICTED: chaperone protein ClpC1, chloropl...    137   4e-36   Tarenaya hassleriana [spider flower]
ref|WP_032558761.1|  hypothetical protein                               133   4e-36   
ref|XP_010550758.1|  PREDICTED: chaperone protein ClpC1, chloropl...    128   5e-36   Tarenaya hassleriana [spider flower]
ref|XP_002877635.1|  AtClpC                                             135   5e-36   
ref|XP_006485108.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    137   6e-36   Citrus sinensis [apfelsine]
ref|XP_010442573.1|  PREDICTED: chaperone protein ClpC1, chloropl...    137   6e-36   
ref|WP_032553896.1|  hypothetical protein                               133   6e-36   
ref|XP_010426385.1|  PREDICTED: chaperone protein ClpC2, chloropl...    135   1e-35   Camelina sativa [gold-of-pleasure]
gb|EMS48250.1|  ATP-dependent Clp protease ATP-binding subunit cl...    136   1e-35   Triticum urartu
gb|KIY94281.1|  ATP-dependent Clp protease ATP-binding subunit ClpC     137   3e-35   Monoraphidium neglectum
ref|XP_009149790.1|  PREDICTED: LOW QUALITY PROTEIN: chaperone pr...    135   4e-35   
ref|XP_006290259.1|  hypothetical protein CARUB_v10016640mg             135   4e-35   
gb|EMS54417.1|  ATP-dependent Clp protease ATP-binding subunit cl...    137   5e-35   Triticum urartu
ref|XP_006290258.1|  hypothetical protein CARUB_v10016640mg             135   6e-35   
ref|XP_010503529.1|  PREDICTED: chaperone protein ClpC2, chloropl...    135   6e-35   Camelina sativa [gold-of-pleasure]
ref|XP_009132682.1|  PREDICTED: chaperone protein ClpC1, chloropl...    137   7e-35   Brassica rapa
emb|CDY45800.1|  BnaC03g16230D                                          137   7e-35   Brassica napus [oilseed rape]
ref|XP_010929657.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    137   7e-35   Elaeis guineensis
ref|XP_008811697.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    133   7e-35   Phoenix dactylifera
ref|XP_010515218.1|  PREDICTED: chaperone protein ClpC2, chloropl...    135   1e-34   Camelina sativa [gold-of-pleasure]
ref|XP_009403788.1|  PREDICTED: chaperone protein ClpC1, chloropl...    137   2e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009393873.1|  PREDICTED: chaperone protein ClpC1, chloropl...    137   2e-34   Musa acuminata subsp. malaccensis [pisang utan]
gb|EDZ93048.1|  Clp domain protein                                      136   2e-34   Arthrospira maxima CS-328
ref|XP_009387981.1|  PREDICTED: chaperone protein ClpC1, chloropl...    137   3e-34   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT20100.1|  ATP-dependent Clp protease ATP-binding subunit cl...    137   3e-34   
ref|XP_009411804.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    137   9e-34   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC77204.1|  hypothetical protein OsI_15716                          137   1e-33   Oryza sativa Indica Group [Indian rice]
gb|ABK95905.1|  unknown                                                 137   1e-33   Populus trichocarpa [western balsam poplar]
gb|KIZ07494.1|  ATP-dependent Clp protease ATP-binding subunit ClpC     137   1e-33   Monoraphidium neglectum
ref|WP_044105586.1|  Clp protease ClpX                                  137   1e-33   cyanobacterium endosymbiont of Epithemia turgida
ref|XP_006652229.1|  PREDICTED: chaperone protein ClpC1, chloropl...    137   1e-33   
ref|XP_006374569.1|  hypothetical protein POPTR_0015s11640g             137   1e-33   
emb|CDX84888.1|  BnaA03g13420D                                          137   1e-33   
ref|XP_003575034.2|  PREDICTED: chaperone protein ClpC1, chloropl...    137   2e-33   Brachypodium distachyon [annual false brome]
ref|XP_002447724.1|  hypothetical protein SORBIDRAFT_06g014590          137   2e-33   Sorghum bicolor [broomcorn]
ref|XP_003575035.1|  PREDICTED: chaperone protein ClpC1, chloropl...    137   2e-33   Brachypodium distachyon [annual false brome]
emb|CAE05148.2|  OSJNBa0039C07.4                                        137   2e-33   Oryza sativa Japonica Group [Japonica rice]
sp|Q7F9I1.2|CLPC1_ORYSJ  RecName: Full=Chaperone protein ClpC1, c...    137   2e-33   Oryza sativa Japonica Group [Japonica rice]
sp|P46523.1|CLPA_BRANA  RecName: Full=ATP-dependent Clp protease ...    137   2e-33   Brassica napus [oilseed rape]
ref|WP_039899756.1|  Clp protease ClpX                                  136   2e-33   Microcystis sp. T1-4
gb|KGN63436.1|  hypothetical protein Csa_1G000600                       137   2e-33   Cucumis sativus [cucumbers]
emb|CAN78847.1|  hypothetical protein VITISV_010724                     137   2e-33   Vitis vinifera
ref|WP_015162264.1|  ATPase with chaperone activity, ATP-binding ...    137   2e-33   Chamaesiphon minutus
ref|XP_004975454.1|  PREDICTED: chaperone protein ClpC1, chloropl...    137   2e-33   Setaria italica
gb|AAL10478.1|  AT3g48870/T21J18_140                                    135   2e-33   Arabidopsis thaliana [mouse-ear cress]
gb|EAZ30583.1|  hypothetical protein OsJ_14634                          137   2e-33   Oryza sativa Japonica Group [Japonica rice]
ref|WP_038544339.1|  Clp protease ClpX                                  137   2e-33   Synechococcus sp. KORDI-100
ref|WP_011364587.1|  ATP-dependent Clp protease ATP-binding protein     137   2e-33   Synechococcus sp. CC9605
ref|WP_038554285.1|  Clp protease ClpX                                  137   2e-33   Synechococcus sp. KORDI-52
ref|WP_012162462.1|  ATP-dependent Clp protease ATP-binding protein     137   2e-33   Acaryochloris marina
ref|NP_001190035.1|  Clp ATPase                                         135   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|NP_050661.1|  Clp protease ATP binding subunit                      137   3e-33   Guillardia theta
ref|WP_010467511.1|  ATP-dependent Clp protease ATP-binding protein     137   3e-33   Acaryochloris sp. CCMEE 5410
ref|XP_010446016.1|  PREDICTED: chaperone protein ClpC1, chloropl...    134   3e-33   
ref|WP_028951828.1|  Clp protease ClpX                                  137   3e-33   Synechococcus sp. CC9616
ref|WP_002777520.1|  ATP-dependent Clp protease ATP-binding protein     136   3e-33   Microcystis aeruginosa
gb|AHF63374.1|  ATPase                                                  137   3e-33   Synechococcus sp. WH 8109
ref|WP_004160623.1|  ATP-dependent Clp protease ATP-binding subun...    136   3e-33   Microcystis
ref|WP_002732350.1|  ATP-dependent Clp protease ATP-binding protein     136   3e-33   Microcystis aeruginosa
ref|WP_008226206.1|  ATP-dependent Clp protease, ATP-binding subu...    136   3e-33   Richelia intracellularis
ref|WP_041428551.1|  Clp protease ClpX                                  137   3e-33   Synechococcus sp. WH 7803
ref|WP_015111477.1|  ATPase                                             136   3e-33   Nostoc sp. PCC 7107
ref|WP_015107874.1|  chaperone ATPase                                   137   3e-33   Cyanobium gracile
ref|WP_007100194.1|  ATP-dependent Clp protease ATP-binding protein     137   3e-33   Synechococcus sp. RS9917
ref|WP_044521582.1|  Clp protease ClpX                                  136   3e-33   Nostocaceae
ref|WP_002765002.1|  ATP-dependent Clp protease ATP-binding protein     136   3e-33   Microcystis aeruginosa
ref|WP_004158851.1|  ATP-dependent Clp protease ATP-binding protein     136   3e-33   Microcystis aeruginosa
ref|WP_011127803.1|  ATP-dependent Clp protease ATP-binding protein     137   3e-33   Synechococcus
ref|YP_001293474.1|  Clp protease ATP binding subunit                   136   3e-33   Rhodomonas salina
ref|WP_041555480.1|  Clp protease ClpX                                  136   3e-33   Nostoc sp. PCC 7524
ref|WP_011317764.1|  ATP-dependent Clp protease ATP-binding protein     136   3e-33   Trichormus variabilis
ref|WP_006852318.1|  ATP-dependent Clp protease ATP-binding protein     137   3e-33   Synechococcus sp. WH 8016
ref|WP_023174246.1|  ATPase AAA-2 domain protein                        136   3e-33   Gloeobacter kilaueensis
ref|WP_006170858.1|  ATP-dependent Clp protease ATP-binding protein     137   3e-33   Synechococcus sp. WH 5701
ref|XP_004975455.1|  PREDICTED: chaperone protein ClpC1, chloropl...    137   3e-33   Setaria italica
ref|NP_566912.2|  Clp ATPase                                            135   3e-33   Arabidopsis thaliana [mouse-ear cress]
ref|WP_006041704.1|  ATP-dependent Clp protease ATP-binding protein     137   3e-33   Synechococcus sp. WH 7805
ref|WP_029638478.1|  Clp protease ClpX [                                136   3e-33   [Scytonema hofmanni] UTEX B 1581
ref|XP_008663153.1|  PREDICTED: chaperone protein ClpC1, chloropl...    137   3e-33   Zea mays [maize]
ref|WP_043691512.1|  Clp protease ClpX                                  136   3e-33   Synechococcus sp. KORDI-49
ref|WP_011377512.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    136   3e-33   Synechococcus
ref|WP_010303504.1|  ATP-dependent Clp protease ATP-binding protein     136   3e-33   Synechococcus sp. CB0101
dbj|BAB74698.1|  endopeptidase Clp ATP-binding chain                    136   3e-33   Nostoc sp. PCC 7120
emb|CAB87915.1|  AtClpC                                                 135   3e-33   Arabidopsis thaliana [mouse-ear cress]
ref|WP_015126250.1|  chaperone ATPase                                   136   3e-33   Synechococcus sp. PCC 6312
ref|WP_008231833.1|  ATP-dependent Clp protease, ATP-binding subu...    136   3e-33   Richelia intracellularis
ref|WP_019498394.1|  ATP-dependent Clp protease ATP-binding protein     136   3e-33   Pseudanabaena sp. PCC 6802
ref|WP_041458572.1|  Clp protease ClpX                                  136   3e-33   Anabaena sp. 90
ref|WP_015166859.1|  chaperone ATPase                                   136   3e-33   Synechococcus sp. PCC 7502
ref|WP_006910091.1|  ATP-dependent Clp protease ATP-binding protein     136   3e-33   Cyanobium sp. PCC 7001
ref|WP_039200429.1|  Clp protease ClpX                                  136   3e-33   Aphanizomenon flos-aquae
ref|WP_017741509.1|  ATP-dependent Clp protease ATP-binding protein     136   3e-33   Scytonema hofmannii
ref|WP_007353377.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    136   3e-33   Kamptonema
ref|WP_015189078.1|  ATPase AAA-2 domain protein                        136   3e-33   Gloeocapsa sp. PCC 7428
ref|WP_039726508.1|  MULTISPECIES: Clp protease ClpX                    136   3e-33   Lyngbya confervoides
gb|AAB67745.1|  ClpC                                                    136   3e-33   Synechococcus elongatus PCC 7942
ref|WP_006454749.1|  ATP-dependent Clp protease ATP-binding protein     136   3e-33   Synechococcus sp. PCC 7335
gb|KIE07407.1|  Clp protease ClpX                                       136   3e-33   Tolypothrix bouteillei VB521301
gb|AFW96628.1|  ATP-dependent Clp family protein                        136   3e-33   Anabaena sp. 90
ref|WP_023074118.1|  atp-dependent clp protease atp-binding protein     136   3e-33   Leptolyngbya sp. Heron Island J
ref|WP_015128787.1|  ATPase                                             136   3e-33   Calothrix sp. PCC 7507
ref|WP_007098208.1|  ATP-dependent Clp protease ATP-binding protein     136   3e-33   Synechococcus sp. RS9916
ref|WP_011935205.1|  ATP-dependent Clp protease ATP-binding protein     136   3e-33   Synechococcus sp. RCC307
ref|WP_009626822.1|  ATPase AAA-2 domain protein                        136   3e-33   Pseudanabaena biceps
ref|WP_027404746.1|  Clp protease ClpX                                  136   3e-33   Aphanizomenon flos-aquae
ref|XP_002952540.1|  hypothetical protein VOLCADRAFT_75431              137   3e-33   Volvox carteri f. nagariensis
ref|WP_035989117.1|  Clp protease ClpX                                  136   3e-33   Leptolyngbya sp. KIOST-1
gb|AGW80480.1|  Clp protease ATP binding subunit                        136   3e-33   Planktothrix agardhii NIVA-CYA 68
ref|WP_041035515.1|  Clp protease ClpX                                  136   3e-33   Tolypothrix campylonemoides
ref|WP_022603946.1|  ATPase with chaperone activity, ATP-binding ...    136   3e-33   Rubidibacter lacunae
ref|WP_027250152.1|  Clp protease ClpX                                  136   3e-33   Planktothrix agardhii
ref|WP_026795885.1|  MULTISPECIES: Clp protease ClpX                    136   3e-33   Planktothrix
ref|WP_026785489.1|  MULTISPECIES: Clp protease ClpX                    136   3e-33   Planktothrix
ref|WP_009784332.1|  ATP-dependent Clp protease ATP-binding protein     136   3e-33   Lyngbya sp. PCC 8106
ref|WP_006198453.1|  ATP-dependent Clp protease ATP-binding protein     136   3e-33   Nodularia spumigena
ref|WP_017651562.1|  ATP-dependent Clp protease ATP-binding protein     136   3e-33   Fortiea contorta
ref|WP_028090149.1|  Clp protease ClpX                                  136   3e-33   Dolichospermum circinale
ref|WP_015145231.1|  chaperone ATPase                                   136   3e-33   Pleurocapsa minor
ref|WP_042153862.1|  Clp protease ClpX                                  136   3e-33   Planktothrix agardhii
ref|WP_040939432.1|  Clp protease ClpX                                  136   3e-33   
ref|WP_012412218.1|  ATP-dependent Clp protease ATP-binding protein     136   3e-33   Nostoc punctiforme
ref|WP_013192942.1|  ATP-dependent Clp protease ATP-binding protein     136   3e-33   Trichormus azollae
ref|WP_015166218.1|  ATPase                                             136   3e-33   Pseudanabaena sp. PCC 7367
ref|WP_040943370.1|  Clp protease ClpX                                  136   3e-33   
ref|WP_011142062.1|  ATP-dependent Clp protease ATP-binding protein     136   3e-33   Gloeobacter violaceus
ref|WP_012630051.1|  ATP-dependent Clp protease ATP-binding protein     136   3e-33   Cyanothece sp. PCC 7425
gb|AFY46028.1|  ATPase with chaperone activity, ATP-binding subunit     136   3e-33   Nostoc sp. PCC 7524
ref|WP_026097796.1|  Clp protease ClpX                                  136   3e-33   Geitlerinema sp. PCC 7105
ref|WP_015206692.1|  ATPase with chaperone activity, ATP-binding ...    136   3e-33   Cylindrospermum stagnale
ref|WP_036485541.1|  Clp protease ClpX                                  136   3e-33   Myxosarcina sp. GI1
ref|WP_015216290.1|  ATPase AAA-2 domain protein                        136   3e-33   Anabaena cylindrica
ref|WP_017318713.1|  ATP-dependent Clp protease ATP-binding protein     136   4e-33   Mastigocladopsis repens
ref|WP_017306413.1|  ATP-dependent Clp protease ATP-binding protein     136   4e-33   Spirulina subsalsa
ref|WP_017300481.1|  ATP-dependent Clp protease ATP-binding protein     136   4e-33   Nodosilinea nodulosa
gb|KIJ80614.1|  Clp protease ClpX                                       136   4e-33   Scytonema tolypothrichoides VB-61278
ref|WP_039740335.1|  Clp protease ClpX                                  136   4e-33   
ref|WP_006518530.1|  ATPase with chaperone activity, ATP-binding ...    136   4e-33   Leptolyngbya sp. PCC 7375
ref|WP_028082153.1|  Clp protease ClpX                                  136   4e-33   Dolichospermum circinale
ref|WP_017712666.1|  ATP-dependent Clp protease ATP-binding protein     136   4e-33   Prochlorothrix hollandica
ref|WP_011618961.1|  ATP-dependent Clp protease ATP-binding protein     136   4e-33   Synechococcus sp. CC9311
ref|WP_027842712.1|  Clp protease ClpX                                  136   4e-33   Mastigocoleus testarum
ref|WP_037222416.1|  Clp protease ClpX                                  136   4e-33   
ref|WP_015117004.1|  chaperone ATPase                                   136   4e-33   Rivularia sp. PCC 7116
ref|WP_008179937.1|  ATP-dependent Clp protease ATP-binding protein     136   4e-33   Moorea producens
ref|WP_009342297.1|  ATP-dependent Clp protease ATP-binding protein     136   4e-33   Aphanizomenonaceae
ref|WP_006620698.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    136   4e-33   Arthrospira
ref|WP_016952177.1|  ATP-dependent Clp protease ATP-binding protein     136   4e-33   Anabaena sp. PCC 7108
ref|WP_017324677.1|  ATP-dependent Clp protease ATP-binding protein     136   4e-33   Synechococcus sp. PCC 7336
ref|WP_012954277.1|  ATP-dependent Clp protease ATP-binding protein     136   4e-33   Candidatus Atelocyanobacterium thalassa
ref|WP_008274497.1|  ATP-dependent Clp protease ATP-binding protein     136   4e-33   Cyanothece sp. CCY0110
ref|WP_006277610.1|  ATP-dependent Clp protease ATP-binding protein     136   4e-33   Aphanizomenonaceae
ref|WP_017293405.1|  ATP-dependent Clp protease ATP-binding protein     136   4e-33   Geminocystis herdmanii
ref|WP_006618428.1|  ATP-dependent Clp protease ATP-binding protein     136   4e-33   Arthrospira platensis
ref|WP_011612018.1|  ATP-dependent Clp protease ATP-binding protein     136   4e-33   Trichodesmium erythraeum
ref|WP_009555478.1|  ATPase with chaperone activity, ATP-binding ...    136   4e-33   Oscillatoriales cyanobacterium JSC-12
ref|WP_015170572.1|  ATPase                                             136   4e-33   Geitlerinema sp. PCC 7407
ref|WP_007303900.1|  ATP-dependent Clp protease ATP-binding protein     136   4e-33   Crocosphaera watsonii
ref|WP_016879619.1|  ATP-dependent Clp protease ATP-binding protein     136   4e-33   Chlorogloeopsis fritschii
ref|WP_015185589.1|  chaperone ATPase                                   136   4e-33   Microcoleus sp. PCC 7113
ref|WP_017717294.1|  ATP-dependent Clp protease ATP-binding protein     136   4e-33   Oscillatoria sp. PCC 10802
ref|WP_013324812.1|  ATP-dependent Clp protease ATP-binding protein     136   4e-33   Cyanothece sp. PCC 7822
ref|WP_009543682.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    136   4e-33   Cyanothece
ref|WP_008312190.1|  ATPase with chaperone activity, ATP-binding ...    136   4e-33   Leptolyngbya sp. PCC 6406
ref|WP_036000319.1|  Clp protease ClpX                                  136   4e-33   [Leptolyngbya] sp. JSC-1
ref|WP_040054326.1|  Clp protease ClpX                                  136   4e-33   
ref|WP_006632591.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    136   4e-33   Oscillatoriales
ref|WP_019491687.1|  ATP-dependent Clp protease ATP-binding protein     136   4e-33   Calothrix sp. PCC 7103
ref|WP_015201320.1|  ATPase                                             136   4e-33   Crinalium epipsammum
ref|WP_018396432.1|  ATP-dependent Clp protease ATP-binding protein     136   4e-33   filamentous cyanobacterium ESFC-1
ref|WP_015225278.1|  ATPase                                             136   4e-33   Halothece sp. PCC 7418
ref|WP_006102932.1|  ATP-dependent Clp protease ATP-binding protein     136   4e-33   Coleofasciculus chthonoplastes
ref|WP_023066904.1|  istB-like ATP binding family protein               136   4e-33   Lyngbya aestuarii
ref|WP_021832536.1|  ATP-dependent Clp protease, ATP-binding subu...    136   4e-33   Crocosphaera watsonii
ref|WP_017289117.1|  ATP-dependent Clp protease ATP-binding protein     136   4e-33   Leptolyngbya boryana
ref|WP_012594749.1|  ATP-dependent Clp protease ATP-binding protein     136   4e-33   Cyanothece sp. PCC 8801
ref|WP_006512495.1|  ATPase with chaperone activity, ATP-binding ...    136   4e-33   Xenococcus sp. PCC 7305
ref|WP_026734190.1|  Clp protease ClpX                                  136   4e-33   Fischerella sp. PCC 9605
ref|WP_019504000.1|  ATP-dependent Clp protease ATP-binding protein     136   4e-33   Pleurocapsa sp. PCC 7319
ref|WP_015200797.1|  ATPase                                             136   4e-33   Calothrix parietina
ref|WP_017320177.1|  ATP-dependent Clp protease ATP-binding protein     136   4e-33   cyanobacterium PCC 7702
ref|WP_009789541.1|  ATP-dependent Clp protease ATP-binding protein     136   4e-33   Synechococcus sp. BL107
ref|WP_015783654.1|  ATP-dependent Clp protease ATP-binding protein     136   4e-33   Cyanothece sp. PCC 8802
ref|WP_015191669.1|  ATPase AAA-2 domain protein                        136   4e-33   Stanieria cyanosphaera
ref|WP_015147858.1|  chaperone ATPase                                   136   4e-33   Oscillatoria acuminata
ref|WP_015227883.1|  chaperone ATPase                                   136   4e-33   Dactylococcopsis salina
ref|WP_035153450.1|  Clp protease ClpX                                  136   4e-33   Calothrix sp. 336/3
ref|WP_015219504.1|  ATPase                                             136   4e-33   Cyanobacterium aponinum
ref|WP_011360176.1|  ATP-dependent Clp protease ATP-binding protein     136   4e-33   Synechococcus sp. CC9902
ref|WP_026086344.1|  MULTISPECIES: Clp protease ClpX                    136   4e-33   
gb|EHC12174.1|  ATPase AAA-2 domain protein                             136   4e-33   
ref|WP_012599251.1|  ATP-dependent Clp protease ATP-binding protein     136   4e-33   
ref|WP_026086125.1|  Clp protease ClpX                                  136   5e-33   
ref|WP_011432255.1|  ATP-dependent Clp protease ATP-binding protein     136   5e-33   
ref|WP_011824074.1|  ATP-dependent Clp protease ATP-binding protein     136   5e-33   
ref|WP_011429552.1|  ATP-dependent Clp protease ATP-binding protein     136   5e-33   
ref|XP_004960741.1|  PREDICTED: chaperone protein ClpC2, chloropl...    136   5e-33   
ref|WP_036906575.1|  Clp protease ClpX                                  136   5e-33   
ref|XP_010238595.1|  PREDICTED: chaperone protein ClpC2, chloropl...    136   5e-33   
ref|WP_011294749.1|  ATP-dependent Clp protease ATP-binding protein     136   5e-33   
ref|XP_006663917.1|  PREDICTED: chaperone protein ClpC2, chloropl...    136   5e-33   
ref|WP_036917931.1|  MULTISPECIES: Clp protease ClpX                    136   5e-33   
ref|WP_026722984.1|  Clp protease ClpX                                  135   5e-33   
ref|WP_016863560.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    135   5e-33   
ref|NP_001169540.1|  uncharacterized protein LOC100383416               136   5e-33   
dbj|BAJ99801.1|  predicted protein                                      136   5e-33   
ref|WP_028949334.1|  Clp protease ClpX                                  135   5e-33   
ref|WP_010873410.1|  ATP-dependent Clp protease ATP-binding protein     135   5e-33   
gb|EEE52971.1|  hypothetical protein OsJ_35634                          135   5e-33   
ref|WP_011125259.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    135   6e-33   
ref|WP_038653496.1|  Clp protease ClpX                                  135   6e-33   
ref|WP_036902654.1|  Clp protease ClpX                                  135   6e-33   
ref|WP_036909986.1|  Clp protease ClpX                                  135   6e-33   
ref|NP_001066442.1|  Os12g0230100                                       136   6e-33   
gb|EEC69045.1|  hypothetical protein OsI_37876                          136   6e-33   
ref|WP_002796578.1|  ATP-dependent Clp protease ATP-binding protein     135   6e-33   
ref|WP_006530480.1|  ATPase with chaperone activity, ATP-binding ...    135   8e-33   
ref|XP_002965312.1|  hypothetical protein SELMODRAFT_439163             135   8e-33   
ref|WP_015157369.1|  ATPase                                             135   8e-33   
ref|XP_006404210.1|  hypothetical protein EUTSA_v10010105mg             135   8e-33   
gb|EMS46268.1|  ATP-dependent Clp protease ATP-binding subunit cl...    135   8e-33   
ref|WP_039713557.1|  Clp protease ClpX                                  135   9e-33   
emb|CDY64710.1|  BnaA06g38690D                                          135   9e-33   
ref|XP_002977161.1|  hypothetical protein SELMODRAFT_176012             135   9e-33   
ref|WP_009632308.1|  ATPase with chaperone activity, ATP-binding ...    135   9e-33   
ref|WP_011056163.1|  ATP-dependent Clp protease ATP-binding protein     135   9e-33   
ref|WP_015132374.1|  ATPase                                             135   1e-32   
ref|WP_030006722.1|  Clp protease ClpX                                  135   1e-32   
ref|WP_024545676.1|  Clp protease ClpX                                  135   1e-32   
emb|CDY05878.1|  BnaC08g20550D                                          135   1e-32   
ref|WP_012305779.1|  ATP-dependent Clp protease ATP-binding protein     135   1e-32   
ref|WP_024123912.1|  ATP-dependent Clp protease ATPase subunit ClpC     135   1e-32   
ref|WP_022023066.1|  aTP-dependent Clp protease regulatory subunit      135   1e-32   
ref|WP_019474998.1|  hypothetical protein                               134   1e-32   
ref|XP_009404743.1|  PREDICTED: chaperone protein ClpC1, chloropl...    135   1e-32   
ref|WP_041677108.1|  Clp protease ClpX                                  135   1e-32   
ref|WP_032527486.1|  Clp protease ClpX                                  135   1e-32   
dbj|BAD79443.1|  ATP-dependent Clp protease regulatory subunit ClpC     134   1e-32   
ref|XP_001779162.1|  predicted protein                                  134   2e-32   
ref|WP_036910555.1|  MULTISPECIES: Clp protease ClpX                    134   2e-32   
ref|XP_001756645.1|  predicted protein                                  134   2e-32   
ref|WP_011825646.1|  ATP-dependent Clp protease ATP-binding protein     134   2e-32   
gb|EMT29575.1|  ATP-dependent Clp protease ATP-binding subunit cl...    135   2e-32   
ref|WP_025906631.1|  Clp protease ClpX                                  134   2e-32   
ref|WP_015223717.1|  ATPase                                             134   2e-32   
ref|WP_011130433.1|  ATP-dependent Clp protease ATP-binding protein     134   2e-32   
ref|WP_025972244.1|  Clp protease ClpX                                  134   2e-32   
ref|WP_032514205.1|  Clp protease ClpX                                  134   2e-32   
ref|WP_022491472.1|  aTP-dependent Clp protease ATP-binding subun...    134   2e-32   
ref|WP_012007913.1|  ATP-dependent Clp protease ATP-binding protein     134   2e-32   
ref|WP_011818625.1|  ATP-dependent Clp protease ATP-binding protein     134   2e-32   
ref|XP_005844402.1|  hypothetical protein CHLNCDRAFT_32555              134   2e-32   
ref|WP_032522603.1|  Clp protease ClpX                                  134   2e-32   
ref|WP_025954710.1|  Clp protease ClpX                                  134   2e-32   
ref|WP_032523561.1|  Clp protease ClpX                                  134   2e-32   
ref|WP_002807987.1|  ATP-dependent Clp protease ATP-binding protein     134   2e-32   
ref|WP_025932059.1|  Clp protease ClpX                                  134   2e-32   
ref|WP_025881712.1|  MULTISPECIES: Clp protease ClpX                    134   2e-32   
ref|WP_025958425.1|  Clp protease ClpX                                  134   2e-32   
ref|WP_025923359.1|  Clp protease ClpX                                  134   2e-32   
ref|WP_032515069.1|  Clp protease ClpX                                  134   2e-32   
ref|WP_025935195.1|  MULTISPECIES: Clp protease ClpX                    134   2e-32   
ref|WP_025928515.1|  Clp protease ClpX                                  134   2e-32   
ref|WP_025922419.1|  MULTISPECIES: Clp protease ClpX                    134   2e-32   
ref|WP_025894690.1|  Clp protease ClpX                                  134   2e-32   
ref|WP_025961281.1|  Clp protease ClpX                                  134   2e-32   
ref|WP_029976482.1|  Clp protease ClpX                                  134   2e-32   
ref|WP_042850567.1|  Clp protease ClpX                                  134   2e-32   
ref|WP_025959792.1|  Clp protease ClpX                                  134   2e-32   
ref|WP_025944115.1|  Clp protease ClpX                                  134   2e-32   
ref|WP_025926674.1|  Clp protease ClpX                                  134   2e-32   
ref|WP_025893396.1|  Clp protease ClpX                                  134   2e-32   
ref|WP_025941830.1|  Clp protease ClpX                                  134   2e-32   
ref|WP_025970276.1|  Clp protease ClpX                                  134   2e-32   
ref|WP_025964345.1|  Clp protease ClpX                                  134   2e-32   
ref|WP_025962478.1|  Clp protease ClpX                                  134   2e-32   
ref|WP_025890951.1|  MULTISPECIES: Clp protease ClpX                    134   2e-32   
ref|WP_025968127.1|  Clp protease ClpX                                  134   2e-32   
ref|WP_025965623.1|  Clp protease ClpX                                  134   2e-32   
ref|WP_025914744.1|  Clp protease ClpX                                  134   2e-32   
ref|WP_011376649.1|  ATP-dependent Clp protease ATP-binding protein     134   2e-32   
ref|WP_025956785.1|  Clp protease ClpX                                  134   2e-32   
ref|WP_025930513.1|  Clp protease ClpX                                  134   2e-32   
ref|WP_025942442.1|  MULTISPECIES: Clp protease ClpX                    134   2e-32   
ref|WP_025925386.1|  MULTISPECIES: Clp protease ClpX                    134   2e-32   
ref|WP_032524589.1|  Clp protease ClpX                                  134   2e-32   
ref|WP_025935959.1|  Clp protease ClpX                                  134   2e-32   
ref|WP_032519126.1|  Clp protease ClpX                                  134   2e-32   
ref|WP_025955884.1|  Clp protease ClpX                                  134   2e-32   
ref|WP_022485745.1|  aTP-dependent Clp protease regulatory subunit      134   2e-32   
ref|WP_025924610.1|  Clp protease ClpX                                  134   2e-32   
ref|WP_032516684.1|  Clp protease ClpX                                  134   2e-32   
ref|WP_011820486.1|  ATP-dependent Clp protease ATP-binding protein     134   2e-32   
ref|XP_011401568.1|  ATP-dependent Clp protease ATP-binding subun...    134   2e-32   
ref|WP_011863146.1|  ATP-dependent Clp protease ATP-binding protein     134   2e-32   
ref|WP_011132721.1|  ATP-dependent Clp protease ATP-binding protein     134   3e-32   
ref|XP_001766010.1|  predicted protein                                  134   3e-32   
gb|AJA71272.1|  HSP100                                                  134   3e-32   
ref|WP_036896901.1|  Clp protease ClpX                                  134   3e-32   
ref|YP_007947862.1|  Clp protease ATP binding subunit                   134   3e-32   
ref|WP_012195650.1|  ATP-dependent Clp protease ATP-binding protein     134   3e-32   
ref|XP_001766888.1|  predicted protein                                  134   3e-32   
gb|AIA21566.1|  Clp protease ATP binding subunit                        133   3e-32   
ref|YP_537014.1|  Clp protease ATP binding subunit                      133   3e-32   
gb|AIA21360.1|  Clp protease ATP binding subunit                        133   4e-32   
ref|YP_009027615.1|  Clp protease ATP binding subunit                   133   4e-32   
gb|AFC40000.1|  Clp protease ATP binding subunit                        133   4e-32   
ref|XP_010921845.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    129   4e-32   
ref|NP_053942.1|  Clp protease ATP binding subunit                      133   4e-32   
gb|EKE04399.1|  hypothetical protein ACD_20C00084G0019                  133   5e-32   
gb|AJH65889.1|  ATP-dependent Clp protease                              133   5e-32   
gb|ADJ57429.1|  clp protease ATP binding subunit                        133   6e-32   
ref|YP_007627346.1|  Clp protease ATP binding subunit                   133   6e-32   
ref|WP_025781797.1|  Clp protease ClpX                                  133   6e-32   
ref|YP_008144810.1|  ATP-dependent Clp protease ATP-binding subun...    132   6e-32   
ref|YP_063564.1|  Clp protease ATP binding subunit                      132   7e-32   
ref|YP_277337.1|  Clp protease ATP binding subunit                      132   7e-32   
ref|XP_007509860.1|  predicted protein                                  133   7e-32   
gb|AJO68399.1|  Clp protease ATP binding subunit                        132   7e-32   
ref|YP_007878188.1|  Clp protease ATP binding subunit                   132   7e-32   
ref|YP_009019572.1|  Clp protease ATP binding subunit                   132   8e-32   
ref|WP_010317861.1|  ATP-dependent Clp protease ATP-binding protein     132   1e-31   
emb|CEG02027.1|  Clp, N-terminal                                        132   1e-31   
ref|WP_021918297.1|  aTP-dependent Clp protease ATP-binding subun...    132   1e-31   
ref|XP_003063658.1|  predicted protein                                  132   1e-31   
ref|XP_002505550.1|  predicted protein                                  132   1e-31   
ref|XP_001422509.1|  chaperone, Hsp100 family, ClpC-type                132   1e-31   
ref|WP_022442206.1|  aTP-dependent Clp protease ATP-binding subun...    132   1e-31   
ref|WP_022482201.1|  aTP-dependent Clp protease ATP-binding subun...    132   1e-31   
ref|WP_021945551.1|  aTP-dependent Clp protease ATP-binding subun...    132   1e-31   
ref|WP_022457401.1|  aTP-dependent Clp protease ATP-binding subun...    131   2e-31   
ref|NP_045112.1|  Clp protease ATP binding subunit                      131   2e-31   
ref|WP_021865017.1|  aTP-dependent Clp protease ATP-binding subun...    131   2e-31   
ref|WP_022246485.1|  aTP-dependent Clp protease ATP-binding subun...    131   2e-31   
gb|ABR23161.1|  ATP-dependent Clp protease regulatory subunit ClpC      130   5e-31   
gb|AHY04404.1|  ATP-dependent clp protease ATP binding subunit          130   6e-31   
gb|AIA61144.1|  Clp protease ATP binding subunit (chloroplast)          129   1e-30   
ref|YP_002049416.1|  endopeptidase Clp ATP-binding chain C              129   1e-30   
ref|XP_002875732.1|  hypothetical protein ARALYDRAFT_484935             125   2e-30   
ref|WP_017285691.1|  hypothetical protein                               124   2e-30   
ref|YP_009051035.1|  Clp protease ATP binding subunit                   128   2e-30   
ref|YP_005088687.1|  Clp protease ATP binding subunit                   128   2e-30   
ref|YP_008145463.1|  Clp protease ATP binding subunit                   128   3e-30   
ref|YP_008965643.1|  ATP-dependent Clp protease ATP-binding subun...    127   3e-30   
ref|NP_849021.1|  Clp protease ATP binding subunit                      127   3e-30   
ref|WP_011142066.1|  endopeptidase Clp ATP-binding chain                123   6e-30   
ref|YP_007476253.1|  Clp protease ATP binding subunit                   126   9e-30   
ref|WP_026735736.1|  hypothetical protein                               119   9e-30   
ref|XP_005648968.1|  hypothetical protein COCSUDRAFT_28166              123   1e-28   
ref|NP_190131.1|  Double Clp-N motif-containing P-loop nucleoside...    118   5e-28   
ref|YP_003002285.1|  ATP-dependent clp protease ATP-binding subunit     121   8e-28   
gb|AJH65844.1|  ATP-dependent Clp protease                              120   9e-28   
ref|YP_003002123.1|  ATP-dependent clp protease ATP-binding subunit     119   4e-27   
gb|AFR24744.1|  ATP-dependent clp protease ATP-binding subunit          119   4e-27   
ref|WP_011612826.1|  ATP-dependent Clp protease ATP-binding protein     118   7e-27   
gb|ABG51946.1|  TPR repeat containing protein                           118   1e-26   
ref|YP_003359282.1|  Clp protease ATP binding subunit                   117   1e-26   
ref|XP_010687841.1|  PREDICTED: chaperone protein ClpC, chloropla...    116   4e-26   
ref|WP_039961643.1|  Clp protease ClpX, partial [                       115   7e-26   
ref|WP_019487288.1|  ATP-dependent Clp protease ATP-binding protein     115   7e-26   
gb|AFY44720.1|  Clp domain protein                                      113   1e-25   
ref|WP_015197969.1|  Clp domain-containing protein                      113   1e-25   
ref|WP_015181544.1|  chaperone ATPase                                   114   2e-25   
ref|XP_010687844.1|  PREDICTED: chaperone protein ClpC, chloropla...    114   2e-25   
ref|WP_032525473.1|  hypothetical protein                               105   2e-25   
emb|CAK23961.1|  ATP-dependent Clp protease ATP-binding subunit c...    113   3e-25   
ref|WP_006631728.1|  ATP-dependent Clp protease ATP-binding protein     113   4e-25   
ref|WP_015178164.1|  ATPase AAA-2 domain protein                        113   4e-25   
gb|KGG15432.1|  ATP-dependent Clp protease                              112   6e-25   
gb|KGG32385.1|  ATP-dependent Clp protease                              112   6e-25   
ref|WP_015147677.1|  chaperone ATPase                                   112   6e-25   
gb|KGG13948.1|  ATP-dependent Clp protease                              112   6e-25   
gb|KGG12250.1|  ATP-dependent Clp protease                              112   7e-25   
ref|WP_019477666.1|  hypothetical protein                               106   2e-24   
gb|KGF90612.1|  ATP-dependent Clp protease                              111   2e-24   
gb|KGG05896.1|  ATP-dependent Clp protease                              111   3e-24   
ref|YP_009029401.1|  Clp protease ATP binding subunit                   111   3e-24   
ref|YP_009028980.1|  Clp protease ATP binding subunit                   110   3e-24   
ref|WP_010996127.1|  ATP-dependent Clp protease ATP-binding protein     110   5e-24   
ref|WP_011321026.1|  ATP-dependent Clp protease ATP-binding protein     110   5e-24   
ref|WP_016953419.1|  ATP-dependent Clp protease ATP-binding protein     110   6e-24   
ref|WP_007309413.1|  ATP-dependent Clp protease ATP-binding protein     109   6e-24   
ref|WP_019489373.1|  ATP-dependent Clp protease ATP-binding protein     109   7e-24   
ref|WP_009630510.1|  ATPase with chaperone activity, ATP-binding ...    109   8e-24   
ref|WP_017653296.1|  ATP-dependent Clp protease ATP-binding protein     109   9e-24   
ref|WP_015126728.1|  ATPase                                             108   1e-23   
gb|AFY59127.1|  ATPase with chaperone activity, ATP-binding subunit     108   2e-23   
ref|WP_044292615.1|  Clp protease ClpX                                  108   2e-23   
ref|WP_027845315.1|  Clp protease ClpX                                  108   2e-23   
ref|WP_015137763.1|  chaperone ATPase                                   108   2e-23   
gb|KIJ85031.1|  Clp protease ClpX                                       108   3e-23   
ref|WP_006275568.1|  ATP-dependent Clp protease ATP-binding protein     108   3e-23   
gb|KIE09004.1|  Clp protease ClpX                                       107   3e-23   
ref|WP_023064483.1|  sigma-54 interaction domain protein                107   3e-23   
ref|WP_015206990.1|  ATPase with chaperone activity, ATP-binding ...    107   3e-23   
ref|WP_017744020.1|  ATP-dependent Clp protease ATP-binding protein     107   4e-23   
ref|WP_009785004.1|  ATP-dependent Clp protease ATP-binding protein     107   4e-23   
ref|YP_005089717.1|  clpC gene product                                  108   4e-23   
ref|WP_041038849.1|  Clp protease ClpX                                  107   4e-23   
ref|WP_017321287.1|  ATP-dependent Clp protease ATP-binding protein     107   4e-23   
ref|WP_012409943.1|  ATP-dependent Clp protease ATP-binding protein     107   4e-23   
ref|WP_013190390.1|  ATP-dependent Clp protease ATP-binding protein     107   4e-23   
ref|WP_042466185.1|  Clp protease ClpX                                  107   4e-23   
gb|AFZ60359.1|  ATPase AAA-2 domain protein                             107   5e-23   
ref|WP_016875482.1|  ATP-dependent Clp protease ATP-binding protein     107   5e-23   
ref|WP_029638259.1|  Clp protease ClpX [                                107   5e-23   
ref|YP_009093078.1|  Clp protease ATP binding subunit                   107   6e-23   
ref|WP_027255145.1|  Clp protease ClpX                                  107   6e-23   
ref|WP_026788043.1|  Clp protease ClpX                                  107   6e-23   
ref|WP_015199655.1|  ATPase                                             107   6e-23   



>ref|XP_009592686.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic isoform X1 [Nicotiana tomentosiformis]
Length=935

 Score =   137 bits (346),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  103  MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  162

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  163  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  191


 Score = 90.9 bits (224),  Expect(2) = 4e-51, Method: Composition-based stats.
 Identities = 53/79 (67%), Positives = 59/79 (75%), Gaps = 4/79 (5%)
 Frame = +3

Query  51   LGGIMARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGL  230
            L  IMAR LVQSTNIPS VAGE   +F GSGK      R V MLCS+QSPSL+LR F+GL
Sbjct  9    LWSIMARALVQSTNIPSSVAGERTTKFNGSGKTN----RTVKMLCSAQSPSLRLRDFSGL  64

Query  231  RGGNALDTMARSGQTLHSK  287
            RG NA+DT+ RSGQTL SK
Sbjct  65   RGCNAIDTLVRSGQTLQSK  83



>ref|XP_009592687.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic isoform X2 [Nicotiana tomentosiformis]
Length=927

 Score =   137 bits (346),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  95   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  154

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  155  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  183


 Score = 90.5 bits (223),  Expect(2) = 7e-51, Method: Composition-based stats.
 Identities = 52/76 (68%), Positives = 58/76 (76%), Gaps = 4/76 (5%)
 Frame = +3

Query  60   IMARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGG  239
            IMAR LVQSTNIPS VAGE   +F GSGK      R V MLCS+QSPSL+LR F+GLRG 
Sbjct  4    IMARALVQSTNIPSSVAGERTTKFNGSGKTN----RTVKMLCSAQSPSLRLRDFSGLRGC  59

Query  240  NALDTMARSGQTLHSK  287
            NA+DT+ RSGQTL SK
Sbjct  60   NAIDTLVRSGQTLQSK  75



>gb|AIM41271.1| chloroplast ATP-dependent Clp protease chaperone protein [Nicotiana 
benthamiana]
Length=938

 Score =   137 bits (346),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  150

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  151  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  179


 Score = 87.4 bits (215),  Expect(2) = 6e-50, Method: Composition-based stats.
 Identities = 50/75 (67%), Positives = 57/75 (76%), Gaps = 4/75 (5%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MAR LVQSTNIPS V+GE   +F GSGK      R V MLCS+QSPSL+LR F+GLRG N
Sbjct  1    MARALVQSTNIPSSVSGERTTKFNGSGKTN----RTVKMLCSAQSPSLRLRDFSGLRGCN  56

Query  243  ALDTMARSGQTLHSK  287
            A+DT+ RSGQTL SK
Sbjct  57   AVDTLVRSGQTLQSK  71



>gb|AIM41270.1| chloroplast ATP-dependent Clp protease chaperone protein [Nicotiana 
benthamiana]
Length=908

 Score =   137 bits (345),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  150

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  151  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  179


 Score = 87.4 bits (215),  Expect(2) = 6e-50, Method: Composition-based stats.
 Identities = 50/75 (67%), Positives = 57/75 (76%), Gaps = 4/75 (5%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MAR LVQSTNIPS V+GE   +F GSGK      R V MLCS+QSPSL+LR F+GLRG N
Sbjct  1    MARALVQSTNIPSSVSGERTTKFNGSGKTN----RTVKMLCSAQSPSLRLRDFSGLRGCN  56

Query  243  ALDTMARSGQTLHSK  287
            A+DT+ RSGQTL SK
Sbjct  57   AVDTLVRSGQTLQSK  71



>ref|XP_009615664.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Nicotiana tomentosiformis]
Length=923

 Score =   137 bits (346),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  150

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  151  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  179


 Score = 85.9 bits (211),  Expect(2) = 1e-49, Method: Composition-based stats.
 Identities = 50/75 (67%), Positives = 58/75 (77%), Gaps = 4/75 (5%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MAR LVQSTNIPS VAGE   QF GSGK K    + V MLC+ QSPS++L +FTGLRG N
Sbjct  1    MARALVQSTNIPSSVAGERTRQFSGSGKNK----KTVKMLCNVQSPSIRLTNFTGLRGCN  56

Query  243  ALDTMARSGQTLHSK  287
            A+DT+ +SGQTLHSK
Sbjct  57   AIDTLVKSGQTLHSK  71



>ref|XP_009769540.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Nicotiana sylvestris]
Length=923

 Score =   137 bits (346),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  150

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  151  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  179


 Score = 85.9 bits (211),  Expect(2) = 2e-49, Method: Composition-based stats.
 Identities = 50/75 (67%), Positives = 58/75 (77%), Gaps = 4/75 (5%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MAR LVQSTNIPS VAGE   QF GSGK K    + V MLC+ QSPS++L +FTGLRG N
Sbjct  1    MARALVQSTNIPSSVAGERTRQFSGSGKNK----KTVKMLCNVQSPSIRLTNFTGLRGCN  56

Query  243  ALDTMARSGQTLHSK  287
            A+DT+ +SGQTLHSK
Sbjct  57   AVDTLVKSGQTLHSK  71



>ref|XP_009798134.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Nicotiana sylvestris]
Length=923

 Score =   137 bits (346),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  150

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  151  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  179


 Score = 85.9 bits (211),  Expect(2) = 2e-49, Method: Composition-based stats.
 Identities = 50/75 (67%), Positives = 56/75 (75%), Gaps = 4/75 (5%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MAR LVQSTNIPS VAGE   +F GSGK      R V MLCS+QSPSL+LR F+GLRG N
Sbjct  1    MARALVQSTNIPSSVAGERTTKFNGSGKTN----RTVKMLCSAQSPSLRLRDFSGLRGCN  56

Query  243  ALDTMARSGQTLHSK  287
            A+DT+ RS QTL SK
Sbjct  57   AIDTLVRSEQTLQSK  71



>gb|AIM41268.1| chloroplast ATP-dependent Clp protease chaperone protein [Nicotiana 
benthamiana]
Length=906

 Score =   137 bits (345),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  150

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  151  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  179


 Score = 84.3 bits (207),  Expect(2) = 5e-49, Method: Composition-based stats.
 Identities = 49/75 (65%), Positives = 57/75 (76%), Gaps = 4/75 (5%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MAR LVQSTNIPS VAGE   QF GSGK K    + V MLC+ Q PS++L +FTGLRG N
Sbjct  1    MARALVQSTNIPSSVAGERTRQFSGSGKNK----KTVKMLCNVQPPSIRLTNFTGLRGCN  56

Query  243  ALDTMARSGQTLHSK  287
            A+DT+ +SGQTLHSK
Sbjct  57   AIDTLVKSGQTLHSK  71



>ref|XP_006346636.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Solanum tuberosum]
Length=923

 Score =   137 bits (346),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  150

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  151  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  179


 Score = 82.0 bits (201),  Expect(2) = 2e-48, Method: Composition-based stats.
 Identities = 50/75 (67%), Positives = 56/75 (75%), Gaps = 4/75 (5%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MAR LVQST+IPS VAGE   +F GSGK K    R V MLC++QS SL LR FTGLRG N
Sbjct  1    MARALVQSTSIPSSVAGERTTKFNGSGKTK----RAVTMLCNAQSSSLTLRDFTGLRGCN  56

Query  243  ALDTMARSGQTLHSK  287
            A+DT+ RSGQTL SK
Sbjct  57   AIDTLVRSGQTLQSK  71



>ref|XP_004252280.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Solanum lycopersicum]
Length=923

 Score =   137 bits (346),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  150

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  151  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  179


 Score = 82.0 bits (201),  Expect(2) = 2e-48, Method: Composition-based stats.
 Identities = 50/75 (67%), Positives = 56/75 (75%), Gaps = 4/75 (5%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MAR LVQST+IPS VAGE   +F GSGK K    R V MLC++QS SL LR FTGLRG N
Sbjct  1    MARALVQSTSIPSSVAGERTTKFNGSGKTK----RAVTMLCNAQSSSLTLRDFTGLRGCN  56

Query  243  ALDTMARSGQTLHSK  287
            A+DT+ RSGQTL SK
Sbjct  57   AIDTLVRSGQTLQSK  71



>sp|P31542.1|CLPAB_SOLLC RecName: Full=ATP-dependent Clp protease ATP-binding subunit 
clpA homolog CD4B, chloroplastic; Flags: Precursor [Solanum 
lycopersicum]
 gb|AAA34161.1| ATP-dependent protease (CD4B) [Solanum lycopersicum]
Length=923

 Score =   137 bits (345),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  150

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  151  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  179


 Score = 81.3 bits (199),  Expect(2) = 4e-48, Method: Composition-based stats.
 Identities = 49/75 (65%), Positives = 56/75 (75%), Gaps = 4/75 (5%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MAR LVQST+IPS VAGE   +F GSGK K    R V MLC++QS SL LR FTGLRG N
Sbjct  1    MARALVQSTSIPSSVAGERTTKFNGSGKTK----RAVTMLCNAQSSSLTLRDFTGLRGCN  56

Query  243  ALDTMARSGQTLHSK  287
            A+DT+ RSG+TL SK
Sbjct  57   AIDTLVRSGETLQSK  71



>ref|XP_004297496.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Fragaria vesca subsp. vesca]
Length=922

 Score =   137 bits (345),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  150

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  151  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  179


 Score = 75.9 bits (185),  Expect(2) = 1e-46, Method: Composition-based stats.
 Identities = 43/75 (57%), Positives = 54/75 (72%), Gaps = 4/75 (5%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MARVLV STNIP LVAG+ +GQ     KG G  +R   M+CS ++P+L++ SF+GLR  N
Sbjct  1    MARVLVHSTNIPGLVAGQRLGQ----SKGSGNARRSTKMMCSLRTPALRISSFSGLRSVN  56

Query  243  ALDTMARSGQTLHSK  287
            ALD MAR GQ L+SK
Sbjct  57   ALDIMARPGQDLYSK  71



>gb|ADN33858.1| ATP-dependent clp protease [Cucumis melo subsp. melo]
Length=929

 Score =   137 bits (345),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  92   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  151

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  152  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  180


 Score = 75.5 bits (184),  Expect(2) = 2e-46, Method: Composition-based stats.
 Identities = 41/75 (55%), Positives = 51/75 (68%), Gaps = 3/75 (4%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MARVLVQSTNIP LV G   G    + +G    KR V M+ ++ SP L++R+F+GLRG N
Sbjct  1    MARVLVQSTNIPGLVGGRKNG---LTSRGSASVKRAVKMMATAHSPGLRIRNFSGLRGFN  57

Query  243  ALDTMARSGQTLHSK  287
            +LD M RSGQ  HSK
Sbjct  58   SLDNMLRSGQDFHSK  72



>ref|XP_008464372.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Cucumis melo]
Length=923

 Score =   137 bits (345),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  92   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  151

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  152  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  180


 Score = 75.5 bits (184),  Expect(2) = 2e-46, Method: Composition-based stats.
 Identities = 41/75 (55%), Positives = 51/75 (68%), Gaps = 3/75 (4%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MARVLVQSTNIP LV G   G    + +G    KR V M+ ++ SP L++R+F+GLRG N
Sbjct  1    MARVLVQSTNIPGLVGGRKNG---LTSRGSASVKRAVKMMATAHSPGLRIRNFSGLRGFN  57

Query  243  ALDTMARSGQTLHSK  287
            +LD M RSGQ  HSK
Sbjct  58   SLDNMLRSGQDFHSK  72



>gb|AIM41269.1| chloroplast ATP-dependent Clp protease chaperone protein [Nicotiana 
benthamiana]
Length=923

 Score =   127 bits (319),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 88/104 (85%), Gaps = 15/104 (14%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgt---------------eqillgligegtgiA  477
            +FERFTEKAIKVIMLAQEEARRLGHNFVGT                +ILLGLIGEGTGIA
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKILLGLIGEGTGIA  150

Query  478  AKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            AKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  151  AKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPRAKRVLE  194


 Score = 84.3 bits (207),  Expect(2) = 5e-46, Method: Composition-based stats.
 Identities = 49/75 (65%), Positives = 57/75 (76%), Gaps = 4/75 (5%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MAR LVQSTNIPS VAGE   QF GSGK K    + V MLC+ Q PS++L +FTGLRG N
Sbjct  1    MARALVQSTNIPSSVAGEMTRQFSGSGKNK----KTVKMLCNVQPPSIRLTNFTGLRGCN  56

Query  243  ALDTMARSGQTLHSK  287
            A+DT+ +SGQTLHSK
Sbjct  57   AIDTLVKSGQTLHSK  71



>ref|XP_007210385.1| hypothetical protein PRUPE_ppa001062mg [Prunus persica]
 gb|EMJ11584.1| hypothetical protein PRUPE_ppa001062mg [Prunus persica]
Length=921

 Score =   137 bits (346),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  90   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  149

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  150  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  178


 Score = 73.2 bits (178),  Expect(2) = 1e-45, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 52/75 (69%), Gaps = 4/75 (5%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MARVLVQSTNIP +VAG  +GQ     KG G  KR V M C+ ++P L++ SF+GLR  N
Sbjct  1    MARVLVQSTNIPGVVAGRRLGQ----SKGSGNAKRTVKMCCTLRAPGLRISSFSGLRSVN  56

Query  243  ALDTMARSGQTLHSK  287
            ALD MA+ GQ  +SK
Sbjct  57   ALDIMAKPGQDFYSK  71



>emb|CBI15747.3| unnamed protein product [Vitis vinifera]
Length=746

 Score =   137 bits (346),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  139  MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  198

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  199  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  227


 Score = 72.0 bits (175),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 39/80 (49%), Positives = 54/80 (68%), Gaps = 4/80 (5%)
 Frame = +3

Query  48   SLGGIMARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTG  227
            S+  +MAR LVQSTNI + VA    G+F+GS + K    + V M+C+ Q+P L++R F+G
Sbjct  44   SVSAVMARALVQSTNIFASVADGKHGKFQGSERTK----KSVKMMCNVQAPGLRIRGFSG  99

Query  228  LRGGNALDTMARSGQTLHSK  287
            LRG NALD + RSG   HS+
Sbjct  100  LRGANALDNLVRSGHDFHSR  119



>ref|XP_004171086.1| PREDICTED: chaperone protein ClpC, chloroplastic-like, partial 
[Cucumis sativus]
Length=475

 Score =   137 bits (345),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  92   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  151

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  152  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  180


 Score = 72.0 bits (175),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 50/75 (67%), Gaps = 3/75 (4%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MARVLVQSTNIP LV G   G    + +G    KR V M+ ++ SP L++R+F+GLRG N
Sbjct  1    MARVLVQSTNIPGLVGGRKNG---LTTRGSANVKRAVKMMSTAHSPGLRIRNFSGLRGFN  57

Query  243  ALDTMARSGQTLHSK  287
            +LD M RS Q  HSK
Sbjct  58   SLDNMLRSRQNFHSK  72



>ref|XP_004138021.1| PREDICTED: chaperone protein ClpC, chloroplastic-like [Cucumis 
sativus]
Length=929

 Score =   137 bits (345),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  92   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  151

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  152  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  180


 Score = 72.0 bits (175),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 50/75 (67%), Gaps = 3/75 (4%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MARVLVQSTNIP LV G   G    + +G    KR V M+ ++ SP L++R+F+GLRG N
Sbjct  1    MARVLVQSTNIPGLVGGRKNG---LTTRGSANVKRAVKMMSTAHSPGLRIRNFSGLRGFN  57

Query  243  ALDTMARSGQTLHSK  287
            +LD M RS Q  HSK
Sbjct  58   SLDNMLRSRQNFHSK  72



>ref|XP_008239551.1| PREDICTED: chaperone protein ClpC, chloroplastic [Prunus mume]
Length=922

 Score =   137 bits (346),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  150

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  151  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  179


 Score = 70.9 bits (172),  Expect(2) = 5e-45, Method: Composition-based stats.
 Identities = 41/75 (55%), Positives = 51/75 (68%), Gaps = 4/75 (5%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MARVLVQSTNIP +VAG  + Q     KG G  KR V M C+ ++P L++ SF+GLR  N
Sbjct  1    MARVLVQSTNIPGVVAGRRLSQ----SKGSGNAKRTVKMCCTLRAPGLRISSFSGLRSVN  56

Query  243  ALDTMARSGQTLHSK  287
            ALD MA+ GQ  +SK
Sbjct  57   ALDIMAKPGQDFYSK  71



>emb|CDO98310.1| unnamed protein product [Coffea canephora]
Length=923

 Score =   137 bits (346),  Expect(2) = 8e-45, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  150

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  151  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  179


 Score = 69.7 bits (169),  Expect(2) = 8e-45, Method: Composition-based stats.
 Identities = 44/75 (59%), Positives = 52/75 (69%), Gaps = 4/75 (5%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MAR +VQSTN+ SLVA    GQFKGSGK K    R V MLCS     L++R F+GLR  N
Sbjct  1    MARAIVQSTNVSSLVAPGRYGQFKGSGKNK----RAVMMLCSLHVAPLRMRGFSGLRTSN  56

Query  243  ALDTMARSGQTLHSK  287
            ALD M ++GQ+LHSK
Sbjct  57   ALDMMVKTGQSLHSK  71



>ref|XP_010099042.1| Chaperone protein ClpC [Morus notabilis]
 gb|EXB76502.1| Chaperone protein ClpC [Morus notabilis]
Length=571

 Score =   137 bits (346),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  150

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  151  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  179


 Score = 70.1 bits (170),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 51/75 (68%), Gaps = 4/75 (5%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MARVLVQSTN+P LV+G   GQ     KG GK KR V M+   Q+P L++R F+GLR  N
Sbjct  1    MARVLVQSTNVPGLVSGLKHGQ----SKGSGKSKRAVRMMSCIQAPGLRMRGFSGLRSFN  56

Query  243  ALDTMARSGQTLHSK  287
            ALDTM R GQ  +SK
Sbjct  57   ALDTMMRPGQDFYSK  71



>ref|XP_008457503.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Cucumis melo]
Length=924

 Score =   135 bits (340),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 87/89 (98%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  92   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  151

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRG GFVAVEIPFTPRAKRVLE
Sbjct  152  VEVEKIIGRGGGFVAVEIPFTPRAKRVLE  180


 Score = 70.1 bits (170),  Expect(2) = 3e-44, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 50/75 (67%), Gaps = 4/75 (5%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MARVLVQ TNIP LV    +G+   S KG G  KR V M+ S  SP +++RSF+GLRG N
Sbjct  1    MARVLVQPTNIPGLV----VGRKSPSSKGSGNSKRAVKMMSSVHSPCMRMRSFSGLRGLN  56

Query  243  ALDTMARSGQTLHSK  287
            +LD M R GQ  HSK
Sbjct  57   SLDNMFRPGQDFHSK  71



>ref|XP_004235839.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4A, chloroplastic [Solanum lycopersicum]
Length=926

 Score =   137 bits (344),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 87/89 (98%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  93   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  152

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGF+AVEIPFTPRAKRVLE
Sbjct  153  VEVEKIIGRGSGFIAVEIPFTPRAKRVLE  181


 Score = 68.2 bits (165),  Expect(2) = 4e-44, Method: Composition-based stats.
 Identities = 44/77 (57%), Positives = 53/77 (69%), Gaps = 5/77 (6%)
 Frame = +3

Query  60   IMARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGG  239
            +MAR LVQSTNI   VAGE  GQF GS K +    R V MLC+ +  S +L +F GLRG 
Sbjct  1    MMARALVQSTNILPSVAGERAGQFNGSRKDQ----RTVRMLCNVKCCSSRLNNFAGLRGC  56

Query  240  NALDT-MARSGQTLHSK  287
            NALDT + +SG+TLHSK
Sbjct  57   NALDTLLVKSGETLHSK  73



>ref|XP_010663794.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Vitis vinifera]
 ref|XP_010663795.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Vitis vinifera]
Length=923

 Score =   137 bits (345),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  150

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  151  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  179


 Score = 67.8 bits (164),  Expect(2) = 4e-44, Method: Composition-based stats.
 Identities = 38/75 (51%), Positives = 51/75 (68%), Gaps = 4/75 (5%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MAR LVQSTNI + VA    G+F+GS + K    + V M+C+ Q+P L++R F+GLRG N
Sbjct  1    MARALVQSTNIFASVADGKHGKFQGSERTK----KSVKMMCNVQAPGLRIRGFSGLRGAN  56

Query  243  ALDTMARSGQTLHSK  287
            ALD + RSG   HS+
Sbjct  57   ALDNLVRSGHDFHSR  71



>sp|P31541.1|CLPAA_SOLLC RecName: Full=ATP-dependent Clp protease ATP-binding subunit 
clpA homolog CD4A, chloroplastic; Flags: Precursor [Solanum 
lycopersicum]
 gb|AAA34160.1| ATP-dependent protease (CD4A) [Solanum lycopersicum]
Length=926

 Score =   137 bits (344),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 87/89 (98%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  93   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  152

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGF+AVEIPFTPRAKRVLE
Sbjct  153  VEVEKIIGRGSGFIAVEIPFTPRAKRVLE  181


 Score = 68.2 bits (165),  Expect(2) = 4e-44, Method: Composition-based stats.
 Identities = 44/77 (57%), Positives = 53/77 (69%), Gaps = 5/77 (6%)
 Frame = +3

Query  60   IMARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGG  239
            +MAR LVQSTNI   VAGE  GQF GS K +    R V MLC+ +  S +L +F GLRG 
Sbjct  1    MMARALVQSTNILPSVAGERAGQFNGSRKDQ----RTVRMLCNVKCCSSRLNNFAGLRGC  56

Query  240  NALDT-MARSGQTLHSK  287
            NALDT + +SG+TLHSK
Sbjct  57   NALDTLLVKSGETLHSK  73



>ref|XP_004152900.1| PREDICTED: chaperone protein ClpC, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004162592.1| PREDICTED: chaperone protein ClpC, chloroplastic-like [Cucumis 
sativus]
 gb|KGN65697.1| hypothetical protein Csa_1G502360 [Cucumis sativus]
Length=924

 Score =   135 bits (340),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 87/89 (98%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  92   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  151

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRG GFVAVEIPFTPRAKRVLE
Sbjct  152  VEVEKIIGRGGGFVAVEIPFTPRAKRVLE  180


 Score = 69.7 bits (169),  Expect(2) = 5e-44, Method: Composition-based stats.
 Identities = 41/75 (55%), Positives = 50/75 (67%), Gaps = 4/75 (5%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MARVLVQ TNIP LV    + +   S +G G  KRVV M+ S  SP +++RSF+GLRG N
Sbjct  1    MARVLVQPTNIPGLV----VARKSPSSRGSGNAKRVVKMMSSVHSPGMRMRSFSGLRGLN  56

Query  243  ALDTMARSGQTLHSK  287
            +LD M R GQ  HSK
Sbjct  57   SLDNMFRPGQDFHSK  71



>ref|XP_006341485.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4A, chloroplastic-like [Solanum tuberosum]
Length=925

 Score =   137 bits (344),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 87/89 (98%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  92   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  151

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGF+AVEIPFTPRAKRVLE
Sbjct  152  VEVEKIIGRGSGFIAVEIPFTPRAKRVLE  180


 Score = 67.8 bits (164),  Expect(2) = 6e-44, Method: Composition-based stats.
 Identities = 44/76 (58%), Positives = 52/76 (68%), Gaps = 5/76 (7%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MAR LVQST+I S VA E  GQF GS K +    R V MLC+ +  S +L SF GLRG N
Sbjct  1    MARALVQSTDILSSVASERAGQFNGSRKNQ----RTVRMLCNVKCSSSRLNSFAGLRGCN  56

Query  243  ALDT-MARSGQTLHSK  287
            ALDT + +SG+TLHSK
Sbjct  57   ALDTLLVKSGETLHSK  72



>gb|KDP22549.1| hypothetical protein JCGZ_26380 [Jatropha curcas]
Length=924

 Score =   137 bits (345),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  92   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  151

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  152  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  180


 Score = 65.5 bits (158),  Expect(2) = 2e-43, Method: Composition-based stats.
 Identities = 35/75 (47%), Positives = 47/75 (63%), Gaps = 3/75 (4%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MAR+LV STNIP+L  G   G  + S   +    +   M+CS++ P+L LR F+GLR  N
Sbjct  1    MARLLVHSTNIPALSHGVKHGLSQESETSRRTATK---MMCSTRPPALTLRGFSGLRNSN  57

Query  243  ALDTMARSGQTLHSK  287
             LDT+ RSGQ  HS+
Sbjct  58   CLDTLLRSGQDFHSR  72



>gb|KHG07735.1| Chaperone ClpC, chloroplastic [Gossypium arboreum]
Length=893

 Score =   137 bits (346),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  150

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  151  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  179


 Score = 63.9 bits (154),  Expect(2) = 4e-43, Method: Composition-based stats.
 Identities = 35/75 (47%), Positives = 50/75 (67%), Gaps = 4/75 (5%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MA++L QS  +P+L++  + G    + K  GK KR   M+CS Q+P L++RSF+GLRG N
Sbjct  1    MAKILAQSAIVPTLLSSRSHG----ASKESGKPKRSAKMMCSLQTPGLRIRSFSGLRGSN  56

Query  243  ALDTMARSGQTLHSK  287
            +LD + R GQ  HSK
Sbjct  57   SLDNIVRYGQDFHSK  71



>gb|KJB19710.1| hypothetical protein B456_003G116200 [Gossypium raimondii]
Length=922

 Score =   137 bits (346),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  150

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  151  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  179


 Score = 62.8 bits (151),  Expect(2) = 1e-42, Method: Composition-based stats.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MA++L QS  +P+L+   + G    + K  GK KR   M+CS Q+P L++RSF+GLRG N
Sbjct  1    MAKILSQSAIVPTLLTSRSHG----ASKESGKPKRSAKMMCSLQTPGLRIRSFSGLRGSN  56

Query  243  ALDTMARSGQTLHSK  287
            +LD + R GQ  HSK
Sbjct  57   SLDNIVRFGQDFHSK  71



>gb|KJB19712.1| hypothetical protein B456_003G116200 [Gossypium raimondii]
Length=919

 Score =   137 bits (346),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  150

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  151  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  179


 Score = 62.8 bits (151),  Expect(2) = 1e-42, Method: Composition-based stats.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MA++L QS  +P+L+   + G    + K  GK KR   M+CS Q+P L++RSF+GLRG N
Sbjct  1    MAKILSQSAIVPTLLTSRSHG----ASKESGKPKRSAKMMCSLQTPGLRIRSFSGLRGSN  56

Query  243  ALDTMARSGQTLHSK  287
            +LD + R GQ  HSK
Sbjct  57   SLDNIVRFGQDFHSK  71



>ref|XP_007038115.1| CLPC [Theobroma cacao]
 gb|EOY22616.1| CLPC [Theobroma cacao]
Length=922

 Score =   137 bits (345),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  150

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  151  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  179


 Score = 62.4 bits (150),  Expect(2) = 2e-42, Method: Composition-based stats.
 Identities = 36/75 (48%), Positives = 46/75 (61%), Gaps = 4/75 (5%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MA+VL QST +P+LV   + G      K   K K    M+CS Q+P L++RSF+GLRG N
Sbjct  1    MAKVLAQSTIVPALVTSRSHGP----SKESSKSKGSAKMMCSLQTPGLRIRSFSGLRGSN  56

Query  243  ALDTMARSGQTLHSK  287
            +LD M R GQ   SK
Sbjct  57   SLDNMVRFGQDFRSK  71



>gb|KJB19711.1| hypothetical protein B456_003G116200 [Gossypium raimondii]
Length=753

 Score =   137 bits (346),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  150

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  151  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  179


 Score = 61.6 bits (148),  Expect(2) = 2e-42, Method: Composition-based stats.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 4/75 (5%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MA++L QS  +P+L+   + G    + K  GK KR   M+CS Q+P L++RSF+GLRG N
Sbjct  1    MAKILSQSAIVPTLLTSRSHG----ASKESGKPKRSAKMMCSLQTPGLRIRSFSGLRGSN  56

Query  243  ALDTMARSGQTLHSK  287
            +LD + R GQ  HSK
Sbjct  57   SLDNIVRFGQDFHSK  71



>ref|XP_002511102.1| ATP-dependent clp protease, putative [Ricinus communis]
 gb|EEF51704.1| ATP-dependent clp protease, putative [Ricinus communis]
Length=924

 Score =   137 bits (345),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  92   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  151

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  152  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  180


 Score = 62.0 bits (149),  Expect(2) = 2e-42, Method: Composition-based stats.
 Identities = 35/75 (47%), Positives = 46/75 (61%), Gaps = 3/75 (4%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MAR+LV S N+P+L      GQ + SG  +    +   M+CSS+ P+L LR +TGLR  N
Sbjct  1    MARLLVHSINVPALAPHIKHGQSQESGTSRRTATK---MMCSSRLPALTLRGYTGLRSSN  57

Query  243  ALDTMARSGQTLHSK  287
             LDTM RSG   HS+
Sbjct  58   CLDTMLRSGLDFHSR  72



>gb|AAD02267.1| ClpC protease [Spinacia oleracea]
Length=891

 Score =   137 bits (346),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  90   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  149

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  150  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  178


 Score = 60.1 bits (144),  Expect(2) = 7e-42, Method: Composition-based stats.
 Identities = 36/75 (48%), Positives = 50/75 (67%), Gaps = 5/75 (7%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MA  L+QSTNIPSL A +  GQF+ S KG     + V M+ S Q P  ++R+F+G+RGGN
Sbjct  1    MAGALIQSTNIPSL-AYKVNGQFQRSDKGN----KAVKMMASLQDPGYRMRTFSGVRGGN  55

Query  243  ALDTMARSGQTLHSK  287
            ALDT+  + +  +SK
Sbjct  56   ALDTLGTTSECFYSK  70



>ref|XP_010678345.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Beta vulgaris subsp. vulgaris]
Length=923

 Score =   137 bits (346),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  150

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  151  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  179


 Score = 58.9 bits (141),  Expect(2) = 2e-41, Method: Composition-based stats.
 Identities = 36/75 (48%), Positives = 50/75 (67%), Gaps = 4/75 (5%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MA  L+QST IP+  A +  GQF+ SGKGK      V M+ S Q+P  ++R+F+GLRGGN
Sbjct  1    MAGALIQSTTIPASFAYQRNGQFQRSGKGKQG----VKMMASLQAPGYRMRNFSGLRGGN  56

Query  243  ALDTMARSGQTLHSK  287
            ALDT+  + +  +SK
Sbjct  57   ALDTLGSTSECFYSK  71



>gb|KJB07945.1| hypothetical protein B456_001G054700 [Gossypium raimondii]
 gb|KJB07946.1| hypothetical protein B456_001G054700 [Gossypium raimondii]
Length=920

 Score =   137 bits (346),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  89   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  148

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  149  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  177


 Score = 58.5 bits (140),  Expect(2) = 2e-41, Method: Composition-based stats.
 Identities = 35/75 (47%), Positives = 45/75 (60%), Gaps = 6/75 (8%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MA+VL QST +PSLV   + G+        GK KR V M+ S  +P L++ SF+GLRG  
Sbjct  1    MAKVLAQSTIVPSLVTSRSHGR------STGKSKRSVKMMSSLPTPGLRINSFSGLRGST  54

Query  243  ALDTMARSGQTLHSK  287
            +LD M R  Q  HSK
Sbjct  55   SLDNMVRVDQDFHSK  69



>gb|KEH35688.1| ATP-dependent Clp protease ATP-binding subunit [Medicago truncatula]
Length=922

 Score =   137 bits (345),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  150

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  151  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  179


 Score = 58.2 bits (139),  Expect(2) = 3e-41, Method: Composition-based stats.
 Identities = 38/75 (51%), Positives = 47/75 (63%), Gaps = 4/75 (5%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MARVL QS N+P LV G    Q KGSGK K    R V M+C+S++  L++  F+GLR  N
Sbjct  1    MARVLAQSINVPGLVVGHKQSQHKGSGKSK----RSVKMMCASRTIGLRMPGFSGLRTIN  56

Query  243  ALDTMARSGQTLHSK  287
             LDTM R G   H+K
Sbjct  57   HLDTMLRPGLDFHAK  71



>ref|XP_004501745.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X1 [Cicer arietinum]
 ref|XP_004501746.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X2 [Cicer arietinum]
 ref|XP_004501747.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X3 [Cicer arietinum]
Length=923

 Score =   137 bits (345),  Expect(2) = 6e-41, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  92   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  151

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  152  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  180


 Score = 57.0 bits (136),  Expect(2) = 6e-41, Method: Composition-based stats.
 Identities = 37/75 (49%), Positives = 45/75 (60%), Gaps = 4/75 (5%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MARVL Q  N+P LVAG    Q K SGK K    R V M+C+ ++  L++  F+GLR  N
Sbjct  1    MARVLAQPINVPGLVAGHRQNQHKASGKSK----RSVKMMCAFRTNRLRMPGFSGLRTFN  56

Query  243  ALDTMARSGQTLHSK  287
             LDTM R G   HSK
Sbjct  57   HLDTMLRPGLDFHSK  71



>ref|XP_006367832.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4A, chloroplastic-like [Solanum tuberosum]
Length=921

 Score =   123 bits (308),  Expect(2) = 6e-41, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIK IMLAQ+EARRLGH+FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  94   MFERFTEKAIKGIMLAQDEARRLGHDFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  153

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGS F+ VEIPFTP AKRVLE
Sbjct  154  VEVEKIIGRGSVFITVEIPFTPLAKRVLE  182


 Score = 71.6 bits (174),  Expect(2) = 6e-41, Method: Composition-based stats.
 Identities = 47/78 (60%), Positives = 55/78 (71%), Gaps = 7/78 (9%)
 Frame = +3

Query  63   MARVLVQSTNIPS--LVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRG  236
            MAR LVQST+I S   VAGE  GQF GS K +    R V M+C  + PSLKL+SF GLRG
Sbjct  1    MARALVQSTDILSSVAVAGERAGQFNGSRKNQ----RTVRMICDVKFPSLKLKSFVGLRG  56

Query  237  GNALDT-MARSGQTLHSK  287
             NALDT + +SG+TLHSK
Sbjct  57   CNALDTLLVKSGETLHSK  74



>ref|XP_010036862.1| PREDICTED: chaperone protein ClpC, chloroplastic isoform X2 [Eucalyptus 
grandis]
 gb|KCW48519.1| hypothetical protein EUGRSUZ_K02198 [Eucalyptus grandis]
Length=922

 Score =   137 bits (345),  Expect(2) = 8e-41, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  150

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  151  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  179


 Score = 56.6 bits (135),  Expect(2) = 8e-41, Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 46/75 (61%), Gaps = 4/75 (5%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MA VL QS N P++V+G+  G       G  K +R V M+ +  +PS+++R F+GLRG N
Sbjct  1    MAGVLAQSRNAPAIVSGQRYG----GSGGSAKSRRSVKMMSALTAPSIRMRGFSGLRGSN  56

Query  243  ALDTMARSGQTLHSK  287
            +LDT+  S    HS+
Sbjct  57   SLDTLLNSSPDFHSR  71



>ref|XP_010036860.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic isoform X1 [Eucalyptus grandis]
 ref|XP_010036861.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic isoform X1 [Eucalyptus grandis]
 gb|KCW48521.1| hypothetical protein EUGRSUZ_K02198 [Eucalyptus grandis]
Length=922

 Score =   137 bits (345),  Expect(2) = 9e-41, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  150

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  151  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  179


 Score = 56.6 bits (135),  Expect(2) = 9e-41, Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 46/75 (61%), Gaps = 4/75 (5%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MA VL QS N P++V+G+  G       G  K +R V M+ +  +PS+++R F+GLRG N
Sbjct  1    MAGVLAQSRNAPAIVSGQRYG----GSGGSAKSRRSVKMMSALTAPSIRMRGFSGLRGSN  56

Query  243  ALDTMARSGQTLHSK  287
            +LDT+  S    HS+
Sbjct  57   SLDTLLNSSPDFHSR  71



>ref|XP_003630582.1| ATP-dependent Clp protease ATP-binding subunit clpA-like protein 
[Medicago truncatula]
 gb|AET05058.1| ATP-dependent Clp protease ATP-binding subunit [Medicago truncatula]
Length=926

 Score =   137 bits (345),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  95   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  154

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  155  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  183


 Score = 55.5 bits (132),  Expect(2) = 2e-40, Method: Composition-based stats.
 Identities = 32/75 (43%), Positives = 48/75 (64%), Gaps = 3/75 (4%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            M+R L QS N+P LVAG    +   + KG  + +R V M+ ++++ S +L S++GLR  N
Sbjct  1    MSRALAQSINVPGLVAGR---RHVNNNKGAARSRRSVRMMFTTRTASPRLSSYSGLRTLN  57

Query  243  ALDTMARSGQTLHSK  287
            +LD+M R GQ  HSK
Sbjct  58   SLDSMLRPGQDFHSK  72



>gb|EPS63111.1| hypothetical protein M569_11677, partial [Genlisea aurea]
Length=195

 Score =   138 bits (348),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  95   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  154

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  155  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  183


 Score = 54.3 bits (129),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 50/77 (65%), Gaps = 5/77 (6%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQ-SPSLKLRSFTGLRGG  239
            MA VLVQST++PS V   ++    G  +   K +R V MLCSS+ +P+  +RSF+G RG 
Sbjct  1    MAGVLVQSTSLPSSV---SLANNGGKLEASTKNRRAVTMLCSSRLAPARTMRSFSGFRGV  57

Query  240  NALDTMA-RSGQTLHSK  287
            N LD +  +S QTLHSK
Sbjct  58   NVLDRLVQKSSQTLHSK  74



>ref|XP_011083076.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent Clp protease ATP-binding 
subunit clpA homolog CD4B, chloroplastic [Sesamum 
indicum]
Length=928

 Score =   124 bits (310),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/82 (100%), Positives = 82/82 (100%), Gaps = 0/82 (0%)
 Frame = +1

Query  364  KAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKII  543
            KAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII
Sbjct  103  KAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII  162

Query  544  GRGSGFVAVEIPFTPRAKRVLE  609
            GRGSGFVAVEIPFTPRAKRVLE
Sbjct  163  GRGSGFVAVEIPFTPRAKRVLE  184


 Score = 68.2 bits (165),  Expect(2) = 3e-40, Method: Composition-based stats.
 Identities = 44/76 (58%), Positives = 52/76 (68%), Gaps = 5/76 (7%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MAR LVQSTN+PS V     GQF+GS K K    +   MLC+S S  +++RSF+GLRG N
Sbjct  1    MARALVQSTNLPSSVGFVNNGQFEGSNKTK----KASTMLCNSWSAPVRMRSFSGLRGAN  56

Query  243  ALDTMA-RSGQTLHSK  287
            ALD M  RSGQTL SK
Sbjct  57   ALDVMVQRSGQTLQSK  72



>ref|XP_007159971.1| hypothetical protein PHAVU_002G282500g [Phaseolus vulgaris]
 gb|ESW31965.1| hypothetical protein PHAVU_002G282500g [Phaseolus vulgaris]
Length=923

 Score =   137 bits (346),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  150

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  151  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  179


 Score = 54.3 bits (129),  Expect(2) = 4e-40, Method: Composition-based stats.
 Identities = 36/75 (48%), Positives = 51/75 (68%), Gaps = 4/75 (5%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MARVL QS  +P L++G+  GQ KGSGK +    R + M+ S Q P+L++ SF+GLR  N
Sbjct  1    MARVLAQSIGMPGLLSGQRHGQHKGSGKSR----RSLKMMSSLQMPALRMSSFSGLRTVN  56

Query  243  ALDTMARSGQTLHSK  287
             LD ++RS ++L SK
Sbjct  57   NLDLLSRSRRSLPSK  71



>ref|XP_010249192.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Nelumbo nucifera]
Length=916

 Score =   137 bits (346),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  88   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  147

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  148  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  176


 Score = 54.3 bits (129),  Expect(2) = 4e-40, Method: Composition-based stats.
 Identities = 37/75 (49%), Positives = 46/75 (61%), Gaps = 7/75 (9%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MAR LVQSTN+ + V G+  GQF+GS +      R   M  +  +PSL LR F+GLR  N
Sbjct  1    MARALVQSTNLSAAV-GQHHGQFRGSNR------RSSIMAYNIPAPSLMLRGFSGLRASN  53

Query  243  ALDTMARSGQTLHSK  287
            ALD+M RS    HSK
Sbjct  54   ALDSMLRSHCNFHSK  68



>gb|KCW48520.1| hypothetical protein EUGRSUZ_K02198 [Eucalyptus grandis]
Length=528

 Score =   137 bits (345),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  150

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  151  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  179


 Score = 54.3 bits (129),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 46/75 (61%), Gaps = 4/75 (5%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MA VL QS N P++V+G+  G       G  K +R V M+ +  +PS+++R F+GLRG N
Sbjct  1    MAGVLAQSRNAPAIVSGQRYG----GSGGSAKSRRSVKMMSALTAPSIRMRGFSGLRGSN  56

Query  243  ALDTMARSGQTLHSK  287
            +LDT+  S    HS+
Sbjct  57   SLDTLLNSSPDFHSR  71



>sp|P35100.1|CLPC_PEA RecName: Full=Chaperone protein ClpC, chloroplastic; AltName: 
Full=ATP-dependent Clp protease ATP-binding subunit ClpC homolog; 
AltName: Full=Casein lytic proteinase C; Flags: Precursor 
[Pisum sativum]
 gb|AAA33680.1| nuclear encoded precursor to chloroplast protein [Pisum sativum]
Length=922

 Score =   137 bits (346),  Expect(2) = 7e-40, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  150

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  151  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  179


 Score = 53.5 bits (127),  Expect(2) = 7e-40, Method: Composition-based stats.
 Identities = 36/75 (48%), Positives = 46/75 (61%), Gaps = 4/75 (5%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MARVL QS ++P LVAG    Q KGSGK K    R V  +C+ ++  L++  F+GLR  N
Sbjct  1    MARVLAQSLSVPGLVAGHKDSQHKGSGKSK----RSVKTMCALRTSGLRMSGFSGLRTFN  56

Query  243  ALDTMARSGQTLHSK  287
             L+TM R G   HSK
Sbjct  57   HLNTMMRPGLDFHSK  71



>ref|XP_003526929.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X1 [Glycine max]
 ref|XP_006581844.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X2 [Glycine max]
 gb|KHN09721.1| Chaperone protein ClpC, chloroplastic [Glycine soja]
Length=922

 Score =   137 bits (346),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  150

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  151  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  179


 Score = 53.1 bits (126),  Expect(2) = 1e-39, Method: Composition-based stats.
 Identities = 36/75 (48%), Positives = 44/75 (59%), Gaps = 4/75 (5%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MARVL QS N+P LVA    GQ     KG GK KR   M+ + ++  L++  F+GLR  N
Sbjct  1    MARVLAQSVNVPGLVAEHRHGQ----QKGSGKLKRSTKMMSALRTNGLRMSGFSGLRTFN  56

Query  243  ALDTMARSGQTLHSK  287
             LDTM R G   HSK
Sbjct  57   PLDTMLRPGIDFHSK  71



>ref|XP_002322299.1| ATP-dependent clp protease ATP-binding subunit clpA family protein 
[Populus trichocarpa]
 gb|EEF06426.1| ATP-dependent clp protease ATP-binding subunit clpA family protein 
[Populus trichocarpa]
Length=932

 Score =   137 bits (346),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  92   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  151

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  152  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  180


 Score = 52.8 bits (125),  Expect(2) = 1e-39, Method: Composition-based stats.
 Identities = 32/75 (43%), Positives = 43/75 (57%), Gaps = 3/75 (4%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MAR+LV S NIP++       QF+ S K +    R   M+ SS S  L +  ++GLR  N
Sbjct  1    MARLLVHSANIPAVAPCLRHCQFEESKKRRDSSAR---MMSSSPSQGLVMSGYSGLRSAN  57

Query  243  ALDTMARSGQTLHSK  287
             LDT+ R GQ+ HSK
Sbjct  58   CLDTLLRHGQSFHSK  72



>gb|EYU24516.1| hypothetical protein MIMGU_mgv1a0010411mg, partial [Erythranthe 
guttata]
Length=400

 Score =   138 bits (347),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  89   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  148

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  149  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  177


 Score = 52.0 bits (123),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 48/76 (63%), Gaps = 5/76 (7%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MAR LVQSTN+PS V+      F+GS K K        MLC+S + S ++RSF+GLRG N
Sbjct  1    MARALVQSTNLPSSVSWANNCPFEGSNKTKAGP----TMLCNSLATSARMRSFSGLRGAN  56

Query  243  ALDTMARSG-QTLHSK  287
            ++D M +   QTL SK
Sbjct  57   SIDMMLQKNIQTLQSK  72



>gb|KEH35794.1| ATP-dependent Clp protease ATP-binding subunit [Medicago truncatula]
Length=927

 Score =   135 bits (339),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGI AKVLKSMGINLKD+R
Sbjct  96   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIGAKVLKSMGINLKDSR  155

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  156  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  184


 Score = 54.7 bits (130),  Expect(2) = 2e-39, Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 43/75 (57%), Gaps = 2/75 (3%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            M+RVL QS N+P LVAG        +        R V M+ ++Q+ +++L  F+GLR  N
Sbjct  1    MSRVLAQSINVPGLVAGRR--HVNNNNGSVRSRPRSVRMMYATQTATMRLSGFSGLRPLN  58

Query  243  ALDTMARSGQTLHSK  287
            +LD+M R  Q  HSK
Sbjct  59   SLDSMFRPRQDFHSK  73



>ref|XP_010250552.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like isoform X1 [Nelumbo nucifera]
Length=945

 Score =   137 bits (345),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  118  MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  177

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  178  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  206


 Score = 52.0 bits (123),  Expect(2) = 3e-39, Method: Composition-based stats.
 Identities = 37/75 (49%), Positives = 44/75 (59%), Gaps = 6/75 (8%)
 Frame = +3

Query  60   IMARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGG  239
            IMA  LVQ TN+ + VAG+  GQ +GSG+   K      ML     PSL LR F+GLR  
Sbjct  29   IMAMALVQLTNLSAAVAGQCHGQLRGSGRNPSK------MLFHVPFPSLLLRGFSGLRAS  82

Query  240  NALDTMARSGQTLHS  284
            NALD+M RS    HS
Sbjct  83   NALDSMLRSHCNFHS  97



>ref|XP_003523172.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
1 [Glycine max]
 ref|XP_003523173.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
2 [Glycine max]
Length=922

 Score =   137 bits (345),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  150

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  151  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  179


 Score = 51.6 bits (122),  Expect(2) = 3e-39, Method: Composition-based stats.
 Identities = 34/75 (45%), Positives = 43/75 (57%), Gaps = 4/75 (5%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MARVL QS N+P L+A    GQ     K  GK KR   M+ + ++  L++  F+GLR  N
Sbjct  1    MARVLAQSINVPGLLAEHRHGQ----QKESGKLKRSTKMMSALRTNGLRMSGFSGLRTFN  56

Query  243  ALDTMARSGQTLHSK  287
             LDTM R G   HSK
Sbjct  57   PLDTMLRPGIDFHSK  71



>gb|KHN31263.1| Chaperone protein ClpC, chloroplastic [Glycine soja]
Length=907

 Score =   137 bits (345),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  150

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  151  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  179


 Score = 51.6 bits (122),  Expect(2) = 3e-39, Method: Composition-based stats.
 Identities = 34/75 (45%), Positives = 43/75 (57%), Gaps = 4/75 (5%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MARVL QS N+P L+A    GQ     K  GK KR   M+ + ++  L++  F+GLR  N
Sbjct  1    MARVLAQSINVPGLLAEHRHGQ----QKESGKLKRSTKMMSALRTNGLRMSGFSGLRTFN  56

Query  243  ALDTMARSGQTLHSK  287
             LDTM R G   HSK
Sbjct  57   PLDTMLRPGIDFHSK  71



>ref|XP_009368798.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Pyrus x bretschneideri]
Length=921

 Score =   137 bits (345),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  90   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  149

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  150  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  178


 Score = 51.6 bits (122),  Expect(2) = 3e-39, Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 39/74 (53%), Gaps = 5/74 (7%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MAR LVQST IPS+  G  +G             R   M C+ ++P+L++ S+TGLR  N
Sbjct  1    MARNLVQSTYIPSVATGRRLGY-----SKGSGNARRTVMFCTLRAPALRMSSYTGLRSVN  55

Query  243  ALDTMARSGQTLHS  284
            ALD   +    L S
Sbjct  56   ALDVSVKPRHDLFS  69



>ref|XP_008374277.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Malus domestica]
Length=936

 Score =   137 bits (345),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  90   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  149

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  150  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  178


 Score = 51.2 bits (121),  Expect(2) = 3e-39, Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 39/74 (53%), Gaps = 5/74 (7%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MAR LVQST IPS+  G  +G             R   M C+ ++P+L++ S+TGLR  N
Sbjct  1    MARNLVQSTYIPSVATGRRLGY-----SKGSGNARRTVMFCTLRAPALRMSSYTGLRSVN  55

Query  243  ALDTMARSGQTLHS  284
            ALD   +    L S
Sbjct  56   ALDVSVKPRHDLFS  69



>ref|XP_003525431.1| PREDICTED: chaperone protein ClpC, chloroplastic-like [Glycine 
max]
 gb|KHN17465.1| Chaperone protein ClpC, chloroplastic [Glycine soja]
Length=919

 Score =   137 bits (345),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  87   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  146

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  147  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  175


 Score = 51.2 bits (121),  Expect(2) = 4e-39, Method: Composition-based stats.
 Identities = 33/72 (46%), Positives = 49/72 (68%), Gaps = 4/72 (6%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MARVLVQST +P L++G+  G+ KGSGK K    R V M+ + + P+L++ SF+GLR  N
Sbjct  1    MARVLVQSTGMPGLLSGQRHGKHKGSGKSK----RSVKMMSTLRMPALRMSSFSGLRTLN  56

Query  243  ALDTMARSGQTL  278
             +D+++R   T 
Sbjct  57   PMDSLSRPRHTF  68



>ref|XP_009337515.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Pyrus x bretschneideri]
 ref|XP_009337516.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Pyrus x bretschneideri]
Length=921

 Score =   137 bits (346),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  90   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  149

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  150  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  178


 Score = 51.2 bits (121),  Expect(2) = 4e-39, Method: Composition-based stats.
 Identities = 30/74 (41%), Positives = 40/74 (54%), Gaps = 5/74 (7%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MA  LVQST IPSLV G  +G             R   MLC+ ++P+L++  +TGLR  N
Sbjct  1    MATNLVQSTYIPSLVTGRRLGY-----SKGSGNARRTVMLCTLRAPALRMSCYTGLRSVN  55

Query  243  ALDTMARSGQTLHS  284
            ALD   +  + L S
Sbjct  56   ALDISVKPRRDLFS  69



>ref|XP_011042955.1| PREDICTED: chaperone protein ClpC, chloroplastic [Populus euphratica]
Length=926

 Score =   137 bits (345),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  92   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  151

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  152  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  180


 Score = 50.8 bits (120),  Expect(2) = 5e-39, Method: Composition-based stats.
 Identities = 29/75 (39%), Positives = 42/75 (56%), Gaps = 3/75 (4%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MAR+LV S NIP++       Q++ S K +    +   M+CS  S  L +  ++GLR  N
Sbjct  1    MARLLVHSANIPAVAPCPRHRQYEESKKSRASSAK---MMCSLPSRGLVISGYSGLRSAN  57

Query  243  ALDTMARSGQTLHSK  287
             LDT+ R G + HSK
Sbjct  58   CLDTLLRHGHSFHSK  72



>ref|XP_006376920.1| hypothetical protein POPTR_0012s10770g [Populus trichocarpa]
 ref|XP_006376921.1| ATP-dependent clp protease ATP-binding subunit clpA family protein 
[Populus trichocarpa]
 gb|ERP54717.1| hypothetical protein POPTR_0012s10770g [Populus trichocarpa]
 gb|ERP54718.1| ATP-dependent clp protease ATP-binding subunit clpA family protein 
[Populus trichocarpa]
Length=926

 Score =   137 bits (346),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  92   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  151

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  152  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  180


 Score = 50.4 bits (119),  Expect(2) = 6e-39, Method: Composition-based stats.
 Identities = 29/75 (39%), Positives = 42/75 (56%), Gaps = 3/75 (4%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MAR+LV S NIP++       Q++ S K +    +   M+CS  S  L +  ++GLR  N
Sbjct  1    MARLLVHSANIPAVAPCPRHCQYEESKKSRASSAK---MMCSLPSRGLVISGYSGLRSAN  57

Query  243  ALDTMARSGQTLHSK  287
             LDT+ R G + HSK
Sbjct  58   CLDTLLRHGHSFHSK  72



>ref|XP_010250553.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like isoform X2 [Nelumbo nucifera]
 ref|XP_010250554.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like isoform X2 [Nelumbo nucifera]
Length=916

 Score =   137 bits (345),  Expect(2) = 7e-39, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  89   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  148

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  149  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  177


 Score = 50.4 bits (119),  Expect(2) = 7e-39, Method: Composition-based stats.
 Identities = 36/74 (49%), Positives = 43/74 (58%), Gaps = 6/74 (8%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MA  LVQ TN+ + VAG+  GQ +GSG+   K      ML     PSL LR F+GLR  N
Sbjct  1    MAMALVQLTNLSAAVAGQCHGQLRGSGRNPSK------MLFHVPFPSLLLRGFSGLRASN  54

Query  243  ALDTMARSGQTLHS  284
            ALD+M RS    HS
Sbjct  55   ALDSMLRSHCNFHS  68



>ref|XP_010519480.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Tarenaya 
hassleriana]
 ref|XP_010519481.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Tarenaya 
hassleriana]
Length=926

 Score =   137 bits (345),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  90   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  149

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  150  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  178


 Score = 49.7 bits (117),  Expect(2) = 1e-38, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  165  RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSK  287
            R V M+   Q+  L+++SF+GLR  NALD MARSGQ  HSK
Sbjct  30   RCVKMMSGLQASGLRMQSFSGLRSSNALDFMARSGQDFHSK  70



>ref|XP_007137864.1| hypothetical protein PHAVU_009G162100g [Phaseolus vulgaris]
 gb|ESW09858.1| hypothetical protein PHAVU_009G162100g [Phaseolus vulgaris]
Length=922

 Score =   137 bits (345),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  150

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  151  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  179


 Score = 48.9 bits (115),  Expect(2) = 2e-38, Method: Composition-based stats.
 Identities = 35/75 (47%), Positives = 42/75 (56%), Gaps = 4/75 (5%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MARVL QS  +P LVA    GQ     KG GK KR   M+ + ++  L++  FTGLR  N
Sbjct  1    MARVLAQSVTVPGLVAEHRHGQ----QKGSGKLKRPAKMMSAVRTNGLRMSGFTGLRTFN  56

Query  243  ALDTMARSGQTLHSK  287
             LDTM R G    SK
Sbjct  57   PLDTMLRPGIDFRSK  71



>ref|XP_010942381.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Elaeis guineensis]
Length=920

 Score =   137 bits (346),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  150

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  151  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  179


 Score = 47.8 bits (112),  Expect(2) = 3e-38, Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 44/74 (59%), Gaps = 4/74 (5%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MA  LVQS  +P  V      Q KGSGK +    +   M+C+ +S +L+L++F GLRG N
Sbjct  1    MAGALVQSAILPVQVVSRTCEQLKGSGKTR----KAAKMMCNLRSHALRLQAFAGLRGAN  56

Query  243  ALDTMARSGQTLHS  284
             LD ++RS Q  HS
Sbjct  57   NLDLLSRSRQDFHS  70



>ref|XP_008392716.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Malus domestica]
Length=921

 Score =   137 bits (345),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  90   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  149

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  150  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  178


 Score = 47.8 bits (112),  Expect(2) = 3e-38, Method: Composition-based stats.
 Identities = 28/74 (38%), Positives = 39/74 (53%), Gaps = 5/74 (7%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MA  LVQST IPS+  G  +G             R   MLC+ ++P+L++  +TGLR  N
Sbjct  1    MATNLVQSTYIPSVAMGRRLGY-----SKGSGNARRTVMLCTLRAPALRMSGYTGLRSVN  55

Query  243  ALDTMARSGQTLHS  284
            ALD   +  + L S
Sbjct  56   ALDISVKPRRDLFS  69



>ref|XP_006402040.1| hypothetical protein EUTSA_v10012603mg [Eutrema salsugineum]
 gb|ESQ43493.1| hypothetical protein EUTSA_v10012603mg [Eutrema salsugineum]
Length=929

 Score =   137 bits (345),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  94   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  153

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  154  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  182


 Score = 46.6 bits (109),  Expect(2) = 8e-38, Method: Composition-based stats.
 Identities = 34/78 (44%), Positives = 44/78 (56%), Gaps = 6/78 (8%)
 Frame = +3

Query  57   GIMARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSS-QSPSLKLRSFTGLR  233
             +  RVL QST  PSL    A  Q     +G G+ +R V M+CS  Q   L+++ F GLR
Sbjct  2    AMATRVLAQSTP-PSL----ACYQRNVPSRGSGRTRRPVKMMCSQLQVSGLRMQGFLGLR  56

Query  234  GGNALDTMARSGQTLHSK  287
            G N LDT+ RS Q  HS+
Sbjct  57   GNNVLDTLGRSRQDFHSR  74



>ref|XP_011040255.1| PREDICTED: chaperone protein ClpC, chloroplastic [Populus euphratica]
 ref|XP_011040256.1| PREDICTED: chaperone protein ClpC, chloroplastic [Populus euphratica]
Length=926

 Score =   137 bits (345),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  92   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  151

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  152  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  180


 Score = 46.2 bits (108),  Expect(2) = 1e-37, Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 41/75 (55%), Gaps = 3/75 (4%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MAR+LV S NIP++       QF+ S K +      V M+ S  S  L +  ++GLR  N
Sbjct  1    MARLLVYSANIPAVAPRLRHCQFEESKKRRDSS---VKMMSSLPSRGLVMSGYSGLRSAN  57

Query  243  ALDTMARSGQTLHSK  287
             LDT+ R G + HSK
Sbjct  58   CLDTLLRHGHSFHSK  72



>ref|NP_568746.1| ATP-dependent Clp protease ATP-binding subunit ClpC [Arabidopsis 
thaliana]
 sp|Q9FI56.1|CLPC1_ARATH RecName: Full=Chaperone protein ClpC1, chloroplastic; AltName: 
Full=ATP-dependent Clp protease ATP-binding subunit ClpC homolog 
1; AltName: Full=Casein lytic proteinase C1; AltName: 
Full=Protein DE-REGULATED CAO ACCUMULATION 1; AltName: Full=Protein 
IRON-RESCUED MUTANT 1; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB08738.1| ATP-dependent Clp protease, ATP-binding subunit [Arabidopsis 
thaliana]
 gb|AAM26692.1| AT5g50920/K3K7_7 [Arabidopsis thaliana]
 dbj|BAE99213.1| ATP-dependent Clp protease [Arabidopsis thaliana]
 gb|AED96011.1| ATP-dependent Clp protease ATP-binding subunit ClpC [Arabidopsis 
thaliana]
Length=929

 Score =   137 bits (346),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  94   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  153

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  154  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  182


 Score = 45.8 bits (107),  Expect(2) = 1e-37, Method: Composition-based stats.
 Identities = 35/78 (45%), Positives = 45/78 (58%), Gaps = 6/78 (8%)
 Frame = +3

Query  57   GIMARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSS-QSPSLKLRSFTGLR  233
             +  RVL QST  PSL    A  Q     +G G+ +R V M+CS  Q   L+++ F GLR
Sbjct  2    AMATRVLAQSTP-PSL----ACYQRNVPSRGSGRSRRSVKMMCSQLQVSGLRMQGFMGLR  56

Query  234  GGNALDTMARSGQTLHSK  287
            G NALDT+ +S Q  HSK
Sbjct  57   GNNALDTLGKSRQDFHSK  74



>ref|XP_004503801.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X1 [Cicer arietinum]
 ref|XP_004503802.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X2 [Cicer arietinum]
Length=926

 Score =   137 bits (345),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  95   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  154

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  155  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  183


 Score = 45.4 bits (106),  Expect(2) = 2e-37, Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 44/75 (59%), Gaps = 3/75 (4%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            M+R+LV S N+P LV G+  G    + K   K +R V M+ ++ + + ++  F+GLR  N
Sbjct  1    MSRLLVHSLNVPGLVPGQRHGN---NNKVLAKVRRPVKMMFATGTAASRMPGFSGLRTVN  57

Query  243  ALDTMARSGQTLHSK  287
            +LD+M R     HSK
Sbjct  58   SLDSMLRPRLDFHSK  72



>ref|XP_001690745.1| hypothetical protein CHLREDRAFT_110360 [Chlamydomonas reinhardtii]
 gb|EDO95778.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=97

 Score =   136 bits (342),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKV+MLAQEEARRLGHNFVGTEQ+LLGLIGE TGIAAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVVMLAQEEARRLGHNFVGTEQLLLGLIGESTGIAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|XP_002865831.1| heat shock protein 93-V [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42090.1| heat shock protein 93-V [Arabidopsis lyrata subsp. lyrata]
Length=929

 Score =   137 bits (346),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  94   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  153

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  154  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  182


 Score = 44.3 bits (103),  Expect(2) = 4e-37, Method: Composition-based stats.
 Identities = 34/78 (44%), Positives = 45/78 (58%), Gaps = 6/78 (8%)
 Frame = +3

Query  57   GIMARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSS-QSPSLKLRSFTGLR  233
             +  RVL QST  PSL    A  Q     +G G+ +R V M+CS  Q   L+++ F GLR
Sbjct  2    AMATRVLAQSTP-PSL----ACYQRNVPSRGSGRSRRSVKMMCSQLQVSGLRMQGFLGLR  56

Query  234  GGNALDTMARSGQTLHSK  287
            G NALDT+ ++ Q  HSK
Sbjct  57   GNNALDTLGKNRQDFHSK  74



>gb|EYU21822.1| hypothetical protein MIMGU_mgv1a000973mg [Erythranthe guttata]
Length=925

 Score =   135 bits (341),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEG+GIAAKV+KSMGINLKDAR
Sbjct  93   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGSGIAAKVIKSMGINLKDAR  152

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  153  IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  181


 Score = 45.8 bits (107),  Expect(2) = 5e-37, Method: Composition-based stats.
 Identities = 31/76 (41%), Positives = 44/76 (58%), Gaps = 5/76 (7%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            M   L++ TN+PS V     GQ  GS K +    +   MLCS+Q  +++L+SF+GLR  N
Sbjct  1    MTHTLIRPTNLPSSVVLGNNGQLNGSNKAR----KAPTMLCSTQPTAIRLQSFSGLRRAN  56

Query  243  ALDTMA-RSGQTLHSK  287
            +LD M  +   TL SK
Sbjct  57   SLDIMVWQPRHTLQSK  72



>gb|KHN16879.1| Chaperone protein ClpC, chloroplastic [Glycine soja]
Length=919

 Score =   134 bits (336),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 87/89 (98%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  87   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  146

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFT RAKRVLE
Sbjct  147  VEVEKIIGRGSGFVAVEIPFTSRAKRVLE  175


 Score = 47.4 bits (111),  Expect(2) = 5e-37, Method: Composition-based stats.
 Identities = 33/72 (46%), Positives = 46/72 (64%), Gaps = 4/72 (6%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MARVL QST +P L++G   G  KGSGK K    R V M+ + + P+L++ SF+GLR  N
Sbjct  1    MARVLAQSTGMPGLLSGRRHGPHKGSGKTK----RSVKMMSTLRIPALRMSSFSGLRTLN  56

Query  243  ALDTMARSGQTL  278
             LD+++R   T 
Sbjct  57   PLDSVSRPRHTF  68



>ref|XP_003532383.1| PREDICTED: chaperone protein ClpC, chloroplastic-like [Glycine 
max]
Length=919

 Score =   134 bits (336),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 87/89 (98%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  87   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  146

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFT RAKRVLE
Sbjct  147  VEVEKIIGRGSGFVAVEIPFTSRAKRVLE  175


 Score = 47.4 bits (111),  Expect(2) = 5e-37, Method: Composition-based stats.
 Identities = 33/72 (46%), Positives = 46/72 (64%), Gaps = 4/72 (6%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MARVL QST +P L++G   G  KGSGK K    R V M+ + + P+L++ SF+GLR  N
Sbjct  1    MARVLAQSTGMPGLLSGRRHGPHKGSGKTK----RSVKMMSTLRIPALRMSSFSGLRTLN  56

Query  243  ALDTMARSGQTL  278
             LD+++R   T 
Sbjct  57   PLDSVSRPRHTF  68



>ref|XP_009151567.1| PREDICTED: chaperone protein ClpC2, chloroplastic [Brassica rapa]
 ref|XP_009151572.1| PREDICTED: chaperone protein ClpC2, chloroplastic [Brassica rapa]
Length=928

 Score =   137 bits (344),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 98/106 (92%), Gaps = 1/106 (1%)
 Frame = +1

Query  295  LQLLVDEGEVAVLLLK-LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtg  471
            LQ+   +G+ +  + K +FERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTG
Sbjct  73   LQISSRKGKASRCVTKAMFERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTG  132

Query  472  iAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            IAAKVLKSMGINLKD+RVEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  133  IAAKVLKSMGINLKDSRVEVEKIIGRGSGFVAVEIPFTPRAKRVLE  178


 Score = 43.9 bits (102),  Expect(2) = 7e-37, Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 39/75 (52%), Gaps = 5/75 (7%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MAR+L   T  P L  G  +           K +R V M+ +SQ+P L ++SF+GLR  N
Sbjct  1    MARLLANFTARPLLGPGRHV-----QSDDYRKPRRCVKMMYTSQTPVLSIQSFSGLRAAN  55

Query  243  ALDTMARSGQTLHSK  287
            A+D +AR      SK
Sbjct  56   AVDLIARPAHGFFSK  70



>emb|CDX83052.1| BnaA01g20520D [Brassica napus]
Length=927

 Score =   137 bits (344),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 98/106 (92%), Gaps = 1/106 (1%)
 Frame = +1

Query  295  LQLLVDEGEVAVLLLK-LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtg  471
            LQ+   +G+ +  + K +FERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTG
Sbjct  73   LQISSRKGKSSRCVTKAMFERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTG  132

Query  472  iAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            IAAKVLKSMGINLKD+RVEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  133  IAAKVLKSMGINLKDSRVEVEKIIGRGSGFVAVEIPFTPRAKRVLE  178


 Score = 43.9 bits (102),  Expect(2) = 8e-37, Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 39/75 (52%), Gaps = 5/75 (7%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MAR+L   T  P L  G  +           K +R V M+ +SQ+P L ++SF+GLR  N
Sbjct  1    MARLLANFTARPLLGPGRHV-----QSDDYRKPRRCVKMMYTSQTPVLSIQSFSGLRAAN  55

Query  243  ALDTMARSGQTLHSK  287
            A+D +AR      SK
Sbjct  56   AVDLIARPAHGFFSK  70



>ref|XP_011073186.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Sesamum indicum]
Length=924

 Score =   137 bits (345),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  93   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  152

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  153  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  181


 Score = 43.1 bits (100),  Expect(2) = 1e-36, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 25/38 (66%), Gaps = 1/38 (3%)
 Frame = +3

Query  177  MLCSSQSPSLKLRSFTGLRGGNALDTMAR-SGQTLHSK  287
            MLCS+    L L  FTGLR  NALD M R +GQTL SK
Sbjct  35   MLCSAHFAPLTLTGFTGLRRANALDMMVRQAGQTLQSK  72



>tpg|DAA38057.1| TPA: hypothetical protein ZEAMMB73_563254, partial [Zea mays]
Length=188

 Score =   137 bits (346),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  90   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  149

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  150  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  178



>ref|XP_008778670.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Phoenix dactylifera]
Length=195

 Score =   137 bits (344),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 87/89 (98%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMG+NLKDAR
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGVNLKDAR  150

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  151  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  179


 Score = 43.5 bits (101),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 4/74 (5%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MA  LVQS  +PS V     GQ KG+GK +    +   M+ + +S  L+L+ F GLRG N
Sbjct  1    MAGALVQSAILPSQVVSRNRGQLKGAGKTR----KAPKMMGNLRSHPLRLQDFAGLRGAN  56

Query  243  ALDTMARSGQTLHS  284
             LD ++RS Q  HS
Sbjct  57   NLDLLSRSRQDFHS  70



>ref|XP_006279971.1| hypothetical protein CARUB_v10025837mg [Capsella rubella]
 gb|EOA12869.1| hypothetical protein CARUB_v10025837mg [Capsella rubella]
Length=929

 Score =   137 bits (346),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  94   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  153

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  154  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  182


 Score = 42.0 bits (97),  Expect(2) = 2e-36, Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 44/78 (56%), Gaps = 6/78 (8%)
 Frame = +3

Query  57   GIMARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSS-QSPSLKLRSFTGLR  233
             +  RVL QST  PSL    A  Q     +G G+ +R V M+CS  Q    +++ F GLR
Sbjct  2    AMATRVLAQSTP-PSL----ACYQRNVPSRGSGRSRRSVKMMCSQLQVSGSRMQGFLGLR  56

Query  234  GGNALDTMARSGQTLHSK  287
            G NALDT+ ++ Q  HSK
Sbjct  57   GSNALDTLGKTRQDFHSK  74



>ref|XP_008791045.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Phoenix dactylifera]
Length=920

 Score =   137 bits (345),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  150

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  151  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  179


 Score = 42.4 bits (98),  Expect(2) = 2e-36, Method: Composition-based stats.
 Identities = 30/74 (41%), Positives = 41/74 (55%), Gaps = 4/74 (5%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MA  L QS  +P+ V     GQ KGSGK +        M+C+ +   L+L+ F GLRG N
Sbjct  1    MAGALFQSAILPAQVLSRNRGQLKGSGKAR----EAAKMMCNMRLHPLRLQGFAGLRGSN  56

Query  243  ALDTMARSGQTLHS  284
             LD ++RS +  HS
Sbjct  57   NLDLLSRSRRDFHS  70



>emb|CDX68504.1| BnaC01g25820D [Brassica napus]
Length=928

 Score =   135 bits (340),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+R
Sbjct  91   MFERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSR  150

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  151  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  179


 Score = 43.9 bits (102),  Expect(2) = 2e-36, Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 39/75 (52%), Gaps = 5/75 (7%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MAR+L   T  P L  G  +           K +R V M+ +SQ+P L ++SF+GLR  N
Sbjct  1    MARLLANFTARPLLGPGRHV-----QSDEYRKPRRCVKMMYTSQTPVLSIQSFSGLRSAN  55

Query  243  ALDTMARSGQTLHSK  287
            A+D +AR      SK
Sbjct  56   AVDLIARPAHGFFSK  70



>gb|AAC04687.1| ClpC [Arabidopsis thaliana]
Length=928

 Score =   137 bits (345),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  93   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  152

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  153  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  181


 Score = 41.6 bits (96),  Expect(2) = 2e-36, Method: Composition-based stats.
 Identities = 33/77 (43%), Positives = 43/77 (56%), Gaps = 5/77 (6%)
 Frame = +3

Query  57   GIMARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRG  236
             +  RVL QST  PSL    A  Q     +G G+ +R V M+C   +  L ++ F GLRG
Sbjct  2    AMATRVLAQSTP-PSL----ACYQRNVPSRGSGRSRRSVKMMCIIFNVWLPMQGFMGLRG  56

Query  237  GNALDTMARSGQTLHSK  287
             NALDT+ +S Q  HSK
Sbjct  57   NNALDTLGKSRQDFHSK  73



>ref|XP_010536587.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like isoform 
X2 [Tarenaya hassleriana]
Length=929

 Score =   137 bits (346),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  95   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  154

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  155  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  183


 Score = 41.6 bits (96),  Expect(2) = 3e-36, Method: Composition-based stats.
 Identities = 18/31 (58%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +3

Query  195  SPSLKLRSFTGLRGGNALDTMARSGQTLHSK  287
            SP L+++ F GLRG N LDT+ RS Q  HSK
Sbjct  45   SPGLRIQGFLGLRGQNVLDTLGRSHQDFHSK  75



>ref|XP_010536586.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like isoform 
X1 [Tarenaya hassleriana]
Length=936

 Score =   137 bits (345),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  102  MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  161

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  162  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  190


 Score = 41.6 bits (96),  Expect(2) = 3e-36, Method: Composition-based stats.
 Identities = 18/31 (58%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +3

Query  195  SPSLKLRSFTGLRGGNALDTMARSGQTLHSK  287
            SP L+++ F GLRG N LDT+ RS Q  HSK
Sbjct  52   SPGLRIQGFLGLRGQNVLDTLGRSHQDFHSK  82



>ref|XP_010482409.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Camelina sativa]
Length=929

 Score =   137 bits (346),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  94   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  153

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  154  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  182


 Score = 40.8 bits (94),  Expect(2) = 3e-36, Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 43/78 (55%), Gaps = 6/78 (8%)
 Frame = +3

Query  57   GIMARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSS-QSPSLKLRSFTGLR  233
             +  RVL QST  PSL    A  Q     +G G+ +R V M+CS  Q    +++ F GLR
Sbjct  2    AMATRVLAQSTP-PSL----ACYQRNVPSRGSGRSRRSVKMMCSQLQVSGSRMQGFMGLR  56

Query  234  GGNALDTMARSGQTLHSK  287
            G NALDT+  + Q  HSK
Sbjct  57   GSNALDTLGSTRQDFHSK  74



>ref|XP_010442575.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Camelina 
sativa]
Length=929

 Score =   137 bits (346),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  94   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  153

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  154  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  182


 Score = 40.8 bits (94),  Expect(2) = 3e-36, Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 43/78 (55%), Gaps = 6/78 (8%)
 Frame = +3

Query  57   GIMARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSS-QSPSLKLRSFTGLR  233
             +  RVL QST  PSL    A  Q     +G G+ +R V M+CS  Q    +++ F GLR
Sbjct  2    AMATRVLAQSTP-PSL----ACYQRNVPSRGSGRSRRSVKMMCSQLQVSGSRMQGFMGLR  56

Query  234  GGNALDTMARSGQTLHSK  287
            G NALDT+  + Q  HSK
Sbjct  57   GSNALDTLGSTRQDFHSK  74



>ref|WP_032554674.1| hypothetical protein, partial [Prochlorococcus sp. scB245a_518J7]
Length=91

 Score =   133 bits (334),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKS+G+NLKD+R
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSLGVNLKDSR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|XP_010555578.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Tarenaya hassleriana]
 ref|XP_010555579.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Tarenaya hassleriana]
Length=927

 Score =   137 bits (345),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  94   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  153

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  154  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  182


 Score = 41.2 bits (95),  Expect(2) = 4e-36, Method: Composition-based stats.
 Identities = 18/37 (49%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = +3

Query  177  MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSK  287
            M    Q+P L+++ F GLRG N LD + RS Q  HSK
Sbjct  38   MSSQPQAPGLRIQGFLGLRGQNVLDMLGRSRQDFHSK  74



>ref|WP_032558761.1| hypothetical protein, partial [Prochlorococcus sp. scB243_498A3]
Length=100

 Score =   133 bits (335),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKS+G+NLKD+R
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSLGVNLKDSR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|XP_010550758.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Tarenaya hassleriana]
 ref|XP_010550759.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Tarenaya hassleriana]
Length=926

 Score =   128 bits (322),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEA+RLGHNFVGTEQILLGLIGEGTGIAAKVLKS+GINLK AR
Sbjct  90   MFERFTEKAIKVIMLAQEEAQRLGHNFVGTEQILLGLIGEGTGIAAKVLKSLGINLKYAR  149

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAK VLE
Sbjct  150  VEVEKIIGRGSGFVAVEIPFTPRAKHVLE  178


 Score = 49.7 bits (117),  Expect(2) = 5e-36, Method: Composition-based stats.
 Identities = 32/75 (43%), Positives = 48/75 (64%), Gaps = 5/75 (7%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MAR+L  ST + SL A     ++    +G GK +R V M+ + ++P L+++SF+GLR  N
Sbjct  1    MARLLAHST-VSSLFAS----RWNVQSQGSGKPRRYVKMMYNLEAPGLRIQSFSGLRSSN  55

Query  243  ALDTMARSGQTLHSK  287
            +LD +ARSG   HSK
Sbjct  56   SLDFIARSGHDFHSK  70



>ref|XP_002877635.1| AtClpC [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53894.1| AtClpC [Arabidopsis lyrata subsp. lyrata]
Length=953

 Score =   135 bits (339),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+R
Sbjct  114  MFERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSR  173

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  174  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  202


 Score = 43.1 bits (100),  Expect(2) = 5e-36, Method: Composition-based stats.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  171  VAMLCSSQSPSLKLRSFTGLRGGNALDTMAR  263
            V M+CS Q+P LK++SF+GLR  +ALD MAR
Sbjct  56   VKMMCSLQAPVLKIQSFSGLRAPSALDYMAR  86



>ref|XP_006485108.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like isoform X1 [Citrus sinensis]
 ref|XP_006485109.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like isoform X2 [Citrus sinensis]
Length=923

 Score =   137 bits (345),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  150

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  151  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  179


 Score = 40.8 bits (94),  Expect(2) = 6e-36, Method: Composition-based stats.
 Identities = 27/64 (42%), Positives = 37/64 (58%), Gaps = 4/64 (6%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MAR+L Q TN P+LV G    Q     +  G+ +R V M+   Q  + ++ SF+GLR  N
Sbjct  1    MARLLAQLTNAPALVPGGRHFQ----SQNAGRSRRNVKMMSYMQPSASRISSFSGLRRSN  56

Query  243  ALDT  254
            ALDT
Sbjct  57   ALDT  60



>ref|XP_010442573.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Camelina 
sativa]
Length=929

 Score =   137 bits (346),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  94   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  153

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  154  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  182


 Score = 40.0 bits (92),  Expect(2) = 6e-36, Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 43/78 (55%), Gaps = 6/78 (8%)
 Frame = +3

Query  57   GIMARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSS-QSPSLKLRSFTGLR  233
             +  RVL QST  PSL    A  Q     +G G+ +R V M+CS  Q    +++ F GLR
Sbjct  2    AMATRVLAQSTP-PSL----ACYQRNVPSRGSGRSRRSVKMMCSQLQVSGSRMQGFMGLR  56

Query  234  GGNALDTMARSGQTLHSK  287
            G NALDT+  + Q  HSK
Sbjct  57   GRNALDTLGSTRQDFHSK  74



>ref|WP_032553896.1| hypothetical protein, partial [Prochlorococcus sp. scB243_498J20]
Length=123

 Score =   133 bits (335),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKS+G+NLKD+R
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSLGVNLKDSR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|XP_010426385.1| PREDICTED: chaperone protein ClpC2, chloroplastic [Camelina sativa]
 ref|XP_010426386.1| PREDICTED: chaperone protein ClpC2, chloroplastic [Camelina sativa]
Length=927

 Score =   135 bits (339),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+R
Sbjct  89   MFERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSR  148

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  149  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  177


 Score = 42.0 bits (97),  Expect(2) = 1e-35, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 25/39 (64%), Gaps = 0/39 (0%)
 Frame = +3

Query  171  VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSK  287
            V M+ S Q+P LK++ FTGLR  NALD  AR  Q   SK
Sbjct  31   VKMMFSVQAPVLKIQCFTGLRASNALDFRARPSQDFVSK  69



>gb|EMS48250.1| ATP-dependent Clp protease ATP-binding subunit clpA-like protein 
CD4B, chloroplastic [Triticum urartu]
Length=241

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQ+LLGL+GEGTGIAAKVLKSMGINLKDAR
Sbjct  138  MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQVLLGLVGEGTGIAAKVLKSMGINLKDAR  197

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRG+GFVAVEIPFTPRAKRVLE
Sbjct  198  VEVEKIIGRGNGFVAVEIPFTPRAKRVLE  226



>gb|KIY94281.1| ATP-dependent Clp protease ATP-binding subunit ClpC [Monoraphidium 
neglectum]
Length=300

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKV+MLAQEEARRLGHNFVGTEQILLGLIGE TGIAAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVVMLAQEEARRLGHNFVGTEQILLGLIGESTGIAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|XP_009149790.1| PREDICTED: LOW QUALITY PROTEIN: chaperone protein ClpC2, chloroplastic 
[Brassica rapa]
Length=930

 Score =   135 bits (340),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+R
Sbjct  91   MFERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSR  150

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  151  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  179


 Score = 39.7 bits (91),  Expect(2) = 4e-35, Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 39/75 (52%), Gaps = 5/75 (7%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MAR+L  ST+   L +G          +   K +R V M+ +SQ+  L ++SF+GLR  N
Sbjct  1    MARLLANSTSRSLLGSGRDF-----QSEDYRKPRRCVKMMYTSQTSVLSIQSFSGLRASN  55

Query  243  ALDTMARSGQTLHSK  287
            ALD +AR       K
Sbjct  56   ALDRVARPSHDFFGK  70



>ref|XP_006290259.1| hypothetical protein CARUB_v10016640mg [Capsella rubella]
 gb|EOA23157.1| hypothetical protein CARUB_v10016640mg [Capsella rubella]
Length=977

 Score =   135 bits (341),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 87/89 (98%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+R
Sbjct  139  MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSR  198

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  199  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  227


 Score = 39.3 bits (90),  Expect(2) = 4e-35, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 21/34 (62%), Gaps = 0/34 (0%)
 Frame = +3

Query  171  VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQ  272
            V M+ S Q+P LKL SF GLR  N LD M R  Q
Sbjct  81   VKMMYSCQAPVLKLHSFAGLRATNPLDIMGRPRQ  114



>gb|EMS54417.1| ATP-dependent Clp protease ATP-binding subunit clpA-like protein 
CD4B, chloroplastic [Triticum urartu]
Length=376

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  85   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  144

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  145  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  173



>ref|XP_006290258.1| hypothetical protein CARUB_v10016640mg [Capsella rubella]
 gb|EOA23156.1| hypothetical protein CARUB_v10016640mg [Capsella rubella]
Length=750

 Score =   135 bits (341),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 87/89 (98%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+R
Sbjct  139  MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSR  198

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  199  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  227


 Score = 38.9 bits (89),  Expect(2) = 6e-35, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 21/34 (62%), Gaps = 0/34 (0%)
 Frame = +3

Query  171  VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQ  272
            V M+ S Q+P LKL SF GLR  N LD M R  Q
Sbjct  81   VKMMYSCQAPVLKLHSFAGLRATNPLDIMGRPRQ  114



>ref|XP_010503529.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like [Camelina 
sativa]
 ref|XP_010503530.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like [Camelina 
sativa]
Length=928

 Score =   135 bits (339),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+R
Sbjct  90   MFERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSR  149

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  150  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  178


 Score = 39.3 bits (90),  Expect(2) = 6e-35, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 27/40 (68%), Gaps = 1/40 (3%)
 Frame = +3

Query  171  VAMLCSSQSPSLKLRSFTGLRGGNALDTMAR-SGQTLHSK  287
            V M+ SSQ+P LK++ FTGL+  NALD  AR S Q   SK
Sbjct  31   VKMMFSSQAPVLKIQCFTGLKASNALDFRARPSHQDFVSK  70



>ref|XP_009132682.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Brassica rapa]
Length=929

 Score =   137 bits (346),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  94   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  153

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  154  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  182


 Score = 36.6 bits (83),  Expect(2) = 7e-35, Method: Composition-based stats.
 Identities = 18/42 (43%), Positives = 25/42 (60%), Gaps = 1/42 (2%)
 Frame = +3

Query  165  RVVAMLCSS-QSPSLKLRSFTGLRGGNALDTMARSGQTLHSK  287
            R V M+C+  Q    +++ F GLRG N LDT+ RS Q+   K
Sbjct  33   RSVKMMCTQLQVSGSRMQGFLGLRGNNVLDTLGRSRQSFGGK  74



>emb|CDY45800.1| BnaC03g16230D [Brassica napus]
Length=921

 Score =   137 bits (346),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  95   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  154

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  155  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  183


 Score = 36.6 bits (83),  Expect(2) = 7e-35, Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 26/41 (63%), Gaps = 2/41 (5%)
 Frame = +3

Query  171  VAMLCSSQ--SPSLKLRSFTGLRGGNALDTMARSGQTLHSK  287
            V M+C+    S S +++ F GLRG NALDT+ RS Q+   K
Sbjct  35   VKMMCTQLQVSGSSRMQGFLGLRGNNALDTLGRSRQSFGGK  75



>ref|XP_010929657.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Elaeis guineensis]
Length=920

 Score =   137 bits (346),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  150

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  151  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  179


 Score = 37.0 bits (84),  Expect(2) = 7e-35, Method: Composition-based stats.
 Identities = 30/74 (41%), Positives = 43/74 (58%), Gaps = 4/74 (5%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MA  LVQS  +P+ V      Q KGSG+ +G  K    M+ + +  S++L+ F GLRG N
Sbjct  1    MAGALVQSAVLPAQVLSRNHRQLKGSGRTRGAAK----MMYNMRLHSIRLQGFAGLRGSN  56

Query  243  ALDTMARSGQTLHS  284
             LD ++RS +  HS
Sbjct  57   NLDLLSRSRRDFHS  70



>ref|XP_008811697.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4A, chloroplastic-like [Phoenix dactylifera]
Length=916

 Score =   133 bits (335),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKS+GI+LKDAR
Sbjct  90   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSLGISLKDAR  149

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  150  IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  178


 Score = 41.2 bits (95),  Expect(2) = 7e-35, Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 39/74 (53%), Gaps = 5/74 (7%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MA  LV+S   P++ +   I       +G  +  R+  M+C+ +   L+L  FTGLR  N
Sbjct  1    MAGTLVKSATFPAVTSRAHI-----QIQGSRRPSRLTLMMCNVRVSPLRLHGFTGLRQLN  55

Query  243  ALDTMARSGQTLHS  284
            ALD   +SG+  HS
Sbjct  56   ALDFPYKSGKDFHS  69



>ref|XP_010515218.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like [Camelina 
sativa]
 ref|XP_010515219.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like [Camelina 
sativa]
Length=928

 Score =   135 bits (339),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+R
Sbjct  90   MFERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSR  149

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  150  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  178


 Score = 38.1 bits (87),  Expect(2) = 1e-34, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 26/40 (65%), Gaps = 1/40 (3%)
 Frame = +3

Query  171  VAMLCSSQSPSLKLRSFTGLRGGNALDTMAR-SGQTLHSK  287
            V M+ S Q+P LK++ FTGLR  NALD  AR S Q   SK
Sbjct  31   VKMMFSLQAPVLKIQCFTGLRASNALDFRARPSHQDFVSK  70



>ref|XP_009403788.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=922

 Score =   137 bits (346),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  150

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  151  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  179


 Score = 35.0 bits (79),  Expect(2) = 2e-34, Method: Composition-based stats.
 Identities = 25/74 (34%), Positives = 42/74 (57%), Gaps = 4/74 (5%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MA  LVQS  +P++    A+ + +   +G GK KR   M+C  +  SL+L+ F GLR  +
Sbjct  1    MAGSLVQSAILPTV----AVNRIQSHLRGSGKVKRGSKMMCQPRKHSLRLQGFAGLRRSD  56

Query  243  ALDTMARSGQTLHS  284
             ++  +R+ +  HS
Sbjct  57   NVEFSSRNQRDFHS  70



>ref|XP_009393873.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=922

 Score =   137 bits (345),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  150

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  151  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  179


 Score = 35.4 bits (80),  Expect(2) = 2e-34, Method: Composition-based stats.
 Identities = 30/74 (41%), Positives = 39/74 (53%), Gaps = 4/74 (5%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MA  LV S  +PS V   +  Q +GSGK K    R   M+ S +   L+L+SF GLR  +
Sbjct  1    MADSLVHSAILPSAVMTRSQSQLRGSGKAK----RGAKMVRSMRMHPLRLQSFAGLRAAD  56

Query  243  ALDTMARSGQTLHS  284
             LD  +R  Q  HS
Sbjct  57   NLDFSSRCQQDFHS  70



>gb|EDZ93048.1| Clp domain protein [Arthrospira maxima CS-328]
Length=402

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|XP_009387981.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009387982.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=922

 Score =   137 bits (345),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  91   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  150

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  151  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  179


 Score = 35.0 bits (79),  Expect(2) = 3e-34, Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 38/74 (51%), Gaps = 4/74 (5%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MA  LVQ T +PS +A     Q +GSGK K    R   M+C  Q   L+L  F GLR  +
Sbjct  1    MAGSLVQLTILPSALANRRQSQLRGSGKAK----RGAKMMCQLQMHPLRLPGFAGLRRAD  56

Query  243  ALDTMARSGQTLHS  284
             L+  +R+    HS
Sbjct  57   NLEFFSRNRHDFHS  70



>gb|EMT20100.1| ATP-dependent Clp protease ATP-binding subunit clpA-like CD4A 
protein, chloroplastic [Aegilops tauschii]
Length=546

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  85   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  144

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  145  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  173



>ref|XP_009411804.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Musa acuminata subsp. malaccensis]
 ref|XP_009411805.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=921

 Score =   137 bits (344),  Expect(2) = 9e-34, Method: Compositional matrix adjust.
 Identities = 87/89 (98%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  90   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  149

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  150  IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  178


 Score = 33.9 bits (76),  Expect(2) = 9e-34, Method: Composition-based stats.
 Identities = 23/62 (37%), Positives = 34/62 (55%), Gaps = 5/62 (8%)
 Frame = +3

Query  63   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  242
            MAR L +S+ +P  V+G          +G GK ++   M+CS +S  L+   FTGL+G N
Sbjct  1    MARPLFKSSVLPDAVSGSV-----PLFQGSGKARKPANMMCSRRSSQLRFLGFTGLKGSN  55

Query  243  AL  248
             L
Sbjct  56   DL  57



>gb|EEC77204.1| hypothetical protein OsI_15716 [Oryza sativa Indica Group]
Length=785

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  87   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  146

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  147  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  175



>gb|ABK95905.1| unknown [Populus trichocarpa]
Length=835

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>gb|KIZ07494.1| ATP-dependent Clp protease ATP-binding subunit ClpC [Monoraphidium 
neglectum]
Length=938

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 87/95 (92%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +1

Query  325  AVLLLKLFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGI  504
            AV +  +FERFTEKAIKV+MLAQEEARRLGHNFVGTEQILLGLIGE TGIAAKVLKSMG+
Sbjct  73   AVRVNAMFERFTEKAIKVVMLAQEEARRLGHNFVGTEQILLGLIGESTGIAAKVLKSMGV  132

Query  505  NLKDARVEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            NLKDARVEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  133  NLKDARVEVEKIIGRGSGFVAVEIPFTPRAKRVLE  167



>ref|WP_044105586.1| Clp protease ClpX [cyanobacterium endosymbiont of Epithemia turgida]
 dbj|BAP16974.1| ATP-dependent Clp protease regulatory subunit [cyanobacterium 
endosymbiont of Epithemia turgida isolate EtSB Lake Yunoko]
Length=823

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 87/89 (98%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMGINLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGINLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|XP_006652229.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Oryza 
brachyantha]
Length=888

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  57   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  116

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  117  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  145



>ref|XP_006374569.1| hypothetical protein POPTR_0015s11640g [Populus trichocarpa]
 gb|ERP52366.1| hypothetical protein POPTR_0015s11640g [Populus trichocarpa]
Length=835

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>emb|CDX84888.1| BnaA03g13420D [Brassica napus]
Length=827

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|XP_003575034.2| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Brachypodium 
distachyon]
Length=921

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  90   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  149

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  150  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  178



>ref|XP_002447724.1| hypothetical protein SORBIDRAFT_06g014590 [Sorghum bicolor]
 gb|EES12052.1| hypothetical protein SORBIDRAFT_06g014590 [Sorghum bicolor]
Length=921

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  90   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  149

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  150  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  178



>ref|XP_003575035.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Brachypodium 
distachyon]
Length=921

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  90   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  149

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  150  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  178



>emb|CAE05148.2| OSJNBa0039C07.4 [Oryza sativa Japonica Group]
Length=888

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  57   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  116

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  117  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  145



>sp|Q7F9I1.2|CLPC1_ORYSJ RecName: Full=Chaperone protein ClpC1, chloroplastic; AltName: 
Full=ATP-dependent Clp protease ATP-binding subunit ClpC homolog 
1; AltName: Full=Casein lytic proteinase C1; Flags: Precursor 
[Oryza sativa Japonica Group]
Length=918

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  87   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  146

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  147  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  175



>sp|P46523.1|CLPA_BRANA RecName: Full=ATP-dependent Clp protease ATP-binding subunit 
clpA homolog, chloroplastic; Flags: Precursor, partial [Brassica 
napus]
 emb|CAA53077.1| clpA [Brassica napus]
Length=874

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  41   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  100

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  101  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  129



>ref|WP_039899756.1| Clp protease ClpX, partial [Microcystis sp. T1-4]
Length=718

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>gb|KGN63436.1| hypothetical protein Csa_1G000600 [Cucumis sativus]
Length=862

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  31   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  90

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  91   VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  119



>emb|CAN78847.1| hypothetical protein VITISV_010724 [Vitis vinifera]
Length=890

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  65   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  124

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  125  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  153



>ref|WP_015162264.1| ATPase with chaperone activity, ATP-binding subunit [Chamaesiphon 
minutus]
 gb|AFY96180.1| ATPase with chaperone activity, ATP-binding subunit [Chamaesiphon 
minutus PCC 6605]
Length=833

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMGINLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGINLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|XP_004975454.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Setaria 
italica]
Length=921

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  90   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  149

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  150  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  178



>gb|AAL10478.1| AT3g48870/T21J18_140 [Arabidopsis thaliana]
Length=558

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+R
Sbjct  114  MFERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSR  173

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  174  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  202



>gb|EAZ30583.1| hypothetical protein OsJ_14634 [Oryza sativa Japonica Group]
Length=1033

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  202  MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  261

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  262  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  290



>ref|WP_038544339.1| Clp protease ClpX [Synechococcus sp. KORDI-100]
 gb|AII43210.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. KORDI-100]
Length=862

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_011364587.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. CC9605]
 gb|ABB35376.1| ATPase [Synechococcus sp. CC9605]
Length=846

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_038554285.1| Clp protease ClpX [Synechococcus sp. KORDI-52]
 gb|AII49099.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. KORDI-52]
Length=846

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_012162462.1| ATP-dependent Clp protease ATP-binding protein [Acaryochloris 
marina]
 gb|ABW26964.1| ATP-dependent protease, ATP-binding subunit ClpC [Acaryochloris 
marina MBIC11017]
Length=822

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|NP_001190035.1| Clp ATPase [Arabidopsis thaliana]
 gb|AEE78467.1| Clp ATPase [Arabidopsis thaliana]
Length=921

 Score =   135 bits (340),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+R
Sbjct  83   MFERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSR  142

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  143  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  171


 Score = 33.9 bits (76),  Expect(2) = 2e-33, Method: Composition-based stats.
 Identities = 15/31 (48%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +3

Query  171  VAMLCSSQSPSLKLRSFTGLRGGNALDTMAR  263
            V M+ S Q+P L ++SF+GLR  +ALD + R
Sbjct  25   VKMMSSLQAPLLTIQSFSGLRAPSALDYLGR  55



>ref|NP_050661.1| Clp protease ATP binding subunit (chloroplast) [Guillardia theta]
 sp|O78410.1|CLPC_GUITH RecName: Full=ATP-dependent Clp protease ATP-binding subunit 
clpA homolog (chloroplast) [Guillardia theta]
 gb|AAC35595.1| Clp protease ATP binding subunit (chloroplast) [Guillardia theta]
Length=819

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 87/89 (98%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_010467511.1| ATP-dependent Clp protease ATP-binding protein [Acaryochloris 
sp. CCMEE 5410]
Length=822

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|XP_010446016.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Camelina 
sativa]
Length=546

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNF+GTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFMGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAK VLE
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPRAKHVLE  89



>ref|WP_028951828.1| Clp protease ClpX [Synechococcus sp. CC9616]
Length=856

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_002777520.1| ATP-dependent Clp protease ATP-binding protein [Microcystis aeruginosa]
 emb|CCI07823.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 7941]
 gb|EPF22760.1| Negative regulator of genetic competence ClpC/MecB [Microcystis 
aeruginosa SPC777]
Length=821

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>gb|AHF63374.1| ATPase [Synechococcus sp. WH 8109]
Length=846

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_004160623.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa]
 emb|CCI13172.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 9806]
Length=821

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_002732350.1| ATP-dependent Clp protease ATP-binding protein [Microcystis aeruginosa]
 emb|CAO87778.1| clpC [Microcystis aeruginosa PCC 7806]
 emb|CCH96065.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 9717]
 emb|CCI26165.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 9808]
 emb|CCI35401.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 9701]
 gb|ELP55843.1| clp amino terminal domain protein [Microcystis aeruginosa TAIHU98]
 gb|ELS46866.1| clp amino terminal domain protein [Microcystis aeruginosa DIANCHI905]
 dbj|GAL91758.1| ATP-dependent Clp protease, ATP-binding subunit ClpC [Microcystis 
aeruginosa NIES-44]
Length=821

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_008226206.1| ATP-dependent Clp protease, ATP-binding subunit ClpC / Negative 
regulator of genetic competence clcC/mecB [Richelia intracellularis]
 emb|CCH64853.1| ATP-dependent Clp protease, ATP-binding subunit ClpC / Negative 
regulator of genetic competence clcC/mecB [Richelia intracellularis 
HM01]
Length=822

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_041428551.1| Clp protease ClpX [Synechococcus sp. WH 7803]
Length=857

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_015111477.1| ATPase [Nostoc sp. PCC 7107]
 gb|AFY41237.1| ATPase AAA-2 domain protein [Nostoc sp. PCC 7107]
Length=823

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_015107874.1| chaperone ATPase [Cyanobium gracile]
 gb|AFY27415.1| ATPase with chaperone activity, ATP-binding subunit [Cyanobium 
gracile PCC 6307]
Length=849

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_007100194.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. RS9917]
 gb|EAQ68890.1| endopeptidase Clp ATP-binding chain C [Synechococcus sp. RS9917]
Length=860

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_044521582.1| Clp protease ClpX [Nostoc sp. PCC 7120]
Length=823

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_002765002.1| ATP-dependent Clp protease ATP-binding protein [Microcystis aeruginosa]
 emb|CCI03294.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 9443]
 emb|CCI17774.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 9807]
Length=821

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_004158851.1| ATP-dependent Clp protease ATP-binding protein [Microcystis aeruginosa]
 emb|CCH94083.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 9432]
Length=821

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_011127803.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. WH 8102]
 emb|CAE07453.1| endopeptidase Clp ATP-binding chain C [Synechococcus sp. WH 8102]
Length=846

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|YP_001293474.1| Clp protease ATP binding subunit [Rhodomonas salina]
 gb|ABO70723.1| Clp protease ATP binding subunit [Rhodomonas salina]
Length=819

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 87/89 (98%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_041555480.1| Clp protease ClpX [Nostoc sp. PCC 7524]
Length=823

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_011317764.1| ATP-dependent Clp protease ATP-binding protein [Anabaena variabilis]
 gb|ABA20534.1| UvrB/UvrC protein [Anabaena variabilis ATCC 29413]
Length=823

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_006852318.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. WH 8016]
 gb|EHA63138.1| ATPase AAA-2 domain protein [Synechococcus sp. WH 8016]
Length=860

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_023174246.1| ATPase AAA-2 domain protein [Gloeobacter kilaueensis]
 gb|AGY59031.1| ATPase AAA-2 domain protein [Gloeobacter kilaueensis JS1]
Length=821

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_006170858.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. WH 5701]
 gb|EAQ74030.1| endopeptidase Clp ATP-binding chain C [Synechococcus sp. WH 5701]
Length=856

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|XP_004975455.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Setaria 
italica]
Length=918

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 87/89 (98%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKV+MLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  87   MFERFTEKAIKVVMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  146

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  147  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  175



>ref|NP_566912.2| Clp ATPase [Arabidopsis thaliana]
 sp|Q9SXJ7.1|CLPC2_ARATH RecName: Full=Chaperone protein ClpC2, chloroplastic; AltName: 
Full=ATP-dependent Clp protease ATP-binding subunit ClpC homolog 
2; AltName: Full=AtClpC; AltName: Full=Casein lytic proteinase 
C2; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAA82062.1| AtClpC [Arabidopsis thaliana]
 gb|AEE78466.1| Clp ATPase [Arabidopsis thaliana]
Length=952

 Score =   135 bits (339),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+R
Sbjct  114  MFERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSR  173

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  174  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  202


 Score = 33.9 bits (76),  Expect(2) = 3e-33, Method: Composition-based stats.
 Identities = 15/31 (48%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +3

Query  171  VAMLCSSQSPSLKLRSFTGLRGGNALDTMAR  263
            V M+ S Q+P L ++SF+GLR  +ALD + R
Sbjct  56   VKMMSSLQAPLLTIQSFSGLRAPSALDYLGR  86



>ref|WP_006041704.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. WH 7805]
 gb|EAR18013.1| ATPase [Synechococcus sp. WH 7805]
Length=857

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_029638478.1| Clp protease ClpX [[Scytonema hofmanni] UTEX B 1581]
Length=823

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|XP_008663153.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Zea mays]
 gb|AFW58112.1| hypothetical protein ZEAMMB73_120778 [Zea mays]
Length=921

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 87/89 (98%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKV+KSMGINLKDAR
Sbjct  90   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVMKSMGINLKDAR  149

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  150  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  178



>ref|WP_043691512.1| Clp protease ClpX [Synechococcus sp. KORDI-49]
 gb|AII45534.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. KORDI-49]
Length=843

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_011377512.1| MULTISPECIES: ATP-dependent Clp protease ATP-binding protein 
[Synechococcus]
 gb|ABB56292.1| ATPase [Synechococcus elongatus PCC 7942]
 gb|AJD56659.1| Clp protease ClpX [Synechococcus sp. UTEX 2973]
Length=824

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_010303504.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. CB0101]
Length=853

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>dbj|BAB74698.1| endopeptidase Clp ATP-binding chain [Nostoc sp. PCC 7120]
Length=839

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  17   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  76

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  77   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  105



>emb|CAB87915.1| AtClpC [Arabidopsis thaliana]
Length=952

 Score =   135 bits (339),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+R
Sbjct  114  MFERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSR  173

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  174  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  202


 Score = 33.9 bits (76),  Expect(2) = 3e-33, Method: Composition-based stats.
 Identities = 15/31 (48%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +3

Query  171  VAMLCSSQSPSLKLRSFTGLRGGNALDTMAR  263
            V M+ S Q+P L ++SF+GLR  +ALD + R
Sbjct  56   VKMMSSLQAPLLTIQSFSGLRAPSALDYLGR  86



>ref|WP_015126250.1| chaperone ATPase [Synechococcus sp. PCC 6312]
 gb|AFY62713.1| ATPase with chaperone activity, ATP-binding subunit [Synechococcus 
sp. PCC 6312]
Length=824

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_008231833.1| ATP-dependent Clp protease, ATP-binding subunit ClpC / Negative 
regulator of genetic competence clcC/mecB [Richelia intracellularis]
 emb|CCH66412.1| ATP-dependent Clp protease, ATP-binding subunit ClpC / Negative 
regulator of genetic competence clcC/mecB [Richelia intracellularis 
HH01]
Length=822

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_019498394.1| ATP-dependent Clp protease ATP-binding protein [Pseudanabaena 
sp. PCC 6802]
Length=828

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_041458572.1| Clp protease ClpX [Anabaena sp. 90]
Length=822

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_015166859.1| chaperone ATPase [Synechococcus sp. PCC 7502]
 gb|AFY72200.1| ATPase with chaperone activity, ATP-binding subunit [Synechococcus 
sp. PCC 7502]
Length=828

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_006910091.1| ATP-dependent Clp protease ATP-binding protein [Cyanobium sp. 
PCC 7001]
 gb|EDY38192.1| ATPase, AAA family [Cyanobium sp. PCC 7001]
Length=843

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_039200429.1| Clp protease ClpX [Aphanizomenon flos-aquae]
 gb|KHG42537.1| Clp protease ClpX [Aphanizomenon flos-aquae 2012/KM1/D3]
Length=823

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_017741509.1| ATP-dependent Clp protease ATP-binding protein [Scytonema hofmanni]
Length=823

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_007353377.1| MULTISPECIES: ATP-dependent Clp protease ATP-binding protein 
[Kamptonema]
 emb|CBN54150.1| ATPase AAA-2 [ [[Oscillatoria] sp. PCC 6506]
Length=823

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_015189078.1| ATPase AAA-2 domain protein [Gloeocapsa sp. PCC 7428]
 gb|AFZ31206.1| ATPase AAA-2 domain protein [Gloeocapsa sp. PCC 7428]
Length=825

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_039726508.1| MULTISPECIES: Clp protease ClpX [Oscillatoriophycideae]
 gb|KIF14711.1| Clp protease ClpX [Aphanocapsa montana BDHKU210001]
 gb|KIF39633.1| Clp protease ClpX [Lyngbya confervoides BDU141951]
Length=822

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>gb|AAB67745.1| ClpC [Synechococcus elongatus PCC 7942]
Length=839

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  16   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  75

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  76   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  104



>ref|WP_006454749.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. PCC 7335]
 gb|EDX85005.1| ATPase, AAA family [Synechococcus sp. PCC 7335]
Length=826

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>gb|KIE07407.1| Clp protease ClpX [Tolypothrix bouteillei VB521301]
Length=823

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>gb|AFW96628.1| ATP-dependent Clp family protein [Anabaena sp. 90]
Length=838

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  17   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  76

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  77   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  105



>ref|WP_023074118.1| atp-dependent clp protease atp-binding protein [Leptolyngbya 
sp. Heron Island J]
 gb|ESA35054.1| atp-dependent clp protease atp-binding protein [Leptolyngbya 
sp. Heron Island J]
Length=822

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_015128787.1| ATPase [Calothrix sp. PCC 7507]
 gb|AFY32974.1| ATPase AAA-2 domain protein [Calothrix sp. PCC 7507]
Length=822

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_007098208.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. RS9916]
 gb|EAU74102.1| ATPase [Synechococcus sp. RS9916]
Length=859

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_011935205.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. RCC307]
 emb|CAK27691.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Synechococcus 
sp. RCC307]
Length=852

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_009626822.1| ATPase AAA-2 domain protein [Pseudanabaena biceps]
 gb|ELS33048.1| ATPase AAA-2 domain protein [Pseudanabaena biceps PCC 7429]
Length=829

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_027404746.1| Clp protease ClpX [Aphanizomenon flos-aquae]
Length=823

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|XP_002952540.1| hypothetical protein VOLCADRAFT_75431 [Volvox carteri f. nagariensis]
 gb|EFJ46387.1| hypothetical protein VOLCADRAFT_75431 [Volvox carteri f. nagariensis]
Length=915

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 87/99 (88%), Positives = 93/99 (94%), Gaps = 1/99 (1%)
 Frame = +1

Query  316  GEVAVLLLK-LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLK  492
            G    L++K +FERFTEKAIKV+MLAQEEARRLGHNFVGTEQ+LLGLIGE TGIAAKVLK
Sbjct  65   GRAGRLVVKSMFERFTEKAIKVVMLAQEEARRLGHNFVGTEQLLLGLIGESTGIAAKVLK  124

Query  493  SMGINLKDARVEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            SMG+NLKDARVEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  125  SMGVNLKDARVEVEKIIGRGSGFVAVEIPFTPRAKRVLE  163



>ref|WP_035989117.1| Clp protease ClpX [Leptolyngbya sp. KIOST-1]
Length=821

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>gb|AGW80480.1| Clp protease ATP binding subunit [Planktothrix agardhii NIVA-CYA 
68]
Length=825

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_041035515.1| Clp protease ClpX [Tolypothrix campylonemoides]
 gb|KIJ77734.1| Clp protease ClpX [Tolypothrix campylonemoides VB511288]
Length=822

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_022603946.1| ATPase with chaperone activity, ATP-binding subunit [Rubidibacter 
lacunae]
 gb|ERN42931.1| ATPase with chaperone activity, ATP-binding subunit [Rubidibacter 
lacunae KORDI 51-2]
Length=826

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_027250152.1| Clp protease ClpX [Planktothrix agardhii]
Length=825

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_026795885.1| MULTISPECIES: Clp protease ClpX [Planktothrix]
Length=825

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_026785489.1| MULTISPECIES: Clp protease ClpX [Planktothrix]
Length=825

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_009784332.1| ATP-dependent Clp protease ATP-binding protein [Lyngbya sp. PCC 
8106]
 gb|EAW37092.1| ATP-dependent Clp protease regulatory subunit [Lyngbya sp. PCC 
8106]
Length=825

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_006198453.1| ATP-dependent Clp protease ATP-binding protein [Nodularia spumigena]
 gb|EAW43399.1| endopeptidase Clp ATP-binding chain [Nodularia spumigena CCY9414]
 gb|AHJ31070.1| ATP-dependent Clp protease, ATP-binding subunit ClpC / Negative 
regulator of genetic competence clcC/mecB [Nodularia spumigena 
CCY9414]
Length=823

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_017651562.1| ATP-dependent Clp protease ATP-binding protein [Microchaete sp. 
PCC 7126]
Length=822

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_028090149.1| Clp protease ClpX [Dolichospermum circinale]
Length=823

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_015145231.1| chaperone ATPase [Pleurocapsa minor]
 gb|AFY78932.1| ATPase with chaperone activity, ATP-binding subunit [Pleurocapsa 
sp. PCC 7327]
Length=821

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_042153862.1| Clp protease ClpX [Planktothrix agardhii]
 gb|KEI66870.1| ClpC [Planktothrix agardhii NIVA-CYA 126/8]
Length=825

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_040939432.1| Clp protease ClpX [Prochloron didemni]
Length=822

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_012412218.1| ATP-dependent Clp protease ATP-binding protein [Nostoc punctiforme]
 gb|ACC84277.1| ATPase AAA-2 domain protein [Nostoc punctiforme PCC 73102]
Length=822

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_013192942.1| ATP-dependent Clp protease ATP-binding protein [Trichormus azollae]
 gb|ADI65932.1| ATPase AAA-2 domain protein ['Nostoc azollae' 0708]
Length=824

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_015166218.1| ATPase [Pseudanabaena sp. PCC 7367]
 gb|AFY71262.1| ATPase AAA-2 domain protein [Pseudanabaena sp. PCC 7367]
Length=831

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_040943370.1| Clp protease ClpX [Prochloron didemni]
Length=822

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_011142062.1| ATP-dependent Clp protease ATP-binding protein [Gloeobacter violaceus]
 ref|NP_925010.1| endopeptidase Clp ATP-binding chain [Gloeobacter violaceus PCC 
7421]
 dbj|BAC90005.1| endopeptidase Clp ATP-binding chain [Gloeobacter violaceus PCC 
7421]
Length=819

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_012630051.1| ATP-dependent Clp protease ATP-binding protein [Cyanothece sp. 
PCC 7425]
 gb|ACL47009.1| ATPase AAA-2 domain protein [Cyanothece sp. PCC 7425]
Length=825

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>gb|AFY46028.1| ATPase with chaperone activity, ATP-binding subunit [Nostoc sp. 
PCC 7524]
Length=856

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  34   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  93

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  94   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  122



>ref|WP_026097796.1| Clp protease ClpX [Geitlerinema sp. PCC 7105]
Length=822

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_015206692.1| ATPase with chaperone activity, ATP-binding subunit [Cylindrospermum 
stagnale]
 gb|AFZ23436.1| ATPase with chaperone activity, ATP-binding subunit [Cylindrospermum 
stagnale PCC 7417]
Length=823

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_036485541.1| Clp protease ClpX [Myxosarcina sp. GI1]
Length=822

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_015216290.1| ATPase AAA-2 domain protein [Anabaena cylindrica]
 gb|AFZ59673.1| ATPase AAA-2 domain protein [Anabaena cylindrica PCC 7122]
Length=824

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_017318713.1| ATP-dependent Clp protease ATP-binding protein [Mastigocladopsis 
repens]
Length=822

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_017306413.1| ATP-dependent Clp protease ATP-binding protein [Spirulina subsalsa]
Length=822

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_017300481.1| ATP-dependent Clp protease ATP-binding protein [Nodosilinea nodulosa]
Length=821

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>gb|KIJ80614.1| Clp protease ClpX [Scytonema tolypothrichoides VB-61278]
Length=822

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_039740335.1| Clp protease ClpX [Hassallia byssoidea]
 gb|KIF37306.1| Clp protease ClpX [Hassallia byssoidea VB512170]
Length=822

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_006518530.1| ATPase with chaperone activity, ATP-binding subunit [Leptolyngbya 
sp. PCC 7375]
 gb|EKU97345.1| ATPase with chaperone activity, ATP-binding subunit [Leptolyngbya 
sp. PCC 7375]
Length=822

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_028082153.1| Clp protease ClpX [Dolichospermum circinale]
Length=823

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_017712666.1| ATP-dependent Clp protease ATP-binding protein [Prochlorothrix 
hollandica]
Length=824

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_011618961.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. CC9311]
 gb|ABI47413.1| putative Clp protease, ATP-binding subunit ClpC [Synechococcus 
sp. CC9311]
Length=860

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_027842712.1| Clp protease ClpX [Mastigocoleus testarum]
Length=822

 Score =   136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_037222416.1| Clp protease ClpX [Richelia intracellularis]
 emb|CDN15062.1| ATP-dependent Clp protease, ATP-binding subunit ClpC / Negative 
regulator of genetic competence clcC/mecB [Richelia intracellularis]
Length=822

 Score =   136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_015117004.1| chaperone ATPase [Rivularia sp. PCC 7116]
 gb|AFY53426.1| ATPase with chaperone activity, ATP-binding subunit [Rivularia 
sp. PCC 7116]
Length=831

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_008179937.1| ATP-dependent Clp protease ATP-binding protein [Moorea producens]
 gb|EGJ34643.1| ATPase with chaperone activity, ATP-binding subunit [Moorea producens 
3L]
Length=822

 Score =   136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_009342297.1| ATP-dependent Clp protease ATP-binding protein [Raphidiopsis 
brookii]
 gb|EFA73676.1| UvrB/UvrC protein [Raphidiopsis brookii D9]
Length=823

 Score =   136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_006620698.1| MULTISPECIES: ATP-dependent Clp protease ATP-binding protein 
[Arthrospira]
 emb|CCE15484.1| ATP-dependent Clp protease regulatory subunit [Arthrospira sp. 
PCC 8005]
 gb|EKD11313.1| ATPase AAA-2 [Arthrospira platensis C1]
 emb|CDM94048.1| ATP-dependent Clp protease regulatory subunit [Arthrospira sp. 
PCC 8005]
Length=823

 Score =   136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_016952177.1| ATP-dependent Clp protease ATP-binding protein [Anabaena sp. 
PCC 7108]
Length=824

 Score =   136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_017324677.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. PCC 7336]
Length=828

 Score =   136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_012954277.1| ATP-dependent Clp protease ATP-binding protein [Candidatus Atelocyanobacterium 
thalassa]
 gb|ADB95590.1| ATPase with chaperone activity, ATP-binding subunit [Candidatus 
Atelocyanobacterium thalassa isolate ALOHA]
Length=825

 Score =   136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_008274497.1| ATP-dependent Clp protease ATP-binding protein [Cyanothece sp. 
CCY0110]
 gb|EAZ92285.1| ATP-dependent Clp protease regulatory subunit [Cyanothece sp. 
CCY0110]
Length=822

 Score =   136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_006277610.1| ATP-dependent Clp protease ATP-binding protein [Cylindrospermopsis 
raciborskii]
 gb|EFA69311.1| UvrB/UvrC protein [Cylindrospermopsis raciborskii CS-505]
Length=823

 Score =   136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_017293405.1| ATP-dependent Clp protease ATP-binding protein [Geminocystis 
herdmanii]
Length=824

 Score =   136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_006618428.1| ATP-dependent Clp protease ATP-binding protein [Arthrospira platensis]
 dbj|BAI89446.1| ATP-dependent Clp protease ATP-binding subunit ClpC [Arthrospira 
platensis NIES-39]
 gb|KDR58691.1| Clp protease ClpX [Arthrospira platensis str. Paraca]
Length=823

 Score =   136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_011612018.1| ATP-dependent Clp protease ATP-binding protein [Trichodesmium 
erythraeum]
 gb|ABG51652.1| ATPase AAA-2 [Trichodesmium erythraeum IMS101]
Length=825

 Score =   136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_009555478.1| ATPase with chaperone activity, ATP-binding subunit [Oscillatoriales 
cyanobacterium JSC-12]
 gb|EKQ70911.1| ATPase with chaperone activity, ATP-binding subunit [Oscillatoriales 
cyanobacterium JSC-12]
Length=822

 Score =   136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_015170572.1| ATPase [Geitlerinema sp. PCC 7407]
 gb|AFY65004.1| ATPase AAA-2 domain protein [Geitlerinema sp. PCC 7407]
Length=822

 Score =   136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_007303900.1| ATP-dependent Clp protease ATP-binding protein [Crocosphaera 
watsonii]
 gb|EAM52246.1| UvrB/UvrC protein:AAA ATPase, central region:Clp, N terminal:Clp, 
N terminal [Crocosphaera watsonii WH 8501]
 emb|CCQ60500.1| ATP-dependent Clp protease, ATP-binding subunit ClpC / Negative 
regulator of genetic competence clcC/mecB [Crocosphaera watsonii 
WH 0401]
 emb|CCQ52695.1| ATP-dependent Clp protease, ATP-binding subunit ClpC / Negative 
regulator of genetic competence clcC/mecB [Crocosphaera watsonii 
WH 8502]
Length=823

 Score =   136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_016879619.1| ATP-dependent Clp protease ATP-binding protein [Chlorogloeopsis 
fritschii]
Length=822

 Score =   136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



>ref|WP_015185589.1| chaperone ATPase [Microcoleus sp. PCC 7113]
 gb|AFZ21460.1| ATPase with chaperone activity, ATP-binding subunit [Microcoleus 
sp. PCC 7113]
Length=822

 Score =   136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  343  LFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  522
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  523  VEVEKIIGRGSGFVAVEIPFTPRAKRVLE  609
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLE
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLE  89



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 829366762230