BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS082G05

Length=606
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002268645.1|  PREDICTED: 60S acidic ribosomal protein P0         280   2e-90   Vitis vinifera
emb|CAN80537.1|  hypothetical protein VITISV_003812                     277   3e-89   Vitis vinifera
ref|XP_002276842.1|  PREDICTED: 60S acidic ribosomal protein P0         277   3e-89   Vitis vinifera
ref|XP_007009051.1|  Ribosomal protein L10 family protein isoform 1     276   5e-89   
ref|XP_010247657.1|  PREDICTED: 60S acidic ribosomal protein P0-like    274   3e-88   Nelumbo nucifera [Indian lotus]
gb|KHG25462.1|  60S acidic ribosomal P0                                 273   6e-88   Gossypium arboreum [tree cotton]
ref|XP_010256605.1|  PREDICTED: 60S acidic ribosomal protein P0         273   9e-88   Nelumbo nucifera [Indian lotus]
ref|XP_011076719.1|  PREDICTED: 60S acidic ribosomal protein P0         273   1e-87   Sesamum indicum [beniseed]
gb|KJB78787.1|  hypothetical protein B456_013G019000                    273   1e-87   Gossypium raimondii
gb|KHG08087.1|  60S acidic ribosomal P0                                 273   1e-87   Gossypium arboreum [tree cotton]
gb|KDP44812.1|  hypothetical protein JCGZ_01312                         273   1e-87   Jatropha curcas
gb|KJB74260.1|  hypothetical protein B456_011G283700                    271   1e-87   Gossypium raimondii
gb|KHG25720.1|  60S acidic ribosomal P0                                 272   2e-87   Gossypium arboreum [tree cotton]
gb|KJB76159.1|  hypothetical protein B456_012G076000                    272   2e-87   Gossypium raimondii
gb|EPS69246.1|  p0 ribosomal protein-like protein                       272   3e-87   Genlisea aurea
ref|XP_007009052.1|  Ribosomal protein L10 family protein isoform 2     271   4e-87   
ref|XP_006848156.1|  hypothetical protein AMTR_s00029p00231170          271   7e-87   Amborella trichopoda
gb|KJB74261.1|  hypothetical protein B456_011G283700                    270   9e-87   Gossypium raimondii
ref|XP_004149240.1|  PREDICTED: 60S acidic ribosomal protein P0-like    270   1e-86   Cucumis sativus [cucumbers]
ref|XP_004165071.1|  PREDICTED: 60S acidic ribosomal protein P0-like    270   2e-86   
ref|XP_006435697.1|  hypothetical protein CICLE_v10032141mg             270   2e-86   Citrus clementina [clementine]
ref|XP_008463223.1|  PREDICTED: 60S acidic ribosomal protein P0         270   2e-86   Cucumis melo [Oriental melon]
gb|KDO69054.1|  hypothetical protein CISIN_1g020952mg                   269   3e-86   Citrus sinensis [apfelsine]
gb|KDO69055.1|  hypothetical protein CISIN_1g020952mg                   269   4e-86   Citrus sinensis [apfelsine]
ref|XP_011084927.1|  PREDICTED: 60S acidic ribosomal protein P0-like    268   4e-86   Sesamum indicum [beniseed]
ref|XP_010534571.1|  PREDICTED: 60S acidic ribosomal protein P0-like    268   5e-86   Tarenaya hassleriana [spider flower]
ref|XP_004501267.1|  PREDICTED: 60S acidic ribosomal protein P0-like    268   9e-86   Cicer arietinum [garbanzo]
gb|ADR71235.1|  60S acidic ribosomal protein P0A                        267   2e-85   Hevea brasiliensis [jebe]
ref|XP_007222847.1|  hypothetical protein PRUPE_ppa008800mg             267   2e-85   Prunus persica
ref|XP_010534676.1|  PREDICTED: 60S acidic ribosomal protein P0-like    267   2e-85   Tarenaya hassleriana [spider flower]
ref|XP_010554654.1|  PREDICTED: 60S acidic ribosomal protein P0         267   2e-85   Tarenaya hassleriana [spider flower]
ref|XP_011072152.1|  PREDICTED: 60S acidic ribosomal protein P0-like    267   3e-85   
ref|XP_002526873.1|  60S acidic ribosomal protein P0, putative          266   3e-85   Ricinus communis
ref|NP_187531.1|  60S acidic ribosomal protein P0-2                     266   4e-85   Arabidopsis thaliana [mouse-ear cress]
gb|ADR71236.1|  60S acidic ribosomal protein P0B                        266   4e-85   Hevea brasiliensis [jebe]
ref|XP_002884720.1|  60S acidic ribosomal protein P0                    266   5e-85   Arabidopsis lyrata subsp. lyrata
ref|XP_002882720.1|  60S acidic ribosomal protein P0                    266   6e-85   
ref|XP_010486703.1|  PREDICTED: 60S acidic ribosomal protein P0-3       266   8e-85   Camelina sativa [gold-of-pleasure]
ref|XP_009344598.1|  PREDICTED: 60S acidic ribosomal protein P0         265   1e-84   Pyrus x bretschneideri [bai li]
ref|XP_011035984.1|  PREDICTED: 60S acidic ribosomal protein P0         265   1e-84   Populus euphratica
ref|XP_010095082.1|  60S acidic ribosomal protein P0                    265   1e-84   Morus notabilis
ref|XP_010486773.1|  PREDICTED: 60S acidic ribosomal protein P0-3...    265   1e-84   Camelina sativa [gold-of-pleasure]
ref|XP_006298124.1|  hypothetical protein CARUB_v10014186mg             265   1e-84   Capsella rubella
ref|XP_010464828.1|  PREDICTED: 60S acidic ribosomal protein P0-3...    265   1e-84   Camelina sativa [gold-of-pleasure]
ref|NP_001239676.1|  uncharacterized protein LOC100777482               265   1e-84   Glycine max [soybeans]
ref|XP_010464557.1|  PREDICTED: 60S acidic ribosomal protein P0-3...    265   2e-84   Camelina sativa [gold-of-pleasure]
ref|XP_010469822.1|  PREDICTED: 60S acidic ribosomal protein P0-3...    265   2e-84   Camelina sativa [gold-of-pleasure]
ref|NP_001238374.1|  60S acidic ribosomal protein P0                    265   2e-84   Glycine max [soybeans]
gb|AAM65265.1|  60S acidic ribosomal protein P0-C                       265   2e-84   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008392940.1|  PREDICTED: 60S acidic ribosomal protein P0         265   2e-84   Malus domestica [apple tree]
ref|NP_187734.1|  60S acidic ribosomal protein P0-3                     265   2e-84   Arabidopsis thaliana [mouse-ear cress]
emb|CDY53103.1|  BnaCnng24330D                                          264   3e-84   Brassica napus [oilseed rape]
ref|XP_007163525.1|  hypothetical protein PHAVU_001G241400g             264   3e-84   Phaseolus vulgaris [French bean]
gb|KCW65657.1|  hypothetical protein EUGRSUZ_G03042                     259   3e-84   Eucalyptus grandis [rose gum]
ref|XP_004490967.1|  PREDICTED: 60S acidic ribosomal protein P0-like    264   3e-84   Cicer arietinum [garbanzo]
ref|XP_004490966.1|  PREDICTED: 60S acidic ribosomal protein P0-like    264   3e-84   Cicer arietinum [garbanzo]
ref|XP_006298147.1|  hypothetical protein CARUB_v10014197mg             264   4e-84   Capsella rubella
emb|CDY07906.1|  BnaC03g36170D                                          264   4e-84   Brassica napus [oilseed rape]
ref|XP_009350848.1|  PREDICTED: 60S acidic ribosomal protein P0-like    263   4e-84   Pyrus x bretschneideri [bai li]
ref|XP_011042597.1|  PREDICTED: 60S acidic ribosomal protein P0-like    263   6e-84   Populus euphratica
ref|XP_002315165.1|  60S acidic ribosomal protein P0-A                  263   7e-84   
ref|XP_006407705.1|  hypothetical protein EUTSA_v10021147mg             262   7e-84   
gb|ACJ84880.1|  unknown                                                 263   7e-84   Medicago truncatula
gb|AFK39880.1|  unknown                                                 263   8e-84   Medicago truncatula
gb|AAM63644.1|  putative 60S acidic ribosomal protein P0                263   8e-84   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003603496.1|  60S acidic ribosomal protein p0                    263   9e-84   Medicago truncatula
gb|KFK38515.1|  hypothetical protein AALP_AA3G123100                    263   1e-83   Arabis alpina [alpine rockcress]
ref|XP_006407706.1|  hypothetical protein EUTSA_v10021147mg             263   1e-83   Eutrema salsugineum [saltwater cress]
ref|XP_008360784.1|  PREDICTED: 60S acidic ribosomal protein P0         263   1e-83   Malus domestica [apple tree]
ref|XP_002525622.1|  60S acidic ribosomal protein P0, putative          263   1e-83   Ricinus communis
ref|XP_010486480.1|  PREDICTED: 60S acidic ribosomal protein P0-3...    262   1e-83   Camelina sativa [gold-of-pleasure]
ref|XP_009146942.1|  PREDICTED: 60S acidic ribosomal protein P0-2       262   2e-83   Brassica rapa
ref|XP_009389889.1|  PREDICTED: 60S acidic ribosomal protein P0         262   2e-83   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFK38760.1|  unknown                                                 262   2e-83   Lotus japonicus
ref|XP_009135066.1|  PREDICTED: 60S acidic ribosomal protein P0-2...    262   2e-83   Brassica rapa
ref|XP_007157498.1|  hypothetical protein PHAVU_002G074600g             262   2e-83   Phaseolus vulgaris [French bean]
emb|CDX73962.1|  BnaA03g30850D                                          262   2e-83   
ref|XP_002312149.1|  60S acidic ribosomal protein P0-A                  261   4e-83   Populus trichocarpa [western balsam poplar]
gb|ABK95701.1|  unknown                                                 261   4e-83   Populus trichocarpa [western balsam poplar]
gb|ABK94988.1|  unknown                                                 261   4e-83   Populus trichocarpa [western balsam poplar]
ref|XP_003616595.1|  60S acidic ribosomal protein p0                    261   4e-83   Medicago truncatula
gb|AAF34767.1|AF227622_1  60S acidic ribosomal protein PO               261   4e-83   Euphorbia esula [wolf's milk]
ref|XP_009409427.1|  PREDICTED: 60S acidic ribosomal protein P0-like    261   5e-83   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009123454.1|  PREDICTED: 60S acidic ribosomal protein P0-2...    261   5e-83   Brassica rapa
gb|KCW65655.1|  hypothetical protein EUGRSUZ_G03042                     259   5e-83   Eucalyptus grandis [rose gum]
ref|XP_004145258.1|  PREDICTED: 60S acidic ribosomal protein P0-2...    261   6e-83   Cucumis sativus [cucumbers]
ref|XP_010067511.1|  PREDICTED: 60S acidic ribosomal protein P0         260   7e-83   Eucalyptus grandis [rose gum]
ref|XP_007153264.1|  hypothetical protein PHAVU_003G020600g             260   9e-83   Phaseolus vulgaris [French bean]
gb|AGV54296.1|  60S acidic ribosomal protein P0                         260   9e-83   Phaseolus vulgaris [French bean]
gb|KFK38306.1|  hypothetical protein AALP_AA3G096900                    260   9e-83   Arabis alpina [alpine rockcress]
gb|ADU04571.1|  60S acidic ribosomal protein PO                         260   1e-82   Phaseolus vulgaris [French bean]
emb|CDP16385.1|  unnamed protein product                                259   1e-82   Coffea canephora [robusta coffee]
gb|EYU43500.1|  hypothetical protein MIMGU_mgv1a010103mg                259   2e-82   Erythranthe guttata [common monkey flower]
gb|KHN36391.1|  60S acidic ribosomal protein P0                         259   2e-82   Glycine soja [wild soybean]
dbj|BAE71263.1|  putative 60S acidic ribosomal protein P0               259   2e-82   Trifolium pratense [peavine clover]
ref|XP_009399833.1|  PREDICTED: 60S acidic ribosomal protein P0-like    259   2e-82   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU18304.1|  hypothetical protein MIMGU_mgv1a010092mg                259   3e-82   Erythranthe guttata [common monkey flower]
ref|XP_010941551.1|  PREDICTED: 60S acidic ribosomal protein P0         259   3e-82   Elaeis guineensis
gb|KHN34735.1|  60S acidic ribosomal protein P0                         259   4e-82   Glycine soja [wild soybean]
ref|XP_003538454.1|  PREDICTED: 60S acidic ribosomal protein P0-like    258   4e-82   Glycine max [soybeans]
ref|XP_010926952.1|  PREDICTED: 60S acidic ribosomal protein P0         258   4e-82   Elaeis guineensis
ref|XP_008457380.1|  PREDICTED: 60S acidic ribosomal protein P0-like    258   4e-82   Cucumis melo [Oriental melon]
ref|NP_181530.1|  60S acidic ribosomal protein P0-1                     258   8e-82   Arabidopsis thaliana [mouse-ear cress]
gb|AFK46889.1|  unknown                                                 257   1e-81   Medicago truncatula
ref|XP_009619762.1|  PREDICTED: 60S acidic ribosomal protein P0-like    257   1e-81   Nicotiana tomentosiformis
ref|XP_010508934.1|  PREDICTED: 60S acidic ribosomal protein P0-1       257   1e-81   Camelina sativa [gold-of-pleasure]
ref|XP_002881693.1|  60S acidic ribosomal protein P0                    257   2e-81   
ref|XP_009764939.1|  PREDICTED: 60S acidic ribosomal protein P0-like    257   2e-81   Nicotiana sylvestris
ref|XP_008799093.1|  PREDICTED: 60S acidic ribosomal protein P0         257   2e-81   Phoenix dactylifera
gb|KJB76158.1|  hypothetical protein B456_012G076000                    256   2e-81   Gossypium raimondii
ref|XP_006411245.1|  hypothetical protein EUTSA_v10016954mg             256   2e-81   Eutrema salsugineum [saltwater cress]
sp|P50345.1|RLA0_LUPLU  RecName: Full=60S acidic ribosomal protei...    256   2e-81   Lupinus luteus
ref|XP_010517390.1|  PREDICTED: 60S acidic ribosomal protein P0-1...    255   8e-81   Camelina sativa [gold-of-pleasure]
ref|XP_004247949.1|  PREDICTED: 60S acidic ribosomal protein P0-like    255   1e-80   Solanum lycopersicum
gb|KFK36893.1|  hypothetical protein AALP_AA4G185700                    254   1e-80   Arabis alpina [alpine rockcress]
ref|XP_007016138.1|  Ribosomal protein L10 family protein               254   1e-80   
emb|CDY24932.1|  BnaC03g22400D                                          254   2e-80   Brassica napus [oilseed rape]
ref|XP_009799989.1|  PREDICTED: 60S acidic ribosomal protein P0-like    254   2e-80   Nicotiana sylvestris
gb|EYU43501.1|  hypothetical protein MIMGU_mgv1a010103mg                254   3e-80   Erythranthe guttata [common monkey flower]
ref|XP_006360336.1|  PREDICTED: 60S acidic ribosomal protein P0-like    253   4e-80   Solanum tuberosum [potatoes]
emb|CDY60988.1|  BnaA03g56530D                                          253   6e-80   Brassica napus [oilseed rape]
ref|XP_010689885.1|  PREDICTED: 60S acidic ribosomal protein P0         252   1e-79   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009133397.1|  PREDICTED: 60S acidic ribosomal protein P0-1       252   2e-79   Brassica rapa
ref|XP_006350830.1|  PREDICTED: 60S acidic ribosomal protein P0-like    251   3e-79   Solanum tuberosum [potatoes]
ref|XP_004241171.1|  PREDICTED: 60S acidic ribosomal protein P0-like    251   4e-79   Solanum lycopersicum
ref|XP_006296009.1|  hypothetical protein CARUB_v10025153mg             251   5e-79   Capsella rubella
gb|ABO31368.1|  60S ribosomal protein                                   248   5e-79   Gossypium hirsutum [American cotton]
gb|KJB19895.1|  hypothetical protein B456_003G123400                    251   5e-79   Gossypium raimondii
ref|XP_009592351.1|  PREDICTED: 60S acidic ribosomal protein P0-like    251   5e-79   Nicotiana tomentosiformis
gb|KDP46515.1|  hypothetical protein JCGZ_08487                         249   1e-78   Jatropha curcas
ref|XP_004307622.1|  PREDICTED: 60S acidic ribosomal protein P0         249   1e-78   Fragaria vesca subsp. vesca
ref|XP_004307662.1|  PREDICTED: 60S acidic ribosomal protein P0         249   2e-78   Fragaria vesca subsp. vesca
emb|CDP14047.1|  unnamed protein product                                249   2e-78   Coffea canephora [robusta coffee]
sp|P29764.1|RLA0_OXYRB  RecName: Full=60S acidic ribosomal protei...    248   6e-78   Oxybasis rubra [pigweed]
ref|XP_009791710.1|  PREDICTED: 60S acidic ribosomal protein P0         247   1e-77   Nicotiana sylvestris
ref|XP_009608105.1|  PREDICTED: 60S acidic ribosomal protein P0         246   2e-77   Nicotiana tomentosiformis
ref|XP_002440235.1|  hypothetical protein SORBIDRAFT_09g028230          246   3e-77   Sorghum bicolor [broomcorn]
gb|KDO69056.1|  hypothetical protein CISIN_1g036252mg                   246   3e-77   Citrus sinensis [apfelsine]
ref|XP_006435696.1|  hypothetical protein CICLE_v10033862mg             246   3e-77   Citrus clementina [clementine]
ref|XP_004239781.1|  PREDICTED: 60S acidic ribosomal protein P0         244   2e-76   Solanum lycopersicum
ref|NP_001275012.1|  60S acidic ribosomal protein P0-like               244   2e-76   Solanum tuberosum [potatoes]
ref|XP_004287422.1|  PREDICTED: 60S acidic ribosomal protein P0-like    244   2e-76   Fragaria vesca subsp. vesca
ref|NP_001060923.1|  Os08g0130500                                       241   4e-75   
ref|XP_001759851.1|  predicted protein                                  240   5e-75   
ref|XP_001759592.1|  predicted protein                                  240   8e-75   
gb|ABA91328.1|  60S acidic ribosomal protein P0, putative, expressed    239   1e-74   Oryza sativa Japonica Group [Japonica rice]
gb|EAY82182.1|  hypothetical protein OsI_37384                          239   1e-74   Oryza sativa Indica Group [Indian rice]
gb|ABA95724.1|  60S acidic ribosomal protein P0, putative, expressed    239   1e-74   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006659092.1|  PREDICTED: 60S acidic ribosomal protein P0-like    239   1e-74   Oryza brachyantha
dbj|BAC10912.1|  putative 60S acidic ribosomal protein P0               234   2e-74   Zinnia elegans [garden zinnia]
gb|AID52928.1|  60S acidic ribosomal protein P0                         238   6e-74   Carthamus tinctorius
emb|CBX25428.1|  hypothetical_protein                                   234   1e-72   Oryza glaberrima
gb|EMT02739.1|  60S acidic ribosomal protein P0                         234   1e-72   
gb|AIN39821.1|  hypothetical protein                                    231   5e-72   Zoysia matrella [Japanese carpet grass]
dbj|BAJ92405.1|  predicted protein                                      231   2e-71   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ94456.1|  predicted protein                                      231   2e-71   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT17099.1|  60S acidic ribosomal protein P0                         231   2e-71   
gb|AFW74478.1|  hypothetical protein ZEAMMB73_076912                    224   2e-70   
ref|XP_002974292.1|  hypothetical protein SELMODRAFT_149765             228   2e-70   Selaginella moellendorffii
ref|XP_002983859.1|  hypothetical protein SELMODRAFT_268802             228   3e-70   Selaginella moellendorffii
ref|XP_010234277.1|  PREDICTED: 60S acidic ribosomal protein P0         227   7e-70   Brachypodium distachyon [annual false brome]
ref|XP_002960810.1|  hypothetical protein SELMODRAFT_437282             226   1e-69   Selaginella moellendorffii
ref|XP_004296403.1|  PREDICTED: 60S acidic ribosomal protein P0-like    225   4e-69   Fragaria vesca subsp. vesca
gb|ACL52455.1|  unknown                                                 225   4e-69   Zea mays [maize]
ref|NP_001141489.1|  hypothetical protein                               225   4e-69   Zea mays [maize]
gb|ACF83717.1|  unknown                                                 225   5e-69   Zea mays [maize]
ref|NP_001105482.1|  60S acidic ribosomal protein P0                    225   5e-69   Zea mays [maize]
emb|CAN65663.1|  hypothetical protein VITISV_014917                     225   2e-68   Vitis vinifera
ref|XP_002445000.1|  hypothetical protein SORBIDRAFT_07g002560          223   3e-68   Sorghum bicolor [broomcorn]
ref|XP_002967451.1|  hypothetical protein SELMODRAFT_87354              223   3e-68   Selaginella moellendorffii
ref|XP_002960261.1|  hypothetical protein SELMODRAFT_229877             222   6e-68   Selaginella moellendorffii
ref|XP_010685586.1|  PREDICTED: 60S acidic ribosomal protein P0         219   1e-66   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004972933.1|  PREDICTED: 60S acidic ribosomal protein P0-like    219   1e-66   Setaria italica
ref|XP_004958562.1|  PREDICTED: 60S acidic ribosomal protein P0-like    218   2e-66   Setaria italica
ref|XP_003573632.1|  PREDICTED: 60S acidic ribosomal protein P0-like    214   1e-64   Brachypodium distachyon [annual false brome]
emb|CBI25508.3|  unnamed protein product                                211   8e-64   Vitis vinifera
emb|CBI31491.3|  unnamed protein product                                208   9e-63   Vitis vinifera
emb|CAN76468.1|  hypothetical protein VITISV_030042                     206   4e-62   Vitis vinifera
ref|NP_001176776.1|  Os12g0133050                                       191   1e-58   
gb|EYU19991.1|  hypothetical protein MIMGU_mgv1a0100891mg               185   2e-56   Erythranthe guttata [common monkey flower]
ref|NP_001078125.1|  60S acidic ribosomal protein P0-2                  191   3e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008779031.1|  PREDICTED: 60S acidic ribosomal protein P0-like    183   4e-55   Phoenix dactylifera
ref|XP_005650079.1|  hypothetical protein COCSUDRAFT_52908              187   2e-54   Coccomyxa subellipsoidea C-169
ref|XP_011402179.1|  60S acidic ribosomal protein P0-2                  181   1e-52   Auxenochlorella protothecoides
ref|XP_005850392.1|  hypothetical protein CHLNCDRAFT_59607              182   2e-52   Chlorella variabilis
gb|KIZ02211.1|  60S acidic ribosomal protein P0                         176   3e-50   Monoraphidium neglectum
gb|KDD72928.1|  hypothetical protein H632_c2720p0                       174   1e-49   Helicosporidium sp. ATCC 50920
emb|CDP06275.1|  unnamed protein product                                166   3e-47   Coffea canephora [robusta coffee]
emb|CBV76074.1|  60S acidic ribosomal protein P0                        166   4e-46   Polytomella sp. Pringsheim 198.80
ref|XP_006846796.1|  hypothetical protein AMTR_s00148p00060210          162   8e-46   Amborella trichopoda
gb|KJB32134.1|  hypothetical protein B456_005G225800                    155   7e-45   Gossypium raimondii
ref|XP_002597893.1|  hypothetical protein BRAFLDRAFT_97880              154   9e-42   Branchiostoma floridae
gb|ACR08654.1|  ribosomal protein LP0                                   151   1e-41   Drosophila silvestris
ref|XP_011196704.1|  PREDICTED: 60S acidic ribosomal protein P0         154   2e-41   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_011208099.1|  PREDICTED: 60S acidic ribosomal protein P0         154   2e-41   Bactrocera dorsalis [papaya fruit fly]
gb|ABV60317.1|  60S acidic ribosomal protein P0-like protein            153   2e-41   Lutzomyia longipalpis
emb|CEG01946.1|  Ribosomal protein L10/acidic P0                        153   2e-41   Ostreococcus tauri
ref|NP_001176336.1|  Os11g0135300                                       147   2e-41   
ref|XP_004522331.1|  PREDICTED: 60S acidic ribosomal protein P0-like    153   2e-41   Ceratitis capitata [medfly]
dbj|BAN20115.1|  ribosomal protein LP0                                  153   3e-41   Riptortus pedestris
gb|AAR09675.1|  similar to Drosophila melanogaster RpP0                 151   3e-41   Drosophila yakuba
ref|XP_011496436.1|  PREDICTED: 60S acidic ribosomal protein P0         153   3e-41   Ceratosolen solmsi marchali
gb|AFK45016.1|  unknown                                                 149   4e-41   Lotus japonicus
ref|XP_002068394.1|  GK20443                                            152   5e-41   
ref|XP_001352888.1|  GA20389                                            152   7e-41   Drosophila pseudoobscura pseudoobscura
ref|XP_006595496.1|  PREDICTED: uncharacterized protein LOC100305...    148   7e-41   Glycine max [soybeans]
ref|XP_001697060.1|  acidic ribosomal protein P0                        152   7e-41   Chlamydomonas reinhardtii
ref|XP_006612127.1|  PREDICTED: 60S acidic ribosomal protein P0-like    152   9e-41   Apis dorsata [rock honeybee]
ref|XP_001655016.1|  AAEL010821-PA                                      152   9e-41   Aedes aegypti
ref|XP_623106.1|  PREDICTED: 60S acidic ribosomal protein P0 isof...    152   9e-41   Apis mellifera [bee]
ref|XP_003398378.1|  PREDICTED: 60S acidic ribosomal protein P0-l...    151   1e-40   Bombus terrestris [large earth bumblebee]
ref|XP_011266937.1|  PREDICTED: 60S acidic ribosomal protein P0         151   1e-40   Camponotus floridanus
ref|XP_011297993.1|  PREDICTED: 60S acidic ribosomal protein P0         151   1e-40   Fopius arisanus
ref|XP_001958489.1|  GF10946                                            151   1e-40   Drosophila ananassae
ref|XP_008544624.1|  PREDICTED: 60S acidic ribosomal protein P0         151   1e-40   Microplitis demolitor
ref|XP_003488353.1|  PREDICTED: 60S acidic ribosomal protein P0-like    151   1e-40   Bombus impatiens
ref|XP_011157010.1|  PREDICTED: 60S acidic ribosomal protein P0         151   1e-40   Solenopsis invicta [imported red fire ant]
ref|XP_001607606.1|  PREDICTED: 60S acidic ribosomal protein P0         151   1e-40   Nasonia vitripennis
ref|XP_001973718.1|  GG16244                                            151   1e-40   Drosophila erecta
ref|XP_002047707.1|  GJ13582                                            151   1e-40   Drosophila virilis
ref|XP_006575531.1|  PREDICTED: 60S acidic ribosomal protein P0-l...    147   1e-40   
ref|NP_524211.1|  ribosomal protein LP0, isoform A                      151   1e-40   Drosophila melanogaster
ref|XP_001985147.1|  GH14667                                            151   1e-40   Drosophila grimshawi
ref|XP_002040897.1|  GM22429                                            151   2e-40   Drosophila sechellia
ref|XP_002095795.1|  RpLP0                                              151   2e-40   Drosophila yakuba
ref|XP_011347099.1|  PREDICTED: 60S acidic ribosomal protein P0         150   2e-40   Ooceraea biroi
gb|AAM97779.1|  ribosomal protein P0                                    150   2e-40   Aedes albopictus [forest day mosquito]
ref|XP_002008961.1|  GI13777                                            150   2e-40   Drosophila mojavensis
ref|XP_011146290.1|  PREDICTED: 60S acidic ribosomal protein P0-like    150   2e-40   Harpegnathos saltator
dbj|BAM18929.1|  ribosomal protein LP0                                  150   3e-40   Papilio polytes
ref|XP_001851128.1|  60S acidic ribosomal protein P0                    150   3e-40   Culex quinquefasciatus
ref|XP_003706895.1|  PREDICTED: 60S acidic ribosomal protein P0-like    150   3e-40   Megachile rotundata
dbj|BAM17678.1|  ribosomal protein LP0                                  150   3e-40   Papilio xuthus [Chinese swallowtail]
ref|XP_002958097.1|  hypothetical protein VOLCADRAFT_84328              150   3e-40   Volvox carteri f. nagariensis
ref|NP_001236064.1|  uncharacterized protein LOC100305996               146   3e-40   Glycine max [soybeans]
ref|XP_011146226.1|  PREDICTED: 60S acidic ribosomal protein P0-like    150   4e-40   Harpegnathos saltator
ref|XP_011064775.1|  PREDICTED: 60S acidic ribosomal protein P0         150   4e-40   Acromyrmex echinatior
emb|CBM69268.1|  venom protein Ci-40b                                   150   5e-40   Chelonus inanitus
ref|XP_313349.1|  AGAP003592-PA                                         149   5e-40   Anopheles gambiae str. PEST
emb|CAD29995.1|  ribosomal P0 protein                                   150   5e-40   Bombyx mori [silk moth]
ref|NP_001037123.1|  ribosomal protein P0                               150   5e-40   Bombyx mori [silk moth]
gb|ACY95307.1|  ribosomal protein P0                                    149   6e-40   Manduca sexta [Carolina sphinx]
gb|ETN64428.1|  60S acidic ribosomal protein P0                         149   7e-40   Anopheles darlingi [American malaria mosquito]
gb|EHJ75936.1|  ribosomal protein P0                                    149   9e-40   
gb|AAL62465.1|  60S acidic ribosomal protein P0                         149   1e-39   Spodoptera frugiperda
ref|XP_007141772.1|  hypothetical protein PHAVU_008G224500g             145   1e-39   Phaseolus vulgaris [French bean]
gb|AIW62441.1|  60S acidic ribosomal protein                            149   1e-39   Scytodes thoracica
gb|ADT80652.1|  ribosomal protein P0                                    149   1e-39   Euphydryas aurinia [marsh fritillary]
gb|AEE62116.1|  unknown                                                 149   1e-39   Dendroctonus ponderosae
gb|AAX62441.1|  ribosomal protein P0                                    145   2e-39   Lysiphlebus testaceipes
tpg|DAA34132.1|  TPA: ribosomal phosphoprotein P0                       146   2e-39   Amblyomma variegatum
gb|AAY66850.1|  60S acidic ribosomal protein P0                         147   3e-39   Ixodes scapularis [blacklegged tick]
gb|AFD93398.1|  ribosomal protein P0                                    147   3e-39   Lobesia botrana
gb|EFX74249.1|  hypothetical protein DAPPUDRAFT_307348                  147   4e-39   Daphnia pulex
ref|XP_002505583.1|  predicted protein                                  147   4e-39   Micromonas commoda
ref|XP_001626294.1|  predicted protein                                  147   4e-39   Nematostella vectensis
ref|XP_002399611.1|  60S acidic ribosomal protein P0, putative          147   4e-39   Ixodes scapularis [blacklegged tick]
gb|ABM55512.1|  putative ribosomal protein P0                           147   4e-39   Maconellicoccus hirsutus [pink hibiscus mealybug]
gb|AFD93397.1|  ribosomal protein P0                                    147   5e-39   Eupoecilia ambiguella
ref|XP_005187209.1|  PREDICTED: 60S acidic ribosomal protein P0         147   5e-39   Musca domestica
gb|AGQ49465.1|  acidic ribosomal protein P0                             147   5e-39   Rhipicephalus microplus [cattle tick]
gb|AEL28833.1|  ribosomal protein P0                                    147   6e-39   Heliconius melpomene cythera
gb|AJQ18906.1|  acidic ribosomal protein P0                             146   8e-39   Rhipicephalus sanguineus
gb|AJQ18907.1|  acidic ribosomal protein P0                             146   9e-39   Amblyomma cajennense
gb|ABW16870.1|  ribosomal protein P0                                    146   9e-39   Haemaphysalis longicornis
gb|AJQ18908.1|  acidic ribosomal protein P0                             146   1e-38   Dermacentor nitens
ref|XP_008468123.1|  PREDICTED: 60S acidic ribosomal protein P0         146   1e-38   Diaphorina citri
ref|XP_003063696.1|  predicted protein                                  146   1e-38   Micromonas pusilla CCMP1545
gb|ABY87386.1|  60S acidic ribosomal protein P0                         144   1e-38   Haliotis diversicolor
gb|AAF31449.1|AF220939_1  60S acidic ribosomal protein P0               145   1e-38   Sarcophaga crassipalpis
gb|ADE76171.1|  unknown                                                 144   2e-38   Picea sitchensis
sp|Q9DG68.1|RLA0_RANSY  RecName: Full=60S acidic ribosomal protei...    145   2e-38   Rana sylvatica
ref|XP_003082807.1|  RLA0_MAIZE 60S acidic ribosomal protein P0 p...    145   2e-38   
ref|XP_975936.1|  PREDICTED: 60S acidic ribosomal protein P0            145   2e-38   Tribolium castaneum [rust-red flour beetle]
emb|CAH04311.1|  acidic p0 ribosomal protein                            145   3e-38   Biphyllus lunatus
gb|AEF59081.1|  60S acidic ribosomal-like protein P0                    140   3e-38   Phragmatopoma lapidosa
ref|XP_003743791.1|  PREDICTED: 60S acidic ribosomal protein P0-like    145   3e-38   Galendromus occidentalis
gb|EPZ33240.1|  Ribosomal protein L10/acidic P0 domain-containing...    144   4e-38   Rozella allomycis CSF55
gb|AFD93389.1|  ribosomal protein P0                                    144   4e-38   Cydia pomonella
gb|KDR14762.1|  60S acidic ribosomal protein P0                         144   4e-38   
gb|AEE61707.1|  unknown                                                 144   4e-38   
gb|ADV40160.1|  60S acidic ribosomal protein P0                         144   5e-38   
gb|KIM26245.1|  hypothetical protein M408DRAFT_194239                   143   5e-38   
emb|CAH04309.1|  acidic p0 ribosomal protein                            141   6e-38   
ref|XP_002279500.1|  PREDICTED: 60S acidic ribosomal protein P0-2...    142   1e-37   
ref|XP_009041081.1|  hypothetical protein AURANDRAFT_32917              139   1e-37   
ref|XP_006697000.1|  ribosomal protein P0-like protein                  143   1e-37   
gb|ELT92567.1|  hypothetical protein CAPTEDRAFT_167366                  143   2e-37   
gb|AFM87759.1|  ribosomal protein, large, P0                            143   2e-37   
ref|XP_001422456.1|  Cytosolic 80S ribosomal protein P0; Cytosoli...    143   2e-37   
ref|XP_005707548.1|  60S acidic ribosomal protein P0                    143   2e-37   
gb|ACD65186.1|  putative 60S ribosomal protein RPLP0                    140   3e-37   
dbj|BAH70542.1|  ACYPI000079                                            138   4e-37   
gb|KFH71275.1|  large subunit ribosomal protein LP0                     142   4e-37   
gb|EYC13195.1|  hypothetical protein Y032_0044g1026                     142   4e-37   
emb|CAH04310.1|  acidic p0 ribosomal protein                            142   4e-37   
gb|ADD21618.1|  ribosomal protein P0                                    141   5e-37   
ref|XP_001897742.1|  60S acidic ribosomal protein P0                    142   6e-37   
gb|AAI51696.1|  RPLP0 protein                                           141   8e-37   
ref|XP_002425010.1|  ribosomal P0 protein, putative                     141   9e-37   
gb|AFM89484.1|  ribosomal protein, large, P0                            140   1e-36   
ref|XP_003135972.1|  60S acidic ribosomal protein P0                    140   1e-36   
gb|ACO14779.1|  60S acidic ribosomal protein P0                         140   1e-36   
ref|XP_002259307.1|  ribosomal phosphoprotein                           140   1e-36   
gb|EFO28098.2|  60S acidic ribosomal protein P0                         140   2e-36   
ref|XP_009045933.1|  hypothetical protein LOTGIDRAFT_237709             140   2e-36   
gb|AFK37198.1|  unknown                                                 140   2e-36   
gb|AFM89472.1|  ribosomal protein, large, P0                            140   2e-36   
gb|AFM88893.1|  ribosomal protein, large, P0                            140   2e-36   
gb|AFM86828.1|  ribosomal protein, large, P0                            140   2e-36   
gb|AFM85590.1|  ribosomal protein, large, P0                            140   2e-36   
gb|ACO12290.1|  60S acidic ribosomal protein P0                         140   2e-36   
gb|AFM86966.1|  ribosomal protein, large, P0                            140   2e-36   
gb|AFM86675.1|  ribosomal protein, large, P0                            140   2e-36   
gb|AFM87342.1|  ribosomal protein, large, P0                            140   2e-36   
gb|AFM88521.1|  ribosomal protein, large, P0                            140   2e-36   
gb|AFM86446.1|  ribosomal protein, large, P0                            140   2e-36   
gb|AFM86948.1|  ribosomal protein, large, P0                            140   2e-36   
gb|AFM87081.1|  ribosomal protein, large, P0                            140   2e-36   
gb|AFM85775.1|  ribosomal protein, large, P0                            140   2e-36   
gb|AFM86570.1|  ribosomal protein, large, P0                            140   3e-36   
gb|AFM85484.1|  ribosomal protein, large, P0                            140   3e-36   
ref|XP_008816121.1|  60S acidic ribosomal protein P0                    140   3e-36   
gb|AFM90832.1|  ribosomal protein, large, P0                            140   3e-36   
ref|XP_004222525.1|  60S acidic ribosomal protein P0                    139   3e-36   
gb|AFM85937.1|  ribosomal protein, large, P0                            139   3e-36   
gb|AFM86528.1|  ribosomal protein, large, P0                            139   3e-36   
emb|CCO03039.1|  ribosomal protein, large, P0                           134   3e-36   
gb|ACQ57902.1|  60S acidic ribosomal protein P0                         139   4e-36   
ref|XP_004492062.1|  PREDICTED: 60S acidic ribosomal protein P0-like    136   4e-36   
gb|KDO34134.1|  hypothetical protein SPRG_01404                         139   4e-36   
ref|NP_001080134.1|  ribosomal protein, large, P0                       139   4e-36   
ref|XP_001615417.1|  60S acidic ribosomal protein P0                    139   4e-36   
gb|ETN75251.1|  ribosomal protein L10                                   142   5e-36   
ref|XP_008904900.1|  hypothetical protein PPTG_11356                    139   5e-36   
ref|XP_009041647.1|  hypothetical protein AURANDRAFT_39285              139   5e-36   
gb|AFM89459.1|  ribosomal protein, large, P0                            139   5e-36   
ref|XP_008151673.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    139   5e-36   
ref|XP_004996745.1|  arbp-prov protein                                  139   5e-36   
ref|XP_009041887.1|  hypothetical protein AURANDRAFT_39351              139   6e-36   
tpe|CAL69061.1|  TPA: putative 60S ribosomal protein L10e/P0            137   6e-36   
ref|XP_009039052.1|  hypothetical protein AURANDRAFT_60208              138   6e-36   
ref|NP_989067.1|  ribosomal protein, large, P0                          139   7e-36   
ref|XP_009513921.1|  hypothetical protein PHYSODRAFT_353332             139   7e-36   
dbj|BAN39226.1|  60S acidic ribosomal protein P0, putative              139   7e-36   
gb|AFM89518.1|  ribosomal protein, large, P0                            139   8e-36   
gb|AFM86580.1|  ribosomal protein, large, P0                            138   8e-36   
gb|AFM86008.1|  ribosomal protein, large, P0                            138   9e-36   
gb|KHN76000.1|  60S acidic ribosomal protein P0                         138   9e-36   
ref|XP_741984.1|  ribosomal phosphoprotein P0                           135   9e-36   
gb|AAU84931.1|  putative acidic p0 ribosomal protein                    138   1e-35   
ref|XP_008969157.1|  PREDICTED: 60S acidic ribosomal protein P0-like    139   1e-35   
ref|NP_001119687.1|  ribosomal protein LP0                              138   1e-35   
emb|CAD58931.1|  60S acidic ribosomal protein P0                        138   1e-35   
gb|KFB37344.1|  hypothetical protein ZHAS_00004637                      143   1e-35   
emb|CBK23042.2|  unnamed protein product                                138   1e-35   
ref|XP_003621750.1|  60S acidic ribosomal protein P0                    134   1e-35   
gb|KHJ98883.1|  ribosomal protein L10                                   140   1e-35   
dbj|BAH70543.1|  ACYPI000079                                            138   1e-35   
emb|CDO65105.1|  60S acidic ribosomal protein P0, putative              138   2e-35   
gb|EJU04978.1|  hypothetical protein DACRYDRAFT_20548                   137   2e-35   
ref|XP_672283.1|  hypothetical protein                                  135   2e-35   
gb|ACR24956.1|  ribosomal protein P0                                    134   2e-35   
gb|KIK25519.1|  hypothetical protein PISMIDRAFT_677145                  137   2e-35   
gb|AFM86819.1|  ribosomal protein, large, P0                            137   2e-35   
emb|CAF18552.1|  ribosomal phosphoprotein                               137   2e-35   
emb|CAE84233.1|  ribosomal phosphoprotein                               137   2e-35   
gb|AFM85706.1|  ribosomal protein, large, P0                            137   3e-35   
gb|ESA18298.1|  hypothetical protein GLOINDRAFT_344659                  137   3e-35   
ref|XP_001347984.1|  60S ribosomal protein P0                           137   3e-35   
gb|AFK10546.1|  ribosomal protein, large, P0                            137   4e-35   
ref|NP_001279963.1|  ribosomal protein, large, P0                       137   4e-35   
gb|AFM87161.1|  ribosomal protein, large, P0                            137   4e-35   
gb|AHW80376.1|  ribosomol protein P0L10e                                137   4e-35   
ref|XP_004336616.1|  ribosomal protein L10, putative                    137   4e-35   
emb|CBN08637.1|  ribosomal protein, large, P0                           136   5e-35   
ref|XP_003710994.1|  60S acidic ribosomal protein P0                    136   5e-35   
ref|XP_006676559.1|  hypothetical protein BATDEDRAFT_15859              136   5e-35   
ref|XP_002896775.1|  60S acidic ribosomal protein P0                    136   5e-35   
gb|KIM58332.1|  hypothetical protein SCLCIDRAFT_128366                  136   5e-35   
ref|NP_492766.1|  Protein RLA-0                                         136   6e-35   
gb|KIY43991.1|  hypothetical protein FISHEDRAFT_77910                   136   7e-35   
ref|XP_005107960.1|  PREDICTED: 60S acidic ribosomal protein P0-l...    136   7e-35   
ref|XP_009018535.1|  hypothetical protein HELRODRAFT_185645             135   7e-35   
ref|XP_009440587.1|  PREDICTED: 60S acidic ribosomal protein P0-like    136   8e-35   
ref|XP_008624852.1|  60S acidic ribosomal protein P0                    135   1e-34   
ref|XP_003112032.1|  CRE-RPA-0 protein                                  135   1e-34   
emb|CDS47367.1|  60S acidic ribosomal protein P0, putative              135   1e-34   
gb|EUD72932.1|  60S acidic ribosomal protein P0                         135   1e-34   
ref|XP_008865510.1|  hypothetical protein H310_03433                    135   1e-34   
ref|XP_726106.1|  ribosomal protein L10                                 135   1e-34   
ref|XP_002639809.1|  C. briggsae CBR-RPA-0 protein                      135   1e-34   
ref|XP_011415179.1|  PREDICTED: 60S acidic ribosomal protein P0-like    135   1e-34   
gb|KIO14468.1|  hypothetical protein M404DRAFT_11602                    135   1e-34   
gb|AAM21934.1|  ribosomal phosphoprotein P0                             135   1e-34   
gb|EGT39704.1|  hypothetical protein CAEBREN_29720                      135   1e-34   
gb|ADD21619.1|  ribosomal protein P0                                    134   2e-34   
dbj|BAN38267.1|  60S acidic ribosomal protein P0, putative              135   2e-34   
dbj|BAN39755.1|  60S acidic ribosomal protein P0, putative              135   2e-34   
gb|AAS49564.1|  ribosomal protein Large P0                              133   2e-34   
emb|CBK20650.2|  unnamed protein product                                137   3e-34   
ref|XP_003384811.1|  PREDICTED: 60S acidic ribosomal protein P0-like    134   3e-34   
gb|ABO38860.1|  acidic ribosomal phosphoprotein P0                      129   3e-34   
gb|ABK32519.1|  ribosomal protein large PO subunit                      131   3e-34   
gb|AAX48841.1|  L10e/P0                                                 134   3e-34   
ref|XP_002184623.1|  predicted protein                                  133   4e-34   
ref|XP_001734355.1|  60S acidic ribosomal protein P0                    134   5e-34   
ref|XP_001740880.1|  60S acidic ribosomal protein P0                    134   5e-34   
dbj|BAH70537.1|  ACYPI000079                                            134   5e-34   
ref|XP_004648896.1|  PREDICTED: 60S acidic ribosomal protein P0-like    129   5e-34   
ref|XP_006205714.1|  PREDICTED: 60S acidic ribosomal protein P0-like    130   6e-34   
gb|AFQ90983.1|  ribosomal protein large P0                              129   6e-34   
dbj|BAN37454.1|  60S acidic ribosomal protein P0, putative              134   6e-34   
ref|XP_008612085.1|  50S ribosomal protein LP0                          134   6e-34   
gb|AAP13484.1|  acidic ribosomal phosphoprotein P0                      129   7e-34   
dbj|BAN40137.1|  60S acidic ribosomal protein P0, putative              133   7e-34   
ref|XP_001733424.1|  60S acidic ribosomal protein P0                    134   7e-34   
gb|AFQ90986.1|  ribosomal protein large P0                              129   8e-34   
gb|EAW98172.1|  ribosomal protein, large, P0, isoform CRA_c             129   8e-34   
gb|ABF69531.1|  acidic ribosomal protein P0                             133   9e-34   
dbj|BAN38149.1|  60S acidic ribosomal protein P0, putative              133   9e-34   
dbj|BAN38628.1|  60S acidic ribosomal protein P0, putative              133   9e-34   
ref|XP_649340.1|  60S acidic ribosomal protein P0                       133   1e-33   
dbj|BAN40100.1|  60S acidic ribosomal protein P0, putative              133   1e-33   
dbj|BAN39927.1|  60S acidic ribosomal protein P0, putative              133   1e-33   
dbj|BAN39606.1|  60S acidic ribosomal protein P0, putative              133   1e-33   
dbj|BAN38629.1|  60S acidic ribosomal protein P0, putative              133   1e-33   
dbj|BAN38349.1|  60S acidic ribosomal protein P0, putative              133   1e-33   
ref|XP_009219733.1|  60S acidic ribosomal protein P0                    133   1e-33   
dbj|BAN39624.1|  60S acidic ribosomal protein P0, putative              133   1e-33   
dbj|BAN38993.1|  60S acidic ribosomal protein P0, putative              133   1e-33   
dbj|BAN39915.1|  60S acidic ribosomal protein P0, putative              133   1e-33   
dbj|BAN39332.1|  60S acidic ribosomal protein P0, putative              133   1e-33   
emb|CDW52119.1|  60S acidic ribosomal protein P0                        133   1e-33   
emb|CAQ63458.1|  ribosomal protein                                      133   1e-33   
dbj|BAC56488.1|  similar to acidic ribosomal phosphoprotein PO          129   1e-33   
ref|XP_007513516.1|  60S acidic ribosomal protein P0                    132   1e-33   
dbj|BAN39831.1|  60S acidic ribosomal protein P0, putative              132   1e-33   
dbj|BAN38491.1|  60S acidic ribosomal protein P0, putative              132   1e-33   
gb|KFQ10333.1|  60S acidic ribosomal protein P0                         132   2e-33   
ref|XP_007393561.1|  hypothetical protein PHACADRAFT_171498             132   2e-33   
ref|XP_679654.1|  ribosomal phosphoprotein P0                           132   2e-33   
ref|XP_008639852.1|  PREDICTED: 60S acidic ribosomal protein P0         131   2e-33   
gb|AHK09712.1|  60S acidic ribosomal protein P0                         129   2e-33   
gb|KFO65132.1|  60S acidic ribosomal protein P0                         131   2e-33   
ref|XP_002154455.2|  PREDICTED: 60S acidic ribosomal protein P0-like    132   2e-33   
gb|EWM28546.1|  60s acidic ribosomal protein p0                         134   2e-33   
gb|AAP13485.1|  acidic ribosomal phosphoprotein P0                      127   2e-33   
ref|XP_010396743.1|  PREDICTED: 60S acidic ribosomal protein P0         131   2e-33   
gb|AFQ90984.1|  ribosomal protein large P0                              127   2e-33   
ref|XP_005147936.1|  PREDICTED: 60S acidic ribosomal protein P0         131   2e-33   
gb|EIF47803.1|  60s acidic ribosomal protein p0                         132   2e-33   
gb|ABW04139.1|  ribosomal protein LP0                                   131   3e-33   
ref|XP_009823852.1|  hypothetical protein H257_02063                    132   3e-33   
gb|ACZ65034.1|  acidic ribosomal protein                                127   3e-33   
ref|XP_007434308.1|  PREDICTED: 60S acidic ribosomal protein P0-l...    132   3e-33   
ref|XP_002489404.1|  60S acidic ribosomal protein P0                    132   3e-33   
dbj|BAF98695.1|  ribosomal protein LP0                                  132   3e-33   
ref|XP_005233278.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    132   3e-33   
ref|XP_010177042.1|  PREDICTED: 60S acidic ribosomal protein P0         132   3e-33   
ref|XP_009886897.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    131   3e-33   
ref|XP_009907942.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    132   3e-33   
ref|XP_009685789.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    131   3e-33   
emb|CCO03025.1|  ribosomal protein, large, P0                           127   4e-33   
dbj|BAN37785.1|  60S acidic ribosomal protein P0, putative              131   4e-33   
ref|XP_008501040.1|  PREDICTED: 60S acidic ribosomal protein P0         131   4e-33   
ref|XP_004346242.1|  ribosomal protein P0                               131   4e-33   
ref|XP_009948467.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    131   4e-33   
ref|XP_002199561.1|  PREDICTED: 60S acidic ribosomal protein P0         131   4e-33   
ref|XP_005524479.1|  PREDICTED: 60S acidic ribosomal protein P0         131   4e-33   
ref|XP_005493516.1|  PREDICTED: 60S acidic ribosomal protein P0         131   4e-33   
ref|XP_006039721.1|  PREDICTED: 60S acidic ribosomal protein P0-like    129   4e-33   
gb|KFP07838.1|  60S acidic ribosomal protein P0                         131   4e-33   
ref|XP_008924020.1|  PREDICTED: 60S acidic ribosomal protein P0         131   4e-33   
gb|EGE00113.1|  ribosomal protein P0                                    131   4e-33   
ref|XP_009285795.1|  PREDICTED: 60S acidic ribosomal protein P0         131   4e-33   
ref|XP_010572856.1|  PREDICTED: 60S acidic ribosomal protein P0         131   4e-33   
ref|XP_005054917.1|  PREDICTED: 60S acidic ribosomal protein P0         131   4e-33   
ref|XP_002175920.1|  60S acidic ribosomal protein Rpp0                  131   5e-33   
gb|KFD51108.1|  hypothetical protein M513_08008                         131   5e-33   
ref|XP_010226991.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    131   5e-33   
ref|XP_005962036.1|  PREDICTED: 60S acidic ribosomal protein P0-l...    130   5e-33   
ref|XP_010341232.1|  PREDICTED: 60S acidic ribosomal protein P0         129   5e-33   
gb|EGE05266.1|  ribosomal protein P0                                    131   5e-33   
gb|AEA51110.1|  60S acidic ribosomal protein P0                         130   6e-33   
ref|NP_990318.1|  60S acidic ribosomal protein P0                       130   7e-33   
ref|XP_003726867.1|  PREDICTED: 60S acidic ribosomal protein P0-like    127   7e-33   
gb|ADD21620.1|  ribosomal protein P0                                    130   7e-33   
gb|EMP24441.1|  60S acidic ribosomal protein P0                         130   7e-33   
ref|XP_006096615.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    129   7e-33   
ref|XP_003280011.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    129   7e-33   
ref|XP_004611132.1|  PREDICTED: 60S acidic ribosomal protein P0-l...    129   7e-33   
ref|XP_005503982.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    130   7e-33   
ref|XP_007071837.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    130   7e-33   
ref|XP_005891538.1|  PREDICTED: 60S acidic ribosomal protein P0-l...    129   8e-33   
gb|AAP20211.1|  acidic ribosomal phosphoprotein                         128   8e-33   
ref|XP_003226041.1|  PREDICTED: 60S acidic ribosomal protein P0         130   8e-33   
ref|XP_005288756.1|  PREDICTED: 60S acidic ribosomal protein P0         130   8e-33   
ref|XP_002140323.1|  60S acidic ribosomal protein P0                    130   8e-33   
ref|XP_005987234.1|  PREDICTED: 60S acidic ribosomal protein P0         130   8e-33   



>ref|XP_002268645.1| PREDICTED: 60S acidic ribosomal protein P0 [Vitis vinifera]
Length=320

 Score =   280 bits (715),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVK +KA KKIAYDQKLCQLLDEY+QILIA ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKPSKADKKIAYDQKLCQLLDEYSQILIAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRSIR+HAE TGNTA LNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSIRLHAEKTGNTAFLNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDV+VPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVIVPPGNTGLDPSQTSFFQVLN  145



>emb|CAN80537.1| hypothetical protein VITISV_003812 [Vitis vinifera]
Length=320

 Score =   277 bits (708),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVK +KA KKIAYDQKLCQLLDEYTQILIA ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKPSKADKKIAYDQKLCQLLDEYTQILIAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRSIR+HAE TGN A LNLIPLLVGNVGLIFT+GDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSIRLHAEKTGNQAFLNLIPLLVGNVGLIFTRGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDV+VPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVIVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_002276842.1| PREDICTED: 60S acidic ribosomal protein P0 [Vitis vinifera]
Length=320

 Score =   277 bits (708),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVK +KA KKIAYDQKLCQLLDEYTQILIA ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKPSKADKKIAYDQKLCQLLDEYTQILIAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRSIR+HAE TGN A LNLIPLLVGNVGLIFT+GDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSIRLHAEKTGNQAFLNLIPLLVGNVGLIFTRGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDV+VPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVIVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_007009051.1| Ribosomal protein L10 family protein isoform 1 [Theobroma cacao]
 gb|EOY17861.1| Ribosomal protein L10 family protein isoform 1 [Theobroma cacao]
Length=320

 Score =   276 bits (706),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVK +KA KKIAYD KLCQLLDEYTQILIA ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKPSKADKKIAYDAKLCQLLDEYTQILIAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRSIR+HAE TGNTA LNLIPLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSIRMHAEKTGNTAFLNLIPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_010247657.1| PREDICTED: 60S acidic ribosomal protein P0-like [Nelumbo nucifera]
Length=320

 Score =   274 bits (701),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 132/145 (91%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVK +K +KK AYDQKLCQLLDEYTQIL+A ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKPSKTEKKAAYDQKLCQLLDEYTQILVASADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRSIR+HAE TGN A LNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGL+A
Sbjct  61   MMKRSIRLHAEKTGNKAFLNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLIA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>gb|KHG25462.1| 60S acidic ribosomal P0 [Gossypium arboreum]
Length=321

 Score =   273 bits (699),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVK +KA+KKIAYD KLCQLLDEYTQILIA ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKPSKAEKKIAYDAKLCQLLDEYTQILIAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+HAE TGN A LNLIPLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVRMHAEKTGNQAFLNLIPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_010256605.1| PREDICTED: 60S acidic ribosomal protein P0 [Nelumbo nucifera]
Length=319

 Score =   273 bits (698),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVK +KA KKIAYD+KLC+LLD+YTQIL+A ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKSSKADKKIAYDKKLCELLDQYTQILVAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KR+IR+H+E TGNTA LNLIPLLVGNVGLIFTKGDLKEVSEEV KYKVGAPARVGLVA
Sbjct  61   MMKRTIRIHSERTGNTAFLNLIPLLVGNVGLIFTKGDLKEVSEEVGKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_011076719.1| PREDICTED: 60S acidic ribosomal protein P0 [Sesamum indicum]
Length=321

 Score =   273 bits (698),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/145 (90%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA K +K++KK+ YDQKLCQLLDEYTQ+L+AVADNVGSNQLQ+IRKGLRGDSVVLMGKNT
Sbjct  1    MAPKLSKSEKKVVYDQKLCQLLDEYTQVLVAVADNVGSNQLQSIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRSIR+HAE TGN AILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSIRMHAEKTGNNAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>gb|KJB78787.1| hypothetical protein B456_013G019000 [Gossypium raimondii]
Length=321

 Score =   273 bits (698),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVK +KA KKIAYD KLCQLLDEYTQILIA ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKPSKADKKIAYDAKLCQLLDEYTQILIAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+HAE TGN A LNLIPLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVRMHAEKTGNQAFLNLIPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>gb|KHG08087.1| 60S acidic ribosomal P0 [Gossypium arboreum]
Length=321

 Score =   273 bits (697),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVK +KA KKIAYD KLCQLLDEYTQILIA ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKPSKADKKIAYDAKLCQLLDEYTQILIAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+HAE TGN A LNLIPLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVRMHAEKTGNQAFLNLIPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>gb|KDP44812.1| hypothetical protein JCGZ_01312 [Jatropha curcas]
Length=321

 Score =   273 bits (697),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA K +KA KKIAYD KLCQLLDEY+QILIA ADNVGSNQLQNIR+GLRGDSVVLMGKNT
Sbjct  1    MAAKPSKADKKIAYDAKLCQLLDEYSQILIAQADNVGSNQLQNIRRGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRSIRVHAE TGNTAILNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSIRVHAEKTGNTAILNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>gb|KJB74260.1| hypothetical protein B456_011G283700 [Gossypium raimondii]
Length=273

 Score =   271 bits (692),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/145 (91%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVK +KA KKIAYD KLCQLLDEYTQILIA ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKPSKADKKIAYDAKLCQLLDEYTQILIAAADNVGSKQLQNIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+HAE TGN A LNLIPLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVRMHAEKTGNEAFLNLIPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>gb|KHG25720.1| 60S acidic ribosomal P0 [Gossypium arboreum]
Length=320

 Score =   272 bits (696),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVK +KA KKIAYD KLCQLLDEYTQILIA ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKPSKADKKIAYDAKLCQLLDEYTQILIAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+HAE TGN A LNLIPLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVRMHAEKTGNQAFLNLIPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>gb|KJB76159.1| hypothetical protein B456_012G076000 [Gossypium raimondii]
Length=320

 Score =   272 bits (696),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVK +KA KKIAYD KLCQLLDEYTQILIA ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKPSKADKKIAYDAKLCQLLDEYTQILIAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+HAE TGN A LNLIPLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVRMHAEKTGNQAFLNLIPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>gb|EPS69246.1| p0 ribosomal protein-like protein, partial [Genlisea aurea]
Length=329

 Score =   272 bits (696),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = +1

Query  169  SMAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKN  348
            SMA K +K++KKIAYDQKLCQLLDEYTQ+L+AVADNVGSNQLQ+IR+GLRGDSVVLMGKN
Sbjct  7    SMAPKISKSEKKIAYDQKLCQLLDEYTQVLVAVADNVGSNQLQSIRRGLRGDSVVLMGKN  66

Query  349  TMIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLV  528
            TM+KRSIR+H+E TGNTAILNLIPLL GNVGLIFTKGDLKEVSEE+ KY+VGAPARVGLV
Sbjct  67   TMMKRSIRIHSEKTGNTAILNLIPLLAGNVGLIFTKGDLKEVSEEIGKYQVGAPARVGLV  126

Query  529  APIDVVVPPGNTGLDPSQTSFFQVLN  606
            APIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  127  APIDVVVPPGNTGLDPSQTSFFQVLN  152



>ref|XP_007009052.1| Ribosomal protein L10 family protein isoform 2 [Theobroma cacao]
 gb|EOY17862.1| Ribosomal protein L10 family protein isoform 2 [Theobroma cacao]
Length=321

 Score =   271 bits (694),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 135/146 (92%), Positives = 138/146 (95%), Gaps = 1/146 (1%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVK +KA KKIAYD KLCQLLDEYTQILIA ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKPSKADKKIAYDAKLCQLLDEYTQILIAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLL-VGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLV  528
            M+KRSIR+HAE TGNTA LNLIPLL  GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLV
Sbjct  61   MMKRSIRMHAEKTGNTAFLNLIPLLQQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLV  120

Query  529  APIDVVVPPGNTGLDPSQTSFFQVLN  606
            APIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  APIDVVVPPGNTGLDPSQTSFFQVLN  146



>ref|XP_006848156.1| hypothetical protein AMTR_s00029p00231170 [Amborella trichopoda]
 gb|ERN09737.1| hypothetical protein AMTR_s00029p00231170 [Amborella trichopoda]
Length=322

 Score =   271 bits (692),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVK +KA+KK+AYDQKLCQLLD+Y+Q+LI  ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKTSKAEKKVAYDQKLCQLLDQYSQVLIVAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KR+IR+H E TGN A LNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRTIRLHTEKTGNNAFLNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>gb|KJB74261.1| hypothetical protein B456_011G283700 [Gossypium raimondii]
Length=321

 Score =   270 bits (691),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 132/145 (91%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVK +KA KKIAYD KLCQLLDEYTQILIA ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKPSKADKKIAYDAKLCQLLDEYTQILIAAADNVGSKQLQNIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+HAE TGN A LNLIPLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVRMHAEKTGNEAFLNLIPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_004149240.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cucumis sativus]
 gb|KGN50643.1| 60S acidic ribosomal protein PO [Cucumis sativus]
Length=320

 Score =   270 bits (690),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA+K TKA+KK+AYD KLCQLLDEY+Q+L+  ADNVGSNQLQNIRKGLRGDS+VLMGKNT
Sbjct  1    MAIKPTKAEKKVAYDSKLCQLLDEYSQVLVVAADNVGSNQLQNIRKGLRGDSIVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+H+E TGN A LNL+PLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVRIHSEQTGNKAYLNLLPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDV+VPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVIVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_004165071.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cucumis sativus]
Length=320

 Score =   270 bits (689),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA+K TKA+KK+AYD KLCQLLDEY+Q+L+  ADNVGSNQLQNIRKGLRGDS+VLMGKNT
Sbjct  1    MAIKPTKAEKKVAYDSKLCQLLDEYSQVLVVAADNVGSNQLQNIRKGLRGDSIVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+H+E TGN A LNL+PLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVRIHSEQTGNKAYLNLLPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDV+VPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVIVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_006435697.1| hypothetical protein CICLE_v10032141mg [Citrus clementina]
 ref|XP_006486350.1| PREDICTED: 60S acidic ribosomal protein P0-like [Citrus sinensis]
 gb|ESR48937.1| hypothetical protein CICLE_v10032141mg [Citrus clementina]
Length=319

 Score =   270 bits (689),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            M VK +KA+KKIAYD KLCQLL+EYTQIL+A ADNVGSNQLQNIR+GLRGDSVVLMGKNT
Sbjct  1    MVVKASKAEKKIAYDAKLCQLLEEYTQILVAAADNVGSNQLQNIRRGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KR+IR+HAE TGNTA LNLIPLL GNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61   MMKRTIRMHAEKTGNTAFLNLIPLLQGNVGLIFTKGDLKEVKEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_008463223.1| PREDICTED: 60S acidic ribosomal protein P0 [Cucumis melo]
Length=320

 Score =   270 bits (689),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA+K TKA+KK+AYD KLCQLLDEY+Q+L+  ADNVGSNQLQNIRKGLRGDS+VLMGKNT
Sbjct  1    MAIKPTKAEKKVAYDSKLCQLLDEYSQVLVVAADNVGSNQLQNIRKGLRGDSIVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+H+E TGN A LNL+PLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVRIHSEQTGNKAYLNLLPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDV+VPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVIVPPGNTGLDPSQTSFFQVLN  145



>gb|KDO69054.1| hypothetical protein CISIN_1g020952mg [Citrus sinensis]
Length=319

 Score =   269 bits (688),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            M VK +KA+KKIAYD KLCQLL+EYTQIL+A ADNVGSNQLQNIR+GLRGDSVVLMGKNT
Sbjct  1    MVVKASKAEKKIAYDAKLCQLLEEYTQILVAAADNVGSNQLQNIRRGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KR+IR+HAE TGNTA LNLIPLL GNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61   MMKRTIRMHAEKTGNTAFLNLIPLLQGNVGLIFTKGDLKEVKEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>gb|KDO69055.1| hypothetical protein CISIN_1g020952mg [Citrus sinensis]
Length=318

 Score =   269 bits (687),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            M VK +KA+KKIAYD KLCQLL+EYTQIL+A ADNVGSNQLQNIR+GLRGDSVVLMGKNT
Sbjct  1    MVVKASKAEKKIAYDAKLCQLLEEYTQILVAAADNVGSNQLQNIRRGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KR+IR+HAE TGNTA LNLIPLL GNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61   MMKRTIRMHAEKTGNTAFLNLIPLLQGNVGLIFTKGDLKEVKEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_011084927.1| PREDICTED: 60S acidic ribosomal protein P0-like [Sesamum indicum]
Length=315

 Score =   268 bits (686),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA K +KA KKIAYD+KLCQL+D++TQIL+A ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAPKLSKADKKIAYDRKLCQLIDDHTQILVAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRSIR+HAE TGNT ILNLIPLLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSIRIHAEKTGNTDILNLIPLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_010534571.1| PREDICTED: 60S acidic ribosomal protein P0-like [Tarenaya hassleriana]
Length=321

 Score =   268 bits (686),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVK TKA+KKIAYD KLCQLLDEYTQILI  ADNVGSNQLQ+IRKGLRGDS+VLMGKNT
Sbjct  1    MAVKPTKAEKKIAYDAKLCQLLDEYTQILIVAADNVGSNQLQSIRKGLRGDSIVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+HAE T N A LNLIPLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVRMHAEKTDNKAFLNLIPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_004501267.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cicer arietinum]
Length=322

 Score =   268 bits (685),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVK TKA+KKIAYD KLCQLLD+Y+QIL+  ADNVGSNQLQ+IR GLRGDSVVLMGKNT
Sbjct  1    MAVKPTKAEKKIAYDSKLCQLLDDYSQILVVHADNVGSNQLQSIRSGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRSIR+HAE TGN   LNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSIRIHAEQTGNKTFLNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>gb|ADR71235.1| 60S acidic ribosomal protein P0A [Hevea brasiliensis]
Length=320

 Score =   267 bits (683),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA K +KA KKIAYD KLCQLLDEY+QILI  ADNVGSNQLQNIR+GLRGDSVVLMGKNT
Sbjct  1    MAGKPSKADKKIAYDAKLCQLLDEYSQILIVAADNVGSNQLQNIRQGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KR+IRVH+E TGNTA LNLIPLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRTIRVHSEKTGNTAFLNLIPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_007222847.1| hypothetical protein PRUPE_ppa008800mg [Prunus persica]
 ref|XP_008222707.1| PREDICTED: 60S acidic ribosomal protein P0 [Prunus mume]
 gb|EMJ24046.1| hypothetical protein PRUPE_ppa008800mg [Prunus persica]
Length=319

 Score =   267 bits (682),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA K +KA+KKIAYD KLCQLLDEY QILI  ADNVGSNQLQNIRKGLRGDS+VLMGKNT
Sbjct  1    MAPKPSKAEKKIAYDSKLCQLLDEYGQILIVAADNVGSNQLQNIRKGLRGDSIVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRSIR+HAE TGN   LNL+PLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSIRIHAEKTGNNVYLNLVPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_010534676.1| PREDICTED: 60S acidic ribosomal protein P0-like [Tarenaya hassleriana]
Length=320

 Score =   267 bits (682),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/143 (91%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +1

Query  178  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  357
            VK TKA+KKIAYD KLCQLLDEYTQILI  ADNVGSNQLQ+IRKGLRGDS+VLMGKNTM+
Sbjct  2    VKPTKAEKKIAYDAKLCQLLDEYTQILIVAADNVGSNQLQSIRKGLRGDSIVLMGKNTMM  61

Query  358  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  537
            KRSIR+HAE TGN A LNLIPLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62   KRSIRMHAEKTGNNAYLNLIPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  538  DVVVPPGNTGLDPSQTSFFQVLN  606
            DVVVPPGNTGLDPSQTSFFQVLN
Sbjct  122  DVVVPPGNTGLDPSQTSFFQVLN  144



>ref|XP_010554654.1| PREDICTED: 60S acidic ribosomal protein P0 [Tarenaya hassleriana]
Length=320

 Score =   267 bits (682),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVK TKA+KKIAYD KLCQLLDEYTQIL+  ADNVGSNQLQ+IRKGLRGDSVVLMGKNT
Sbjct  1    MAVKPTKAEKKIAYDAKLCQLLDEYTQILVVAADNVGSNQLQSIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRSIR+HAE TGN   LNLI LL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSIRMHAEKTGNNGFLNLITLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_011072152.1| PREDICTED: 60S acidic ribosomal protein P0-like [Sesamum indicum]
Length=330

 Score =   267 bits (682),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA K +KA KKIAYD+KLCQL+D++TQIL+A ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAPKLSKADKKIAYDRKLCQLIDDHTQILVAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRSIR+HAE TGN  ILNLIPLLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSIRIHAEKTGNADILNLIPLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_002526873.1| 60S acidic ribosomal protein P0, putative [Ricinus communis]
 gb|EEF35504.1| 60S acidic ribosomal protein P0, putative [Ricinus communis]
Length=320

 Score =   266 bits (681),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA K +KA KK+AYD KLCQLLDEY+QILI  ADNVGSNQLQNIR+GLRGDSVVLMGKNT
Sbjct  1    MAGKPSKADKKLAYDAKLCQLLDEYSQILIVAADNVGSNQLQNIRRGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRSIRVHA+NTGN  ILNLIPLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSIRVHADNTGNKTILNLIPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|NP_187531.1| 60S acidic ribosomal protein P0-2 [Arabidopsis thaliana]
 sp|Q42112.2|RLA02_ARATH RecName: Full=60S acidic ribosomal protein P0-2 [Arabidopsis 
thaliana]
 gb|AAF14020.1|AC011436_4 putative 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
 gb|AAK44040.1|AF370225_1 putative 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
 gb|AAL15223.1| putative 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
 gb|AEE74736.1| 60S acidic ribosomal protein P0-2 [Arabidopsis thaliana]
Length=320

 Score =   266 bits (680),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +1

Query  178  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  357
            VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDTKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  358  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  537
            KRS+R+H+ENTGNTAILNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62   KRSVRIHSENTGNTAILNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  538  DVVVPPGNTGLDPSQTSFFQVLN  606
            DVVV PGNTGLDPSQTSFFQVLN
Sbjct  122  DVVVQPGNTGLDPSQTSFFQVLN  144



>gb|ADR71236.1| 60S acidic ribosomal protein P0B [Hevea brasiliensis]
Length=320

 Score =   266 bits (680),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA K +KA KK+AYD KLCQLLDEY+QILI  ADNVGSNQLQNIR+GLRGDSVVLMGKNT
Sbjct  1    MAGKPSKADKKMAYDAKLCQLLDEYSQILIVAADNVGSNQLQNIRQGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KR+IRVH+E TGNTA LNLIPLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRTIRVHSEKTGNTAFLNLIPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_002884720.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60979.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
Length=322

 Score =   266 bits (680),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +1

Query  178  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  357
            VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDTKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  358  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  537
            KRS+R+H+ENTGNTAILNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62   KRSVRIHSENTGNTAILNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  538  DVVVPPGNTGLDPSQTSFFQVLN  606
            DVVV PGNTGLDPSQTSFFQVLN
Sbjct  122  DVVVQPGNTGLDPSQTSFFQVLN  144



>ref|XP_002882720.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58979.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
Length=323

 Score =   266 bits (680),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +1

Query  178  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  357
            VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDTKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  358  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  537
            KRS+R+H+ENTGNTAILNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62   KRSVRIHSENTGNTAILNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  538  DVVVPPGNTGLDPSQTSFFQVLN  606
            DVVV PGNTGLDPSQTSFFQVLN
Sbjct  122  DVVVQPGNTGLDPSQTSFFQVLN  144



>ref|XP_010486703.1| PREDICTED: 60S acidic ribosomal protein P0-3 [Camelina sativa]
Length=323

 Score =   266 bits (679),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +1

Query  178  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  357
            VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDAKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  358  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  537
            KRS+R+H+ENTGNTA+LNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62   KRSVRIHSENTGNTAVLNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  538  DVVVPPGNTGLDPSQTSFFQVLN  606
            DVVV PGNTGLDPSQTSFFQVLN
Sbjct  122  DVVVQPGNTGLDPSQTSFFQVLN  144



>ref|XP_009344598.1| PREDICTED: 60S acidic ribosomal protein P0 [Pyrus x bretschneideri]
Length=321

 Score =   265 bits (678),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA K +KA KKIAYD KLC LLDEY QILI  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAPKPSKADKKIAYDSKLCSLLDEYGQILIVAADNVGSKQLQNIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+HAE TGN+A LNL+PLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVRIHAEKTGNSAYLNLVPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_011035984.1| PREDICTED: 60S acidic ribosomal protein P0 [Populus euphratica]
Length=320

 Score =   265 bits (678),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            M  K +KA KKIAYD KLCQLLDEY+QILIA ADNVGSNQLQNIR+GLRGDSVVLMGKNT
Sbjct  1    MVNKLSKADKKIAYDAKLCQLLDEYSQILIAAADNVGSNQLQNIRRGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+H+E TGN A LNLIPLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVRIHSEKTGNKAFLNLIPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_010095082.1| 60S acidic ribosomal protein P0 [Morus notabilis]
 gb|EXB58188.1| 60S acidic ribosomal protein P0 [Morus notabilis]
Length=320

 Score =   265 bits (677),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            M  K +KA KKIAYD KLCQLLDEY+Q+LI  ADNVGSNQLQ+IR+GLRGDS+VLMGKNT
Sbjct  1    MVGKLSKADKKIAYDAKLCQLLDEYSQVLIVAADNVGSNQLQSIRRGLRGDSIVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+H+ENTGN A LNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVRIHSENTGNKAFLNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDV+VPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVIVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_010486773.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
Length=324

 Score =   265 bits (678),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +1

Query  178  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  357
            VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDAKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  358  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  537
            KRS+R+H+ENTGNTA+LNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62   KRSVRIHSENTGNTAVLNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  538  DVVVPPGNTGLDPSQTSFFQVLN  606
            DVVV PGNTGLDPSQTSFFQVLN
Sbjct  122  DVVVQPGNTGLDPSQTSFFQVLN  144



>ref|XP_006298124.1| hypothetical protein CARUB_v10014186mg [Capsella rubella]
 gb|EOA31022.1| hypothetical protein CARUB_v10014186mg [Capsella rubella]
Length=323

 Score =   265 bits (677),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +1

Query  178  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  357
            VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDAKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  358  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  537
            KRS+R+H+ENTGNTA+LNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62   KRSVRIHSENTGNTAVLNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  538  DVVVPPGNTGLDPSQTSFFQVLN  606
            DVVV PGNTGLDPSQTSFFQVLN
Sbjct  122  DVVVQPGNTGLDPSQTSFFQVLN  144



>ref|XP_010464828.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
Length=324

 Score =   265 bits (677),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +1

Query  178  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  357
            VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDAKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  358  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  537
            KRS+R+H+ENTGNTA+LNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62   KRSVRIHSENTGNTAVLNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  538  DVVVPPGNTGLDPSQTSFFQVLN  606
            DVVV PGNTGLDPSQTSFFQVLN
Sbjct  122  DVVVQPGNTGLDPSQTSFFQVLN  144



>ref|NP_001239676.1| uncharacterized protein LOC100777482 [Glycine max]
 gb|ACU20858.1| unknown [Glycine max]
 gb|KHN20859.1| 60S acidic ribosomal protein P0 [Glycine soja]
Length=319

 Score =   265 bits (676),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA KQTKA+KKIAYD KLC L++EY QIL+  +DNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAPKQTKAEKKIAYDAKLCDLMEEYGQILVVNSDNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+HAE TGN A LNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVRMHAEKTGNNAYLNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_010464557.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
 ref|XP_010464558.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
Length=321

 Score =   265 bits (676),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +1

Query  178  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  357
            VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDTKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  358  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  537
            KRS+R+H+ENTGNT+ILNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62   KRSVRIHSENTGNTSILNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  538  DVVVPPGNTGLDPSQTSFFQVLN  606
            DVVV PGNTGLDPSQTSFFQVLN
Sbjct  122  DVVVQPGNTGLDPSQTSFFQVLN  144



>ref|XP_010469822.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
Length=321

 Score =   265 bits (676),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +1

Query  178  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  357
            VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDTKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  358  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  537
            KRS+R+H+ENTGNT+ILNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62   KRSVRIHSENTGNTSILNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  538  DVVVPPGNTGLDPSQTSFFQVLN  606
            DVVV PGNTGLDPSQTSFFQVLN
Sbjct  122  DVVVQPGNTGLDPSQTSFFQVLN  144



>ref|NP_001238374.1| 60S acidic ribosomal protein P0 [Glycine max]
 sp|P50346.1|RLA0_SOYBN RecName: Full=60S acidic ribosomal protein P0 [Glycine max]
 gb|AAB63814.1| acidic ribosomal protein P0 [Glycine max]
Length=320

 Score =   265 bits (676),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA KQTKA+KKIAYD KLC L++EY QIL+  +DNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAPKQTKAEKKIAYDAKLCDLMEEYGQILVVNSDNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+HAE TGN A LNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVRMHAEKTGNNAYLNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>gb|AAM65265.1| 60S acidic ribosomal protein P0-C [Arabidopsis thaliana]
Length=323

 Score =   265 bits (676),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +1

Query  178  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  357
            VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDTKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  358  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  537
            KRS+R+H+EN+GNTAILNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62   KRSVRIHSENSGNTAILNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  538  DVVVPPGNTGLDPSQTSFFQVLN  606
            DVVV PGNTGLDPSQTSFFQVLN
Sbjct  122  DVVVQPGNTGLDPSQTSFFQVLN  144



>ref|XP_008392940.1| PREDICTED: 60S acidic ribosomal protein P0 [Malus domestica]
Length=321

 Score =   265 bits (676),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA K +KA KKIAYD KLC LLDEY Q+LI  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAPKPSKADKKIAYDSKLCSLLDEYGQVLIVAADNVGSKQLQNIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+HAE TGN+A LNL+PLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVRIHAEKTGNSAYLNLVPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|NP_187734.1| 60S acidic ribosomal protein P0-3 [Arabidopsis thaliana]
 sp|P57691.1|RLA03_ARATH RecName: Full=60S acidic ribosomal protein P0-3 [Arabidopsis 
thaliana]
 gb|AAG50973.1|AC073395_15 60S acidic ribosomal protein, putative; 58619-59992 [Arabidopsis 
thaliana]
 gb|AAL07229.1| putative 60S acidic ribosomal protein [Arabidopsis thaliana]
 gb|AAM14140.1| putative 60S acidic ribosomal protein [Arabidopsis thaliana]
 gb|AEE75020.1| 60S acidic ribosomal protein P0-3 [Arabidopsis thaliana]
Length=323

 Score =   265 bits (676),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +1

Query  178  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  357
            VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDTKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  358  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  537
            KRS+R+H+EN+GNTAILNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62   KRSVRIHSENSGNTAILNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  538  DVVVPPGNTGLDPSQTSFFQVLN  606
            DVVV PGNTGLDPSQTSFFQVLN
Sbjct  122  DVVVQPGNTGLDPSQTSFFQVLN  144



>emb|CDY53103.1| BnaCnng24330D [Brassica napus]
Length=323

 Score =   264 bits (675),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +1

Query  178  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  357
            VK TKA+KKIAYD KLCQL+DE+TQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDAKLCQLIDEFTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  358  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  537
            KRS+++HAENTGNTAILNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62   KRSVKIHAENTGNTAILNLMPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  538  DVVVPPGNTGLDPSQTSFFQVLN  606
            DVVV PGNTGLDPSQTSFFQVLN
Sbjct  122  DVVVQPGNTGLDPSQTSFFQVLN  144



>ref|XP_007163525.1| hypothetical protein PHAVU_001G241400g [Phaseolus vulgaris]
 gb|ESW35519.1| hypothetical protein PHAVU_001G241400g [Phaseolus vulgaris]
Length=317

 Score =   264 bits (674),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVK TKAQKKIAYD KLC+LLD YTQIL+  ADNVGSNQLQNIR+GLRGDS+VLMGKNT
Sbjct  1    MAVKLTKAQKKIAYDAKLCRLLDNYTQILVVAADNVGSNQLQNIRQGLRGDSIVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+++HAE+TGN A LNL+PLLVGNVGLIFTKGD+KEVSE VAKYKVGAPARVGL+A
Sbjct  61   MMKRSVKLHAESTGNNAFLNLVPLLVGNVGLIFTKGDVKEVSEVVAKYKVGAPARVGLIA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>gb|KCW65657.1| hypothetical protein EUGRSUZ_G03042 [Eucalyptus grandis]
Length=186

 Score =   259 bits (662),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = +1

Query  181  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  360
            K +KA KK+AYD KLC+L+DEY+QILI  ADNVGSNQLQNIRKGLRGDS+VLMGKNTM+K
Sbjct  3    KLSKADKKLAYDAKLCRLMDEYSQILIVAADNVGSNQLQNIRKGLRGDSLVLMGKNTMMK  62

Query  361  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  540
            RSIR+HAENTGN A LNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID
Sbjct  63   RSIRIHAENTGNNAYLNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  122

Query  541  VVVPPGNTGLDPSQTSFFQVLN  606
            V+VPPGNTGLDPSQTSFFQVLN
Sbjct  123  VIVPPGNTGLDPSQTSFFQVLN  144



>ref|XP_004490967.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cicer arietinum]
Length=321

 Score =   264 bits (674),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA K TKA+KKIAYD KLCQLL+EY+QIL+  ADNVGSNQLQ+IR GLRGDSVVLMGKNT
Sbjct  1    MAPKPTKAEKKIAYDSKLCQLLEEYSQILVVHADNVGSNQLQSIRSGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRSIR+HAE TGN   LNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSIRMHAEKTGNNVYLNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_004490966.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cicer arietinum]
Length=321

 Score =   264 bits (674),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA K TKA+KKIAYD KLCQLL+EY+QIL+  ADNVGSNQLQ+IR GLRGDSVVLMGKNT
Sbjct  1    MAPKPTKAEKKIAYDSKLCQLLEEYSQILVVHADNVGSNQLQSIRSGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRSIR+HAE TGN   LNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSIRMHAEKTGNNVYLNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_006298147.1| hypothetical protein CARUB_v10014197mg [Capsella rubella]
 gb|EOA31045.1| hypothetical protein CARUB_v10014197mg [Capsella rubella]
Length=322

 Score =   264 bits (674),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +1

Query  178  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  357
            VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDAKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  358  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  537
            KRS+R+H+ENTGNT+ILNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62   KRSVRMHSENTGNTSILNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  538  DVVVPPGNTGLDPSQTSFFQVLN  606
            DVVV PGNTGLDPSQTSFFQVLN
Sbjct  122  DVVVQPGNTGLDPSQTSFFQVLN  144



>emb|CDY07906.1| BnaC03g36170D [Brassica napus]
Length=323

 Score =   264 bits (674),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +1

Query  178  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  357
            VK TKA+KKIAYD KLCQL+DE+TQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDAKLCQLIDEFTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  358  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  537
            KRS+++HAENTGNTAILNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62   KRSVKIHAENTGNTAILNLMPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  538  DVVVPPGNTGLDPSQTSFFQVLN  606
            DVVV PGNTGLDPSQTSFFQVLN
Sbjct  122  DVVVQPGNTGLDPSQTSFFQVLN  144



>ref|XP_009350848.1| PREDICTED: 60S acidic ribosomal protein P0-like [Pyrus x bretschneideri]
Length=321

 Score =   263 bits (673),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA K +KA+KKIAYD KLC LLDEY Q+LI  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAPKPSKAEKKIAYDSKLCSLLDEYGQVLIVAADNVGSKQLQNIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+HAE TGN+A LNL+PLLVGNVGLIFTKGDLKEVSEEV KYKVGAPARVGLVA
Sbjct  61   MMKRSVRIHAEKTGNSAYLNLVPLLVGNVGLIFTKGDLKEVSEEVGKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_011042597.1| PREDICTED: 60S acidic ribosomal protein P0-like [Populus euphratica]
Length=321

 Score =   263 bits (673),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            M  K +KA KKIAYD KLCQLLDEY+QILIA ADNVGSNQLQNIR+GLRGDSVVLMGKNT
Sbjct  1    MVNKLSKADKKIAYDAKLCQLLDEYSQILIAAADNVGSNQLQNIRRGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+H+E TGN   LNLIPLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVRIHSEKTGNKTFLNLIPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_002315165.1| 60S acidic ribosomal protein P0-A [Populus trichocarpa]
 gb|EEF01336.1| 60S acidic ribosomal protein P0-A [Populus trichocarpa]
Length=320

 Score =   263 bits (672),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            M  K +KA KKIAYD KLCQLLDEY+QILIA ADNVGS QLQNIR+GLRGDSVVLMGKNT
Sbjct  1    MVNKLSKADKKIAYDAKLCQLLDEYSQILIAAADNVGSTQLQNIRRGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+H+E TGN A LNLIPLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVRIHSEKTGNKAFLNLIPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_006407705.1| hypothetical protein EUTSA_v10021147mg [Eutrema salsugineum]
 gb|ESQ49158.1| hypothetical protein EUTSA_v10021147mg [Eutrema salsugineum]
Length=298

 Score =   262 bits (670),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +1

Query  178  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  357
            VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQ+IRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDAKLCQLVDEYTQILVVAADNVGSTQLQSIRKGLRGDSVVLMGKNTMM  61

Query  358  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  537
            KRS+R+HAENTGNT I+NL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62   KRSVRIHAENTGNTGIMNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  538  DVVVPPGNTGLDPSQTSFFQVLN  606
            DVVV PGNTGLDPSQTSFFQVLN
Sbjct  122  DVVVQPGNTGLDPSQTSFFQVLN  144



>gb|ACJ84880.1| unknown [Medicago truncatula]
Length=323

 Score =   263 bits (672),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVK TKA+KK  YD KLCQL+DEYTQIL+  ADNVGS QLQNIR+GLRGDSVVLMGKNT
Sbjct  1    MAVKPTKAEKKQNYDAKLCQLIDEYTQILVVNADNVGSKQLQNIRQGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+HAE TGN A LNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVRMHAEKTGNNAFLNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>gb|AFK39880.1| unknown [Medicago truncatula]
Length=323

 Score =   263 bits (672),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVK TKA+KK  YD KLCQL+DEYTQIL+  ADNVGS QLQNIR+GLRGDSVVLMGKNT
Sbjct  1    MAVKPTKAEKKQNYDAKLCQLIDEYTQILVVNADNVGSKQLQNIRQGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+HAE TGN A LNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVRMHAEKTGNNAFLNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>gb|AAM63644.1| putative 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
Length=320

 Score =   263 bits (672),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +1

Query  178  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  357
            VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQNIRKGL GDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDTKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLLGDSVVLMGKNTMM  61

Query  358  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  537
            KRS+R+H+ENTGNTAILNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62   KRSVRIHSENTGNTAILNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  538  DVVVPPGNTGLDPSQTSFFQVLN  606
            DVVV PGNTGLDPSQTSFFQVLN
Sbjct  122  DVVVQPGNTGLDPSQTSFFQVLN  144



>ref|XP_003603496.1| 60S acidic ribosomal protein p0 [Medicago truncatula]
 gb|AES73747.1| 60S acidic ribosomal protein P0-1 [Medicago truncatula]
Length=323

 Score =   263 bits (671),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVK TKA+KK  YD KLCQL+DEYTQIL+  ADNVGS QLQNIR+GLRGDSVVLMGKNT
Sbjct  1    MAVKPTKAEKKQNYDAKLCQLIDEYTQILVVNADNVGSKQLQNIRQGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+HAE TGN A LNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVRMHAEKTGNNAFLNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>gb|KFK38515.1| hypothetical protein AALP_AA3G123100 [Arabis alpina]
Length=324

 Score =   263 bits (671),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +1

Query  178  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  357
            VK TKA+KKIAYD KLCQL+DEYTQILI  ADNVGS QLQ+IRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDAKLCQLVDEYTQILIVAADNVGSTQLQSIRKGLRGDSVVLMGKNTMM  61

Query  358  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  537
            KRS+R+H+ENTGNT ILNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62   KRSVRIHSENTGNTGILNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  538  DVVVPPGNTGLDPSQTSFFQVLN  606
            DVVV PGNTGLDPSQTSFFQVLN
Sbjct  122  DVVVQPGNTGLDPSQTSFFQVLN  144



>ref|XP_006407706.1| hypothetical protein EUTSA_v10021147mg [Eutrema salsugineum]
 gb|ESQ49159.1| hypothetical protein EUTSA_v10021147mg [Eutrema salsugineum]
Length=322

 Score =   263 bits (671),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +1

Query  178  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  357
            VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQ+IRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDAKLCQLVDEYTQILVVAADNVGSTQLQSIRKGLRGDSVVLMGKNTMM  61

Query  358  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  537
            KRS+R+HAENTGNT I+NL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62   KRSVRIHAENTGNTGIMNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  538  DVVVPPGNTGLDPSQTSFFQVLN  606
            DVVV PGNTGLDPSQTSFFQVLN
Sbjct  122  DVVVQPGNTGLDPSQTSFFQVLN  144



>ref|XP_008360784.1| PREDICTED: 60S acidic ribosomal protein P0 [Malus domestica]
Length=321

 Score =   263 bits (671),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA K +KA KKIAYD KLC LLDEY Q+LI  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAPKPSKADKKIAYDSKLCSLLDEYGQVLIVAADNVGSKQLQNIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+HAE TGN+A LNL+PLLVGNVGLIFTKGDLKEVSEEV KYKVGAPARVGLVA
Sbjct  61   MMKRSVRIHAEKTGNSAYLNLVPLLVGNVGLIFTKGDLKEVSEEVGKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_002525622.1| 60S acidic ribosomal protein P0, putative [Ricinus communis]
 gb|EEF36740.1| 60S acidic ribosomal protein P0, putative [Ricinus communis]
Length=323

 Score =   263 bits (671),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVK TKAQKK+ YD+KLC+ LDEY+QIL+  ADNVGSNQLQ+IR+GLRGDSVVLMGKNT
Sbjct  1    MAVKPTKAQKKVEYDKKLCRFLDEYSQILVVAADNVGSNQLQSIRQGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+HAE TGN A LNLIPLLVGNVGLIFTKG+LKEV EE+AKYKVGAPARVGL+A
Sbjct  61   MMKRSVRLHAEKTGNNAFLNLIPLLVGNVGLIFTKGELKEVREEIAKYKVGAPARVGLIA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_010486480.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
Length=321

 Score =   262 bits (670),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +1

Query  178  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  357
            VK TKA+KKIAYD KLCQ +DEYTQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDTKLCQHIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  358  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  537
            KRS+R+H+ENTGNT+ILNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62   KRSVRIHSENTGNTSILNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  538  DVVVPPGNTGLDPSQTSFFQVLN  606
            DVVV PGNTGLDPSQTSFFQVLN
Sbjct  122  DVVVQPGNTGLDPSQTSFFQVLN  144



>ref|XP_009146942.1| PREDICTED: 60S acidic ribosomal protein P0-2 [Brassica rapa]
 emb|CDY44688.1| BnaA05g29180D [Brassica napus]
Length=323

 Score =   262 bits (670),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +1

Query  178  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  357
            VK TKA+KKIAYD KLCQL+DE+TQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDAKLCQLIDEFTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  358  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  537
            KRS+++HAENTGNT ILNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62   KRSVKIHAENTGNTGILNLMPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  538  DVVVPPGNTGLDPSQTSFFQVLN  606
            DVVV PGNTGLDPSQTSFFQVLN
Sbjct  122  DVVVQPGNTGLDPSQTSFFQVLN  144



>ref|XP_009389889.1| PREDICTED: 60S acidic ribosomal protein P0 [Musa acuminata subsp. 
malaccensis]
Length=319

 Score =   262 bits (669),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            M VK +KA+KK+ YD+KLC LLDEY+++LIAVADNVGSNQLQNIRKGLRGDS+VLMGKNT
Sbjct  1    MTVKLSKAEKKVVYDKKLCSLLDEYSKVLIAVADNVGSNQLQNIRKGLRGDSIVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            +I+R IR+HAE TGN   LNL+PLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   LIRRCIRIHAEKTGNKNYLNLLPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>gb|AFK38760.1| unknown [Lotus japonicus]
Length=322

 Score =   262 bits (669),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +1

Query  178  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  357
            VK TKA+KKIAYD KLCQLLD+YTQIL+  ADNVGSNQLQNIR+GLRGDSVVLMGKNTM+
Sbjct  2    VKPTKAEKKIAYDAKLCQLLDDYTQILVVNADNVGSNQLQNIRRGLRGDSVVLMGKNTMM  61

Query  358  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  537
            KR++R+HAE +GN   LNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62   KRTVRIHAEKSGNNVYLNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  538  DVVVPPGNTGLDPSQTSFFQVLN  606
            DVVVPPGNTGLDPSQTSFFQVLN
Sbjct  122  DVVVPPGNTGLDPSQTSFFQVLN  144



>ref|XP_009135066.1| PREDICTED: 60S acidic ribosomal protein P0-2-like [Brassica rapa]
Length=323

 Score =   262 bits (669),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +1

Query  178  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  357
            VK TKA+KKIAYD KLCQL+DE+TQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDAKLCQLIDEFTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  358  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  537
            KRS+++HAENTGNT ILNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62   KRSVKIHAENTGNTGILNLMPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  538  DVVVPPGNTGLDPSQTSFFQVLN  606
            DVVV PGNTGLDPSQTSFFQVLN
Sbjct  122  DVVVQPGNTGLDPSQTSFFQVLN  144



>ref|XP_007157498.1| hypothetical protein PHAVU_002G074600g [Phaseolus vulgaris]
 gb|ESW29492.1| hypothetical protein PHAVU_002G074600g [Phaseolus vulgaris]
Length=321

 Score =   262 bits (669),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA KQTKA+KKI+YD KLCQLLD+Y QIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAPKQTKAEKKISYDGKLCQLLDDYGQILVVNADNVGSKQLQNIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+HAE TGN   L+LIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVRIHAEKTGNNVYLSLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>emb|CDX73962.1| BnaA03g30850D [Brassica napus]
Length=323

 Score =   262 bits (669),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +1

Query  178  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  357
            VK TKA+KKIAYD KLCQL+DE+TQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDAKLCQLIDEFTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  358  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  537
            KRS+++HAENTGNT ILNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62   KRSVKIHAENTGNTGILNLMPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  538  DVVVPPGNTGLDPSQTSFFQVLN  606
            DVVV PGNTGLDPSQTSFFQVLN
Sbjct  122  DVVVQPGNTGLDPSQTSFFQVLN  144



>ref|XP_002312149.1| 60S acidic ribosomal protein P0-A [Populus trichocarpa]
 gb|EEE89516.1| 60S acidic ribosomal protein P0-A [Populus trichocarpa]
Length=322

 Score =   261 bits (668),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            M  K +KA KKIAYD KLCQLLDEY+QILIA ADNVGS QLQNIR+GLRGDSVVLMGKNT
Sbjct  1    MVNKLSKADKKIAYDAKLCQLLDEYSQILIAAADNVGSTQLQNIRRGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+H+E TGN   LNLIPLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVRIHSEKTGNKTFLNLIPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>gb|ABK95701.1| unknown [Populus trichocarpa]
Length=322

 Score =   261 bits (667),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            M  K +KA KKIAYD KLCQLLDEY+QILIA ADNVGS QLQNIR+GLRGDSVVLMGKNT
Sbjct  1    MVNKLSKADKKIAYDAKLCQLLDEYSQILIAAADNVGSTQLQNIRRGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+H+E TGN   LNLIPLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVRIHSEKTGNKTFLNLIPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>gb|ABK94988.1| unknown [Populus trichocarpa]
 gb|ABK95694.1| unknown [Populus trichocarpa]
Length=320

 Score =   261 bits (667),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            M  K +KA KKIAYD KLCQLLDEY+QILIA ADNVGS QLQNIR+GLRGDSVVLMGKNT
Sbjct  1    MVNKLSKADKKIAYDAKLCQLLDEYSQILIAAADNVGSTQLQNIRRGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+H+E T N A LNLIPLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVRIHSEKTANKAFLNLIPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_003616595.1| 60S acidic ribosomal protein p0 [Medicago truncatula]
 gb|AES99553.1| 60S acidic ribosomal protein P0-1 [Medicago truncatula]
Length=323

 Score =   261 bits (667),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA K TKA+KK AYD KLCQLLDE+TQILI  ADNVGS QLQNIR GLRGDSVVLMGKNT
Sbjct  1    MAPKPTKAEKKQAYDVKLCQLLDEFTQILIVNADNVGSKQLQNIRGGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+HAE TGN A LNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVRMHAEKTGNNAFLNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>gb|AAF34767.1|AF227622_1 60S acidic ribosomal protein PO [Euphorbia esula]
Length=317

 Score =   261 bits (667),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 124/140 (89%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +1

Query  187  TKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIKRS  366
            +KA+KKIAYD KLCQLLD+Y+QIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+KRS
Sbjct  3    SKAEKKIAYDAKLCQLLDDYSQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMMKRS  62

Query  367  IRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVV  546
            +RVH+E TGNTA LNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVV
Sbjct  63   VRVHSEKTGNTAFLNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVV  122

Query  547  VPPGNTGLDPSQTSFFQVLN  606
            VPPGNTGLDPSQTSFFQVLN
Sbjct  123  VPPGNTGLDPSQTSFFQVLN  142



>ref|XP_009409427.1| PREDICTED: 60S acidic ribosomal protein P0-like [Musa acuminata 
subsp. malaccensis]
Length=320

 Score =   261 bits (666),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            M VK +KA+KK+ YD+KLC LLDEY+++LIAVADNVGSNQLQNIRKGLRGDS+VLMGKNT
Sbjct  1    MTVKLSKAEKKVVYDKKLCGLLDEYSKVLIAVADNVGSNQLQNIRKGLRGDSIVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            +I+R IR+HAE TGN   LNL+PLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   LIRRCIRIHAEKTGNKNYLNLLPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_009123454.1| PREDICTED: 60S acidic ribosomal protein P0-2-like [Brassica rapa]
Length=323

 Score =   261 bits (667),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +1

Query  178  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  357
            VK TKA+KKIAYD KLCQL+DE+TQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDAKLCQLIDEFTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  358  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  537
            KRS+++HAEN+GNT ILNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62   KRSVKIHAENSGNTGILNLMPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  538  DVVVPPGNTGLDPSQTSFFQVLN  606
            DVVV PGNTGLDPSQTSFFQVLN
Sbjct  122  DVVVQPGNTGLDPSQTSFFQVLN  144



>gb|KCW65655.1| hypothetical protein EUGRSUZ_G03042 [Eucalyptus grandis]
Length=266

 Score =   259 bits (661),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = +1

Query  181  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  360
            K +KA KK+AYD KLC+L+DEY+QILI  ADNVGSNQLQNIRKGLRGDS+VLMGKNTM+K
Sbjct  3    KLSKADKKLAYDAKLCRLMDEYSQILIVAADNVGSNQLQNIRKGLRGDSLVLMGKNTMMK  62

Query  361  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  540
            RSIR+HAENTGN A LNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID
Sbjct  63   RSIRIHAENTGNNAYLNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  122

Query  541  VVVPPGNTGLDPSQTSFFQVLN  606
            V+VPPGNTGLDPSQTSFFQVLN
Sbjct  123  VIVPPGNTGLDPSQTSFFQVLN  144



>ref|XP_004145258.1| PREDICTED: 60S acidic ribosomal protein P0-2-like [Cucumis sativus]
 ref|XP_004152959.1| PREDICTED: 60S acidic ribosomal protein P0-2-like [Cucumis sativus]
 ref|XP_004168551.1| PREDICTED: 60S acidic ribosomal protein P0-2-like [Cucumis sativus]
 gb|KGN65800.1| hypothetical protein Csa_1G530120 [Cucumis sativus]
Length=320

 Score =   261 bits (666),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            M +K T+AQKK  YDQKLC+LLDEY+Q+LI  ADNVGSNQLQ+IRKGLRGDS++LMGKNT
Sbjct  1    MVLKPTRAQKKTNYDQKLCRLLDEYSQVLIVGADNVGSNQLQSIRKGLRGDSIILMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRSIR+H+ENTGNTA+ NL+P LVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSIRIHSENTGNTAVTNLLPHLVGNVGLIFTKGDLKEVKEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDV+VPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVIVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_010067511.1| PREDICTED: 60S acidic ribosomal protein P0 [Eucalyptus grandis]
 gb|KCW65656.1| hypothetical protein EUGRSUZ_G03042 [Eucalyptus grandis]
Length=320

 Score =   260 bits (665),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = +1

Query  181  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  360
            K +KA KK+AYD KLC+L+DEY+QILI  ADNVGSNQLQNIRKGLRGDS+VLMGKNTM+K
Sbjct  3    KLSKADKKLAYDAKLCRLMDEYSQILIVAADNVGSNQLQNIRKGLRGDSLVLMGKNTMMK  62

Query  361  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  540
            RSIR+HAENTGN A LNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID
Sbjct  63   RSIRIHAENTGNNAYLNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  122

Query  541  VVVPPGNTGLDPSQTSFFQVLN  606
            V+VPPGNTGLDPSQTSFFQVLN
Sbjct  123  VIVPPGNTGLDPSQTSFFQVLN  144



>ref|XP_007153264.1| hypothetical protein PHAVU_003G020600g [Phaseolus vulgaris]
 gb|ESW25258.1| hypothetical protein PHAVU_003G020600g [Phaseolus vulgaris]
Length=320

 Score =   260 bits (665),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA K TKA+KKIAYD KLCQLL+EY QIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAPKATKAEKKIAYDGKLCQLLEEYGQILVVNADNVGSTQLQNIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+H+E TGN   LNLIPLL+GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVRMHSEKTGNNVYLNLIPLLIGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>gb|AGV54296.1| 60S acidic ribosomal protein P0 [Phaseolus vulgaris]
Length=320

 Score =   260 bits (665),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA K TKA+KKIAYD KLCQLL+EY QIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAPKATKAEKKIAYDGKLCQLLEEYGQILVVNADNVGSTQLQNIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+H+E TGN   LNLIPLL+GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVRMHSEKTGNNVYLNLIPLLIGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>gb|KFK38306.1| hypothetical protein AALP_AA3G096900 [Arabis alpina]
Length=323

 Score =   260 bits (665),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +1

Query  178  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  357
            VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQ+IRKGLRGDSVVLMGKNTM+
Sbjct  2    VKATKAEKKIAYDAKLCQLVDEYTQILVVAADNVGSTQLQSIRKGLRGDSVVLMGKNTMM  61

Query  358  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  537
            KRS+R+H+E+TGNT ILNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62   KRSVRIHSESTGNTGILNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  538  DVVVPPGNTGLDPSQTSFFQVLN  606
            DVVV PGNTGLDPSQTSFFQVLN
Sbjct  122  DVVVQPGNTGLDPSQTSFFQVLN  144



>gb|ADU04571.1| 60S acidic ribosomal protein PO [Phaseolus vulgaris]
 gb|AGV54610.1| 60S acidic ribosomal protein P0 [Phaseolus vulgaris]
Length=320

 Score =   260 bits (664),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA K TKA+KKIAYD KLCQLL+EY QIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAPKATKAEKKIAYDGKLCQLLEEYGQILVVNADNVGSTQLQNIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+H+E TGN   LNLIPLL+GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVRMHSEKTGNNVYLNLIPLLIGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>emb|CDP16385.1| unnamed protein product [Coffea canephora]
Length=322

 Score =   259 bits (663),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            M VK +KA+KKIAYDQKLC+LLDEY+ ILI  ADNVGSNQLQNIR+GLR +SV+LMGKNT
Sbjct  1    MVVKHSKAEKKIAYDQKLCKLLDEYSHILIVGADNVGSNQLQNIRRGLRAESVILMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRSIRVHAENTGN   L+LIPLLVGNVGLIFTKGDLKE+SEEV+KYKVGAPARVGL+A
Sbjct  61   MMKRSIRVHAENTGNKNFLSLIPLLVGNVGLIFTKGDLKEISEEVSKYKVGAPARVGLIA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            P DVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PDDVVVPPGNTGLDPSQTSFFQVLN  145



>gb|EYU43500.1| hypothetical protein MIMGU_mgv1a010103mg [Erythranthe guttata]
Length=322

 Score =   259 bits (663),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA K +KA KKIAYD+KLC LLDEYTQ+L+AVADNVGS QLQNIR  LRGDSVVLMGKNT
Sbjct  1    MAPKVSKADKKIAYDKKLCNLLDEYTQVLVAVADNVGSTQLQNIRSALRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRSIR+H+ENTGN AIL LI LLVGNVGLIFTKGDLKEV+EEVAK+KVGAPARVGLVA
Sbjct  61   MMKRSIRIHSENTGNKAILALIDLLVGNVGLIFTKGDLKEVTEEVAKFKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDV+VPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVIVPPGNTGLDPSQTSFFQVLN  145



>gb|KHN36391.1| 60S acidic ribosomal protein P0 [Glycine soja]
Length=321

 Score =   259 bits (663),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA K TKAQKKIAYD KLC+LLD YTQIL+  ADNVGSNQLQNIR GLRGDSV+LMGKNT
Sbjct  1    MARKLTKAQKKIAYDAKLCKLLDNYTQILVVAADNVGSNQLQNIRHGLRGDSVILMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KR+I++HA+NTGNT ILNLIPLLVGNVGLIFTKGD+KEV E V+KYKV APARVGLVA
Sbjct  61   MMKRTIKIHAQNTGNTTILNLIPLLVGNVGLIFTKGDVKEVKEVVSKYKVAAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>dbj|BAE71263.1| putative 60S acidic ribosomal protein P0 [Trifolium pratense]
 dbj|BAE71276.1| putative 60S acidic ribosomal protein P0 [Trifolium pratense]
Length=321

 Score =   259 bits (662),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA K TKA+KK  YD KLCQLLDE+ QIL+  ADNVGSNQLQ+IR+GLRGDSVVLMGKNT
Sbjct  1    MAPKATKAEKKQNYDSKLCQLLDEFNQILVVNADNVGSNQLQSIRRGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+HAE TGN A LNL+PLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVRMHAEKTGNNAFLNLVPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_009399833.1| PREDICTED: 60S acidic ribosomal protein P0-like [Musa acuminata 
subsp. malaccensis]
Length=319

 Score =   259 bits (662),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            M VK +KA+KK+ YD+KLC LLDEY+++LIAVADNVGSNQLQNIRKGLRGDS+VLMGKNT
Sbjct  1    MTVKLSKAEKKVVYDKKLCSLLDEYSKVLIAVADNVGSNQLQNIRKGLRGDSIVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            +I+R I++HAE TGN   LNL+PLLVGNVGLIFTKGDLKEVSEEVAKY+VGAPARVGLVA
Sbjct  61   LIRRCIKIHAEKTGNKNYLNLLPLLVGNVGLIFTKGDLKEVSEEVAKYQVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>gb|EYU18304.1| hypothetical protein MIMGU_mgv1a010092mg [Erythranthe guttata]
Length=322

 Score =   259 bits (661),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA K +KA+KKIAYD+KLC LLDEYTQ+L+AVADNVGS QLQNIR  LRGDSVVLMGKNT
Sbjct  1    MAPKVSKAEKKIAYDKKLCNLLDEYTQVLVAVADNVGSTQLQNIRSALRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRSIR+H++NTGN AIL LI LLVGNVGLIFTKGDLKEV+EEVAK+KVGAPARVGLVA
Sbjct  61   MMKRSIRIHSDNTGNKAILALIDLLVGNVGLIFTKGDLKEVTEEVAKFKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDV+VPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVIVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_010941551.1| PREDICTED: 60S acidic ribosomal protein P0 [Elaeis guineensis]
Length=321

 Score =   259 bits (661),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            M VK +K++KKI YD+KLC+LLDEY+Q+LIA ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MTVKLSKSEKKIEYDKKLCRLLDEYSQVLIAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            +I+R I++HAE TGN   LNL+PLLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61   LIRRCIKIHAEKTGNKDYLNLLPLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>gb|KHN34735.1| 60S acidic ribosomal protein P0 [Glycine soja]
Length=320

 Score =   259 bits (661),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA K TKAQKKIAYD KLC+LLD YTQIL+  ADNVGSNQLQNIR GLRGDSV+LMGKNT
Sbjct  1    MARKLTKAQKKIAYDAKLCKLLDNYTQILVVAADNVGSNQLQNIRHGLRGDSVILMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRSI++HA+NTG+T ILNLIPLLVGNVGLIFTKGD+KEV E V+KYKV APARVGLVA
Sbjct  61   MMKRSIKIHAQNTGDTTILNLIPLLVGNVGLIFTKGDVKEVKEVVSKYKVAAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDV+VPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVIVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_003538454.1| PREDICTED: 60S acidic ribosomal protein P0-like [Glycine max]
Length=320

 Score =   258 bits (660),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA K TKAQKKIAYD KLC+LLD YTQIL+  ADNVGSNQLQNIR GLRGDSV+LMGKNT
Sbjct  1    MARKLTKAQKKIAYDAKLCKLLDNYTQILVVAADNVGSNQLQNIRHGLRGDSVILMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRSI++HA+NTG+T ILNLIPLLVGNVGLIFTKGD+KEV E V+KYKV APARVGLVA
Sbjct  61   MMKRSIKIHAQNTGDTTILNLIPLLVGNVGLIFTKGDVKEVKEVVSKYKVAAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDV+VPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVIVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_010926952.1| PREDICTED: 60S acidic ribosomal protein P0 [Elaeis guineensis]
Length=320

 Score =   258 bits (660),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            M VK +K++KK+ YD+KLC+LLDEY+Q+LIA ADNVGSNQLQNIRKGLRGDS+VLMGKNT
Sbjct  1    MTVKLSKSEKKVEYDKKLCRLLDEYSQVLIAAADNVGSNQLQNIRKGLRGDSIVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            MI+R I+VHA+ TGN   LNL+PLLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61   MIRRCIKVHAQKTGNKECLNLLPLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_008457380.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cucumis melo]
Length=320

 Score =   258 bits (660),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            M +K T+AQKK  YDQKLC+LLDEY+Q+LI  ADNVGSNQLQ+IRKGLRGDS++LMGKNT
Sbjct  1    MVLKPTRAQKKTNYDQKLCRLLDEYSQVLIVGADNVGSNQLQSIRKGLRGDSIILMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRSIR+H+E TGNTA+ NL+P LVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSIRIHSEKTGNTAVTNLLPHLVGNVGLIFTKGDLKEVKEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDV+VPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVIVPPGNTGLDPSQTSFFQVLN  145



>ref|NP_181530.1| 60S acidic ribosomal protein P0-1 [Arabidopsis thaliana]
 sp|O04204.1|RLA01_ARATH RecName: Full=60S acidic ribosomal protein P0-1 [Arabidopsis 
thaliana]
 gb|AAB95286.1| 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
 gb|AAN71918.1| putative 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
 gb|AEC09763.1| 60S acidic ribosomal protein P0-1 [Arabidopsis thaliana]
Length=317

 Score =   258 bits (658),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVK TKA+KKI YD KLCQLL+EY+QIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKATKAEKKIVYDSKLCQLLNEYSQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+HA+ TGN A L+L+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVRIHADKTGNQAFLSLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVV PGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVQPGNTGLDPSQTSFFQVLN  145



>gb|AFK46889.1| unknown [Medicago truncatula]
Length=323

 Score =   257 bits (657),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA K TKA+KK AYD KLCQLLD++TQILI  ADNVGS QLQNIR GLRGDSVVLMGKN 
Sbjct  1    MAPKPTKAEKKQAYDVKLCQLLDKFTQILIVNADNVGSKQLQNIRGGLRGDSVVLMGKNA  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+HAE TGN A LNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVRMHAEKTGNNAFLNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_009619762.1| PREDICTED: 60S acidic ribosomal protein P0-like [Nicotiana tomentosiformis]
Length=323

 Score =   257 bits (657),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVKQTK QKK+AYDQKLC+ LD Y QILI  ADNVGS QLQNIRKGLRG+SVVLMGKNT
Sbjct  1    MAVKQTKTQKKVAYDQKLCKYLDLYNQILIVNADNVGSTQLQNIRKGLRGESVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+HAE TGN   LNLIPLLVGNVGLIFTKGDLKE+ EEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVRIHAEKTGNEGFLNLIPLLVGNVGLIFTKGDLKEIKEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            P+DV+VP GNTGLDPSQTSFFQVLN
Sbjct  121  PVDVIVPTGNTGLDPSQTSFFQVLN  145



>ref|XP_010508934.1| PREDICTED: 60S acidic ribosomal protein P0-1 [Camelina sativa]
Length=318

 Score =   257 bits (657),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVK TKA+KKI YD KLCQLL+EY QIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKATKAEKKIVYDSKLCQLLNEYPQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+HA+ TGN A L+L+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVRIHADKTGNQAFLSLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVV PGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVQPGNTGLDPSQTSFFQVLN  145



>ref|XP_002881693.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57952.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
Length=317

 Score =   257 bits (656),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVK TKA+KKI YD KLCQLL+EY QIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKGTKAEKKIVYDSKLCQLLNEYPQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+HA+ TGN A LNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVRLHADKTGNKAFLNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVV PGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVQPGNTGLDPSQTSFFQVLN  145



>ref|XP_009764939.1| PREDICTED: 60S acidic ribosomal protein P0-like [Nicotiana sylvestris]
Length=323

 Score =   257 bits (656),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVKQTK QKK+AYDQKLC+ LD Y QILI  ADNVGS QLQNIRKGLRG+SVVLMGKNT
Sbjct  1    MAVKQTKTQKKVAYDQKLCKYLDLYNQILIVNADNVGSTQLQNIRKGLRGESVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+HAE TGN   LNLIPLLVGNVGLIFTKGDLKE+ EEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVRIHAEKTGNEGFLNLIPLLVGNVGLIFTKGDLKEIKEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            P+DV+VP GNTGLDPSQTSFFQVLN
Sbjct  121  PVDVIVPTGNTGLDPSQTSFFQVLN  145



>ref|XP_008799093.1| PREDICTED: 60S acidic ribosomal protein P0 [Phoenix dactylifera]
Length=320

 Score =   257 bits (656),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            M VK TKA++K+ YD+KLC+LLDEY+Q+LIA ADNVGSNQLQNIR+GLRG+SV+LMGKNT
Sbjct  1    MTVKLTKAERKLEYDKKLCRLLDEYSQVLIAAADNVGSNQLQNIRQGLRGESVILMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            +I+R I+VHAE TGN   LNL+PLLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61   LIRRCIKVHAEKTGNKEYLNLLPLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>gb|KJB76158.1| hypothetical protein B456_012G076000 [Gossypium raimondii]
Length=315

 Score =   256 bits (655),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 132/145 (91%), Gaps = 5/145 (3%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVK +KA KKIAYD KLCQLLDEYTQILIA ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKPSKADKKIAYDAKLCQLLDEYTQILIAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+HAE TGN A LNLIPLL GNVGLIFTKGDLKEVSEE     VGAPARVGLVA
Sbjct  61   MMKRSVRMHAEKTGNQAFLNLIPLLQGNVGLIFTKGDLKEVSEE-----VGAPARVGLVA  115

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  116  PIDVVVPPGNTGLDPSQTSFFQVLN  140



>ref|XP_006411245.1| hypothetical protein EUTSA_v10016954mg [Eutrema salsugineum]
 gb|ESQ52698.1| hypothetical protein EUTSA_v10016954mg [Eutrema salsugineum]
Length=317

 Score =   256 bits (655),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVK TKA+KKI YD KLCQLL+EY QILI  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKATKAEKKIVYDSKLCQLLNEYPQILIVAADNVGSTQLQNIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+HAE TGN   L+L+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVRLHAEKTGNDCFLSLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVV PGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVQPGNTGLDPSQTSFFQVLN  145



>sp|P50345.1|RLA0_LUPLU RecName: Full=60S acidic ribosomal protein P0 [Lupinus luteus]
 emb|CAA63786.1| P0 ribosomal protein [Lupinus luteus]
Length=322

 Score =   256 bits (655),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA K TKA+KKI YD KLCQLLDEYTQIL+  ADNVGS QLQNIR+GLRGDSVVLMGKNT
Sbjct  1    MAPKATKAEKKIVYDGKLCQLLDEYTQILVVNADNVGSKQLQNIRQGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+HAE TGN A LNLIPLL+GNVGLIFTKG LKEVSEEVAKYKVGAPA VGLVA
Sbjct  61   MMKRSVRIHAEKTGNQAFLNLIPLLIGNVGLIFTKGYLKEVSEEVAKYKVGAPACVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_010517390.1| PREDICTED: 60S acidic ribosomal protein P0-1-like [Camelina sativa]
Length=318

 Score =   255 bits (652),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVK TKA+KKI YD KLCQLL+EY QIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKATKAEKKIVYDSKLCQLLNEYPQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+HA+ TGN   LNL+PLL GNVGLIF KGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVRIHADKTGNQGFLNLLPLLQGNVGLIFNKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVV PGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVQPGNTGLDPSQTSFFQVLN  145



>ref|XP_004247949.1| PREDICTED: 60S acidic ribosomal protein P0-like [Solanum lycopersicum]
Length=320

 Score =   255 bits (651),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA+K TK++KK+ YDQKLC+ LD Y QILI  ADNVGS Q+Q IRKGLRGDSVVLMGKNT
Sbjct  1    MAIKPTKSEKKVMYDQKLCKYLDSYNQILIVNADNVGSTQMQGIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+HA NTGN A LNLIPLLVGNVGLIFTKGDLKE+ EEVAKYKVGAPARVGL+A
Sbjct  61   MMKRSVRIHAGNTGNDAFLNLIPLLVGNVGLIFTKGDLKEIKEEVAKYKVGAPARVGLIA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            P+DV+VPPGNTGLDPSQTSFFQVLN
Sbjct  121  PVDVIVPPGNTGLDPSQTSFFQVLN  145



>gb|KFK36893.1| hypothetical protein AALP_AA4G185700 [Arabis alpina]
Length=318

 Score =   254 bits (650),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA+K TK +KKI YD KLCQLL+EY QIL+  ADNVGS QLQ+IRKGLRGDSVVLMGKNT
Sbjct  1    MAIKATKGEKKIVYDSKLCQLLNEYPQILVVAADNVGSTQLQSIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+HA+ TGN   L+L+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVRIHADKTGNDCFLSLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_007016138.1| Ribosomal protein L10 family protein [Theobroma cacao]
 gb|EOY33757.1| Ribosomal protein L10 family protein [Theobroma cacao]
Length=321

 Score =   254 bits (650),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            M V  +K +KK  YDQKLC+LLDEY+Q+LI  ADNVGS Q+QNIRKGLRG+SVVLMGKNT
Sbjct  1    MVVNTSKREKKEKYDQKLCRLLDEYSQVLIVAADNVGSTQVQNIRKGLRGESVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRSIR+HAENT N AI NLIPLLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGL+A
Sbjct  61   MMKRSIRLHAENTNNEAIRNLIPLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLIA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>emb|CDY24932.1| BnaC03g22400D [Brassica napus]
Length=319

 Score =   254 bits (649),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVK TKA+KKI YD KLCQLL+EY QILI  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKATKAEKKIVYDSKLCQLLNEYPQILIVAADNVGSTQLQNIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+++HA+ TGN   LNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVKLHAQKTGNDGFLNLMPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVV PGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVQPGNTGLDPSQTSFFQVLN  145



>ref|XP_009799989.1| PREDICTED: 60S acidic ribosomal protein P0-like [Nicotiana sylvestris]
Length=319

 Score =   254 bits (649),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVK TKA+KK+ YD+KLC+LLD Y QILI  ADNVGSNQLQ IRKGLRGDS+VLMGKNT
Sbjct  1    MAVKVTKAEKKVNYDKKLCKLLDTYQQILIVGADNVGSNQLQMIRKGLRGDSIVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRSIR+HAE TGN A L LIP LVGNVGLIFT+GDLKEVS+EV+KYKVGAPARVGLVA
Sbjct  61   MMKRSIRIHAEKTGNNAFLALIPCLVGNVGLIFTRGDLKEVSDEVSKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>gb|EYU43501.1| hypothetical protein MIMGU_mgv1a010103mg [Erythranthe guttata]
Length=321

 Score =   254 bits (648),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 134/145 (92%), Gaps = 1/145 (1%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA K +KA KKIAYD+KLC LLDEYTQ+L+AVADNVGS QLQNIR  LRGDSVVLMGKNT
Sbjct  1    MAPKVSKADKKIAYDKKLCNLLDEYTQVLVAVADNVGSTQLQNIRSALRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRSIR+H+ENTGN AIL LI LL GNVGLIFTKGDLKEV+EEVAK+KVGAPARVGLVA
Sbjct  61   MMKRSIRIHSENTGNKAILALIDLL-GNVGLIFTKGDLKEVTEEVAKFKVGAPARVGLVA  119

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDV+VPPGNTGLDPSQTSFFQVLN
Sbjct  120  PIDVIVPPGNTGLDPSQTSFFQVLN  144



>ref|XP_006360336.1| PREDICTED: 60S acidic ribosomal protein P0-like [Solanum tuberosum]
Length=320

 Score =   253 bits (647),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA+K TK +KK+ YDQKLC+ LD Y QILI  ADNVGS+Q+Q IRKGLRGDSVVLMGKNT
Sbjct  1    MAIKPTKFEKKVIYDQKLCKYLDSYNQILIVNADNVGSSQMQGIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+HA++TGN A LNLIPLLVGNVGLIFTKGDLKE+ EEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVRIHAKSTGNDAFLNLIPLLVGNVGLIFTKGDLKEIKEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            P+DV+VPPGNTGLDPSQTSFFQVLN
Sbjct  121  PVDVIVPPGNTGLDPSQTSFFQVLN  145



>emb|CDY60988.1| BnaA03g56530D [Brassica napus]
Length=318

 Score =   253 bits (646),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVK TKA+KKI YD KLCQLL+E+ QILI  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKATKAEKKIVYDSKLCQLLNEFPQILIVAADNVGSTQLQNIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+++HA+ TGN   LNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVKLHAQKTGNDGFLNLMPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVV PGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVQPGNTGLDPSQTSFFQVLN  145



>ref|XP_010689885.1| PREDICTED: 60S acidic ribosomal protein P0 [Beta vulgaris subsp. 
vulgaris]
Length=321

 Score =   252 bits (644),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVK TKA+KKIAYDQKLC LLDE++Q+LIA ADNVGSNQLQ IR GLRGDSVVLMGKNT
Sbjct  1    MAVKPTKAEKKIAYDQKLCNLLDEFSQVLIASADNVGSNQLQGIRSGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRSIR+HAE TGN  +  L  LLVGNVGLIFTKGDLKEV EE++KYKVGAPARVGLVA
Sbjct  61   MMKRSIRLHAEKTGNDNLRKLEQLLVGNVGLIFTKGDLKEVREEISKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_009133397.1| PREDICTED: 60S acidic ribosomal protein P0-1 [Brassica rapa]
Length=319

 Score =   252 bits (643),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVK TKA+KKI YD KLCQLL+E+ QILI  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKATKAEKKIVYDLKLCQLLNEFPQILIVAADNVGSTQLQNIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+++HA+ TGN   LNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRSVKLHAQKTGNDGFLNLMPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVV PGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVQPGNTGLDPSQTSFFQVLN  145



>ref|XP_006350830.1| PREDICTED: 60S acidic ribosomal protein P0-like [Solanum tuberosum]
Length=318

 Score =   251 bits (641),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVK TKA+KK +YD+KLC+LLD Y QILI  ADNVGSNQLQ IRKGLRGDS+VLMGKNT
Sbjct  1    MAVKVTKAEKKASYDKKLCKLLDTYQQILIVGADNVGSNQLQMIRKGLRGDSIVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRSIR+HAE TGN A L LI  LVGNVGLIFTKGDLKEVS+EV+KYKVGAPARVGLVA
Sbjct  61   MMKRSIRIHAEKTGNNAFLALIECLVGNVGLIFTKGDLKEVSDEVSKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_004241171.1| PREDICTED: 60S acidic ribosomal protein P0-like [Solanum lycopersicum]
Length=318

 Score =   251 bits (641),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVK TKA+KK+ YD+KLC+LLD Y QILI  ADNVGSNQLQ IRKGLRGDS+VLMGKNT
Sbjct  1    MAVKVTKAEKKVNYDKKLCKLLDTYQQILIVGADNVGSNQLQMIRKGLRGDSIVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRSIR+HAE TGN A L LI  LVGNVGLIFTKGDLKEVS+EV+KYKVGAPARVGLVA
Sbjct  61   MMKRSIRIHAEKTGNNAFLALIECLVGNVGLIFTKGDLKEVSDEVSKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_006296009.1| hypothetical protein CARUB_v10025153mg [Capsella rubella]
 gb|EOA28907.1| hypothetical protein CARUB_v10025153mg [Capsella rubella]
Length=319

 Score =   251 bits (640),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVK TKA+KK+ YD KLCQLL+EY QIL+  ADNVGS QLQNIRKGLR DSVVLMGKNT
Sbjct  1    MAVKVTKAEKKVVYDSKLCQLLNEYPQILVVAADNVGSTQLQNIRKGLRRDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+HA+ TGN A L+L+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLV 
Sbjct  61   MMKRSVRIHADETGNQAFLSLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVT  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVV PGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVQPGNTGLDPSQTSFFQVLN  145



>gb|ABO31368.1| 60S ribosomal protein [Gossypium hirsutum]
Length=228

 Score =   248 bits (632),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +1

Query  190  KAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIKRSI  369
            K +KK  YDQKLC+LLDEYTQ+L+  ADNVGS Q+QNIRKGLRGDS++LMGKNTM+KRSI
Sbjct  3    KREKKSQYDQKLCRLLDEYTQVLVVAADNVGSTQMQNIRKGLRGDSIILMGKNTMMKRSI  62

Query  370  RVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVV  549
            R+HAE TGN A  NL+PLLVGNVG IFTKGDLKEV EE+AKYKVGAPARVGLVAPIDV+V
Sbjct  63   RLHAERTGNDAFKNLLPLLVGNVGFIFTKGDLKEVREEIAKYKVGAPARVGLVAPIDVIV  122

Query  550  PPGNTGLDPSQTSFFQVLN  606
            PPGNTGLDPSQTSFFQVLN
Sbjct  123  PPGNTGLDPSQTSFFQVLN  141



>gb|KJB19895.1| hypothetical protein B456_003G123400 [Gossypium raimondii]
Length=321

 Score =   251 bits (640),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            M +   K +KK  YDQKLC+LLDEYTQ+L+  ADNVGS Q+QNIRKGLRGDS++LMGKNT
Sbjct  1    MVLNPAKREKKSQYDQKLCRLLDEYTQVLVVAADNVGSTQMQNIRKGLRGDSIILMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRSIR+HAE TGN A  NL+PLLVGNVG IFTKGDLKEV EE+AKYKVGAPARVGLVA
Sbjct  61   MMKRSIRLHAERTGNDAFKNLLPLLVGNVGFIFTKGDLKEVREEIAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDV+VPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVIVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_009592351.1| PREDICTED: 60S acidic ribosomal protein P0-like [Nicotiana tomentosiformis]
Length=319

 Score =   251 bits (640),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVK TK +KK+ YD+KLC+LLD Y QILI  ADNVGSNQLQ IRKGLRGDS+VLMGKNT
Sbjct  1    MAVKVTKGEKKVNYDKKLCKLLDTYQQILIVGADNVGSNQLQMIRKGLRGDSIVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRSIR+HAE TGN + L LIP LVGNVGLIFT+GDLKEVS+EV+KYKVGAPARVGLVA
Sbjct  61   MMKRSIRIHAEKTGNNSFLALIPCLVGNVGLIFTRGDLKEVSDEVSKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>gb|KDP46515.1| hypothetical protein JCGZ_08487 [Jatropha curcas]
Length=319

 Score =   249 bits (637),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA+K TKAQKK  YDQKLC+LLDEY+QIL+  ADNVGSNQLQ+IR+GLRGDS+VLMGKNT
Sbjct  1    MAIKPTKAQKKTQYDQKLCRLLDEYSQILVVGADNVGSNQLQSIRRGLRGDSIVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRSI++HAE TGN A  +L+PLLVGNVGL+FTKGDLKEV EE+AKYKVGAPARVGL+A
Sbjct  61   MMKRSIKLHAEKTGNDAFNSLVPLLVGNVGLVFTKGDLKEVREEIAKYKVGAPARVGLIA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPG TGLDPS TSFFQ LN
Sbjct  121  PIDVVVPPGPTGLDPSMTSFFQALN  145



>ref|XP_004307622.1| PREDICTED: 60S acidic ribosomal protein P0 [Fragaria vesca subsp. 
vesca]
Length=321

 Score =   249 bits (637),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +1

Query  181  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  360
            K +KA+KKI YD KLC LL++Y Q+LI  ADNVGS QLQNIRKGLRGDS VLMGKNTM+K
Sbjct  3    KLSKAEKKINYDAKLCSLLEDYGQVLIVAADNVGSTQLQNIRKGLRGDSTVLMGKNTMMK  62

Query  361  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  540
            RSI++HA  TGN A LNL+PLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID
Sbjct  63   RSIKIHAAKTGNDAYLNLVPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  122

Query  541  VVVPPGNTGLDPSQTSFFQVLN  606
            VVVPPGNTGLDPSQTSFFQVLN
Sbjct  123  VVVPPGNTGLDPSQTSFFQVLN  144



>ref|XP_004307662.1| PREDICTED: 60S acidic ribosomal protein P0 [Fragaria vesca subsp. 
vesca]
Length=321

 Score =   249 bits (637),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +1

Query  181  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  360
            K +KA+KKI YD KLC LL++Y Q+LI  ADNVGS QLQNIRKGLRGDS VLMGKNTM+K
Sbjct  3    KLSKAEKKINYDAKLCSLLEDYGQVLIVAADNVGSTQLQNIRKGLRGDSTVLMGKNTMMK  62

Query  361  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  540
            RSI++HA  TGN A LNL+PLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID
Sbjct  63   RSIKIHAAKTGNDAYLNLVPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  122

Query  541  VVVPPGNTGLDPSQTSFFQVLN  606
            VVVPPGNTGLDPSQTSFFQVLN
Sbjct  123  VVVPPGNTGLDPSQTSFFQVLN  144



>emb|CDP14047.1| unnamed protein product [Coffea canephora]
Length=320

 Score =   249 bits (636),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/145 (90%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            M  K +KA KKIAYDQKLCQLLDEY+Q+LIAVADNVGSNQLQNIRKGLRGDS+VLMGKNT
Sbjct  1    MVTKVSKADKKIAYDQKLCQLLDEYSQVLIAVADNVGSNQLQNIRKGLRGDSIVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KR+IRVHAE TGN AILNLIPLLVGNVGLIFTKGDLKE+SEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRTIRVHAEKTGNQAILNLIPLLVGNVGLIFTKGDLKEISEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            P+DVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PVDVVVPPGNTGLDPSQTSFFQVLN  145



>sp|P29764.1|RLA0_OXYRB RecName: Full=60S acidic ribosomal protein P0; AltName: Full=Light-induced 
34 kDa protein [Oxybasis rubra]
 emb|CAA33276.1| 34kD light-induced protein [Oxybasis rubra]
Length=321

 Score =   248 bits (633),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVK TKA+KKIAYDQKLCQLLDEY+Q+LIA ADNVGSNQLQ IR GLRGDS+VLMGKNT
Sbjct  1    MAVKPTKAEKKIAYDQKLCQLLDEYSQVLIASADNVGSNQLQAIRIGLRGDSIVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRSIR+HAENTGN  + N+  L + NVGLIFTKGDL +V EE++KYKVGAPAR GLVA
Sbjct  61   MMKRSIRLHAENTGNENLRNVEQLFLPNVGLIFTKGDLNQVREEISKYKVGAPARFGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_009791710.1| PREDICTED: 60S acidic ribosomal protein P0 [Nicotiana sylvestris]
Length=321

 Score =   247 bits (631),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA K TKA+KKIAYD K+CQLLDEYTQ+L+A ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAPKATKAEKKIAYDSKMCQLLDEYTQVLVAAADNVGSTQLQNIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KR+IRVHAE TGN  ILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRTIRVHAEKTGNNTILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            P+DVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PVDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_009608105.1| PREDICTED: 60S acidic ribosomal protein P0 [Nicotiana tomentosiformis]
Length=320

 Score =   246 bits (629),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA K TKA+KKIAYD K+CQLLDEYTQ+L+A ADNVGS QLQNIRKGLRGDS+VLMGKNT
Sbjct  1    MAPKATKAEKKIAYDSKMCQLLDEYTQVLVAAADNVGSKQLQNIRKGLRGDSIVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KR+IRVHAE TGN  ILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRTIRVHAEKTGNNTILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            P+DVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PVDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_002440235.1| hypothetical protein SORBIDRAFT_09g028230 [Sorghum bicolor]
 gb|EES18665.1| hypothetical protein SORBIDRAFT_09g028230 [Sorghum bicolor]
Length=319

 Score =   246 bits (628),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA+K+TKA+KKIAYD+KLC LLDEYT++L+A+ADNVGS QLQ+IR+GLRGDS+VLMGKNT
Sbjct  1    MAIKRTKAEKKIAYDKKLCALLDEYTKVLVALADNVGSKQLQDIRRGLRGDSIVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            +I+R I+V+AE TGN A   L+ LLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61   LIRRCIKVYAEKTGNNAFDPLMDLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            P+DVVV PGNTGLDPSQTSFFQVLN
Sbjct  121  PVDVVVSPGNTGLDPSQTSFFQVLN  145



>gb|KDO69056.1| hypothetical protein CISIN_1g036252mg [Citrus sinensis]
Length=318

 Score =   246 bits (628),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA + +KA+KKIAYD +LC+LL+EY+QILI  ADNVGSNQLQ+IR GLR  S+VLMGKNT
Sbjct  1    MATRLSKAEKKIAYDARLCKLLEEYSQILIVAADNVGSNQLQHIRAGLRDHSIVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRSIR+HAE TGN  +LNLIPLL GNVG+IFTKGDLKEVS+EV+K+KV APARVGLVA
Sbjct  61   MMKRSIRLHAERTGNRDLLNLIPLLQGNVGMIFTKGDLKEVSDEVSKHKVAAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_006435696.1| hypothetical protein CICLE_v10033862mg [Citrus clementina]
 ref|XP_006486351.1| PREDICTED: 60S acidic ribosomal protein P0-like [Citrus sinensis]
 gb|ESR48936.1| hypothetical protein CICLE_v10033862mg [Citrus clementina]
Length=318

 Score =   246 bits (628),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA + +KA+KKIAYD +LC+LL+EY+QILI  ADNVGSNQLQ+IR GLR  S+VLMGKNT
Sbjct  1    MATRLSKAEKKIAYDARLCKLLEEYSQILIVAADNVGSNQLQHIRAGLRDHSIVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRSIR+HAE TGN  +LNLIPLL GNVG+IFTKGDLKEVS+EV+K+KV APARVGLVA
Sbjct  61   MMKRSIRLHAERTGNRDLLNLIPLLQGNVGMIFTKGDLKEVSDEVSKHKVAAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_004239781.1| PREDICTED: 60S acidic ribosomal protein P0 [Solanum lycopersicum]
Length=321

 Score =   244 bits (623),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA K TKA+KKIAYD K+CQLLD++TQ+L+A ADNVGSNQLQ+IRKGLRGDSVVLMGKNT
Sbjct  1    MAPKATKAEKKIAYDTKMCQLLDDFTQVLVAAADNVGSNQLQSIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KR+IRVHAE TGN  ILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRTIRVHAEKTGNETILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            P+DVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PVDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|NP_001275012.1| 60S acidic ribosomal protein P0-like [Solanum tuberosum]
 gb|ABB29933.1| P0 ribosomal protein-like [Solanum tuberosum]
 gb|ABB87111.1| P0 ribosomal protein-like [Solanum tuberosum]
Length=320

 Score =   244 bits (623),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA K TKA+KKIAYD K+CQLLD++TQ+L+A ADNVGSNQLQ+IRKGLRGDSVVLMGKNT
Sbjct  1    MAPKATKAEKKIAYDTKMCQLLDDFTQVLVAAADNVGSNQLQSIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KR+IRVHAE TGN  ILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRTIRVHAEKTGNETILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            P+DVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PVDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_004287422.1| PREDICTED: 60S acidic ribosomal protein P0-like [Fragaria vesca 
subsp. vesca]
Length=321

 Score =   244 bits (622),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +1

Query  181  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  360
            K +KA KK  YD KLC+LLD+Y Q+L+  ADNVGS QLQNIRKGLRGDS VLMGKNTM+K
Sbjct  3    KLSKADKKTNYDAKLCKLLDDYGQVLVVAADNVGSTQLQNIRKGLRGDSTVLMGKNTMMK  62

Query  361  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  540
            RSI++HA  TGN A L+L+PLLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVAPID
Sbjct  63   RSIKIHAARTGNDAYLSLVPLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVAPID  122

Query  541  VVVPPGNTGLDPSQTSFFQVLN  606
            VVVPPGNTGLDPSQTSFFQVLN
Sbjct  123  VVVPPGNTGLDPSQTSFFQVLN  144



>ref|NP_001060923.1| Os08g0130500 [Oryza sativa Japonica Group]
 sp|P41095.3|RLA0_ORYSJ RecName: Full=60S acidic ribosomal protein P0 [Oryza sativa Japonica 
Group]
 pdb|3J61|QQ Chain q, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAA04668.1| acidic ribosomal protein P0 [Oryza sativa Japonica Group]
 dbj|BAC66723.1| 60S acidic ribosomal protein P0 [Oryza sativa Japonica Group]
 dbj|BAF22837.1| Os08g0130500 [Oryza sativa Japonica Group]
 dbj|BAG89244.1| unnamed protein product [Oryza sativa Japonica Group]
Length=319

 Score =   241 bits (614),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA+K+TKA+KK+AYD+KLCQLLDEYT++LIAVADNVGSNQLQ IRKGLRGDS+VLMGKNT
Sbjct  1    MAIKRTKAEKKVAYDKKLCQLLDEYTKVLIAVADNVGSNQLQEIRKGLRGDSIVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            +I+R I+VHA+NTGN   L L+PLLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61   LIRRCIKVHADNTGNKEFLELMPLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            P+DVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PVDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_001759851.1| predicted protein [Physcomitrella patens]
 gb|EDQ75355.1| predicted protein [Physcomitrella patens]
Length=318

 Score =   240 bits (613),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            M  K TKA+KK+ YD+KL QLL+EYTQ+LI  ADNVGS QLQ+IRKGLR DS+VLMGKNT
Sbjct  1    MGFKGTKAEKKVLYDKKLIQLLEEYTQVLICAADNVGSKQLQSIRKGLRPDSIVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRSIR+HAE TGN     L+P LVGNVGLIFTKGDLKEV EE+ KYKVGAPARVGLVA
Sbjct  61   MMKRSIRIHAEKTGNKDYEELLPALVGNVGLIFTKGDLKEVREEIGKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDV+VPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVIVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_001759592.1| predicted protein [Physcomitrella patens]
 gb|EDQ75504.1| predicted protein [Physcomitrella patens]
Length=319

 Score =   240 bits (612),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            M  K TKA+KK  YD+KL QLL+EY+Q+LI  ADNVGS QLQ IRKGLR DS+VLMGKNT
Sbjct  1    MGFKGTKAEKKALYDKKLVQLLEEYSQVLICAADNVGSKQLQEIRKGLRPDSIVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRSIR+HAE TGN     L+P LVGNVGLIFTKGDLKEV EE+AKYKVGAPARVGLVA
Sbjct  61   MMKRSIRIHAEKTGNKDYEELLPALVGNVGLIFTKGDLKEVREEIAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLN  145



>gb|ABA91328.1| 60S acidic ribosomal protein P0, putative, expressed [Oryza sativa 
Japonica Group]
 gb|EAY79838.1| hypothetical protein OsI_34997 [Oryza sativa Indica Group]
 gb|EAZ41411.1| hypothetical protein OsJ_25933 [Oryza sativa Japonica Group]
Length=320

 Score =   239 bits (611),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA+K+TKA+KK+AYD+KLCQLLDEYT++LIAVADNVGSNQLQ IRKGLRGDS+VLMGKNT
Sbjct  1    MAIKRTKAEKKVAYDKKLCQLLDEYTKVLIAVADNVGSNQLQEIRKGLRGDSIVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            +I+R I+VHA+NTGN   L L+PLLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61   LIRRCIKVHADNTGNKDFLELMPLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            P+DVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PVDVVVPPGNTGLDPSQTSFFQVLN  145



>gb|EAY82182.1| hypothetical protein OsI_37384 [Oryza sativa Indica Group]
 emb|CBX24392.1| hypothetical_protein [Oryza glaberrima]
Length=320

 Score =   239 bits (611),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA+K+TKA+KK+AYD+KLCQLLDEYT++LIAVADNVGSNQLQ IRKGLRGDS+VLMGKNT
Sbjct  1    MAIKRTKAEKKVAYDKKLCQLLDEYTKVLIAVADNVGSNQLQEIRKGLRGDSIVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            +I+R I+VHA+NTGN   L L+PLLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61   LIRRCIKVHADNTGNKDFLELMPLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            P+DVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PVDVVVPPGNTGLDPSQTSFFQVLN  145



>gb|ABA95724.1| 60S acidic ribosomal protein P0, putative, expressed [Oryza sativa 
Japonica Group]
 gb|EAZ19563.1| hypothetical protein OsJ_35136 [Oryza sativa Japonica Group]
Length=320

 Score =   239 bits (611),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA+K+TKA+KK+AYD+KLCQLLDEYT++LIAVADNVGSNQLQ IRKGLRGDS+VLMGKNT
Sbjct  1    MAIKRTKAEKKVAYDKKLCQLLDEYTKVLIAVADNVGSNQLQEIRKGLRGDSIVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            +I+R I+VHA+NTGN   L L+PLLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61   LIRRCIKVHADNTGNKDFLELMPLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            P+DVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PVDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_006659092.1| PREDICTED: 60S acidic ribosomal protein P0-like [Oryza brachyantha]
Length=319

 Score =   239 bits (611),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA+K+TKA+KK+AYD+KLCQLLDEYT++LIAVADNVGSNQLQ IRKGLRGDS+VLMGKNT
Sbjct  1    MAIKRTKAEKKVAYDKKLCQLLDEYTKVLIAVADNVGSNQLQEIRKGLRGDSIVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            +I+R I+VHAE TGN   L L+PLLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61   LIRRCIKVHAEQTGNKEFLELMPLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            P+DVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PVDVVVPPGNTGLDPSQTSFFQVLN  145



>dbj|BAC10912.1| putative 60S acidic ribosomal protein P0 [Zinnia elegans]
Length=203

 Score =   234 bits (598),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = +1

Query  181  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  360
            K +KA KKIAYDQKLCQLLD+Y Q+L+A ADNVGSNQLQNIR+GLRGDSV+LMGKNTM+K
Sbjct  3    KVSKADKKIAYDQKLCQLLDDYNQVLVAAADNVGSNQLQNIRQGLRGDSVILMGKNTMMK  62

Query  361  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  540
            RSIR+H+E TGN A LNLIPLLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVAP+D
Sbjct  63   RSIRMHSEKTGNKAYLNLIPLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVAPVD  122

Query  541  VVVPPGNTGLDPSQTSFFQVLN  606
            VVVPPGNTGLDPSQTSFFQVLN
Sbjct  123  VVVPPGNTGLDPSQTSFFQVLN  144



>gb|AID52928.1| 60S acidic ribosomal protein P0 [Carthamus tinctorius]
Length=321

 Score =   238 bits (606),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = +1

Query  181  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  360
            K +KA KKIAYDQKLCQLLD+YTQ+L+A ADNVGSNQLQNIR GLRGDSV+LMGKNTM+K
Sbjct  3    KVSKADKKIAYDQKLCQLLDDYTQVLVAAADNVGSNQLQNIRHGLRGDSVILMGKNTMMK  62

Query  361  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  540
            RS+R+H+E TGN A LNLIPLLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVAP+D
Sbjct  63   RSVRMHSEKTGNKAFLNLIPLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVAPVD  122

Query  541  VVVPPGNTGLDPSQTSFFQVLN  606
            VVVPPGNTGLDPSQTSFFQVLN
Sbjct  123  VVVPPGNTGLDPSQTSFFQVLN  144



>emb|CBX25428.1| hypothetical_protein [Oryza glaberrima]
Length=322

 Score =   234 bits (598),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 138/147 (94%), Gaps = 2/147 (1%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA+K+TKA+KK+AYD+KLCQLLDEYT++LIAVADNVGSNQLQ IRKGLRGDS+VLMGKNT
Sbjct  1    MAIKRTKAEKKVAYDKKLCQLLDEYTKVLIAVADNVGSNQLQEIRKGLRGDSIVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYK--VGAPARVGL  525
            +I+R I+VHA+NTGN   L L+PLLVGNVGLIFTKGDLKEV EEVAKYK  VGAPARVGL
Sbjct  61   LIRRCIKVHADNTGNKDFLELMPLLVGNVGLIFTKGDLKEVREEVAKYKVGVGAPARVGL  120

Query  526  VAPIDVVVPPGNTGLDPSQTSFFQVLN  606
            VAP+DVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  VAPVDVVVPPGNTGLDPSQTSFFQVLN  147



>gb|EMT02739.1| 60S acidic ribosomal protein P0 [Aegilops tauschii]
Length=322

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 129/146 (88%), Gaps = 1/146 (1%)
 Frame = +1

Query  172  MAVKQ-TKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKN  348
            MA+K+ +K  KK AYDQKLCQLLDEY+++L+A ADNVGS+QL  IR+G+RG+SV+LMGKN
Sbjct  1    MAIKKPSKTDKKHAYDQKLCQLLDEYSRVLVASADNVGSSQLAEIRRGIRGESVMLMGKN  60

Query  349  TMIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLV  528
            T+I+R I  HAE +GN  +  LIPLL GNVGLIFTKGDLKEV EEVAKYKVGAPARVGL+
Sbjct  61   TLIRRCIAAHAERSGNADVKALIPLLQGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLI  120

Query  529  APIDVVVPPGNTGLDPSQTSFFQVLN  606
            APIDVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  APIDVVVPPGNTGLDPSQTSFFQVLN  146



>gb|AIN39821.1| hypothetical protein, partial [Zoysia matrella]
Length=262

 Score =   231 bits (588),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA+K+TKA+KKIAYD+KLCQLLDEYT++L+AVADNVGS QLQ+IR+GLRGDSVVLMGKNT
Sbjct  1    MAIKRTKAEKKIAYDKKLCQLLDEYTKVLVAVADNVGSKQLQDIRRGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            +I+R I+VHAE TGNT    L  LLVGNVGLIFTKGDLKEV EEV KYKVGAPARVGLVA
Sbjct  61   LIRRCIKVHAEKTGNTEFEQLSKLLVGNVGLIFTKGDLKEVREEVGKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            P+DVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PVDVVVPPGNTGLDPSQTSFFQVLN  145



>dbj|BAJ92405.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=320

 Score =   231 bits (589),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA+K+TKA+KKIAYDQKLCQLL+EYT++LIAVADNVGS QLQ IRKGLRGDS+VLMGKNT
Sbjct  1    MAIKRTKAEKKIAYDQKLCQLLEEYTKVLIAVADNVGSKQLQEIRKGLRGDSIVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            +I+R I+VH+E TGN   L L  LLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61   LIRRCIKVHSEKTGNKDFLELSNLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            P+DVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PVDVVVPPGNTGLDPSQTSFFQVLN  145



>dbj|BAJ94456.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=320

 Score =   231 bits (589),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA+K+TKA+KKIAYDQKLCQLL+EYT++LIAVADNVGS QLQ IRKGLRGDS+VLMGKNT
Sbjct  1    MAIKRTKAEKKIAYDQKLCQLLEEYTKVLIAVADNVGSKQLQEIRKGLRGDSIVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            +I+R I+VH+E TGN   L L  LLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61   LIRRCIKVHSEKTGNKDFLELSNLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            P+DVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PVDVVVPPGNTGLDPSQTSFFQVLN  145



>gb|EMT17099.1| 60S acidic ribosomal protein P0 [Aegilops tauschii]
Length=320

 Score =   231 bits (589),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA+K+TKA+KKIAYDQKLCQLL+EYT++LIAVADNVGS QLQ IRKGLRGDS+VLMGKNT
Sbjct  1    MAIKRTKAEKKIAYDQKLCQLLEEYTKVLIAVADNVGSKQLQEIRKGLRGDSIVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            +I+R I+VH+E TGN   L L  LLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61   LIRRCIKVHSEKTGNKDFLELSNLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            P+DVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PVDVVVPPGNTGLDPSQTSFFQVLN  145



>gb|AFW74478.1| hypothetical protein ZEAMMB73_076912 [Zea mays]
Length=197

 Score =   224 bits (571),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA+K+TKA+KKIAYD+KLC LLDEYT++LIA+ADNVGS QLQ+IR+GLRGDSVVLMGKNT
Sbjct  1    MAIKRTKAEKKIAYDKKLCSLLDEYTKVLIALADNVGSKQLQDIRRGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            +I+R I+V+AE TGN     L+ LLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61   LIRRCIKVYAEKTGNHTFDPLMDLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            P+DVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PVDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_002974292.1| hypothetical protein SELMODRAFT_149765 [Selaginella moellendorffii]
 ref|XP_002985667.1| hypothetical protein SELMODRAFT_181962 [Selaginella moellendorffii]
 gb|EFJ13245.1| hypothetical protein SELMODRAFT_181962 [Selaginella moellendorffii]
 gb|EFJ24514.1| hypothetical protein SELMODRAFT_149765 [Selaginella moellendorffii]
Length=318

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            M  K TK +KK  YD+K+  LL+ Y++ LI  ADNVGSNQLQ IR+GLR +SVVLMGKNT
Sbjct  1    MGFKGTKQEKKEVYDRKMVDLLETYSKALICAADNVGSNQLQQIRRGLRPESVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            ++KR+IR +AE +GNT +L+L+PLLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61   LMKRTIRTYAEKSGNTTVLSLMPLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDV +PPG+TGLDPSQTSFFQVLN
Sbjct  121  PIDVTIPPGSTGLDPSQTSFFQVLN  145



>ref|XP_002983859.1| hypothetical protein SELMODRAFT_268802 [Selaginella moellendorffii]
 gb|EFJ14871.1| hypothetical protein SELMODRAFT_268802 [Selaginella moellendorffii]
Length=322

 Score =   228 bits (582),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            M  K TK +KK  YD+K+  LL+ YT+ LI  ADNVGS QLQ IR+GLR +SVVLMGKNT
Sbjct  1    MGFKGTKQEKKEIYDRKMVDLLENYTKALICAADNVGSTQLQQIRRGLRPESVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            ++KR+IR +AE +GNTA+L+L+PLLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61   LMKRTIRTYAERSGNTAVLSLMPLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDV +PPG+TGLDPSQTSFFQVLN
Sbjct  121  PIDVTIPPGSTGLDPSQTSFFQVLN  145



>ref|XP_010234277.1| PREDICTED: 60S acidic ribosomal protein P0 [Brachypodium distachyon]
Length=321

 Score =   227 bits (579),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA+K+TKA+KKIAYD+KLCQLL+EY+++LIAVADNVGS QLQ IRKGLRGDSVVLMGKNT
Sbjct  1    MAIKRTKAEKKIAYDKKLCQLLEEYSKVLIAVADNVGSKQLQEIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            +I+R I+VH+E TGN   L L  LL+GNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61   LIRRCIKVHSEKTGNKDYLELSNLLIGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            P+DVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PVDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_002960810.1| hypothetical protein SELMODRAFT_437282 [Selaginella moellendorffii]
 gb|EFJ38349.1| hypothetical protein SELMODRAFT_437282 [Selaginella moellendorffii]
Length=321

 Score =   226 bits (577),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            M  K TK +KK  YD+K+  LL+ YT+ LI  ADNVGS QLQ IR+GLR +SVVLMGKNT
Sbjct  1    MGFKGTKQEKKEIYDRKMVDLLENYTKALICAADNVGSTQLQQIRRGLRPESVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            ++KR+IR +AE +GN A+L+L+PLLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61   LMKRTIRTYAERSGNMAVLSLMPLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDV +PPG+TGLDPSQTSFFQVLN
Sbjct  121  PIDVTIPPGSTGLDPSQTSFFQVLN  145



>ref|XP_004296403.1| PREDICTED: 60S acidic ribosomal protein P0-like [Fragaria vesca 
subsp. vesca]
Length=319

 Score =   225 bits (574),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +1

Query  181  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  360
            K +KA+KKI YD KLC+ LDEY QILI  ADNVGSNQLQNIR+GLRG SVVLMGKNTM+K
Sbjct  3    KLSKAEKKINYDAKLCKHLDEYGQILIVAADNVGSNQLQNIRQGLRGHSVVLMGKNTMMK  62

Query  361  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  540
            RSI++HAE T N AILNL+PLLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVAP+D
Sbjct  63   RSIKIHAEKTRNDAILNLVPLLVGNVGLIFTKGDLKEVKEEVAKYKVGAPARVGLVAPVD  122

Query  541  VVVPPGNTGLDPSQTSFFQVLN  606
            VVVPPGNTGLDPSQTSFFQVLN
Sbjct  123  VVVPPGNTGLDPSQTSFFQVLN  144



>gb|ACL52455.1| unknown [Zea mays]
Length=319

 Score =   225 bits (574),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA+K+TKA+KKIAYD+KLC LLDEYT++LIA+ADNVGS QLQ+IR+GLRGDSVVLMGKNT
Sbjct  1    MAIKRTKAEKKIAYDKKLCSLLDEYTKVLIALADNVGSKQLQDIRRGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            +I+R I+V+AE TGN     L+ LLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61   LIRRCIKVYAEKTGNHTFDPLMDLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            P+DVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PVDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|NP_001141489.1| hypothetical protein [Zea mays]
 gb|ACF86473.1| unknown [Zea mays]
 gb|AFW61287.1| hypothetical protein ZEAMMB73_391125 [Zea mays]
Length=319

 Score =   225 bits (574),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA+K+TKA+KKIAYD+KLC LLDEYT++LIA+ADNVGS QLQ+IR+GLRGDSVVLMGKNT
Sbjct  1    MAIKRTKAEKKIAYDKKLCSLLDEYTKVLIALADNVGSKQLQDIRRGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            +I+R I+V+AE TGN     L+ LLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61   LIRRCIKVYAEKTGNHTFDPLMDLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            P+DVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PVDVVVPPGNTGLDPSQTSFFQVLN  145



>gb|ACF83717.1| unknown [Zea mays]
 gb|AFW74477.1| 60S acidic ribosomal protein P0 [Zea mays]
Length=319

 Score =   225 bits (573),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA+K+TKA+KKIAYD+KLC LLDEYT++LIA+ADNVGS QLQ+IR+GLRGDSVVLMGKNT
Sbjct  1    MAIKRTKAEKKIAYDKKLCSLLDEYTKVLIALADNVGSKQLQDIRRGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            +I+R I+V+AE TGN     L+ LLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61   LIRRCIKVYAEKTGNHTFDPLMDLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            P+DVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PVDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|NP_001105482.1| 60S acidic ribosomal protein P0 [Zea mays]
 sp|O24573.3|RLA0_MAIZE RecName: Full=60S acidic ribosomal protein P0 [Zea mays]
 emb|CAA69256.1| 60S acidic ribosomal protein P0 [Zea mays]
Length=319

 Score =   225 bits (573),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA+K+TKA+KKIAYD+KLC LLDEYT++LIA+ADNVGS QLQ+IR+GLRGDSVVLMGKNT
Sbjct  1    MAIKRTKAEKKIAYDKKLCSLLDEYTKVLIALADNVGSKQLQDIRRGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            +I+R I+V+AE TGN     L+ LLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61   LIRRCIKVYAEKTGNHTFDPLMDLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            P+DVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PVDVVVPPGNTGLDPSQTSFFQVLN  145



>emb|CAN65663.1| hypothetical protein VITISV_014917 [Vitis vinifera]
Length=379

 Score =   225 bits (574),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVK ++A+KK+ YDQKLC+LLDEY+QILI   DN+GS QLQ+I + LRG SVVLMG NT
Sbjct  1    MAVKLSRAKKKVQYDQKLCRLLDEYSQILIVAVDNMGSKQLQDIHRALRGHSVVLMGNNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KRS+R+H E TGN A L+LIPLLVGN+GLIFTK DLK VS+EVAKYK GAPAR G+VA
Sbjct  61   MMKRSVRLHVEMTGNKAFLSLIPLLVGNIGLIFTKEDLKGVSDEVAKYKXGAPARXGVVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDVV+ PG+TGLDP+ TSFFQVLN
Sbjct  121  PIDVVIQPGSTGLDPAXTSFFQVLN  145



>ref|XP_002445000.1| hypothetical protein SORBIDRAFT_07g002560 [Sorghum bicolor]
 gb|EES14495.1| hypothetical protein SORBIDRAFT_07g002560 [Sorghum bicolor]
Length=319

 Score =   223 bits (568),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA+K+TKA+KKIAYD+KLC LLDEYT++LIA+ADNVGS QLQ+IR+GLRGDSVVLMGKNT
Sbjct  1    MAIKRTKAEKKIAYDKKLCSLLDEYTKVLIALADNVGSKQLQDIRRGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            +I+R I+ +AE TGN     L+ LLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61   LIRRCIKAYAEKTGNHTFDPLMDLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            P+DVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PVDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_002967451.1| hypothetical protein SELMODRAFT_87354 [Selaginella moellendorffii]
 gb|EFJ32050.1| hypothetical protein SELMODRAFT_87354 [Selaginella moellendorffii]
Length=323

 Score =   223 bits (568),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 122/145 (84%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            M  K TK +KK AYD KLC+ LD+Y + LI  ADNVGSNQ+Q IR+GLR DSVVLMGKNT
Sbjct  1    MGFKGTKLEKKEAYDLKLCKYLDDYARALICAADNVGSNQMQQIRQGLRPDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            ++KR+IR +AE TGN  +LNLIPLLVGNVGL+FT+GDLKEV E +AKYKVGAPARVGLVA
Sbjct  61   LMKRTIRKYAEKTGNRDVLNLIPLLVGNVGLVFTRGDLKEVREVIAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDV + PG+TGLDPS TSFFQ LN
Sbjct  121  PIDVTIQPGSTGLDPSHTSFFQALN  145



>ref|XP_002960261.1| hypothetical protein SELMODRAFT_229877 [Selaginella moellendorffii]
 gb|EFJ37800.1| hypothetical protein SELMODRAFT_229877 [Selaginella moellendorffii]
Length=323

 Score =   222 bits (566),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 122/145 (84%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            M  K TK +KK AYD KLC+ LD+Y + LI  ADNVGSNQ+Q IR+GLR DSVVLMGKNT
Sbjct  1    MGFKGTKLEKKEAYDLKLCKYLDDYGRALICAADNVGSNQMQQIRQGLRPDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            ++KR+IR +AE TGN  +LNLIPLLVGNVGL+FT+GDLKEV E +AKYKVGAPARVGLVA
Sbjct  61   LMKRTIRKYAEKTGNRDVLNLIPLLVGNVGLVFTRGDLKEVREVIAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDV + PG+TGLDPS TSFFQ LN
Sbjct  121  PIDVTIQPGSTGLDPSHTSFFQALN  145



>ref|XP_010685586.1| PREDICTED: 60S acidic ribosomal protein P0 [Beta vulgaris subsp. 
vulgaris]
Length=324

 Score =   219 bits (558),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = +1

Query  184  QTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIKR  363
            ++K +KK  Y  KL +L+D+Y+++L+ +ADNVGSNQLQ IR+GLRGDS+VLMGKNT++KR
Sbjct  9    RSKMEKKEIYSAKLRRLIDDYSKVLVVLADNVGSNQLQQIRQGLRGDSIVLMGKNTLMKR  68

Query  364  SIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDV  543
            +++ H + TGN AI  L+ LLVGNVGLIFTKGDLKEVSEE+ KYKVGAPARVGLVAPIDV
Sbjct  69   ALKTHMDETGNKAIKPLMNLLVGNVGLIFTKGDLKEVSEELGKYKVGAPARVGLVAPIDV  128

Query  544  VVPPGNTGLDPSQTSFFQVLN  606
            V+PPGNTGLDPSQTSFFQ LN
Sbjct  129  VIPPGNTGLDPSQTSFFQALN  149



>ref|XP_004972933.1| PREDICTED: 60S acidic ribosomal protein P0-like [Setaria italica]
Length=319

 Score =   219 bits (557),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA+K+TKA+KK AYD+KLC LLDEYT++LIA+ADNVGS QLQ+IR+GLRGDSVVLMGKNT
Sbjct  1    MAIKRTKAEKKQAYDRKLCSLLDEYTKVLIALADNVGSKQLQDIRRGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            +I+R I+ +A+ TGN     L+ LLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61   LIRRCIKAYADKTGNHTFDPLMDLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            P+DVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PVDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_004958562.1| PREDICTED: 60S acidic ribosomal protein P0-like [Setaria italica]
Length=319

 Score =   218 bits (556),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA+K+TKA+KK AYD+KLC LLDEYT++LIA+ADNVGS QLQ+IR+GLRGDSVVLMGKNT
Sbjct  1    MAIKRTKAEKKQAYDRKLCSLLDEYTKVLIALADNVGSKQLQDIRRGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            +I+R I+ +A+ TGN     L+ LLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61   LIRRCIKAYADKTGNHTFDPLMDLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            P+DVVVPPGNTGLDPSQTSFFQVLN
Sbjct  121  PVDVVVPPGNTGLDPSQTSFFQVLN  145



>ref|XP_003573632.1| PREDICTED: 60S acidic ribosomal protein P0-like [Brachypodium 
distachyon]
Length=323

 Score =   214 bits (544),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +1

Query  208  AYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIKRSIRVHAEN  387
            AYD+KLCQLLDEY ++L+A A++VGS QL  IR+G+RG+SV+LMGKNT+I+R I VHA +
Sbjct  16   AYDKKLCQLLDEYPKVLVASANHVGSTQLAAIRRGIRGESVMLMGKNTLIRRCINVHAVD  75

Query  388  TGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTG  567
            TGN  I  L+PLL GNVGLIFTKGDLKEV EEVAKYKVGAPARVGL+APIDVVVP GNTG
Sbjct  76   TGNENIKALVPLLQGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLIAPIDVVVPAGNTG  135

Query  568  LDPSQTSFFQVLN  606
            LDP+QTSFFQVLN
Sbjct  136  LDPTQTSFFQVLN  148



>emb|CBI25508.3| unnamed protein product [Vitis vinifera]
Length=292

 Score =   211 bits (536),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 112/145 (77%), Gaps = 28/145 (19%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVK +KA KKIAYDQKLCQLLDEY+QILIA ADN                         
Sbjct  1    MAVKPSKADKKIAYDQKLCQLLDEYSQILIAAADN-------------------------  35

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
               RSIR+HAE TGNTA LNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  36   ---RSIRLHAEKTGNTAFLNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  92

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDV+VPPGNTGLDPSQTSFFQVLN
Sbjct  93   PIDVIVPPGNTGLDPSQTSFFQVLN  117



>emb|CBI31491.3| unnamed protein product [Vitis vinifera]
Length=292

 Score =   208 bits (529),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 111/145 (77%), Gaps = 28/145 (19%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVK +KA KKIAYDQKLCQLLDEYTQILIA ADN                         
Sbjct  1    MAVKPSKADKKIAYDQKLCQLLDEYTQILIAAADN-------------------------  35

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
               RSIR+HAE TGN A LNLIPLLVGNVGLIFT+GDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  36   ---RSIRLHAEKTGNQAFLNLIPLLVGNVGLIFTRGDLKEVSEEVAKYKVGAPARVGLVA  92

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDV+VPPGNTGLDPSQTSFFQVLN
Sbjct  93   PIDVIVPPGNTGLDPSQTSFFQVLN  117



>emb|CAN76468.1| hypothetical protein VITISV_030042 [Vitis vinifera]
Length=303

 Score =   206 bits (525),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 118/145 (81%), Gaps = 17/145 (12%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MAVK +KA KKIAYDQKLCQLLDEY+QILIA ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1    MAVKPSKADKKIAYDQKLCQLLDEYSQILIAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  531
            M+KR I           +L+ + L+V +         ++EVSEEVAKYKVGAPARVGLVA
Sbjct  61   MMKRMI---------FCLLSFVCLVVJS--------PIREVSEEVAKYKVGAPARVGLVA  103

Query  532  PIDVVVPPGNTGLDPSQTSFFQVLN  606
            PIDV+VPPGNTGLDPSQTSFFQVLN
Sbjct  104  PIDVIVPPGNTGLDPSQTSFFQVLN  128



>ref|NP_001176776.1| Os12g0133050 [Oryza sativa Japonica Group]
 dbj|BAH95504.1| Os12g0133050 [Oryza sativa Japonica Group]
Length=110

 Score =   191 bits (486),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA+K+TKA+KK+AYD+KLCQLLDEYT++LIAVADNVGSNQLQ IRKGLRGDS+VLMGKNT
Sbjct  1    MAIKRTKAEKKVAYDKKLCQLLDEYTKVLIAVADNVGSNQLQEIRKGLRGDSIVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKV  501
            +I+R I+VHA+NTGN   L L+PLLVGNVGLIFTKGDLKEV EEVAKYKV
Sbjct  61   LIRRCIKVHADNTGNKDFLELMPLLVGNVGLIFTKGDLKEVREEVAKYKV  110



>gb|EYU19991.1| hypothetical protein MIMGU_mgv1a0100891mg, partial [Erythranthe 
guttata]
Length=109

 Score =   185 bits (470),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA K +KA KKIAYD+KLC LLDEYTQ+L+AVADNVGS QLQNIR  LRGDSVVLMGKNT
Sbjct  1    MAPKVSKADKKIAYDKKLCNLLDEYTQVLVAVADNVGSTQLQNIRSALRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYK  498
            M+KRSIR+H+ENTGN AIL LI LLVGNVGLIFTKGDLKEV+EEVAK+K
Sbjct  61   MMKRSIRIHSENTGNKAILALIDLLVGNVGLIFTKGDLKEVTEEVAKFK  109



>ref|NP_001078125.1| 60S acidic ribosomal protein P0-2 [Arabidopsis thaliana]
 gb|AEE74737.1| 60S acidic ribosomal protein P0-2 [Arabidopsis thaliana]
Length=287

 Score =   191 bits (485),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 106/143 (74%), Gaps = 33/143 (23%)
 Frame = +1

Query  178  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  357
            VK TKA+KKIAYD KLCQL+DEYTQIL+                                
Sbjct  2    VKATKAEKKIAYDTKLCQLIDEYTQILV--------------------------------  29

Query  358  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  537
             RS+R+H+ENTGNTAILNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  30   -RSVRIHSENTGNTAILNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  88

Query  538  DVVVPPGNTGLDPSQTSFFQVLN  606
            DVVV PGNTGLDPSQTSFFQVLN
Sbjct  89   DVVVQPGNTGLDPSQTSFFQVLN  111



>ref|XP_008779031.1| PREDICTED: 60S acidic ribosomal protein P0-like [Phoenix dactylifera]
Length=128

 Score =   183 bits (464),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            M VK +K++KK+ YD+KLC LLDEY+Q+LIA ADNVGSNQLQNIR GLRGDSVVLMGKNT
Sbjct  1    MTVKLSKSEKKVEYDKKLCSLLDEYSQVLIAAADNVGSNQLQNIRSGLRGDSVVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKV  501
            +I+R I++HAE TGN   LNL+PLLVGNVGLIFTKGDLKEV EEVAKYKV
Sbjct  61   LIRRCIKIHAEKTGNKDYLNLLPLLVGNVGLIFTKGDLKEVREEVAKYKV  110



>ref|XP_005650079.1| hypothetical protein COCSUDRAFT_52908 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25535.1| hypothetical protein COCSUDRAFT_52908 [Coccomyxa subellipsoidea 
C-169]
Length=319

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 108/141 (77%), Gaps = 2/141 (1%)
 Frame = +1

Query  190  KAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLR--GDSVVLMGKNTMIKR  363
            +  KK  YD+KLC LLD Y +  +  ADNVGS Q  +IR+GLR  GDS+VLMGKNTM+KR
Sbjct  6    RLSKKEEYDEKLCGLLDGYDKCFVVHADNVGSRQFMDIRRGLRDVGDSIVLMGKNTMMKR  65

Query  364  SIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDV  543
            SIR++ E TG+     L+  LVGNVGLIFTK DL E+ +E+ KYKVGAPARVGLVAP  V
Sbjct  66   SIRLYCEKTGDDKWPALLDHLVGNVGLIFTKADLAELRDEIEKYKVGAPARVGLVAPNSV  125

Query  544  VVPPGNTGLDPSQTSFFQVLN  606
            VVP GNTGLDPSQTSFFQ LN
Sbjct  126  VVPAGNTGLDPSQTSFFQALN  146



>ref|XP_011402179.1| 60S acidic ribosomal protein P0-2 [Auxenochlorella protothecoides]
 gb|KFM29126.1| 60S acidic ribosomal protein P0-2 [Auxenochlorella protothecoides]
Length=273

 Score =   181 bits (460),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 107/136 (79%), Gaps = 0/136 (0%)
 Frame = +1

Query  199  KKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIKRSIRVH  378
            KK AYD KLC+LLD +T+  +  ADNVGS Q+ NIR GLR +S VLMGKNT+I+R +R++
Sbjct  9    KKEAYDAKLCELLDTHTKAFLVHADNVGSMQMMNIRAGLRENSTVLMGKNTLIRRCLRLY  68

Query  379  AENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPG  558
             E TGN   L L+  LVGNVGLIFT+GDL EV +++ ++KVGAPARVGLVAP DV V  G
Sbjct  69   VERTGNEQWLVLLDHLVGNVGLIFTQGDLNEVRDKIQEFKVGAPARVGLVAPNDVTVYAG  128

Query  559  NTGLDPSQTSFFQVLN  606
            NTG+DPSQTSFFQ LN
Sbjct  129  NTGMDPSQTSFFQALN  144



>ref|XP_005850392.1| hypothetical protein CHLNCDRAFT_59607 [Chlorella variabilis]
 gb|EFN58290.1| hypothetical protein CHLNCDRAFT_59607 [Chlorella variabilis]
Length=314

 Score =   182 bits (461),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = +1

Query  187  TKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIKRS  366
            TK  KK AYD KLC+++D Y +  +  ADNVGS Q  +IR  +R  S +LMGKNTM++RS
Sbjct  5    TKLVKKEAYDAKLCEMMDTYDRAFLVHADNVGSKQFMDIRAAIRDHSRILMGKNTMMRRS  64

Query  367  IRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVV  546
            IR++ E TGN   L L+  +VGNVGLIFTKGDL EV + +  +KVGAPARVGLVAP DV 
Sbjct  65   IRLYCERTGNDQWLQLLGHMVGNVGLIFTKGDLNEVRKLIDDFKVGAPARVGLVAPNDVT  124

Query  547  VPPGNTGLDPSQTSFFQVLN  606
            +P GNTG+DPSQTSFFQVLN
Sbjct  125  IPGGNTGMDPSQTSFFQVLN  144



>gb|KIZ02211.1| 60S acidic ribosomal protein P0 [Monoraphidium neglectum]
Length=313

 Score =   176 bits (446),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 102/140 (73%), Gaps = 0/140 (0%)
 Frame = +1

Query  187  TKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIKRS  366
            TK +KK AY  +LC  LD Y +  I  ADNVGS Q  +IR  LR +S++LMGKNTM+KRS
Sbjct  5    TKLEKKEAYHARLCDYLDTYEKAFIVHADNVGSKQFSDIRAALRPESLILMGKNTMMKRS  64

Query  367  IRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVV  546
            IR++ E   +     L+  LVGNVG+IFTK DL  V +E+AKYKVGAPARVGLVAP DV 
Sbjct  65   IRLYCEEKEDDRWAPLLDELVGNVGIIFTKADLASVKDEIAKYKVGAPARVGLVAPNDVT  124

Query  547  VPPGNTGLDPSQTSFFQVLN  606
            +P G TG+DPSQTSFFQ LN
Sbjct  125  IPGGGTGMDPSQTSFFQALN  144



>gb|KDD72928.1| hypothetical protein H632_c2720p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=273

 Score =   174 bits (440),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 102/133 (77%), Gaps = 0/133 (0%)
 Frame = +1

Query  208  AYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIKRSIRVHAEN  387
            A+  KLC LLD Y++ L+  ADNVGS Q+ +IR GLRGDSV+LMGK TMI+R IR + + 
Sbjct  8    AFGAKLCDLLDTYSKALVVHADNVGSKQMMDIRAGLRGDSVLLMGKKTMIRRCIRQYVDR  67

Query  388  TGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTG  567
            TGN   + L+ LL GNVG+IFTK DL ++ + V+KY VGAPARVG+VAP DV +  GNTG
Sbjct  68   TGNDQWVPLLDLLEGNVGIIFTKADLNDLRDRVSKYTVGAPARVGVVAPTDVTIYAGNTG  127

Query  568  LDPSQTSFFQVLN  606
            +DPSQTSFFQ LN
Sbjct  128  MDPSQTSFFQALN  140



>emb|CDP06275.1| unnamed protein product [Coffea canephora]
Length=247

 Score =   166 bits (421),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/90 (88%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +1

Query  337  MGKNTMIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPAR  516
            MGKNTM+KRSIRVHAE TGN A LNLIPLLVGNVGLIFTKGDLKE+SEEV+KYKVGAPAR
Sbjct  1    MGKNTMMKRSIRVHAEKTGNGAFLNLIPLLVGNVGLIFTKGDLKEISEEVSKYKVGAPAR  60

Query  517  VGLVAPIDVVVPPGNTGLDPSQTSFFQVLN  606
             GL+A +DVVVPPGNTG DPSQTSFFQVLN
Sbjct  61   AGLIAAVDVVVPPGNTGPDPSQTSFFQVLN  90



>emb|CBV76074.1| 60S acidic ribosomal protein P0 [Polytomella sp. Pringsheim 198.80]
Length=314

 Score =   166 bits (419),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 101/139 (73%), Gaps = 0/139 (0%)
 Frame = +1

Query  187  TKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIKRS  366
            +K  KK AY +++C LL  + +  I  ADNVGS Q Q+IRK LR  S++LMGKNTMIKRS
Sbjct  5    SKLAKKEAYHERICDLLKTFQKAFIVGADNVGSQQFQDIRKALRPQSIILMGKNTMIKRS  64

Query  367  IRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVV  546
            I+++ E TG+     L+  LVGNVG++FT  DL +V +E+AKYKVGAPARVG  A  +V 
Sbjct  65   IKIYCEETGDNKWAALLDHLVGNVGIVFTNQDLNQVKDEIAKYKVGAPARVGATATEEVT  124

Query  547  VPPGNTGLDPSQTSFFQVL  603
            V  G+TG+DPSQTSFFQ L
Sbjct  125  VKAGSTGMDPSQTSFFQAL  143



>ref|XP_006846796.1| hypothetical protein AMTR_s00148p00060210 [Amborella trichopoda]
 gb|ERN08377.1| hypothetical protein AMTR_s00148p00060210 [Amborella trichopoda]
Length=232

 Score =   162 bits (411),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = +1

Query  148  FDYLLTVSMAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDS  327
            F +     +AVK +K +KK+AYD K+CQLLD+Y Q+L+A ADN+ SNQLQN+RKG+  DS
Sbjct  14   FLWRHYFGVAVKSSKREKKLAYDHKVCQLLDQYNQVLVAEADNIRSNQLQNVRKGVSQDS  73

Query  328  VVLMGKNTMIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGA  507
            VV+M KNT+++++I+ HAE TGN A LNLIPLL GNV LIFTKGDLKEV +EVAK+K G 
Sbjct  74   VVIMSKNTVLRQTIKAHAEKTGNKAYLNLIPLLYGNVSLIFTKGDLKEVHDEVAKFKKGV  133

Query  508  PA  513
             A
Sbjct  134  KA  135



>gb|KJB32134.1| hypothetical protein B456_005G225800 [Gossypium raimondii]
Length=100

 Score =   155 bits (393),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/90 (84%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = +1

Query  337  MGKNTMIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPAR  516
            MGK+TM+KRSIR+HAE TGN A LNLIPLL  +VGL+FTKGDLK+V+EEVAKYKVGAP R
Sbjct  1    MGKSTMMKRSIRMHAEMTGNQAFLNLIPLLQEDVGLMFTKGDLKQVNEEVAKYKVGAPVR  60

Query  517  VGLVAPIDVVVPPGNTGLDPSQTSFFQVLN  606
            VGLVAPIDVVVPPGNTGLDPSQTSF QVLN
Sbjct  61   VGLVAPIDVVVPPGNTGLDPSQTSFSQVLN  90



>ref|XP_002597893.1| hypothetical protein BRAFLDRAFT_97880 [Branchiostoma floridae]
 gb|EEN53905.1| hypothetical protein BRAFLDRAFT_97880 [Branchiostoma floridae]
Length=314

 Score =   154 bits (389),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 102/143 (71%), Gaps = 2/143 (1%)
 Frame = +1

Query  178  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  357
            V++ KA  K  Y  K+ +LLDEY +  I  ADNVGSNQ+Q IR  LRG   +LMGKNTM+
Sbjct  2    VREDKATWKSNYFLKIVRLLDEYPKCFIVGADNVGSNQMQRIRMSLRGTGEILMGKNTMM  61

Query  358  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  537
            +++IR H EN  N A+  ++P + GNVG +FTKGDLKEV +++ + KV APA+ G +AP+
Sbjct  62   RKAIRGHMEN--NPALEKILPHISGNVGFVFTKGDLKEVRDKILENKVEAPAKAGAIAPV  119

Query  538  DVVVPPGNTGLDPSQTSFFQVLN  606
            DV + P NTGL P +TSFFQ L+
Sbjct  120  DVYLDPLNTGLGPEKTSFFQALS  142



>gb|ACR08654.1| ribosomal protein LP0, partial [Drosophila silvestris]
Length=208

 Score =   151 bits (381),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 101/143 (71%), Gaps = 2/143 (1%)
 Frame = +1

Query  178  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  357
            V++ KA  K  Y  K+ +L DE+ +  I  ADNVGS Q+QNIR  LRG +VVLMGKNTM+
Sbjct  2    VRENKAAWKAQYFVKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMM  61

Query  358  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  537
            +++IR H EN  N  +  L+P + GNVG +FTKGDL EV +++ + KV APAR G +AP+
Sbjct  62   RKAIRGHLEN--NPQLEKLLPHIKGNVGFVFTKGDLAEVRDKLLESKVRAPARPGAIAPL  119

Query  538  DVVVPPGNTGLDPSQTSFFQVLN  606
             V++P  NTGL P +TSFFQ L+
Sbjct  120  HVIIPAQNTGLGPEKTSFFQALS  142



>ref|XP_011196704.1| PREDICTED: 60S acidic ribosomal protein P0 [Bactrocera cucurbitae]
Length=316

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 100/143 (70%), Gaps = 2/143 (1%)
 Frame = +1

Query  178  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  357
            V++ KA  K  Y  K+ +L DEY +  I  ADNVGS Q+QNIR  LRG  VVLMGKNTM+
Sbjct  2    VRENKAAWKAQYFLKVVELFDEYPKCFIVGADNVGSKQMQNIRTSLRGLGVVLMGKNTMM  61

Query  358  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  537
            +++IR H EN  N  +  L+P + GNVG +FTKGDL EV +++ + KV APAR G +AP+
Sbjct  62   RKAIRGHLEN--NAQLEKLLPHIKGNVGFVFTKGDLAEVRDKLLESKVRAPARAGAIAPL  119

Query  538  DVVVPPGNTGLDPSQTSFFQVLN  606
             V++P  NTGL P +TSFFQ L+
Sbjct  120  HVIIPAQNTGLGPEKTSFFQALS  142



>ref|XP_011208099.1| PREDICTED: 60S acidic ribosomal protein P0 [Bactrocera dorsalis]
Length=317

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 100/143 (70%), Gaps = 2/143 (1%)
 Frame = +1

Query  178  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  357
            V++ KA  K  Y  K+ +L DEY +  I  ADNVGS Q+QNIR  LRG  VVLMGKNTM+
Sbjct  2    VRENKAAWKAQYFLKVVELFDEYPKCFIVGADNVGSKQMQNIRTSLRGLGVVLMGKNTMM  61

Query  358  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  537
            +++IR H EN  N  +  L+P + GNVG +FTKGDL EV +++ + KV APAR G +AP+
Sbjct  62   RKAIRGHLEN--NAQLEKLLPHIKGNVGFVFTKGDLAEVRDKLLESKVRAPARAGAIAPL  119

Query  538  DVVVPPGNTGLDPSQTSFFQVLN  606
             VV+P  NTGL P +TSFFQ L+
Sbjct  120  PVVIPAQNTGLGPEKTSFFQALS  142



>gb|ABV60317.1| 60S acidic ribosomal protein P0-like protein [Lutzomyia longipalpis]
Length=317

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 100/142 (70%), Gaps = 2/142 (1%)
 Frame = +1

Query  181  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  360
            ++ KA  K  Y  K+ QL DEY +  I  ADNVGS Q+Q IR  LRG +VVLMGKNTM++
Sbjct  3    RENKAAWKANYFVKVVQLFDEYPKCFIVGADNVGSRQMQTIRTSLRGLAVVLMGKNTMMR  62

Query  361  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  540
            ++IR H EN  N  +  L+P + GNVG +FTKGDL EV +++ + KV APAR G +AP++
Sbjct  63   KAIRGHLENNAN--LEKLLPHIRGNVGFVFTKGDLNEVRDKLTESKVRAPARAGAIAPLE  120

Query  541  VVVPPGNTGLDPSQTSFFQVLN  606
            V++P  NTGL P +TSFFQ L+
Sbjct  121  VIIPAQNTGLGPEKTSFFQALS  142



>emb|CEG01946.1| Ribosomal protein L10/acidic P0 [Ostreococcus tauri]
Length=311

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 100/136 (74%), Gaps = 0/136 (0%)
 Frame = +1

Query  199  KKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIKRSIRVH  378
            KK  Y +K+  LLD Y   L+  ADNVGS Q  +IR  +RGDSVVLMGKNT++++ I  +
Sbjct  5    KKQTYAEKVNFLLDNYDTALLVGADNVGSRQFMDIRASIRGDSVVLMGKNTLMRKCISNY  64

Query  379  AENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPG  558
            A+ +GN +   L   LVGNVG+IFTKGDL EV ++V ++ V APARVG +AP++VVVP G
Sbjct  65   AKKSGNDSWNILAEKLVGNVGIIFTKGDLLEVRKKVKQFVVPAPARVGAIAPVEVVVPAG  124

Query  559  NTGLDPSQTSFFQVLN  606
             TG++PSQTSFFQ LN
Sbjct  125  PTGMEPSQTSFFQTLN  140



>ref|NP_001176336.1| Os11g0135300 [Oryza sativa Japonica Group]
 dbj|BAH95064.1| Os11g0135300 [Oryza sativa Japonica Group]
Length=119

 Score =   147 bits (372),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            MA+K+TKA+KK+AYD+KLCQLLDEYT++LIAVADNVGSNQLQ IRKGLRGDS+VLMGKNT
Sbjct  1    MAIKRTKAEKKVAYDKKLCQLLDEYTKVLIAVADNVGSNQLQEIRKGLRGDSIVLMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIPLLV  429
            +I+R I+VHA+NTGN   L L+PLLV
Sbjct  61   LIRRCIKVHADNTGNKDFLELMPLLV  86



>ref|XP_004522331.1| PREDICTED: 60S acidic ribosomal protein P0-like [Ceratitis capitata]
 sp|Q9U3U0.1|RLA0_CERCA RecName: Full=60S acidic ribosomal protein P0; Short=CcP0 [Ceratitis 
capitata]
 emb|CAB63647.1| P0 protein [Ceratitis capitata]
Length=317

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 100/143 (70%), Gaps = 2/143 (1%)
 Frame = +1

Query  178  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  357
            V++ KA  K  Y  K+ +L DEY +  I  ADNVGS Q+QNIR  LRG  VVLMGKNTM+
Sbjct  2    VRENKAAWKAQYFLKVVELFDEYPKCFIVGADNVGSKQMQNIRTSLRGLGVVLMGKNTMM  61

Query  358  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  537
            +++IR H EN  N  +  L+P + GNVG +FTKGDL EV +++ + KV APAR G +AP+
Sbjct  62   RKAIRGHLEN--NAQLEKLLPHIKGNVGFVFTKGDLAEVRDKLLESKVRAPARAGAIAPL  119

Query  538  DVVVPPGNTGLDPSQTSFFQVLN  606
             V++P  NTGL P +TSFFQ L+
Sbjct  120  PVIIPAQNTGLGPEKTSFFQALS  142



>dbj|BAN20115.1| ribosomal protein LP0 [Riptortus pedestris]
Length=315

 Score =   153 bits (386),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 99/142 (70%), Gaps = 2/142 (1%)
 Frame = +1

Query  181  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  360
            K+ KA  K  Y  KL QLL+EY +  I  ADNVGS Q+Q IR  LRG +VVLMGKNTM++
Sbjct  3    KEDKATWKSHYFSKLIQLLEEYPKCFIVGADNVGSKQMQQIRMSLRGSAVVLMGKNTMMR  62

Query  361  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  540
            ++IR H E   N A+  L+P + GNVG +FT+G+L EV E++ + KV APAR G +AP  
Sbjct  63   KAIRGHIER--NQALEKLLPHIKGNVGFVFTRGELTEVREKLLQNKVRAPARAGAIAPCP  120

Query  541  VVVPPGNTGLDPSQTSFFQVLN  606
            VV+P  NTGL P +TSFFQ L+
Sbjct  121  VVIPAQNTGLGPEKTSFFQALS  142



>gb|AAR09675.1| similar to Drosophila melanogaster RpP0, partial [Drosophila 
yakuba]
Length=245

 Score =   151 bits (381),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 101/143 (71%), Gaps = 2/143 (1%)
 Frame = +1

Query  178  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  357
            V++ KA  K  Y  K+ +L DE+ +  I  ADNVGS Q+QNIR  LRG +VVLMGKNTM+
Sbjct  2    VRENKAAWKAQYFIKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMM  61

Query  358  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  537
            +++IR H EN  N  +  L+P + GNVG +FTKGDL EV +++ + KV APAR G +AP+
Sbjct  62   RKAIRGHLEN--NPQLEKLLPHIKGNVGFVFTKGDLAEVRDKLLESKVRAPARPGAIAPL  119

Query  538  DVVVPPGNTGLDPSQTSFFQVLN  606
             V++P  NTGL P +TSFFQ L+
Sbjct  120  HVIIPAQNTGLGPEKTSFFQALS  142



>ref|XP_011496436.1| PREDICTED: 60S acidic ribosomal protein P0 [Ceratosolen solmsi 
marchali]
Length=318

 Score =   153 bits (386),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 100/142 (70%), Gaps = 2/142 (1%)
 Frame = +1

Query  181  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  360
            ++ KA  K  Y  KL QLLD+Y +  I  ADNVGS Q+Q IR  LRG +VVLMGKNTM++
Sbjct  3    REDKATWKAGYFNKLIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGTAVVLMGKNTMMR  62

Query  361  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  540
            ++IR H E   N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63   KAIRGHIER--NAALEKLLPHIRGNVGFVFTRGDLVEVRDKLLENKVRAPARAGAIAPLS  120

Query  541  VVVPPGNTGLDPSQTSFFQVLN  606
            VV+P  NTGL P +TSFFQ L+
Sbjct  121  VVIPAQNTGLGPEKTSFFQALS  142



>gb|AFK45016.1| unknown [Lotus japonicus]
Length=187

 Score =   149 bits (375),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  202  KIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIKRSIRVHA  381
            K AYD K+ +LL EY+Q+L+  ADNVGSNQLQ IR+ L GDSVV+MGKNT++KRSI   A
Sbjct  7    KAAYDAKMWKLLREYSQVLVVSADNVGSNQLQGIRRALHGDSVVVMGKNTLMKRSIIDDA  66

Query  382  ENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAP  510
            E TGN A LNL+PLLVGNV LIFTKGDL+EVSE++AKYKV  P
Sbjct  67   EKTGNKAFLNLVPLLVGNVALIFTKGDLREVSEQIAKYKVVDP  109



>ref|XP_002068394.1| GK20443 [Drosophila willistoni]
 gb|EDW79380.1| GK20443 [Drosophila willistoni]
Length=317

 Score =   152 bits (384),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 102/143 (71%), Gaps = 2/143 (1%)
 Frame = +1

Query  178  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  357
            V++ KA  K  Y  K+ +L DE+ +  I  ADNVGS Q+QNIR  LRG +VVLMGKNTM+
Sbjct  2    VRENKAAWKAQYFIKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMM  61

Query  358  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  537
            +++IR H EN  N  +  L+P + GNVG +FTKGDL EV +++ + KV APAR G +AP+
Sbjct  62   RKAIRGHLEN--NPQLEKLLPYIKGNVGFVFTKGDLAEVRDKLLESKVRAPARPGAIAPL  119

Query  538  DVVVPPGNTGLDPSQTSFFQVLN  606
            +V++P  NTGL P +TSFFQ L+
Sbjct  120  NVIIPAQNTGLGPEKTSFFQALS  142



>ref|XP_001352888.1| GA20389 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL30389.1| GA20389 [Drosophila pseudoobscura pseudoobscura]
Length=317

 Score =   152 bits (383),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 102/143 (71%), Gaps = 2/143 (1%)
 Frame = +1

Query  178  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  357
            V++ KA  K  Y  K+ +L DE+ +  I  ADNVGS Q+QNIR  LRG +VVLMGKNTM+
Sbjct  2    VRENKAAWKAQYFVKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMM  61

Query  358  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  537
            +++IR H EN  N  +  L+P + GNVG +FTKGDL EV +++ + KV APAR G +AP+
Sbjct  62   RKAIRGHLEN--NPQLEKLLPHIKGNVGFVFTKGDLAEVRDKLLESKVRAPARPGAIAPL  119

Query  538  DVVVPPGNTGLDPSQTSFFQVLN  606
            +V++P  NTGL P +TSFFQ L+
Sbjct  120  NVIIPAQNTGLGPEKTSFFQALS  142



>ref|XP_006595496.1| PREDICTED: uncharacterized protein LOC100305996 isoform X1 [Glycine 
max]
 gb|KHN20858.1| 60S acidic ribosomal protein P0 [Glycine soja]
Length=187

 Score =   148 bits (374),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 94/131 (72%), Gaps = 10/131 (8%)
 Frame = +1

Query  202  KIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIKRSIRVHA  381
            K AYD K+ +LL EY+Q+L+  +DNVGSNQLQ IR+GL  DSVV+MGKN+M+KRSI + A
Sbjct  7    KAAYDAKMLKLLKEYSQVLVVSSDNVGSNQLQGIRRGLNADSVVVMGKNSMMKRSIILDA  66

Query  382  ENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGN  561
            + TGN A LNL+PLLVGNV LIFTKGDL+EVSE++AKYKV  P          +++ P  
Sbjct  67   QKTGNKAFLNLVPLLVGNVALIFTKGDLREVSEQIAKYKVVQP----------ILMCPKY  116

Query  562  TGLDPSQTSFF  594
            T  D  Q   +
Sbjct  117  TSYDTYQNCTY  127



>ref|XP_001697060.1| acidic ribosomal protein P0 [Chlamydomonas reinhardtii]
 gb|EDP00752.1| acidic ribosomal protein P0 [Chlamydomonas reinhardtii]
Length=320

 Score =   152 bits (383),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 99/149 (66%), Gaps = 5/149 (3%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            M  ++  + KK  Y Q+L Q L  Y +  I  ADNVGS Q  +IRK LR  +V+LMGKNT
Sbjct  1    MVAEERVSDKKKEYRQRLNQYLQTYDKAFIVHADNVGSRQFMDIRKALRPGAVILMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIP-----LLVGNVGLIFTKGDLKEVSEEVAKYKVGAPAR  516
            M++  +  + E TG+     L+      LL GNVG++FT GDL +V +E+AKYKVGAPAR
Sbjct  61   MMRFCVEKYLEETGDHRWECLVKPGKKGLLEGNVGIVFTNGDLSQVKDEIAKYKVGAPAR  120

Query  517  VGLVAPIDVVVPPGNTGLDPSQTSFFQVL  603
            VG VAP DVV+  G TG+DPSQTSFFQ L
Sbjct  121  VGAVAPEDVVIKAGGTGMDPSQTSFFQAL  149



>ref|XP_006612127.1| PREDICTED: 60S acidic ribosomal protein P0-like [Apis dorsata]
Length=317

 Score =   152 bits (383),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 101/142 (71%), Gaps = 2/142 (1%)
 Frame = +1

Query  181  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  360
            ++ KA  K  Y  KL QLLD+Y +  I  ADNVGS Q+Q IR  LRG++VVLMGKNTM++
Sbjct  3    REDKATWKSNYFTKLVQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGNAVVLMGKNTMMR  62

Query  361  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  540
            ++IR H E   N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63   KAIRGHIER--NAALEKLLPHIRGNVGFVFTRGDLIEVRDKLLENKVRAPARAGAIAPLS  120

Query  541  VVVPPGNTGLDPSQTSFFQVLN  606
            V++P  NTGL P +TSFFQ L+
Sbjct  121  VIIPAQNTGLGPEKTSFFQALS  142



>ref|XP_001655016.1| AAEL010821-PA [Aedes aegypti]
 gb|ABF18228.1| ribosomal protein P0 [Aedes aegypti]
 gb|EAT37166.1| AAEL010821-PA [Aedes aegypti]
Length=315

 Score =   152 bits (383),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 101/142 (71%), Gaps = 2/142 (1%)
 Frame = +1

Query  181  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  360
            ++ KA  K  Y  K+ QLLDEY +  I  ADNVGS Q+Q IR  LRG +VVLMGKNTM++
Sbjct  3    REDKATWKANYFVKIVQLLDEYPKCFIVGADNVGSRQMQTIRISLRGTAVVLMGKNTMMR  62

Query  361  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  540
            ++IR H E   N+ +  L+P + GNVG +FTKGDL EV +++ + KV APAR G +AP++
Sbjct  63   KAIRGHLEE--NSNLEKLLPHIKGNVGFVFTKGDLVEVRDKLMESKVRAPARAGAIAPLE  120

Query  541  VVVPPGNTGLDPSQTSFFQVLN  606
            VV+P  NTGL P +TSFFQ L+
Sbjct  121  VVIPAQNTGLGPEKTSFFQALS  142



>ref|XP_623106.1| PREDICTED: 60S acidic ribosomal protein P0 isoformX1 [Apis mellifera]
 ref|XP_003695681.1| PREDICTED: 60S acidic ribosomal protein P0-like [Apis florea]
 ref|XP_006562125.1| PREDICTED: 60S acidic ribosomal protein P0 isoform X2 [Apis mellifera]
Length=317

 Score =   152 bits (383),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 101/142 (71%), Gaps = 2/142 (1%)
 Frame = +1

Query  181  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  360
            ++ KA  K  Y  KL QLLD+Y +  I  ADNVGS Q+Q IR  LRG++VVLMGKNTM++
Sbjct  3    REDKATWKSNYFTKLVQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGNAVVLMGKNTMMR  62

Query  361  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  540
            ++IR H E   N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63   KAIRGHIER--NAALEKLLPHIRGNVGFVFTRGDLIEVRDKLLENKVRAPARAGAIAPLS  120

Query  541  VVVPPGNTGLDPSQTSFFQVLN  606
            V++P  NTGL P +TSFFQ L+
Sbjct  121  VIIPAQNTGLGPEKTSFFQALS  142



>ref|XP_003398378.1| PREDICTED: 60S acidic ribosomal protein P0-like isoform 1 [Bombus 
terrestris]
 ref|XP_003398379.1| PREDICTED: 60S acidic ribosomal protein P0-like isoform 2 [Bombus 
terrestris]
Length=317

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 101/142 (71%), Gaps = 2/142 (1%)
 Frame = +1

Query  181  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  360
            ++ KA  K  Y  KL QLLD+Y +  I  ADNVGS Q+Q IR  LRG++VVLMGKNTM++
Sbjct  3    REDKATWKSNYFTKLVQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGNAVVLMGKNTMMR  62

Query  361  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  540
            ++IR H E   N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63   KAIRGHIER--NAALEKLLPHIRGNVGFVFTRGDLIEVRDKLLENKVRAPARAGAIAPLS  120

Query  541  VVVPPGNTGLDPSQTSFFQVLN  606
            V++P  NTGL P +TSFFQ L+
Sbjct  121  VIIPAQNTGLGPEKTSFFQALS  142



>ref|XP_011266937.1| PREDICTED: 60S acidic ribosomal protein P0 [Camponotus floridanus]
 gb|EFN61067.1| 60S acidic ribosomal protein P0 [Camponotus floridanus]
Length=318

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 101/142 (71%), Gaps = 2/142 (1%)
 Frame = +1

Query  181  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  360
            ++ KA  K  Y  KL QLLD+Y +  I  ADNVGS Q+Q IR  LRG++VVLMGKNTM++
Sbjct  3    REDKATWKSNYFTKLVQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGNAVVLMGKNTMMR  62

Query  361  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  540
            ++IR H E   N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63   KAIRGHIER--NAALEKLLPHIRGNVGFVFTRGDLIEVRDKLLENKVRAPARAGAIAPLS  120

Query  541  VVVPPGNTGLDPSQTSFFQVLN  606
            V++P  NTGL P +TSFFQ L+
Sbjct  121  VIIPAQNTGLGPEKTSFFQALS  142



>ref|XP_011297993.1| PREDICTED: 60S acidic ribosomal protein P0 [Fopius arisanus]
Length=317

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 100/142 (70%), Gaps = 2/142 (1%)
 Frame = +1

Query  181  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  360
            ++ KA  K  Y  KL QLLD+Y +  I  ADNVGS Q+Q IR  LRG +VVLMGKNTM++
Sbjct  3    REDKASWKSNYFTKLIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGSAVVLMGKNTMMR  62

Query  361  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  540
            ++IR H E   N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63   KAIRGHIER--NAALEKLLPHIRGNVGFVFTRGDLVEVRDKLLENKVRAPARAGAIAPLS  120

Query  541  VVVPPGNTGLDPSQTSFFQVLN  606
            V++P  NTGL P +TSFFQ L+
Sbjct  121  VIIPAQNTGLGPEKTSFFQALS  142



>ref|XP_001958489.1| GF10946 [Drosophila ananassae]
 gb|EDV41295.1| GF10946 [Drosophila ananassae]
Length=317

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 102/143 (71%), Gaps = 2/143 (1%)
 Frame = +1

Query  178  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  357
            V++ KA  K  Y  K+ +L DE+ +  I  ADNVGS Q+QNIR  LRG +VVLMGKNTM+
Sbjct  2    VRENKAAWKAQYFIKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMM  61

Query  358  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  537
            +++IR H EN  N  +  L+P + GNVG +FTKGDL EV +++ + KV APAR G +AP+
Sbjct  62   RKAIRGHLEN--NPQLEKLLPHIKGNVGFVFTKGDLAEVRDKLLESKVRAPARPGAIAPL  119

Query  538  DVVVPPGNTGLDPSQTSFFQVLN  606
            +V++P  NTGL P +TSFFQ L+
Sbjct  120  NVIIPAQNTGLGPEKTSFFQALS  142



>ref|XP_008544624.1| PREDICTED: 60S acidic ribosomal protein P0 [Microplitis demolitor]
Length=316

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 100/142 (70%), Gaps = 2/142 (1%)
 Frame = +1

Query  181  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  360
            ++ KA  K  Y  KL QLLD+Y +  I  ADNVGS Q+Q IR  LRG +VVLMGKNTM++
Sbjct  3    REDKASWKSNYFLKLIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGSAVVLMGKNTMMR  62

Query  361  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  540
            ++IR H E   N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63   KAIRGHIER--NAALEKLLPHIRGNVGFVFTRGDLVEVRDKLVENKVRAPARAGAIAPLS  120

Query  541  VVVPPGNTGLDPSQTSFFQVLN  606
            V++P  NTGL P +TSFFQ L+
Sbjct  121  VIIPAQNTGLGPEKTSFFQALS  142



>ref|XP_003488353.1| PREDICTED: 60S acidic ribosomal protein P0-like [Bombus impatiens]
Length=317

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 101/142 (71%), Gaps = 2/142 (1%)
 Frame = +1

Query  181  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  360
            ++ KA  K  Y  KL QLLD+Y +  I  ADNVGS Q+Q IR  LRG++VVLMGKNTM++
Sbjct  3    REDKATWKSNYFTKLVQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGNAVVLMGKNTMMR  62

Query  361  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  540
            ++IR H E   N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63   KAIRGHIER--NAALEKLLPHIRGNVGFVFTRGDLIEVRDKLLENKVRAPARAGAIAPLS  120

Query  541  VVVPPGNTGLDPSQTSFFQVLN  606
            V++P  NTGL P +TSFFQ L+
Sbjct  121  VIIPAQNTGLGPEKTSFFQALS  142



>ref|XP_011157010.1| PREDICTED: 60S acidic ribosomal protein P0 [Solenopsis invicta]
 gb|EFZ19789.1| hypothetical protein SINV_09784 [Solenopsis invicta]
Length=318

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 101/142 (71%), Gaps = 2/142 (1%)
 Frame = +1

Query  181  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  360
            ++ KA  K  Y  KL QLLD+Y +  I  ADNVGS Q+Q IR  LRG++VVLMGKNTM++
Sbjct  3    REDKATWKSNYFTKLVQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGNAVVLMGKNTMMR  62

Query  361  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  540
            ++IR H E   N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63   KAIRGHIER--NAALEKLLPHIRGNVGFVFTRGDLIEVRDKLLENKVRAPARAGAIAPLS  120

Query  541  VVVPPGNTGLDPSQTSFFQVLN  606
            V++P  NTGL P +TSFFQ L+
Sbjct  121  VIIPAQNTGLGPEKTSFFQALS  142



>ref|XP_001607606.1| PREDICTED: 60S acidic ribosomal protein P0 [Nasonia vitripennis]
Length=316

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 100/142 (70%), Gaps = 2/142 (1%)
 Frame = +1

Query  181  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  360
            ++ KA  K  Y  KL QLLD+Y +  I  ADNVGS Q+Q IR  LRG +VVLMGKNTM++
Sbjct  3    REDKASWKAGYFSKLIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGTAVVLMGKNTMMR  62

Query  361  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  540
            ++I+ H E   N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63   KAIKGHIER--NAALEKLLPHIRGNVGFVFTRGDLVEVRDKLLENKVRAPARAGAIAPLS  120

Query  541  VVVPPGNTGLDPSQTSFFQVLN  606
            V++P  NTGL P +TSFFQ L+
Sbjct  121  VIIPAQNTGLGPEKTSFFQALS  142



>ref|XP_001973718.1| GG16244 [Drosophila erecta]
 gb|EDV52744.1| GG16244 [Drosophila erecta]
Length=317

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 101/143 (71%), Gaps = 2/143 (1%)
 Frame = +1

Query  178  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  357
            V++ KA  K  Y  K+ +L DE+ +  I  ADNVGS Q+QNIR  LRG +VVLMGKNTM+
Sbjct  2    VRENKAAWKAQYFIKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMM  61

Query  358  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  537
            +++IR H EN  N  +  L+P + GNVG +FTKGDL EV +++ + KV APAR G +AP+
Sbjct  62   RKAIRGHLEN--NPQLEKLLPHIKGNVGFVFTKGDLAEVRDKLLESKVRAPARPGAIAPL  119

Query  538  DVVVPPGNTGLDPSQTSFFQVLN  606
             V++P  NTGL P +TSFFQ L+
Sbjct  120  HVIIPAQNTGLGPEKTSFFQALS  142



>ref|XP_002047707.1| GJ13582 [Drosophila virilis]
 gb|EDW70049.1| GJ13582 [Drosophila virilis]
Length=317

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 101/143 (71%), Gaps = 2/143 (1%)
 Frame = +1

Query  178  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  357
            V++ KA  K  Y  K+ +L DE+ +  I  ADNVGS Q+QNIR  LRG +VVLMGKNTM+
Sbjct  2    VRENKAAWKAQYFIKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMM  61

Query  358  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  537
            +++IR H EN  N  +  L+P + GNVG +FTKGDL EV +++ + KV APAR G +AP+
Sbjct  62   RKAIRGHLEN--NPQLEKLLPHIKGNVGFVFTKGDLAEVRDKLLESKVRAPARPGAIAPL  119

Query  538  DVVVPPGNTGLDPSQTSFFQVLN  606
             VV+P  NTGL P +TSFFQ L+
Sbjct  120  PVVIPAQNTGLGPEKTSFFQALS  142



>ref|XP_006575531.1| PREDICTED: 60S acidic ribosomal protein P0-like isoform X1 [Glycine 
max]
 ref|XP_006575532.1| PREDICTED: 60S acidic ribosomal protein P0-like isoform X2 [Glycine 
max]
 gb|KHN48551.1| 60S acidic ribosomal protein P0 [Glycine soja]
Length=187

 Score =   147 bits (372),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 94/131 (72%), Gaps = 10/131 (8%)
 Frame = +1

Query  202  KIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIKRSIRVHA  381
            K AYD K+ +LL EY+Q+L+  +DNVGSNQLQ IR+GL  DSVV+MGKN+M+KRSI + A
Sbjct  7    KAAYDAKMLKLLREYSQVLVVSSDNVGSNQLQGIRRGLNADSVVVMGKNSMMKRSIILDA  66

Query  382  ENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGN  561
            + TGN A LNL+PLLVGNV LIFTKGDL+EVSE++AKYKV  P          +++ P  
Sbjct  67   KKTGNKAFLNLVPLLVGNVALIFTKGDLREVSEQIAKYKVVQP----------ILMCPKY  116

Query  562  TGLDPSQTSFF  594
            T  D  Q   +
Sbjct  117  TSYDTYQNCTY  127



>ref|NP_524211.1| ribosomal protein LP0, isoform A [Drosophila melanogaster]
 ref|NP_001262202.1| ribosomal protein LP0, isoform B [Drosophila melanogaster]
 sp|P19889.1|RLA0_DROME RecName: Full=60S acidic ribosomal protein P0; AltName: Full=Apurinic-apyrimidinic 
endonuclease; AltName: Full=DNA-(apurinic 
or apyrimidinic site) lyase [Drosophila melanogaster]
 gb|AAA53372.1| DNA repair protein [Drosophila melanogaster]
 gb|AAF51807.1| ribosomal protein LP0, isoform A [Drosophila melanogaster]
 gb|AAL68335.1| RE74511p [Drosophila melanogaster]
 gb|AAX33595.1| GH01513p [Drosophila melanogaster]
 gb|AGB94895.1| ribosomal protein LP0, isoform B [Drosophila melanogaster]
Length=317

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 101/143 (71%), Gaps = 2/143 (1%)
 Frame = +1

Query  178  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  357
            V++ KA  K  Y  K+ +L DE+ +  I  ADNVGS Q+QNIR  LRG +VVLMGKNTM+
Sbjct  2    VRENKAAWKAQYFIKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMM  61

Query  358  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  537
            +++IR H EN  N  +  L+P + GNVG +FTKGDL EV +++ + KV APAR G +AP+
Sbjct  62   RKAIRGHLEN--NPQLEKLLPHIKGNVGFVFTKGDLAEVRDKLLESKVRAPARPGAIAPL  119

Query  538  DVVVPPGNTGLDPSQTSFFQVLN  606
             V++P  NTGL P +TSFFQ L+
Sbjct  120  HVIIPAQNTGLGPEKTSFFQALS  142



>ref|XP_001985147.1| GH14667 [Drosophila grimshawi]
 gb|EDV97495.1| GH14667 [Drosophila grimshawi]
Length=318

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 101/143 (71%), Gaps = 2/143 (1%)
 Frame = +1

Query  178  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  357
            V++ KA  K  Y  K+ +L DE+ +  I  ADNVGS Q+QNIR  LRG +VVLMGKNTM+
Sbjct  2    VRENKAAWKAQYFVKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMM  61

Query  358  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  537
            +++IR H EN  N  +  L+P + GNVG +FTKGDL EV +++ + KV APAR G +AP+
Sbjct  62   RKAIRGHLEN--NPQLEKLLPHIKGNVGFVFTKGDLAEVRDKLLESKVRAPARPGAIAPL  119

Query  538  DVVVPPGNTGLDPSQTSFFQVLN  606
             V++P  NTGL P +TSFFQ L+
Sbjct  120  HVIIPAQNTGLGPEKTSFFQALS  142



>ref|XP_002040897.1| GM22429 [Drosophila sechellia]
 ref|XP_002085890.1| GD15019 [Drosophila simulans]
 gb|EDW44450.1| GM22429 [Drosophila sechellia]
 gb|EDX11475.1| GD15019 [Drosophila simulans]
Length=317

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 101/143 (71%), Gaps = 2/143 (1%)
 Frame = +1

Query  178  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  357
            V++ KA  K  Y  K+ +L DE+ +  I  ADNVGS Q+QNIR  LRG +VVLMGKNTM+
Sbjct  2    VRENKAAWKAQYFIKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMM  61

Query  358  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  537
            +++IR H EN  N  +  L+P + GNVG +FTKGDL EV +++ + KV APAR G +AP+
Sbjct  62   RKAIRGHLEN--NPQLEKLLPHIKGNVGFVFTKGDLAEVRDKLLESKVRAPARPGAIAPL  119

Query  538  DVVVPPGNTGLDPSQTSFFQVLN  606
             V++P  NTGL P +TSFFQ L+
Sbjct  120  HVIIPAQNTGLGPEKTSFFQALS  142



>ref|XP_002095795.1| RpLP0 [Drosophila yakuba]
 gb|EDW95507.1| RpLP0 [Drosophila yakuba]
Length=317

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 101/143 (71%), Gaps = 2/143 (1%)
 Frame = +1

Query  178  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  357
            V++ KA  K  Y  K+ +L DE+ +  I  ADNVGS Q+QNIR  LRG +VVLMGKNTM+
Sbjct  2    VRENKAAWKAQYFIKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMM  61

Query  358  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  537
            +++IR H EN  N  +  L+P + GNVG +FTKGDL EV +++ + KV APAR G +AP+
Sbjct  62   RKAIRGHLEN--NPQLEKLLPHIKGNVGFVFTKGDLAEVRDKLLESKVRAPARPGAIAPL  119

Query  538  DVVVPPGNTGLDPSQTSFFQVLN  606
             V++P  NTGL P +TSFFQ L+
Sbjct  120  HVIIPAQNTGLGPEKTSFFQALS  142



>ref|XP_011347099.1| PREDICTED: 60S acidic ribosomal protein P0 [Cerapachys biroi]
 gb|EZA49150.1| 60S acidic ribosomal protein P0 [Cerapachys biroi]
Length=317

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 101/142 (71%), Gaps = 2/142 (1%)
 Frame = +1

Query  181  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  360
            ++ KA  K  Y  KL QLLD++ +  I  ADNVGS Q+Q IR  LRG++VVLMGKNTM++
Sbjct  3    REDKATWKSQYFTKLVQLLDDFPKCFIVGADNVGSKQMQQIRMSLRGNAVVLMGKNTMMR  62

Query  361  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  540
            ++IR H E   N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63   KAIRGHIER--NAALEKLLPHIRGNVGFVFTRGDLIEVRDKLLENKVRAPARAGAIAPLS  120

Query  541  VVVPPGNTGLDPSQTSFFQVLN  606
            V++P  NTGL P +TSFFQ L+
Sbjct  121  VIIPAQNTGLGPEKTSFFQALS  142



>gb|AAM97779.1| ribosomal protein P0 [Aedes albopictus]
Length=315

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 101/142 (71%), Gaps = 2/142 (1%)
 Frame = +1

Query  181  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  360
            ++ KA  K  Y  K+ QLLDEY +  I  ADNVGS Q+Q IR  LRG +VVLMGKNTM++
Sbjct  3    REDKATWKANYFVKIVQLLDEYPKCFIVGADNVGSRQMQTIRISLRGTAVVLMGKNTMMR  62

Query  361  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  540
            ++IR H E   N+ +  L+P + GNVG +FTKGDL EV +++ + KV APAR G +AP++
Sbjct  63   KAIRGHLEE--NSNLEKLLPHVKGNVGFVFTKGDLVEVRDKLMESKVRAPARAGAIAPLE  120

Query  541  VVVPPGNTGLDPSQTSFFQVLN  606
            V++P  NTGL P +TSFFQ L+
Sbjct  121  VIIPAQNTGLGPEKTSFFQALS  142



>ref|XP_002008961.1| GI13777 [Drosophila mojavensis]
 gb|EDW19437.1| GI13777 [Drosophila mojavensis]
Length=317

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 101/143 (71%), Gaps = 2/143 (1%)
 Frame = +1

Query  178  VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  357
            V++ KA  K  Y  K+ +L DE+ +  I  ADNVGS Q+QNIR  LRG +VVLMGKNTM+
Sbjct  2    VRENKAAWKAQYFIKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMM  61

Query  358  KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  537
            +++IR H EN  N  +  L+P + GNVG +FTKGDL EV +++ + KV APAR G +AP+
Sbjct  62   RKAIRGHLEN--NPQLEKLLPHIKGNVGFVFTKGDLAEVRDKLLESKVRAPARPGAIAPL  119

Query  538  DVVVPPGNTGLDPSQTSFFQVLN  606
             V++P  NTGL P +TSFFQ L+
Sbjct  120  PVIIPAQNTGLGPEKTSFFQALS  142



>ref|XP_011146290.1| PREDICTED: 60S acidic ribosomal protein P0-like [Harpegnathos 
saltator]
 gb|EFN80029.1| 60S acidic ribosomal protein P0 [Harpegnathos saltator]
Length=316

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 100/142 (70%), Gaps = 2/142 (1%)
 Frame = +1

Query  181  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  360
            ++ K   K  Y  KL QLLD+Y +  I  ADNVGS Q+Q IR  LRG++VVLMGKNTM++
Sbjct  3    REDKTTWKSNYFTKLVQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGNAVVLMGKNTMMR  62

Query  361  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  540
            ++IR H E   N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63   KAIRGHVER--NAALEKLLPHIRGNVGFVFTRGDLIEVRDKLLENKVRAPARAGAIAPLS  120

Query  541  VVVPPGNTGLDPSQTSFFQVLN  606
            VV+P  NTGL P +TSFFQ L+
Sbjct  121  VVIPAQNTGLGPEKTSFFQALS  142



>dbj|BAM18929.1| ribosomal protein LP0 [Papilio polytes]
Length=317

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 101/142 (71%), Gaps = 2/142 (1%)
 Frame = +1

Query  181  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  360
            ++ KA  K  Y  K+ QLLDEY +  +  ADNVGS Q+Q IR  LRG S+VLMGKNTM++
Sbjct  3    REDKATWKTNYFTKIIQLLDEYPKCFLVGADNVGSTQMQQIRISLRGHSIVLMGKNTMMR  62

Query  361  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  540
            ++I+ H +N  N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63   KAIKDHLDN--NPALEKLLPHIKGNVGFVFTRGDLVEVRDKLLENKVRAPARPGAIAPLS  120

Query  541  VVVPPGNTGLDPSQTSFFQVLN  606
            VV+P  NTGL P +TSFFQ L+
Sbjct  121  VVIPAHNTGLGPEKTSFFQALS  142



>ref|XP_001851128.1| 60S acidic ribosomal protein P0 [Culex quinquefasciatus]
 gb|EDS33081.1| 60S acidic ribosomal protein P0 [Culex quinquefasciatus]
Length=315

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 101/142 (71%), Gaps = 2/142 (1%)
 Frame = +1

Query  181  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  360
            ++ K   K  Y  K+ QLLDEY +  I  ADNVGS Q+Q IR  LRG ++VLMGKNTM++
Sbjct  3    REDKTTWKANYFVKIVQLLDEYPKCFIVGADNVGSRQMQTIRISLRGSAIVLMGKNTMMR  62

Query  361  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  540
            ++IR H EN  N+ +  L+P + GNVG +FTKGDL ++ +++ + KV APAR G +AP++
Sbjct  63   KAIRGHLEN--NSNLEKLLPHIRGNVGFVFTKGDLADIRDKLMESKVRAPARAGAIAPLE  120

Query  541  VVVPPGNTGLDPSQTSFFQVLN  606
            V++P  NTGL P +TSFFQ L+
Sbjct  121  VIIPAQNTGLGPEKTSFFQALS  142



>ref|XP_003706895.1| PREDICTED: 60S acidic ribosomal protein P0-like [Megachile rotundata]
Length=316

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 101/142 (71%), Gaps = 2/142 (1%)
 Frame = +1

Query  181  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  360
            ++ KA  K  Y  KL QLLD+Y +  I  ADNVGS Q+Q IR  LRG++VVLMGKNTM++
Sbjct  3    REDKATWKSNYFTKLVQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGNAVVLMGKNTMMR  62

Query  361  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  540
            ++IR H E   N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63   KAIRGHIER--NAALEKLLPHIRGNVGFVFTRGDLIEVRDKLLENKVRAPARAGAIAPLS  120

Query  541  VVVPPGNTGLDPSQTSFFQVLN  606
            V++P  NTGL P +T+FFQ L+
Sbjct  121  VIIPAQNTGLGPEKTAFFQALS  142



>dbj|BAM17678.1| ribosomal protein LP0 [Papilio xuthus]
Length=316

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 101/142 (71%), Gaps = 2/142 (1%)
 Frame = +1

Query  181  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  360
            ++ KA  K  Y  K+ QLLDEY +  +  ADNVGS Q+Q IR  LRG S+VLMGKNTM++
Sbjct  3    REDKATWKTNYFTKIIQLLDEYPKCFLVGADNVGSTQMQQIRISLRGHSIVLMGKNTMMR  62

Query  361  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  540
            ++I+ H +N  N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63   KAIKDHLDN--NPALEKLLPHIKGNVGFVFTRGDLVEVRDKLLENKVRAPARPGAIAPLS  120

Query  541  VVVPPGNTGLDPSQTSFFQVLN  606
            VV+P  NTGL P +TSFFQ L+
Sbjct  121  VVIPAHNTGLGPEKTSFFQALS  142



>ref|XP_002958097.1| hypothetical protein VOLCADRAFT_84328 [Volvox carteri f. nagariensis]
 gb|EFJ40828.1| hypothetical protein VOLCADRAFT_84328 [Volvox carteri f. nagariensis]
Length=321

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 99/149 (66%), Gaps = 5/149 (3%)
 Frame = +1

Query  172  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  351
            M  ++  +QKK  Y ++L Q L  Y +  I  ADNVGS Q  +IRK LR +SV+LMGKNT
Sbjct  1    MVAEERVSQKKKDYRKRLAQYLQTYDKAFIVNADNVGSKQFMDIRKALRPNSVILMGKNT  60

Query  352  MIKRSIRVHAENTGNTAILNLIP-----LLVGNVGLIFTKGDLKEVSEEVAKYKVGAPAR  516
            M++  +  + E TG+     L+      LL GNVG++FT GDL +V +E+AKYKVGAPAR
Sbjct  61   MMRYCVEKYLEETGDHRWECLVKPGKKGLLEGNVGIVFTNGDLSQVKDEIAKYKVGAPAR  120

Query  517  VGLVAPIDVVVPPGNTGLDPSQTSFFQVL  603
            VG  A  DVV+  G TG+DPSQTSFFQ L
Sbjct  121  VGATANEDVVIKAGGTGMDPSQTSFFQAL  149



>ref|NP_001236064.1| uncharacterized protein LOC100305996 [Glycine max]
 gb|ACU13955.1| unknown [Glycine max]
Length=187

 Score =   146 bits (369),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 94/131 (72%), Gaps = 10/131 (8%)
 Frame = +1

Query  202  KIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIKRSIRVHA  381
            K AYD K+ +LL EY+Q+L+  +DNVGSNQLQ IR+GL  DSVV+MGK++M+KRSI + A
Sbjct  7    KAAYDAKMLKLLKEYSQVLVVSSDNVGSNQLQGIRRGLNADSVVVMGKSSMMKRSIILDA  66

Query  382  ENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGN  561
            + TGN A LNL+PLLVGNV LIFTKGDL+EVSE++AKYKV  P          +++ P  
Sbjct  67   QKTGNKAFLNLVPLLVGNVALIFTKGDLREVSEQIAKYKVVQP----------ILMCPKY  116

Query  562  TGLDPSQTSFF  594
            T  D  Q   +
Sbjct  117  TSYDTYQNCTY  127



>ref|XP_011146226.1| PREDICTED: 60S acidic ribosomal protein P0-like [Harpegnathos 
saltator]
 gb|EFN79997.1| 60S acidic ribosomal protein P0 [Harpegnathos saltator]
Length=316

 Score =   150 bits (378),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 99/142 (70%), Gaps = 2/142 (1%)
 Frame = +1

Query  181  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  360
            ++ K   K  Y  KL QLLD+Y +  I  ADNVGS Q+Q IR  LRG+ VVLMGKNTM++
Sbjct  3    REDKTTWKSNYFTKLVQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGNGVVLMGKNTMMR  62

Query  361  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  540
            ++IR H E   N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63   KAIRGHVER--NAALEKLLPHIRGNVGFVFTRGDLIEVRDKLLENKVRAPARAGAIAPLS  120

Query  541  VVVPPGNTGLDPSQTSFFQVLN  606
            VV+P  NTGL P +TSFFQ L+
Sbjct  121  VVIPAQNTGLGPEKTSFFQALS  142



>ref|XP_011064775.1| PREDICTED: 60S acidic ribosomal protein P0 [Acromyrmex echinatior]
 gb|EGI58991.1| 60S acidic ribosomal protein P0 [Acromyrmex echinatior]
Length=318

 Score =   150 bits (379),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 101/142 (71%), Gaps = 2/142 (1%)
 Frame = +1

Query  181  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  360
            ++ KA  K  Y  KL QLLD++ +  I  ADNVGS Q+Q IR  LRG++VVLMGKNTM++
Sbjct  3    REDKATWKSNYFTKLVQLLDDFPKCFIVGADNVGSKQMQQIRMSLRGNAVVLMGKNTMMR  62

Query  361  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  540
            ++IR H E   N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63   KAIRGHIER--NAALEKLLPHIRGNVGFVFTRGDLIEVRDKLLENKVRAPARAGAIAPLS  120

Query  541  VVVPPGNTGLDPSQTSFFQVLN  606
            V++P  NTGL P +TSFFQ L+
Sbjct  121  VIIPAQNTGLGPEKTSFFQALS  142



>emb|CBM69268.1| venom protein Ci-40b [Chelonus inanitus]
Length=316

 Score =   150 bits (378),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 101/142 (71%), Gaps = 2/142 (1%)
 Frame = +1

Query  181  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  360
            ++ KA  K  Y  KL QLL++Y +  I  ADNVGS Q+Q IR  LRG++VVLMGKNTM++
Sbjct  3    REDKATWKSNYFTKLIQLLEDYPKCFIVGADNVGSKQMQQIRMSLRGNAVVLMGKNTMMR  62

Query  361  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  540
            ++IR H E   N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63   KAIRGHIER--NAALEKLLPHIRGNVGFVFTRGDLVEVRDKLLENKVRAPARAGAMAPLS  120

Query  541  VVVPPGNTGLDPSQTSFFQVLN  606
            VV+P  NTGL P +TSFFQ L+
Sbjct  121  VVIPAQNTGLGPEKTSFFQALS  142



>ref|XP_313349.1| AGAP003592-PA [Anopheles gambiae str. PEST]
 ref|XP_003436533.1| AGAP003592-PB [Anopheles gambiae str. PEST]
 gb|EAA08855.2| AGAP003592-PA [Anopheles gambiae str. PEST]
 gb|EGK97075.1| AGAP003592-PB [Anopheles gambiae str. PEST]
Length=314

 Score =   149 bits (377),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 100/142 (70%), Gaps = 2/142 (1%)
 Frame = +1

Query  181  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  360
            ++ KA  K  Y  K+ QLLDEY +  I  ADNVGS Q+Q IR  LRG ++VLMGKNTM++
Sbjct  3    REDKATWKSNYFLKVVQLLDEYPRCFIVGADNVGSRQMQTIRMSLRGSAIVLMGKNTMMR  62

Query  361  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  540
            ++IR H EN  N  +  L+  + GNVG +FTKGDL E+ +++ + KV APAR G +AP++
Sbjct  63   KAIRGHLENNQN--LEKLLNHIKGNVGFVFTKGDLAEIRDKLTESKVRAPARAGAIAPLE  120

Query  541  VVVPPGNTGLDPSQTSFFQVLN  606
            VV+P  NTGL P +TSFFQ L+
Sbjct  121  VVIPAQNTGLGPEKTSFFQALS  142



>emb|CAD29995.1| ribosomal P0 protein [Bombyx mori]
Length=316

 Score =   150 bits (378),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 101/142 (71%), Gaps = 2/142 (1%)
 Frame = +1

Query  181  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  360
            ++ KA  K  Y  K+ QLLDEY +  I  ADNVGS Q+Q IR  LRG S+VLMGKNTM++
Sbjct  3    REDKATWKSNYFVKIIQLLDEYPKCFIVGADNVGSQQMQQIRISLRGSSIVLMGKNTMMR  62

Query  361  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  540
            ++I+ H +N  N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63   KAIKDHLDN--NPALEKLLPHIKGNVGFVFTRGDLVEVRDKLLENKVQAPARPGAIAPLS  120

Query  541  VVVPPGNTGLDPSQTSFFQVLN  606
            VV+P  NTGL P +TSFFQ L+
Sbjct  121  VVIPAHNTGLGPEKTSFFQALS  142



>ref|NP_001037123.1| ribosomal protein P0 [Bombyx mori]
 gb|AAV34809.1| ribosomal protein P0 [Bombyx mori]
Length=316

 Score =   150 bits (378),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 101/142 (71%), Gaps = 2/142 (1%)
 Frame = +1

Query  181  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  360
            ++ KA  K  Y  K+ QLLDEY +  I  ADNVGS Q+Q IR  LRG S+VLMGKNTM++
Sbjct  3    REDKATWKSNYFVKIIQLLDEYPKCFIVGADNVGSQQMQQIRISLRGSSIVLMGKNTMMR  62

Query  361  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  540
            ++I+ H +N  N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63   KAIKDHLDN--NPALEKLLPHIKGNVGFVFTRGDLVEVRDKLLENKVQAPARPGAIAPLS  120

Query  541  VVVPPGNTGLDPSQTSFFQVLN  606
            VV+P  NTGL P +TSFFQ L+
Sbjct  121  VVIPAHNTGLGPEKTSFFQALS  142



>gb|ACY95307.1| ribosomal protein P0 [Manduca sexta]
Length=317

 Score =   149 bits (377),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 101/142 (71%), Gaps = 2/142 (1%)
 Frame = +1

Query  181  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  360
            ++ KA  K  Y  K+ QLLDEY +  I  ADNVGS Q+Q IR  LRG S+VLMGKNTM++
Sbjct  3    REDKATWKTNYFTKIIQLLDEYPKCFIVGADNVGSQQMQQIRISLRGHSIVLMGKNTMMR  62

Query  361  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  540
            ++I+ H +N  N A+  L+P + GNVG +FT+GDL +V +++ + KV APAR G +AP+ 
Sbjct  63   KAIKDHLDN--NPALEKLLPHIKGNVGFVFTRGDLVDVRDKLLENKVQAPARPGAIAPLS  120

Query  541  VVVPPGNTGLDPSQTSFFQVLN  606
            VV+P  NTGL P +TSFFQ L+
Sbjct  121  VVIPAHNTGLGPEKTSFFQALS  142



>gb|ETN64428.1| 60S acidic ribosomal protein P0 [Anopheles darlingi]
Length=316

 Score =   149 bits (377),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 101/142 (71%), Gaps = 2/142 (1%)
 Frame = +1

Query  181  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  360
            ++ KA  K  Y  K+ QLLDEY +  I  ADNVGS Q+Q IR  LRG ++VLMGKNTM++
Sbjct  3    REDKATWKSNYFLKVVQLLDEYPKCFIVGADNVGSRQMQTIRMSLRGSAIVLMGKNTMMR  62

Query  361  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  540
            ++IR H EN  N ++  L+  + GNVG +FTKGDL ++ +++ + KV APAR G +AP++
Sbjct  63   KAIRGHLEN--NQSLEKLLTHIKGNVGFVFTKGDLADIRDKLTESKVRAPARAGAIAPLE  120

Query  541  VVVPPGNTGLDPSQTSFFQVLN  606
            V++P  NTGL P +TSFFQ L+
Sbjct  121  VIIPAQNTGLGPEKTSFFQALS  142



>gb|EHJ75936.1| ribosomal protein P0 [Danaus plexippus]
Length=316

 Score =   149 bits (376),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 100/142 (70%), Gaps = 2/142 (1%)
 Frame = +1

Query  181  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  360
            ++ KA  K  Y  K+ QLLDEY +  I  ADNVGS Q+Q IR  LRG S+VLMGKNTM++
Sbjct  3    REDKASWKTNYFTKIIQLLDEYPKCFIVGADNVGSQQMQQIRISLRGSSIVLMGKNTMMR  62

Query  361  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  540
            ++I+ H E   N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63   KAIKDHLET--NPALEKLLPHIKGNVGFVFTRGDLVEVRDKLLENKVRAPARPGAIAPLA  120

Query  541  VVVPPGNTGLDPSQTSFFQVLN  606
            VV+P  NTGL P +T+FFQ L+
Sbjct  121  VVIPAHNTGLGPEKTAFFQALS  142



>gb|AAL62465.1| 60S acidic ribosomal protein P0 [Spodoptera frugiperda]
Length=315

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 100/142 (70%), Gaps = 2/142 (1%)
 Frame = +1

Query  181  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  360
            ++ KA  K  Y  K+ QLLDEY +  I  ADNVGS Q+Q IR  LRG S+VLMGKNTM++
Sbjct  3    REDKATWKTNYFTKIIQLLDEYPKCFIVGADNVGSTQMQQIRISLRGHSIVLMGKNTMMR  62

Query  361  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  540
            ++I+ H E   N A+  L+P + GNVG +FT+GDL +V +++ + KV APAR G +AP+ 
Sbjct  63   KAIKDHLET--NPALEKLLPHIKGNVGFVFTRGDLVDVRDKLLENKVRAPARPGAIAPLS  120

Query  541  VVVPPGNTGLDPSQTSFFQVLN  606
            VV+P  NTGL P +TSFFQ L+
Sbjct  121  VVIPAHNTGLGPEKTSFFQALS  142



>ref|XP_007141772.1| hypothetical protein PHAVU_008G224500g [Phaseolus vulgaris]
 gb|ESW13766.1| hypothetical protein PHAVU_008G224500g [Phaseolus vulgaris]
Length=188

 Score =   145 bits (366),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  202  KIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIKRSIRVHA  381
            K AYD K+ +LL EY+Q+L+  +DNVGSNQLQ IR+GL  DSVV+MGKN+++KRSI + A
Sbjct  7    KAAYDAKMLKLLREYSQVLVISSDNVGSNQLQGIRRGLHADSVVVMGKNSLMKRSIILDA  66

Query  382  ENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAP  510
            + TGN A LNL+PLLVGNV LIFTKGD++EVSE++AKYKV  P
Sbjct  67   QKTGNKAFLNLVPLLVGNVALIFTKGDIREVSEQIAKYKVVQP  109



>gb|AIW62441.1| 60S acidic ribosomal protein [Scytodes thoracica]
Length=320

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 97/141 (69%), Gaps = 2/141 (1%)
 Frame = +1

Query  181  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  360
            ++ +A  K  Y  KL QLLDEY +  I   D+VGS Q+Q IR  LR D+V+LMGKNTMI+
Sbjct  3    REDRATWKSNYFMKLVQLLDEYPKCFIVGVDDVGSRQMQQIRLSLRKDAVLLMGKNTMIR  62

Query  361  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  540
            ++IR H EN  N A+  +IP + GNVG +FTK DL EV +++   KV APAR G +AP D
Sbjct  63   KAIRGHMEN--NPALEKIIPHIRGNVGFVFTKEDLVEVRDKIIDNKVKAPARAGAIAPCD  120

Query  541  VVVPPGNTGLDPSQTSFFQVL  603
            V++ P NTGL P +TSFFQ L
Sbjct  121  VILQPQNTGLGPEKTSFFQAL  141



>gb|ADT80652.1| ribosomal protein P0 [Euphydryas aurinia]
Length=316

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 100/142 (70%), Gaps = 2/142 (1%)
 Frame = +1

Query  181  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  360
            ++ KA  K  Y  K+ QLLDEY +  I  ADNVGS Q+Q IR  LRG S+VLMGKNTM++
Sbjct  3    REDKATWKTNYFTKIIQLLDEYPKCFIVGADNVGSQQMQQIRISLRGHSIVLMGKNTMMR  62

Query  361  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  540
            ++I+ H E   N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63   KAIKDHLET--NPALEKLLPHIKGNVGFVFTRGDLVEVRDKLLENKVRAPARPGAIAPLA  120

Query  541  VVVPPGNTGLDPSQTSFFQVLN  606
            VV+P  NTGL P +T+FFQ L+
Sbjct  121  VVIPAHNTGLGPEKTAFFQALS  142



>gb|AEE62116.1| unknown [Dendroctonus ponderosae]
Length=317

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 100/142 (70%), Gaps = 2/142 (1%)
 Frame = +1

Query  181  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  360
            ++ KA  K  Y  KL QLL++Y +  I  ADNVGS Q+Q IR GLRG +VVLMGKNTM++
Sbjct  3    REDKATWKANYFAKLVQLLEDYPKCFIVGADNVGSKQMQQIRIGLRGSAVVLMGKNTMMR  62

Query  361  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  540
            ++I+ H E   N A+  L+P + GNVG +FTK DL EV +++ + KV APAR G +AP+ 
Sbjct  63   KAIKGHCER--NPALEKLLPRIKGNVGFVFTKNDLVEVRDKLLENKVRAPARAGAIAPLP  120

Query  541  VVVPPGNTGLDPSQTSFFQVLN  606
            VV+P  NTGL P +TSFFQ L+
Sbjct  121  VVIPAQNTGLGPEKTSFFQALS  142



>gb|AAX62441.1| ribosomal protein P0 [Lysiphlebus testaceipes]
Length=223

 Score =   145 bits (367),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 98/142 (69%), Gaps = 2/142 (1%)
 Frame = +1

Query  181  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  360
            ++ KA  K  Y  KL QLLDEY +  I  ADNVGS Q+Q IR  LRG  VVLMGKNTM++
Sbjct  3    REDKASWKSNYFVKLIQLLDEYPKCFIVGADNVGSKQMQQIRMSLRGTGVVLMGKNTMMR  62

Query  361  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  540
            ++I+ H E   N  +  ++P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63   KAIKGHVER--NAHLERILPHIKGNVGFVFTRGDLVEVRDKLVENKVRAPARNGAIAPLS  120

Query  541  VVVPPGNTGLDPSQTSFFQVLN  606
            V++P  NTGL P +TSFFQ L+
Sbjct  121  VIIPAQNTGLGPEKTSFFQALS  142



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 815770585800