BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS082E04

Length=627
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009600890.1|  PREDICTED: pantothenate kinase 2                   378   1e-121   
ref|XP_006344398.1|  PREDICTED: pantothenate kinase 2-like isofor...    377   2e-121   Solanum tuberosum [potatoes]
ref|XP_009793998.1|  PREDICTED: pantothenate kinase 2 isoform X2        376   6e-121   Nicotiana sylvestris
ref|XP_004236210.1|  PREDICTED: pantothenate kinase 2                   375   1e-120   
ref|XP_009793996.1|  PREDICTED: pantothenate kinase 2 isoform X1        376   1e-120   Nicotiana sylvestris
gb|KHN19303.1|  Pantothenate kinase 2                                   356   1e-118   Glycine soja [wild soybean]
gb|EYU42581.1|  hypothetical protein MIMGU_mgv1a001050mg                369   2e-118   Erythranthe guttata [common monkey flower]
gb|KCW49280.1|  hypothetical protein EUGRSUZ_K02840                     368   5e-118   Eucalyptus grandis [rose gum]
ref|XP_006477543.1|  PREDICTED: pantothenate kinase 2-like              367   5e-118   
ref|XP_010037560.1|  PREDICTED: pantothenate kinase 2                   369   5e-118   Eucalyptus grandis [rose gum]
gb|KCW49278.1|  hypothetical protein EUGRSUZ_K02840                     369   6e-118   Eucalyptus grandis [rose gum]
ref|XP_006374524.1|  hypothetical protein POPTR_0015s08830g             363   7e-118   
ref|XP_010243065.1|  PREDICTED: pantothenate kinase 2 isoform X2        365   8e-118   Nelumbo nucifera [Indian lotus]
gb|KDO69623.1|  hypothetical protein CISIN_1g042742mg                   366   9e-118   Citrus sinensis [apfelsine]
ref|XP_008356598.1|  PREDICTED: pantothenate kinase 2-like              368   1e-117   
ref|XP_008438456.1|  PREDICTED: pantothenate kinase 2                   367   3e-117   Cucumis melo [Oriental melon]
ref|XP_004152477.1|  PREDICTED: pantothenate kinase 2-like              367   3e-117   Cucumis sativus [cucumbers]
ref|XP_002511391.1|  Pantothenate kinase, putative                      366   3e-117   
ref|XP_002279079.1|  PREDICTED: pantothenate kinase 2                   366   3e-117   Vitis vinifera
ref|XP_006439830.1|  hypothetical protein CICLE_v10018751mg             367   4e-117   Citrus clementina [clementine]
ref|XP_006600640.1|  PREDICTED: pantothenate kinase 2-like isofor...    365   5e-117   Glycine max [soybeans]
ref|XP_006600639.1|  PREDICTED: pantothenate kinase 2-like isofor...    365   5e-117   Glycine max [soybeans]
ref|XP_007210380.1|  hypothetical protein PRUPE_ppa001094mg             365   6e-117   Prunus persica
ref|XP_008239770.1|  PREDICTED: pantothenate kinase 2                   365   6e-117   Prunus mume [ume]
gb|KJB53157.1|  hypothetical protein B456_008G295400                    364   9e-117   Gossypium raimondii
ref|XP_010243061.1|  PREDICTED: pantothenate kinase 2 isoform X1        365   9e-117   Nelumbo nucifera [Indian lotus]
gb|KDP31092.1|  hypothetical protein JCGZ_11468                         365   1e-116   Jatropha curcas
emb|CBI15019.3|  unnamed protein product                                366   2e-116   Vitis vinifera
gb|KJB53156.1|  hypothetical protein B456_008G295400                    364   2e-116   Gossypium raimondii
ref|XP_010101220.1|  Pantothenate kinase 2                              363   4e-116   Morus notabilis
ref|XP_011028555.1|  PREDICTED: pantothenate kinase 2-like              364   5e-116   Populus euphratica
ref|XP_011071870.1|  PREDICTED: pantothenate kinase 2                   363   8e-116   Sesamum indicum [beniseed]
gb|KHG28314.1|  hypothetical protein F383_13494                         363   9e-116   Gossypium arboreum [tree cotton]
gb|KHG02710.1|  hypothetical protein F383_25888                         360   1e-115   Gossypium arboreum [tree cotton]
ref|XP_002318651.1|  hypothetical protein POPTR_0012s08310g             363   1e-115   
ref|XP_009363012.1|  PREDICTED: pantothenate kinase 2                   361   3e-115   Pyrus x bretschneideri [bai li]
ref|XP_007036235.1|  Pantothenate kinase 2 isoform 2                    361   4e-115   
gb|KJB39190.1|  hypothetical protein B456_007G001600                    361   5e-115   Gossypium raimondii
ref|XP_008393029.1|  PREDICTED: pantothenate kinase 2                   360   5e-115   
ref|XP_011001529.1|  PREDICTED: pantothenate kinase 2-like              360   8e-115   Populus euphratica
ref|XP_010534230.1|  PREDICTED: pantothenate kinase 2                   360   9e-115   Tarenaya hassleriana [spider flower]
ref|XP_007036234.1|  Pantothenate kinase 2 isoform 1                    361   1e-114   
ref|XP_007155432.1|  hypothetical protein PHAVU_003G200700g             358   2e-114   Phaseolus vulgaris [French bean]
ref|XP_003601259.1|  Pantothenate kinase                                358   3e-114   Medicago truncatula
ref|XP_004298946.1|  PREDICTED: pantothenate kinase 2                   357   1e-113   Fragaria vesca subsp. vesca
ref|XP_003528148.1|  PREDICTED: pantothenate kinase 2-like              356   3e-113   Glycine max [soybeans]
gb|ACN39905.1|  unknown                                                 355   5e-113   Picea sitchensis
ref|XP_010447428.1|  PREDICTED: pantothenate kinase 2 isoform X2        351   1e-112   Camelina sativa [gold-of-pleasure]
ref|XP_004501924.1|  PREDICTED: pantothenate kinase 2-like isofor...    355   1e-112   Cicer arietinum [garbanzo]
gb|AAM20690.1|  putative protein                                        352   3e-112   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194945.3|  pantothenate kinase 2                                 353   4e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867254.1|  ATPANK2                                            353   4e-112   
ref|XP_009108890.1|  PREDICTED: pantothenate kinase 2                   352   7e-112   Brassica rapa
ref|XP_010940070.1|  PREDICTED: pantothenate kinase 2-like isofor...    352   1e-111   Elaeis guineensis
emb|CDX68824.1|  BnaC01g06290D                                          352   1e-111   
ref|XP_006840740.1|  hypothetical protein AMTR_s00096p00130150          352   1e-111   
ref|XP_010447427.1|  PREDICTED: pantothenate kinase 2 isoform X1        351   1e-111   Camelina sativa [gold-of-pleasure]
ref|XP_010432761.1|  PREDICTED: pantothenate kinase 2-like              351   2e-111   Camelina sativa [gold-of-pleasure]
ref|XP_006282554.1|  hypothetical protein CARUB_v10004099mg             351   2e-111   Capsella rubella
ref|XP_010437940.1|  PREDICTED: pantothenate kinase 2-like              351   2e-111   Camelina sativa [gold-of-pleasure]
ref|XP_007138072.1|  hypothetical protein PHAVU_009G178200g             351   3e-111   Phaseolus vulgaris [French bean]
ref|XP_009126332.1|  PREDICTED: pantothenate kinase 2                   350   4e-111   Brassica rapa
ref|XP_010678776.1|  PREDICTED: pantothenate kinase 2                   350   4e-111   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX75226.1|  BnaA01g04760D                                          350   4e-111   
gb|KFK29830.1|  hypothetical protein AALP_AA7G184400                    349   6e-111   Arabis alpina [alpine rockcress]
ref|XP_008795923.1|  PREDICTED: pantothenate kinase 2-like isofor...    349   1e-110   Phoenix dactylifera
ref|XP_008795922.1|  PREDICTED: pantothenate kinase 2-like isofor...    349   2e-110   
ref|XP_006412505.1|  hypothetical protein EUTSA_v10024357mg             346   2e-109   Eutrema salsugineum [saltwater cress]
ref|XP_009403915.1|  PREDICTED: pantothenate kinase 2                   345   5e-109   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN48232.1|  Pantothenate kinase 2                                   344   6e-109   Glycine soja [wild soybean]
ref|XP_008782481.1|  PREDICTED: pantothenate kinase 2-like              345   6e-109   
ref|XP_003542534.2|  PREDICTED: pantothenate kinase 2-like isofor...    344   9e-109   
ref|XP_006594169.1|  PREDICTED: pantothenate kinase 2-like isofor...    342   7e-108   
ref|XP_010940068.1|  PREDICTED: pantothenate kinase 2-like isofor...    342   8e-108   Elaeis guineensis
ref|XP_010936708.1|  PREDICTED: pantothenate kinase 2-like              340   4e-107   Elaeis guineensis
dbj|BAD33319.1|  putative pantothenate kinase 4                         335   4e-107   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006439829.1|  hypothetical protein CICLE_v10018751mg             337   1e-106   
ref|NP_001063766.1|  Os09g0533100                                       334   2e-106   
ref|XP_004957459.1|  PREDICTED: pantothenate kinase 2-like              335   1e-105   Setaria italica
gb|EEE70109.1|  hypothetical protein OsJ_30119                          334   3e-105   Oryza sativa Japonica Group [Japonica rice]
gb|EEC84941.1|  hypothetical protein OsI_32156                          334   4e-105   Oryza sativa Indica Group [Indian rice]
sp|Q0J035.2|PANK2_ORYSJ  RecName: Full=Pantothenate kinase 2; Alt...    334   5e-105   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006660887.1|  PREDICTED: pantothenate kinase 2-like              332   1e-104   
ref|XP_002460569.1|  hypothetical protein SORBIDRAFT_02g030920          333   2e-104   Sorghum bicolor [broomcorn]
ref|XP_008652990.1|  PREDICTED: pantothenate kinase 2                   331   9e-104   
ref|XP_003576771.1|  PREDICTED: pantothenate kinase 2                   330   2e-103   Brachypodium distachyon [annual false brome]
ref|NP_001031768.1|  pantothenate kinase 2                              325   1e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002991207.1|  hypothetical protein SELMODRAFT_161467             311   4e-98    
ref|XP_002991270.1|  hypothetical protein SELMODRAFT_269774             311   5e-98    
pir||T05410  hypothetical protein F10M6.180 - Arabidopsis thaliana      314   7e-98 
ref|XP_001768632.1|  predicted protein                                  303   5e-95    
ref|XP_001757682.1|  predicted protein                                  296   5e-91    
pir||T04627  hypothetical protein F10N7.10 - Arabidopsis thaliana...    273   4e-89 
gb|KHN18454.1|  Pantothenate kinase 2                                   249   5e-74    Glycine soja [wild soybean]
ref|XP_003056202.1|  pantothenate kinase                                237   5e-69    Micromonas pusilla CCMP1545
ref|XP_005849803.1|  hypothetical protein CHLNCDRAFT_34679              231   5e-67    Chlorella variabilis
ref|XP_002507494.1|  pantothenate kinase                                228   2e-65    Micromonas commoda
ref|XP_003078604.1|  eukaryotic pantothenate kinase family protei...    225   1e-64    Ostreococcus tauri
ref|XP_001417152.1|  predicted protein                                  224   1e-64    Ostreococcus lucimarinus CCE9901
ref|XP_011395801.1|  Pantothenate kinase 2                              219   1e-62    Auxenochlorella protothecoides
ref|XP_005649526.1|  fumble-domain-containing protein                   218   5e-62    Coccomyxa subellipsoidea C-169
gb|EMT07573.1|  Pantothenate kinase 2                                   208   6e-59    
gb|EMS60500.1|  Pantothenate kinase 2                                   208   1e-58    Triticum urartu
ref|XP_001692949.1|  predicted protein                                  202   3e-57    Chlamydomonas reinhardtii
ref|XP_002951581.1|  hypothetical protein VOLCADRAFT_61514              199   1e-55    Volvox carteri f. nagariensis
emb|CDP12422.1|  unnamed protein product                                193   1e-53    Coffea canephora [robusta coffee]
gb|KJB53155.1|  hypothetical protein B456_008G295400                    188   7e-52    Gossypium raimondii
ref|XP_007512793.1|  predicted protein                                  183   2e-49    Bathycoccus prasinos
emb|CDP12421.1|  unnamed protein product                                159   7e-45    Coffea canephora [robusta coffee]
ref|XP_002593150.1|  hypothetical protein BRAFLDRAFT_72767              158   6e-41    Branchiostoma floridae
ref|XP_002593157.1|  hypothetical protein BRAFLDRAFT_72760              157   9e-41    Branchiostoma floridae
ref|XP_004531491.1|  PREDICTED: pantothenate kinase 4-like              149   2e-39    Ceratitis capitata [medfly]
ref|XP_010784124.1|  PREDICTED: pantothenate kinase 4 isoform X1        153   4e-39    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_007900304.1|  PREDICTED: pantothenate kinase 4 isoform X1        153   4e-39    Callorhinchus milii [Australian ghost shark]
ref|XP_007900305.1|  PREDICTED: pantothenate kinase 4 isoform X2        153   4e-39    Callorhinchus milii [Australian ghost shark]
ref|XP_005729718.1|  PREDICTED: pantothenate kinase 4-like              153   4e-39    Pundamilia nyererei
ref|XP_010784125.1|  PREDICTED: pantothenate kinase 4 isoform X2        153   4e-39    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_008957661.1|  PREDICTED: pantothenate kinase 4                   151   4e-39    Pan paniscus [bonobo]
ref|XP_004547490.1|  PREDICTED: pantothenate kinase 4-like isofor...    152   7e-39    
ref|XP_005469711.1|  PREDICTED: pantothenate kinase 4-like isofor...    151   7e-39    Oreochromis niloticus
ref|XP_004547489.1|  PREDICTED: pantothenate kinase 4-like isofor...    152   7e-39    
ref|XP_002051981.1|  GJ24127                                            148   8e-39    Drosophila virilis
gb|KDR11647.1|  hypothetical protein L798_13976                         150   1e-38    Zootermopsis nevadensis
ref|XP_005469709.1|  PREDICTED: pantothenate kinase 4-like isofor...    151   1e-38    Oreochromis niloticus
ref|XP_003447770.1|  PREDICTED: pantothenate kinase 4-like isofor...    151   1e-38    Oreochromis niloticus
dbj|BAE72988.1|  hypothetical protein                                   150   2e-38    Macaca fascicularis [crab eating macaque]
ref|XP_006782994.1|  PREDICTED: pantothenate kinase 4-like isofor...    151   2e-38    Neolamprologus brichardi [lyretail cichlid]
ref|NP_001127619.1|  pantothenate kinase 4                              151   2e-38    Pongo abelii [orang utan]
ref|XP_006782993.1|  PREDICTED: pantothenate kinase 4-like isofor...    151   2e-38    Neolamprologus brichardi [lyretail cichlid]
ref|XP_010374471.1|  PREDICTED: LOW QUALITY PROTEIN: pantothenate...    151   2e-38    Rhinopithecus roxellana
ref|XP_008305151.1|  PREDICTED: pantothenate kinase 4 isoform X2        151   2e-38    Stegastes partitus
ref|XP_005917899.1|  PREDICTED: LOW QUALITY PROTEIN: pantothenate...    151   2e-38    
ref|XP_008305150.1|  PREDICTED: pantothenate kinase 4 isoform X1        151   2e-38    Stegastes partitus
ref|XP_009445038.1|  PREDICTED: pantothenate kinase 4 isoform X2        150   2e-38    Pan troglodytes
ref|XP_524846.3|  PREDICTED: pantothenate kinase 4 isoform X1           151   2e-38    Pan troglodytes
ref|XP_004024565.1|  PREDICTED: pantothenate kinase 4                   149   3e-38    
ref|XP_009212778.1|  PREDICTED: pantothenate kinase 4 isoform X1        150   3e-38    
emb|CBN80684.1|  Pantothenate kinase 4                                  150   3e-38    Dicentrarchus labrax [European sea bass]
ref|XP_011482908.1|  PREDICTED: pantothenate kinase 4                   149   3e-38    
ref|XP_003891046.1|  PREDICTED: pantothenate kinase 4 isoform X2        150   4e-38    Papio anubis [baboon]
ref|XP_007979099.1|  PREDICTED: pantothenate kinase 4 isoform X1        150   4e-38    Chlorocebus sabaeus
emb|CDQ63015.1|  unnamed protein product                                150   4e-38    Oncorhynchus mykiss
ref|XP_002801781.1|  PREDICTED: pantothenate kinase 4                   150   4e-38    
gb|EHH14245.1|  hypothetical protein EGK_00136                          150   4e-38    Macaca mulatta [rhesus macaque]
gb|EHH49476.1|  hypothetical protein EGM_00139                          150   4e-38    Macaca fascicularis [crab eating macaque]
ref|XP_010880004.1|  PREDICTED: pantothenate kinase 4 isoform X5        150   5e-38    Esox lucius
ref|XP_010880001.1|  PREDICTED: pantothenate kinase 4 isoform X2        150   5e-38    Esox lucius
ref|XP_010880000.1|  PREDICTED: pantothenate kinase 4 isoform X1        150   5e-38    Esox lucius
ref|XP_010880002.1|  PREDICTED: pantothenate kinase 4 isoform X3        150   5e-38    Esox lucius
sp|Q4R4U1.2|PANK4_MACFA  RecName: Full=Pantothenate kinase 4; Alt...    150   5e-38    Macaca fascicularis [crab eating macaque]
ref|NP_001270249.1|  pantothenate kinase 4                              150   5e-38    Macaca fascicularis [crab eating macaque]
ref|XP_010880003.1|  PREDICTED: pantothenate kinase 4 isoform X4        150   5e-38    Esox lucius
ref|XP_003279784.1|  PREDICTED: pantothenate kinase 4                   150   6e-38    
ref|XP_001962564.1|  GF14376                                            145   6e-38    
ref|XP_007228568.1|  PREDICTED: pantothenate kinase 4-like isofor...    148   6e-38    
ref|XP_001086116.2|  PREDICTED: pantothenate kinase 4 isoform 2         150   6e-38    Macaca mulatta [rhesus macaque]
ref|XP_001356515.2|  GA19161                                            145   7e-38    
ref|XP_002014710.1|  GL18804                                            145   9e-38    
ref|XP_002001690.1|  GI16988                                            145   9e-38    Drosophila mojavensis
ref|XP_011187412.1|  PREDICTED: pantothenate kinase 4                   145   1e-37    Zeugodacus cucurbitae [melon fruit fly]
ref|XP_010727835.1|  PREDICTED: pantothenate kinase 4 isoform X1        149   1e-37    
ref|XP_010727836.1|  PREDICTED: pantothenate kinase 4 isoform X2        149   1e-37    
ref|XP_007943625.1|  PREDICTED: pantothenate kinase 4                   148   2e-37    Orycteropus afer afer
ref|XP_007228566.1|  PREDICTED: pantothenate kinase 4-like isofor...    148   2e-37    
ref|XP_007228565.1|  PREDICTED: pantothenate kinase 4-like isofor...    148   2e-37    
ref|XP_007228567.1|  PREDICTED: pantothenate kinase 4-like isofor...    148   2e-37    
ref|XP_001520417.3|  PREDICTED: pantothenate kinase 4                   146   2e-37    
ref|XP_008998534.1|  PREDICTED: pantothenate kinase 4                   148   2e-37    
ref|XP_011431671.1|  PREDICTED: pantothenate kinase 4-like              148   2e-37    Crassostrea gigas
ref|XP_009304208.1|  PREDICTED: pantothenate kinase 4 isoform X8        144   2e-37    
dbj|BAG58281.1|  unnamed protein product                                148   2e-37    Homo sapiens [man]
sp|Q9NVE7.1|PANK4_HUMAN  RecName: Full=Pantothenate kinase 4; Sho...    148   2e-37    Homo sapiens [man]
dbj|BAD97266.1|  pantothenate kinase 4 variant                          148   2e-37    Homo sapiens [man]
ref|XP_001619295.1|  hypothetical protein NEMVEDRAFT_v1g151759          142   2e-37    Nematostella vectensis
ref|NP_060686.2|  pantothenate kinase 4                                 148   2e-37    
ref|XP_006642013.1|  PREDICTED: pantothenate kinase 4-like              148   3e-37    Lepisosteus oculatus
ref|XP_006885881.1|  PREDICTED: pantothenate kinase 4 isoform X2        147   3e-37    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_006871793.1|  PREDICTED: pantothenate kinase 4                   148   3e-37    Chrysochloris asiatica
ref|XP_006885880.1|  PREDICTED: pantothenate kinase 4 isoform X1        147   3e-37    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_005645866.1|  hypothetical protein COCSUDRAFT_53962              144   3e-37    Coccomyxa subellipsoidea C-169
dbj|BAG64233.1|  unnamed protein product                                147   3e-37    Homo sapiens [man]
ref|XP_004473587.1|  PREDICTED: pantothenate kinase 4                   147   3e-37    
ref|XP_003939688.1|  PREDICTED: pantothenate kinase 4                   147   4e-37    Saimiri boliviensis boliviensis
ref|XP_006299387.1|  hypothetical protein CARUB_v10015546mg             143   4e-37    Capsella rubella
ref|XP_004425561.1|  PREDICTED: pantothenate kinase 4                   147   4e-37    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_001989026.1|  GH11492                                            143   4e-37    Drosophila grimshawi
ref|XP_003793256.1|  PREDICTED: pantothenate kinase 4 isoform 2         147   4e-37    
ref|XP_003413554.1|  PREDICTED: pantothenate kinase 4                   147   5e-37    Loxodonta africana [African bush elephant]
ref|XP_004384378.1|  PREDICTED: pantothenate kinase 4                   147   5e-37    Trichechus manatus latirostris
ref|XP_004705533.1|  PREDICTED: pantothenate kinase 4                   147   6e-37    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_003793255.1|  PREDICTED: pantothenate kinase 4 isoform 1         147   6e-37    Otolemur garnettii
ref|XP_004596209.1|  PREDICTED: pantothenate kinase 4                   146   7e-37    Ochotona princeps [southern American pika]
emb|CAC09438.1|  hypothetical protein                                   147   7e-37    Homo sapiens [man]
ref|XP_011200749.1|  PREDICTED: pantothenate kinase 4                   142   7e-37    Bactrocera dorsalis [papaya fruit fly]
ref|XP_008319266.1|  PREDICTED: pantothenate kinase 4 isoform X3        147   8e-37    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008319264.1|  PREDICTED: pantothenate kinase 4 isoform X1        146   8e-37    
ref|XP_008067465.1|  PREDICTED: pantothenate kinase 4                   146   9e-37    
ref|XP_004319339.1|  PREDICTED: pantothenate kinase 4                   145   1e-36    
ref|XP_005811885.1|  PREDICTED: pantothenate kinase 4-like              146   1e-36    
ref|XP_002886109.1|  hypothetical protein ARALYDRAFT_900074             142   1e-36    Arabidopsis lyrata subsp. lyrata
ref|XP_007547099.1|  PREDICTED: pantothenate kinase 4                   146   1e-36    Poecilia formosa
ref|XP_006161261.1|  PREDICTED: pantothenate kinase 4                   146   1e-36    
ref|XP_008407352.1|  PREDICTED: pantothenate kinase 4 isoform X1        145   1e-36    Poecilia reticulata
ref|XP_008407353.1|  PREDICTED: pantothenate kinase 4 isoform X2        145   1e-36    Poecilia reticulata
ref|XP_004272348.1|  PREDICTED: pantothenate kinase 4                   145   2e-36    Orcinus orca [Orca]
ref|XP_004607250.1|  PREDICTED: pantothenate kinase 4                   145   2e-36    Sorex araneus [Eurasian shrew]
ref|XP_008508488.1|  PREDICTED: pantothenate kinase 4                   145   2e-36    Equus przewalskii [Przewalski horse]
ref|XP_008123957.1|  PREDICTED: pantothenate kinase 4                   139   2e-36    Anolis carolinensis [Carolina anole]
ref|XP_007449007.1|  PREDICTED: pantothenate kinase 4                   145   2e-36    Lipotes vexillifer [baiji]
ref|NP_608907.1|  CG5828, isoform A                                     141   3e-36    Drosophila melanogaster
ref|XP_009304206.1|  PREDICTED: pantothenate kinase 4 isoform X6        144   3e-36    Danio rerio [leopard danio]
ref|XP_009304205.1|  PREDICTED: pantothenate kinase 4 isoform X5        144   3e-36    Danio rerio [leopard danio]
ref|XP_008319265.1|  PREDICTED: pantothenate kinase 4 isoform X2        144   4e-36    
ref|XP_002037921.1|  GM18528                                            140   4e-36    Drosophila sechellia
gb|AAM52026.1|  RE73673p                                                141   4e-36    Drosophila melanogaster
ref|XP_001968771.1|  GG25052                                            140   5e-36    
ref|XP_005155852.1|  PREDICTED: pantothenate kinase 4 isoform X2        144   5e-36    Danio rerio [leopard danio]
ref|XP_009304204.1|  PREDICTED: pantothenate kinase 4 isoform X3        144   5e-36    Danio rerio [leopard danio]
ref|XP_005155853.1|  PREDICTED: pantothenate kinase 4 isoform X4        144   5e-36    Danio rerio [leopard danio]
ref|XP_009304203.1|  PREDICTED: pantothenate kinase 4 isoform X1        144   5e-36    
ref|XP_004768800.1|  PREDICTED: pantothenate kinase 4                   144   5e-36    Mustela putorius furo [black ferret]
ref|XP_002078206.1|  GD23321                                            140   6e-36    
ref|XP_002088669.1|  GE11338                                            140   6e-36    
ref|XP_008575565.1|  PREDICTED: pantothenate kinase 4                   144   6e-36    Galeopterus variegatus [Malayan flying lemur]
ref|XP_010515184.1|  PREDICTED: uncharacterized protein At2g17340...    139   7e-36    Camelina sativa [gold-of-pleasure]
ref|XP_011229536.1|  PREDICTED: pantothenate kinase 4                   144   7e-36    
gb|EFB20669.1|  hypothetical protein PANDA_013754                       144   8e-36    Ailuropoda melanoleuca
ref|XP_536718.2|  PREDICTED: pantothenate kinase 4                      144   8e-36    Canis lupus familiaris [dogs]
ref|XP_008150047.1|  PREDICTED: pantothenate kinase 4                   144   8e-36    
ref|XP_011282738.1|  PREDICTED: pantothenate kinase 4                   144   8e-36    
ref|XP_001366436.1|  PREDICTED: pantothenate kinase 4                   144   8e-36    Monodelphis domestica
ref|XP_010515176.1|  PREDICTED: uncharacterized protein At2g17340...    140   8e-36    Camelina sativa [gold-of-pleasure]
ref|XP_005184448.1|  PREDICTED: pantothenate kinase 4                   139   9e-36    Musca domestica
ref|XP_006746516.1|  PREDICTED: pantothenate kinase 4                   143   9e-36    Leptonychotes weddellii
ref|XP_004407420.1|  PREDICTED: pantothenate kinase 4                   143   9e-36    Odobenus rosmarus divergens
ref|XP_004013820.1|  PREDICTED: pantothenate kinase 4                   143   1e-35    
ref|XP_009011203.1|  hypothetical protein HELRODRAFT_109215             144   1e-35    Helobdella robusta
ref|XP_007529566.1|  PREDICTED: pantothenate kinase 4 isoform X2        143   1e-35    Erinaceus europaeus [common hedgehog]
ref|XP_005850909.1|  hypothetical protein CHLNCDRAFT_19893              139   1e-35    Chlorella variabilis
ref|XP_005143769.1|  PREDICTED: pantothenate kinase 4                   142   2e-35    
ref|XP_003397673.1|  PREDICTED: pantothenate kinase 4-like              143   2e-35    
ref|XP_010022564.1|  PREDICTED: pantothenate kinase 4                   142   2e-35    Nestor notabilis
ref|XP_007529565.1|  PREDICTED: pantothenate kinase 4 isoform X1        143   2e-35    Erinaceus europaeus [common hedgehog]
ref|XP_009053272.1|  hypothetical protein LOTGIDRAFT_116077             142   2e-35    Lottia gigantea
gb|EFN73794.1|  Pantothenate kinase 4                                   142   2e-35    Camponotus floridanus
ref|XP_005079304.1|  PREDICTED: pantothenate kinase 4                   142   2e-35    Mesocricetus auratus [Syrian golden hamster]
gb|EMP25953.1|  Pantothenate kinase 4                                   142   2e-35    Chelonia mydas [green seaturtle]
ref|XP_005339283.1|  PREDICTED: pantothenate kinase 4                   142   2e-35    Ictidomys tridecemlineatus
ref|NP_766578.2|  pantothenate kinase 4                                 142   2e-35    Mus musculus [mouse]
gb|EDL14988.1|  pantothenate kinase 4, isoform CRA_b                    142   2e-35    Mus musculus [mouse]
gb|EDL81281.1|  pantothenate kinase 4                                   142   2e-35    Rattus norvegicus [brown rat]
sp|Q80YV4.2|PANK4_MOUSE  RecName: Full=Pantothenate kinase 4; Sho...    142   2e-35    Mus musculus [mouse]
ref|XP_011264108.1|  PREDICTED: LOW QUALITY PROTEIN: pantothenate...    142   2e-35    
gb|ERE82712.1|  pantothenate kinase 4-like protein                      142   2e-35    Cricetulus griseus [Chinese hamsters]
ref|XP_001952497.2|  PREDICTED: pantothenate kinase 4                   142   3e-35    Acyrthosiphon pisum
ref|XP_010848515.1|  PREDICTED: pantothenate kinase 4                   142   3e-35    Bison bison bison
gb|EDL14987.1|  pantothenate kinase 4, isoform CRA_a                    142   3e-35    Mus musculus [mouse]
ref|XP_003973095.1|  PREDICTED: pantothenate kinase 4-like              142   3e-35    
ref|XP_006044710.1|  PREDICTED: pantothenate kinase 4 isoform X2        142   3e-35    Bubalus bubalis [domestic water buffalo]
gb|AAH50089.1|  Pank4 protein                                           142   3e-35    Mus musculus [mouse]
gb|AAI61366.1|  LOC100145609 protein                                    142   3e-35    Xenopus tropicalis [western clawed frog]
ref|XP_005368706.1|  PREDICTED: pantothenate kinase 4                   142   3e-35    Microtus ochrogaster [prairie voles]
ref|XP_005888905.1|  PREDICTED: pantothenate kinase 4                   142   3e-35    Bos mutus
ref|XP_006044709.1|  PREDICTED: pantothenate kinase 4 isoform X1        142   3e-35    Bubalus bubalis [domestic water buffalo]
tpg|DAA21103.1|  TPA: pantothenate kinase 4                             142   3e-35    Bos taurus [bovine]
ref|NP_001076898.1|  pantothenate kinase 4                              142   3e-35    Bos taurus [bovine]
ref|NP_001120490.2|  pantothenate kinase 4                              142   3e-35    Xenopus tropicalis [western clawed frog]
gb|ELR61337.1|  Pantothenate kinase 4                                   142   3e-35    Bos mutus
ref|XP_006124733.1|  PREDICTED: pantothenate kinase 4 isoform X2        142   4e-35    
ref|XP_006016264.1|  PREDICTED: pantothenate kinase 4                   142   4e-35    
ref|XP_007070231.1|  PREDICTED: pantothenate kinase 4-like              142   4e-35    Chelonia mydas [green seaturtle]
ref|XP_003488881.1|  PREDICTED: pantothenate kinase 4-like              142   4e-35    
ref|XP_006561827.1|  PREDICTED: pantothenate kinase 4 isoform X5        142   4e-35    
ref|XP_002500562.1|  predicted protein                                  138   4e-35    Micromonas commoda
ref|XP_005969935.1|  PREDICTED: pantothenate kinase 4                   141   5e-35    Pantholops hodgsonii [Tibetan antelope]
ref|XP_003356172.1|  PREDICTED: pantothenate kinase 4                   141   5e-35    Sus scrofa [pigs]
gb|EHJ77585.1|  hypothetical protein KGM_11112                          137   5e-35    
ref|XP_005690904.1|  PREDICTED: pantothenate kinase 4                   142   5e-35    
ref|XP_006992456.1|  PREDICTED: pantothenate kinase 4                   141   6e-35    Peromyscus maniculatus bairdii
gb|AAS76704.1|  At2g17320                                               137   6e-35    
gb|ENN72915.1|  hypothetical protein YQE_10483                          137   6e-35    
ref|NP_179324.2|  uncharacterized protein                               137   6e-35    
ref|XP_010081712.1|  PREDICTED: pantothenate kinase 4                   140   7e-35    
ref|XP_008850873.1|  PREDICTED: pantothenate kinase 4                   141   7e-35    
ref|XP_010003582.1|  PREDICTED: pantothenate kinase 4                   140   8e-35    
ref|XP_010163632.1|  PREDICTED: pantothenate kinase 4                   140   9e-35    
ref|XP_009925769.1|  PREDICTED: pantothenate kinase 4                   140   9e-35    
ref|XP_009947817.1|  PREDICTED: pantothenate kinase 4                   140   9e-35    
ref|XP_010305525.1|  PREDICTED: pantothenate kinase 4                   140   9e-35    
ref|XP_008946743.1|  PREDICTED: pantothenate kinase 4                   140   9e-35    
ref|XP_006273041.1|  PREDICTED: pantothenate kinase 4-like              138   9e-35    
ref|XP_009968346.1|  PREDICTED: pantothenate kinase 4                   140   9e-35    
ref|XP_009513199.1|  PREDICTED: pantothenate kinase 4                   140   9e-35    
ref|XP_004657776.1|  PREDICTED: pantothenate kinase 4 isoform X1        140   1e-34    
ref|XP_010141607.1|  PREDICTED: pantothenate kinase 4                   140   1e-34    
ref|XP_009873641.1|  PREDICTED: pantothenate kinase 4                   140   1e-34    
ref|XP_009981936.1|  PREDICTED: pantothenate kinase 4                   140   1e-34    
ref|XP_011375648.1|  PREDICTED: pantothenate kinase 4                   140   1e-34    
ref|XP_010127500.1|  PREDICTED: pantothenate kinase 4                   140   1e-34    
ref|XP_009887980.1|  PREDICTED: pantothenate kinase 4                   140   1e-34    
ref|XP_006680154.1|  hypothetical protein BATDEDRAFT_89522              140   1e-34    
ref|XP_010285963.1|  PREDICTED: pantothenate kinase 4                   140   1e-34    
ref|XP_002424875.1|  Pantothenate kinase, putative                      140   1e-34    
ref|XP_009816817.1|  PREDICTED: pantothenate kinase 4                   140   1e-34    
ref|XP_009646432.1|  PREDICTED: pantothenate kinase 4                   140   1e-34    
ref|XP_009704664.1|  PREDICTED: pantothenate kinase 4                   140   1e-34    
ref|XP_009573293.1|  PREDICTED: pantothenate kinase 4                   140   1e-34    
ref|XP_011340652.1|  PREDICTED: pantothenate kinase 4                   140   1e-34    
ref|XP_003513896.1|  PREDICTED: pantothenate kinase 4                   140   1e-34    
ref|XP_009459274.1|  PREDICTED: pantothenate kinase 4                   140   1e-34    
ref|XP_005437801.1|  PREDICTED: pantothenate kinase 4                   140   1e-34    
emb|CDQ56526.1|  unnamed protein product                                141   1e-34    
ref|XP_009909569.1|  PREDICTED: pantothenate kinase 4 isoform X1        140   1e-34    
ref|XP_005238064.1|  PREDICTED: pantothenate kinase 4                   140   1e-34    
ref|XP_009491245.1|  PREDICTED: pantothenate kinase 4                   140   1e-34    
ref|XP_010208574.1|  PREDICTED: LOW QUALITY PROTEIN: pantothenate...    140   1e-34    
gb|KFQ45402.1|  Pantothenate kinase 4                                   140   1e-34    
ref|XP_006196653.1|  PREDICTED: pantothenate kinase 4 isoform X1        140   1e-34    
ref|XP_010575773.1|  PREDICTED: pantothenate kinase 4 isoform X3        140   1e-34    
gb|ELK19609.1|  Pantothenate kinase 4                                   140   1e-34    
ref|XP_008501814.1|  PREDICTED: pantothenate kinase 4                   140   1e-34    
ref|XP_009932758.1|  PREDICTED: pantothenate kinase 4                   140   1e-34    
ref|XP_006903979.1|  PREDICTED: pantothenate kinase 4                   140   1e-34    
ref|NP_598215.1|  pantothenate kinase 4                                 140   2e-34    
ref|XP_005057670.1|  PREDICTED: pantothenate kinase 4 isoform X2        140   2e-34    
ref|XP_010955938.1|  PREDICTED: LOW QUALITY PROTEIN: pantothenate...    140   2e-34    
ref|XP_005528415.1|  PREDICTED: pantothenate kinase 4 isoform X2        140   2e-34    
ref|XP_009071830.1|  PREDICTED: pantothenate kinase 4                   139   2e-34    
ref|XP_006196654.1|  PREDICTED: pantothenate kinase 4 isoform X2        140   2e-34    
ref|XP_005427701.1|  PREDICTED: LOW QUALITY PROTEIN: pantothenate...    140   2e-34    
ref|NP_001231841.1|  pantothenate kinase 4                              140   2e-34    
ref|XP_008799277.1|  PREDICTED: uncharacterized protein At2g17340...    134   2e-34    
ref|XP_006124732.1|  PREDICTED: pantothenate kinase 4 isoform X1        139   2e-34    
ref|XP_002867075.1|  hypothetical protein ARALYDRAFT_491111             136   2e-34    
gb|AAM63225.1|  unknown                                                 136   2e-34    
ref|NP_001231842.1|  pantothenate kinase 4                              139   2e-34    
ref|XP_008927013.1|  PREDICTED: pantothenate kinase 4                   139   3e-34    
ref|XP_005492690.1|  PREDICTED: pantothenate kinase 4                   137   3e-34    
ref|XP_010467503.1|  PREDICTED: uncharacterized protein At2g17340...    135   3e-34    
ref|NP_567984.1|  uncharacterized protein                               135   3e-34    
ref|XP_010575777.1|  PREDICTED: pantothenate kinase 4 isoform X6        138   3e-34    
ref|XP_003461550.1|  PREDICTED: pantothenate kinase 4                   139   3e-34    
ref|XP_010404154.1|  PREDICTED: pantothenate kinase 4                   138   3e-34    
gb|ELT88727.1|  hypothetical protein CAPTEDRAFT_118737                  139   3e-34    
ref|XP_003056890.1|  predicted protein                                  135   3e-34    
dbj|BAC34450.1|  unnamed protein product                                139   4e-34    
ref|XP_006283971.1|  hypothetical protein CARUB_v10005094mg             135   4e-34    
ref|XP_006610072.1|  PREDICTED: pantothenate kinase 4-like isofor...    139   4e-34    
ref|XP_008639464.1|  PREDICTED: LOW QUALITY PROTEIN: pantothenate...    139   4e-34    
ref|XP_003690310.1|  PREDICTED: LOW QUALITY PROTEIN: pantothenate...    139   4e-34    
ref|XP_005404224.1|  PREDICTED: pantothenate kinase 4 isoform X3        138   4e-34    
gb|EOB07531.1|  Pantothenate kinase 4                                   138   5e-34    
gb|KFU95410.1|  Pantothenate kinase 4                                   138   5e-34    
gb|KFO76652.1|  Pantothenate kinase 4                                   138   5e-34    
gb|KFV15236.1|  Pantothenate kinase 4                                   138   5e-34    
ref|XP_005404223.1|  PREDICTED: pantothenate kinase 4 isoform X2        139   5e-34    
ref|XP_009559871.1|  PREDICTED: pantothenate kinase 4                   138   5e-34    
ref|XP_005057671.1|  PREDICTED: pantothenate kinase 4 isoform X3        138   5e-34    
ref|XP_001863122.1|  pantothenate kinase 4                              133   5e-34    
ref|XP_010626079.1|  PREDICTED: pantothenate kinase 4 isoform X2        138   5e-34    
ref|XP_010626078.1|  PREDICTED: pantothenate kinase 4 isoform X1        139   6e-34    
ref|XP_005057669.1|  PREDICTED: pantothenate kinase 4 isoform X1        139   6e-34    
ref|XP_009909570.1|  PREDICTED: pantothenate kinase 4 isoform X2        138   6e-34    
ref|XP_005404222.1|  PREDICTED: pantothenate kinase 4 isoform X1        138   6e-34    
ref|XP_005011144.1|  PREDICTED: pantothenate kinase 4                   138   6e-34    
ref|XP_005528416.1|  PREDICTED: pantothenate kinase 4 isoform X3        137   6e-34    
gb|KFK30177.1|  hypothetical protein AALP_AA7G227700                    135   6e-34    
gb|KFZ55737.1|  Pantothenate kinase 4                                   138   6e-34    
gb|KFP28712.1|  Pantothenate kinase 4                                   138   7e-34    
gb|KGL96989.1|  Pantothenate kinase 4                                   138   7e-34    
ref|XP_010575776.1|  PREDICTED: pantothenate kinase 4 isoform X5        137   7e-34    
gb|KFP53306.1|  Pantothenate kinase 4                                   138   7e-34    
gb|KFV79555.1|  Pantothenate kinase 4                                   138   7e-34    
gb|KFP60469.1|  Pantothenate kinase 4                                   138   7e-34    
gb|KFV55377.1|  Pantothenate kinase 4                                   138   7e-34    
gb|KFW85890.1|  Pantothenate kinase 4                                   138   7e-34    
ref|XP_009669970.1|  PREDICTED: pantothenate kinase 4                   138   7e-34    
gb|KFQ10871.1|  Pantothenate kinase 4                                   138   7e-34    
gb|KFM04076.1|  Pantothenate kinase 4                                   138   7e-34    
gb|KFR10569.1|  Pantothenate kinase 4                                   138   7e-34    
gb|KFP10534.1|  Pantothenate kinase 4                                   138   7e-34    
gb|KFQ93749.1|  Pantothenate kinase 4                                   138   7e-34    
gb|KFQ39396.1|  Pantothenate kinase 4                                   138   7e-34    
gb|KFQ23078.1|  Pantothenate kinase 4                                   138   7e-34    
gb|KFP38681.1|  Pantothenate kinase 4                                   138   7e-34    
ref|XP_010446932.1|  PREDICTED: uncharacterized protein At2g17340...    134   7e-34    
gb|KFO94211.1|  Pantothenate kinase 4                                   138   7e-34    
ref|XP_010432289.1|  PREDICTED: uncharacterized protein At2g17340...    134   7e-34    
gb|KFP81805.1|  Pantothenate kinase 4                                   138   7e-34    
gb|KFW02749.1|  Pantothenate kinase 4                                   137   8e-34    
ref|XP_010188273.1|  PREDICTED: pantothenate kinase 4                   138   8e-34    
ref|XP_009318835.1|  PREDICTED: pantothenate kinase 4                   138   8e-34    
ref|XP_010575771.1|  PREDICTED: pantothenate kinase 4 isoform X1        138   8e-34    
ref|XP_006561823.1|  PREDICTED: pantothenate kinase 4 isoform X1        138   8e-34    
gb|KFQ75559.1|  Pantothenate kinase 4                                   138   8e-34    
ref|XP_004639656.1|  PREDICTED: pantothenate kinase 4                   138   9e-34    
ref|XP_009272502.1|  PREDICTED: pantothenate kinase 4                   138   9e-34    
ref|XP_005292819.1|  PREDICTED: pantothenate kinase 4                   138   9e-34    
ref|XP_010575775.1|  PREDICTED: pantothenate kinase 4 isoform X4        138   9e-34    
ref|XP_003700068.1|  PREDICTED: pantothenate kinase 4-like              139   9e-34    
gb|KFV63523.1|  Pantothenate kinase 4                                   138   9e-34    
gb|KFQ48702.1|  Pantothenate kinase 4                                   137   1e-33    
ref|XP_004933776.1|  PREDICTED: pantothenate kinase 4-like              134   1e-33    
ref|XP_009093945.1|  PREDICTED: pantothenate kinase 4                   137   1e-33    
ref|XP_010575772.1|  PREDICTED: pantothenate kinase 4 isoform X2        138   1e-33    
ref|XP_005528414.1|  PREDICTED: pantothenate kinase 4 isoform X1        137   1e-33    
gb|KFP08332.1|  Pantothenate kinase 4                                   137   1e-33    
ref|XP_010721167.1|  PREDICTED: pantothenate kinase 4                   137   1e-33    
ref|XP_011166367.1|  PREDICTED: pantothenate kinase 4                   137   1e-33    
gb|KFP72021.1|  Pantothenate kinase 4                                   137   1e-33    
ref|XP_006409325.1|  hypothetical protein EUTSA_v10022748mg             134   2e-33    
gb|KFW84962.1|  Pantothenate kinase 4                                   137   2e-33    
gb|KFZ57411.1|  Pantothenate kinase 4                                   137   2e-33    
ref|XP_004880439.1|  PREDICTED: pantothenate kinase 4                   137   2e-33    
ref|XP_004863846.1|  PREDICTED: pantothenate kinase 4 isoform X1        137   2e-33    
ref|XP_008204439.1|  PREDICTED: pantothenate kinase 4 isoform X2        137   2e-33    
ref|XP_008204438.1|  PREDICTED: pantothenate kinase 4 isoform X1        137   2e-33    
ref|XP_010928425.1|  PREDICTED: uncharacterized protein At2g17340...    133   3e-33    
ref|XP_008799268.1|  PREDICTED: uncharacterized protein At2g17340...    133   3e-33    
ref|XP_004338527.1|  pantothenate kinase, putative                      133   3e-33    
ref|XP_005514434.1|  PREDICTED: pantothenate kinase 4                   136   3e-33    
ref|XP_010223585.1|  PREDICTED: pantothenate kinase 4                   136   3e-33    
gb|KGL84572.1|  Pantothenate kinase 4                                   136   3e-33    
gb|EMC79375.1|  Pantothenate kinase 4                                   136   3e-33    
ref|XP_011298123.1|  PREDICTED: pantothenate kinase 4                   136   4e-33    
gb|ERL90334.1|  hypothetical protein D910_07683                         136   5e-33    
emb|CDP14484.1|  unnamed protein product                                132   6e-33    
ref|XP_011501587.1|  PREDICTED: pantothenate kinase 4                   135   6e-33    
gb|KFK40120.1|  hypothetical protein AALP_AA3G333000                    132   6e-33    
ref|XP_009102804.1|  PREDICTED: uncharacterized protein At2g17340       132   6e-33    
ref|XP_006412112.1|  hypothetical protein EUTSA_v10025517mg             132   7e-33    
ref|XP_006299401.1|  hypothetical protein CARUB_v10015561mg             132   7e-33    
ref|XP_010147228.1|  PREDICTED: pantothenate kinase 4                   134   7e-33    
ref|XP_969975.2|  PREDICTED: pantothenate kinase 4                      131   8e-33    
ref|XP_006610071.1|  PREDICTED: pantothenate kinase 4-like isofor...    135   9e-33    
ref|XP_002064615.1|  GK23730                                            131   9e-33    
emb|CDX69133.1|  BnaC01g03200D                                          132   9e-33    
ref|XP_005102785.1|  PREDICTED: pantothenate kinase 4-like              135   1e-32    
ref|XP_010270546.1|  PREDICTED: uncharacterized protein At2g17340       131   1e-32    
gb|KIZ07002.1|  hypothetical protein MNEG_0947                          131   1e-32    
ref|XP_007427172.1|  PREDICTED: pantothenate kinase 4 isoform X1        134   2e-32    
ref|XP_009341504.1|  PREDICTED: uncharacterized protein At2g17340...    131   2e-32    
gb|ETN87160.1|  hypothetical protein NECAME_00019                       129   2e-32    
ref|XP_008544605.1|  PREDICTED: pantothenate kinase 4                   134   2e-32    
ref|XP_009150844.1|  PREDICTED: uncharacterized protein At2g17340...    130   2e-32    
ref|XP_008382502.1|  PREDICTED: uncharacterized protein At2g17340...    130   2e-32    
emb|CDY07861.1|  BnaC03g47610D                                          130   2e-32    
ref|XP_009340789.1|  PREDICTED: uncharacterized protein At2g17340...    130   2e-32    
ref|XP_011154324.1|  PREDICTED: pantothenate kinase 4                   134   2e-32    
ref|NP_001242288.1|  uncharacterized protein LOC100804454               130   2e-32    
ref|XP_011052880.1|  PREDICTED: pantothenate kinase 4 isoform X2        134   3e-32    
ref|XP_009150843.1|  PREDICTED: uncharacterized protein At2g17340...    130   3e-32    
ref|XP_011052879.1|  PREDICTED: pantothenate kinase 4 isoform X1        134   3e-32    
ref|XP_010467504.1|  PREDICTED: uncharacterized protein At2g17340       130   4e-32    
ref|XP_008357317.1|  PREDICTED: uncharacterized protein At2g17340...    130   4e-32    
ref|XP_006299544.1|  hypothetical protein CARUB_v10015717mg             130   4e-32    
ref|XP_007606831.1|  PREDICTED: LOW QUALITY PROTEIN: pantothenate...    133   5e-32    
ref|XP_005996661.1|  PREDICTED: pantothenate kinase 4                   133   5e-32    
ref|XP_009417292.1|  PREDICTED: uncharacterized protein At2g17340...    129   6e-32    
ref|XP_002886110.1|  hypothetical protein ARALYDRAFT_480618             129   7e-32    
ref|XP_003075229.1|  unnamed protein product                            129   9e-32    
emb|CEG01152.1|  Domain of unknown function DUF89                       129   9e-32    
ref|XP_002436967.1|  hypothetical protein SORBIDRAFT_10g012720          129   1e-31    
gb|KEH26450.1|  pantothenate kinase                                     128   1e-31    
gb|KJB79744.1|  hypothetical protein B456_013G064800                    127   2e-31    
gb|KEH26451.1|  pantothenate kinase                                     128   2e-31    
gb|KJB79745.1|  hypothetical protein B456_013G064800                    127   2e-31    
ref|XP_006849981.1|  hypothetical protein AMTR_s00022p00158890          128   2e-31    
gb|AES75860.2|  pantothenate kinase                                     128   2e-31    
pdb|1XFI|A  Chain A, X-Ray Structure Of Gene Product From Arabido...    128   2e-31    
ref|NP_565412.1|  uncharacterized protein                               127   3e-31    
gb|KJB79741.1|  hypothetical protein B456_013G064800                    127   3e-31    
ref|XP_010530975.1|  PREDICTED: uncharacterized protein At2g17340       127   3e-31    
ref|XP_001652140.1|  AAEL006648-PA                                      127   3e-31    
ref|XP_007152408.1|  hypothetical protein PHAVU_004G127600g             127   3e-31    
gb|KJB79743.1|  hypothetical protein B456_013G064800                    127   3e-31    
ref|XP_010928426.1|  PREDICTED: uncharacterized protein At2g17340...    127   4e-31    
ref|XP_004347393.1|  pantothenate kinase 4                              130   4e-31    
ref|XP_003622335.1|  hypothetical protein MTR_7g034660                  127   4e-31    
gb|AAM63619.1|  unknown                                                 127   4e-31    
gb|KJE93934.1|  pantothenate kinase 4, variant                          130   5e-31    
gb|AFK47314.1|  unknown                                                 127   5e-31    
ref|XP_009333785.1|  PREDICTED: uncharacterized protein At2g17340...    127   5e-31    
gb|EMS50340.1|  hypothetical protein TRIUR3_18240                       127   6e-31    
gb|KEH42822.1|  pantothenate kinase                                     127   7e-31    
ref|XP_011040827.1|  PREDICTED: uncharacterized protein At2g17340...    126   8e-31    
ref|XP_001416328.1|  predicted protein                                  124   9e-31    
ref|XP_001752572.1|  predicted protein                                  126   1e-30    
ref|XP_006384863.1|  pantothenate kinase-related family protein         126   1e-30    
ref|NP_001149554.1|  pantothenate kinase 4                              125   2e-30    
ref|XP_007043093.1|  Uncharacterized protein TCM_007589                 125   2e-30    
gb|KCW62358.1|  hypothetical protein EUGRSUZ_H04996                     125   2e-30    
ref|XP_319230.4|  AGAP010073-PA                                         125   2e-30    
gb|EXX62049.1|  pantothenate kinase                                     128   2e-30    
gb|ESA02283.1|  hypothetical protein GLOINDRAFT_337485                  128   2e-30    
gb|EXX73217.1|  pantothenate kinase                                     128   2e-30    
ref|XP_011088725.1|  PREDICTED: uncharacterized protein At2g17340       125   2e-30    
ref|XP_004996233.1|  pantothenate kinase 4                              129   2e-30    
ref|XP_004495428.1|  PREDICTED: uncharacterized protein At2g17340...    125   3e-30    
gb|EMT20744.1|  hypothetical protein F775_10157                         125   3e-30    



>ref|XP_009600890.1| PREDICTED: pantothenate kinase 2 [Nicotiana tomentosiformis]
 ref|XP_009600891.1| PREDICTED: pantothenate kinase 2 [Nicotiana tomentosiformis]
Length=908

 Score =   378 bits (970),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 199/209 (95%), Positives = 203/209 (97%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREFHFFDAYRTIKQRENEASLAVLPDLL+ELD M 
Sbjct  600  RLMEEPAAYGKLGLANLLELREECLREFHFFDAYRTIKQRENEASLAVLPDLLLELDSMT  659

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            E+MRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSR KMQRPWRVDDFD FKER
Sbjct  660  EDMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRKKMQRPWRVDDFDAFKER  719

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGSGE KP+PHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM
Sbjct  720  MLGSGERKPQPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  779

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVAEAAKHC ILRGAAEAGGLLVDA
Sbjct  780  ELPDIVAEAAKHCDILRGAAEAGGLLVDA  808



>ref|XP_006344398.1| PREDICTED: pantothenate kinase 2-like isoform X1 [Solanum tuberosum]
 ref|XP_006344399.1| PREDICTED: pantothenate kinase 2-like isoform X2 [Solanum tuberosum]
 ref|XP_006344400.1| PREDICTED: pantothenate kinase 2-like isoform X3 [Solanum tuberosum]
Length=901

 Score =   377 bits (968),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 198/209 (95%), Positives = 203/209 (97%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREFHFFDAYRTIKQRENEASLAVLPDLLMELD + 
Sbjct  593  RLMEEPAAYGKLGLANLLELREECLREFHFFDAYRTIKQRENEASLAVLPDLLMELDSLT  652

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            E+MRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSR KMQRPWRVDDFD FKER
Sbjct  653  EDMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRKKMQRPWRVDDFDAFKER  712

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGSG+ KP+PHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM
Sbjct  713  MLGSGDRKPQPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  772

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVAEAAKHC ILRGAAEAGGLLVDA
Sbjct  773  ELPDIVAEAAKHCDILRGAAEAGGLLVDA  801



>ref|XP_009793998.1| PREDICTED: pantothenate kinase 2 isoform X2 [Nicotiana sylvestris]
Length=908

 Score =   376 bits (965),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 198/209 (95%), Positives = 202/209 (97%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREFHFFDAYRTIKQRENEASLAVLPDLL+ELD M 
Sbjct  600  RLMEEPAAYGKLGLANLLELREECLREFHFFDAYRTIKQRENEASLAVLPDLLLELDSMT  659

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            E+MRLL LIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSR KMQRPWRVDDFD FKER
Sbjct  660  EDMRLLALIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRKKMQRPWRVDDFDAFKER  719

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGSGE KP+PHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM
Sbjct  720  MLGSGERKPQPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  779

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVAEAAKHC ILRGAAEAGGLLVDA
Sbjct  780  ELPDIVAEAAKHCDILRGAAEAGGLLVDA  808



>ref|XP_004236210.1| PREDICTED: pantothenate kinase 2 [Solanum lycopersicum]
 ref|XP_010318982.1| PREDICTED: pantothenate kinase 2 [Solanum lycopersicum]
Length=901

 Score =   375 bits (963),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 197/209 (94%), Positives = 202/209 (97%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREFHFFDAYRTIKQRENEASLAVLPDLLMELD + 
Sbjct  593  RLMEEPAAYGKLGLANLLELREECLREFHFFDAYRTIKQRENEASLAVLPDLLMELDSLT  652

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            E+MRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSR KMQRPWRVDDFD FKER
Sbjct  653  EDMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRKKMQRPWRVDDFDAFKER  712

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLG G+ KP+PHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM
Sbjct  713  MLGFGDKKPQPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  772

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVAEAAKHC ILRGAAEAGGLLVDA
Sbjct  773  ELPDIVAEAAKHCDILRGAAEAGGLLVDA  801



>ref|XP_009793996.1| PREDICTED: pantothenate kinase 2 isoform X1 [Nicotiana sylvestris]
Length=932

 Score =   376 bits (965),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 198/209 (95%), Positives = 202/209 (97%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREFHFFDAYRTIKQRENEASLAVLPDLL+ELD M 
Sbjct  624  RLMEEPAAYGKLGLANLLELREECLREFHFFDAYRTIKQRENEASLAVLPDLLLELDSMT  683

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            E+MRLL LIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSR KMQRPWRVDDFD FKER
Sbjct  684  EDMRLLALIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRKKMQRPWRVDDFDAFKER  743

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGSGE KP+PHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM
Sbjct  744  MLGSGERKPQPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  803

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVAEAAKHC ILRGAAEAGGLLVDA
Sbjct  804  ELPDIVAEAAKHCDILRGAAEAGGLLVDA  832



>gb|KHN19303.1| Pantothenate kinase 2 [Glycine soja]
Length=440

 Score =   356 bits (914),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 189/209 (90%), Positives = 198/209 (95%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEP+AYGKLGLA+LLE+REECLREF F DAYR+IKQRENEASLAVLPDLL+ELD M+
Sbjct  132  RLMEEPSAYGKLGLANLLEMREECLREFQFVDAYRSIKQRENEASLAVLPDLLVELDSMD  191

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKM RPWRVDDFD+FKER
Sbjct  192  EESRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMCRPWRVDDFDDFKER  251

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLG+G+ K   HKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM
Sbjct  252  MLGTGDKKMPHHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  311

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVAEAAKHC ILR AAEAGGLLVDA
Sbjct  312  ELPDIVAEAAKHCDILRRAAEAGGLLVDA  340



>gb|EYU42581.1| hypothetical protein MIMGU_mgv1a001050mg [Erythranthe guttata]
Length=904

 Score =   369 bits (948),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 194/209 (93%), Positives = 199/209 (95%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREFHF D YR+IKQRENEASLAVLPDLLMELD MN
Sbjct  596  RLMEEPAAYGKLGLANLLELREECLREFHFHDVYRSIKQRENEASLAVLPDLLMELDSMN  655

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFD FKER
Sbjct  656  EETRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDLFKER  715

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            M  S E +PRP+KRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALND+TAM
Sbjct  716  MFSSAEKRPRPYKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDITAM  775

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVAEAAKHC ILRGAAEAGGLLVDA
Sbjct  776  ELPDIVAEAAKHCDILRGAAEAGGLLVDA  804



>gb|KCW49280.1| hypothetical protein EUGRSUZ_K02840 [Eucalyptus grandis]
Length=906

 Score =   368 bits (945),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 193/209 (92%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGK+GLA+LLELREECLREF F DAYR+IKQRENEASLAVLPDLLMELD M+
Sbjct  598  RLMEEPAAYGKMGLANLLELREECLREFQFVDAYRSIKQRENEASLAVLPDLLMELDSMS  657

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFK+R
Sbjct  658  EETRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKKR  717

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGSG  KPRPH+RALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALND+TAM
Sbjct  718  MLGSGPQKPRPHRRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDITAM  777

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELP+IVAEAAKHC ILR AAEAGGLLVDA
Sbjct  778  ELPEIVAEAAKHCDILRRAAEAGGLLVDA  806



>ref|XP_006477543.1| PREDICTED: pantothenate kinase 2-like [Citrus sinensis]
Length=865

 Score =   367 bits (943),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 193/209 (92%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAYR+IKQRENEASLAVLPDLL+ELD M+
Sbjct  557  RLMEEPAAYGKLGLANLLELREECLREFQFLDAYRSIKQRENEASLAVLPDLLVELDSMS  616

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLL LIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFD FKER
Sbjct  617  EETRLLMLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDAFKER  676

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGSG+ KPRPHKRALLFVDNSGAD+VLGMLPLARELLRRGTEVVLVANSLPALND+TAM
Sbjct  677  MLGSGDNKPRPHKRALLFVDNSGADVVLGMLPLARELLRRGTEVVLVANSLPALNDITAM  736

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVAEAAKHC ILR AAEAGGLLVDA
Sbjct  737  ELPDIVAEAAKHCDILRRAAEAGGLLVDA  765



>ref|XP_010037560.1| PREDICTED: pantothenate kinase 2 [Eucalyptus grandis]
 gb|KCW49279.1| hypothetical protein EUGRSUZ_K02840 [Eucalyptus grandis]
Length=915

 Score =   369 bits (946),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 193/209 (92%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGK+GLA+LLELREECLREF F DAYR+IKQRENEASLAVLPDLLMELD M+
Sbjct  607  RLMEEPAAYGKMGLANLLELREECLREFQFVDAYRSIKQRENEASLAVLPDLLMELDSMS  666

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFK+R
Sbjct  667  EETRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKKR  726

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGSG  KPRPH+RALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALND+TAM
Sbjct  727  MLGSGPQKPRPHRRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDITAM  786

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELP+IVAEAAKHC ILR AAEAGGLLVDA
Sbjct  787  ELPEIVAEAAKHCDILRRAAEAGGLLVDA  815



>gb|KCW49278.1| hypothetical protein EUGRSUZ_K02840 [Eucalyptus grandis]
Length=916

 Score =   369 bits (946),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 193/209 (92%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGK+GLA+LLELREECLREF F DAYR+IKQRENEASLAVLPDLLMELD M+
Sbjct  608  RLMEEPAAYGKMGLANLLELREECLREFQFVDAYRSIKQRENEASLAVLPDLLMELDSMS  667

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFK+R
Sbjct  668  EETRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKKR  727

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGSG  KPRPH+RALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALND+TAM
Sbjct  728  MLGSGPQKPRPHRRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDITAM  787

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELP+IVAEAAKHC ILR AAEAGGLLVDA
Sbjct  788  ELPEIVAEAAKHCDILRRAAEAGGLLVDA  816



>ref|XP_006374524.1| hypothetical protein POPTR_0015s08830g [Populus trichocarpa]
 ref|XP_002322167.2| hypothetical protein POPTR_0015s08830g [Populus trichocarpa]
 gb|ERP52321.1| hypothetical protein POPTR_0015s08830g [Populus trichocarpa]
 gb|EEF06294.2| hypothetical protein POPTR_0015s08830g [Populus trichocarpa]
Length=715

 Score =   363 bits (931),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 192/209 (92%), Positives = 198/209 (95%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F D YR+IKQRENEASLAVLPDLL ELD M 
Sbjct  407  RLMEEPAAYGKLGLANLLELREECLREFQFVDVYRSIKQRENEASLAVLPDLLAELDSMT  466

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACV+LYHKGTIIEIYRMSRNKMQRPWRVDDFD FKER
Sbjct  467  EETRLLTLIEGVLAANIFDWGSRACVELYHKGTIIEIYRMSRNKMQRPWRVDDFDVFKER  526

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGSG+ KPRPHKRALLFVDNSGAD+VLGMLPLARELL+RGTEVVLVANSLPALNDVTAM
Sbjct  527  MLGSGDKKPRPHKRALLFVDNSGADVVLGMLPLARELLQRGTEVVLVANSLPALNDVTAM  586

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVAEAAKHC ILR AAEAGGLLVDA
Sbjct  587  ELPDIVAEAAKHCDILRRAAEAGGLLVDA  615



>ref|XP_010243065.1| PREDICTED: pantothenate kinase 2 isoform X2 [Nelumbo nucifera]
Length=805

 Score =   365 bits (938),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 192/209 (92%), Positives = 199/209 (95%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREFHF DAYR+IKQRENEASLAVLPDLLMELD MN
Sbjct  497  RLMEEPAAYGKLGLANLLELREECLREFHFVDAYRSIKQRENEASLAVLPDLLMELDSMN  556

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLL LIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSR KMQRPW+VDD+D FKER
Sbjct  557  EETRLLALIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRKKMQRPWQVDDYDIFKER  616

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGSGE  PRPH+RALLFVDNSGADIVLGMLPLARELLRRGTEVVL+ANSLPALNDVTAM
Sbjct  617  MLGSGEKNPRPHRRALLFVDNSGADIVLGMLPLARELLRRGTEVVLIANSLPALNDVTAM  676

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELP+IVAEAAKHC ILR AAEAGGLLVDA
Sbjct  677  ELPEIVAEAAKHCDILRKAAEAGGLLVDA  705



>gb|KDO69623.1| hypothetical protein CISIN_1g042742mg [Citrus sinensis]
Length=834

 Score =   366 bits (939),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 192/209 (92%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAYR+IKQRENEASLAVLPDLL+ELD M+
Sbjct  526  RLMEEPAAYGKLGLANLLELREECLREFQFLDAYRSIKQRENEASLAVLPDLLVELDSMS  585

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            +E RLL LIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFD FKER
Sbjct  586  KETRLLMLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDAFKER  645

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGSG+ KPRPHKRALLFVDNSGAD+VLGMLPLARELLRRGTEVVLVANSLPALND+TAM
Sbjct  646  MLGSGDNKPRPHKRALLFVDNSGADVVLGMLPLARELLRRGTEVVLVANSLPALNDITAM  705

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVAEAAKHC ILR AAEAGGLLVDA
Sbjct  706  ELPDIVAEAAKHCDILRRAAEAGGLLVDA  734



>ref|XP_008356598.1| PREDICTED: pantothenate kinase 2-like [Malus domestica]
Length=916

 Score =   368 bits (944),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 194/209 (93%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAYR+IKQRENEASLAVL DLLMELDGM+
Sbjct  608  RLMEEPAAYGKLGLANLLELREECLREFQFVDAYRSIKQRENEASLAVLADLLMELDGMS  667

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFD FKER
Sbjct  668  EEARLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDVFKER  727

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGSG+ KPRPHKRALLFVDNSGAD++LGMLPLARELLRRGTEVVLVANSLPALNDVTAM
Sbjct  728  MLGSGDKKPRPHKRALLFVDNSGADVILGMLPLARELLRRGTEVVLVANSLPALNDVTAM  787

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELP+IVAEAAKHC ILR AAEAGGLLVDA
Sbjct  788  ELPEIVAEAAKHCDILRRAAEAGGLLVDA  816



>ref|XP_008438456.1| PREDICTED: pantothenate kinase 2 [Cucumis melo]
Length=911

 Score =   367 bits (941),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 192/209 (92%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEP AYGKLGLA+LLELREECLREF FFDAYR+IKQRENEASLAVLPDLL+ELD MN
Sbjct  603  RLMEEPTAYGKLGLANLLELREECLREFQFFDAYRSIKQRENEASLAVLPDLLLELDSMN  662

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFD F+ER
Sbjct  663  EEARLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDAFRER  722

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGSG+ +P PHKRALLFVDNSGAD+VLGMLPLARELLRRGTEVVLVANSLPALNDVTAM
Sbjct  723  MLGSGDERPLPHKRALLFVDNSGADVVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  782

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVAEAAKHC ILR AAEAGGL+VDA
Sbjct  783  ELPDIVAEAAKHCDILRRAAEAGGLIVDA  811



>ref|XP_004152477.1| PREDICTED: pantothenate kinase 2-like [Cucumis sativus]
 ref|XP_004167266.1| PREDICTED: pantothenate kinase 2-like [Cucumis sativus]
 gb|KGN64313.1| hypothetical protein Csa_1G046095 [Cucumis sativus]
Length=911

 Score =   367 bits (941),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 192/209 (92%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEP AYGKLGLA+LLELREECLREF FFDAYR+IKQRENEASLAVLPDLL+ELD MN
Sbjct  603  RLMEEPTAYGKLGLANLLELREECLREFQFFDAYRSIKQRENEASLAVLPDLLLELDSMN  662

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFD F+ER
Sbjct  663  EEARLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDAFRER  722

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGSG+ +P PHKRALLFVDNSGAD+VLGMLPLARELLRRGTEVVLVANSLPALNDVTAM
Sbjct  723  MLGSGDERPPPHKRALLFVDNSGADVVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  782

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVAEAAKHC ILR AAEAGGL+VDA
Sbjct  783  ELPDIVAEAAKHCDILRRAAEAGGLIVDA  811



>ref|XP_002511391.1| Pantothenate kinase, putative [Ricinus communis]
 gb|EEF51993.1| Pantothenate kinase, putative [Ricinus communis]
Length=907

 Score =   366 bits (940),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 191/209 (91%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREFHF DAYR+IKQRENEASLAVLPDLL+ELD M 
Sbjct  599  RLMEEPAAYGKLGLANLLELREECLREFHFVDAYRSIKQRENEASLAVLPDLLVELDSMT  658

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFD FKER
Sbjct  659  EETRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDVFKER  718

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLG+G+ KP PHKRALLFVDNSGAD+VLGMLPLARELLRRGTEVVL+ANSLPALNDVTAM
Sbjct  719  MLGAGDKKPHPHKRALLFVDNSGADVVLGMLPLARELLRRGTEVVLIANSLPALNDVTAM  778

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDI+AEAAKHC ILR AAEAGGL+VDA
Sbjct  779  ELPDIIAEAAKHCDILRKAAEAGGLIVDA  807



>ref|XP_002279079.1| PREDICTED: pantothenate kinase 2 [Vitis vinifera]
 ref|XP_010663163.1| PREDICTED: pantothenate kinase 2 [Vitis vinifera]
 ref|XP_010663164.1| PREDICTED: pantothenate kinase 2 [Vitis vinifera]
 ref|XP_010663165.1| PREDICTED: pantothenate kinase 2 [Vitis vinifera]
 ref|XP_010663166.1| PREDICTED: pantothenate kinase 2 [Vitis vinifera]
 ref|XP_010663167.1| PREDICTED: pantothenate kinase 2 [Vitis vinifera]
 ref|XP_010663168.1| PREDICTED: pantothenate kinase 2 [Vitis vinifera]
Length=906

 Score =   366 bits (940),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 193/209 (92%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREFHF DAYR+IKQRENEASLAVLPDLLME+D MN
Sbjct  598  RLMEEPAAYGKLGLANLLELREECLREFHFVDAYRSIKQRENEASLAVLPDLLMEIDSMN  657

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSR KMQRPWRVDDFD F+ER
Sbjct  658  EETRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRKKMQRPWRVDDFDIFEER  717

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGS + KPRPHKRALLFVDNSGAD++LGMLPLARELLRRGTEVVLVANSLPALNDVTAM
Sbjct  718  MLGSEDKKPRPHKRALLFVDNSGADVILGMLPLARELLRRGTEVVLVANSLPALNDVTAM  777

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVAEAAKHC ILR AAEAGGLLVDA
Sbjct  778  ELPDIVAEAAKHCDILRRAAEAGGLLVDA  806



>ref|XP_006439830.1| hypothetical protein CICLE_v10018751mg [Citrus clementina]
 gb|ESR53070.1| hypothetical protein CICLE_v10018751mg [Citrus clementina]
Length=927

 Score =   367 bits (941),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 192/209 (92%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAYR+IKQRENEASLAVLPDLL+ELD M+
Sbjct  619  RLMEEPAAYGKLGLANLLELREECLREFQFLDAYRSIKQRENEASLAVLPDLLVELDSMS  678

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            +E RLL LIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFD FKER
Sbjct  679  KETRLLMLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDAFKER  738

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGSG+ KPRPHKRALLFVDNSGAD+VLGMLPLARELLRRGTEVVLVANSLPALND+TAM
Sbjct  739  MLGSGDNKPRPHKRALLFVDNSGADVVLGMLPLARELLRRGTEVVLVANSLPALNDITAM  798

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVAEAAKHC ILR AAEAGGLLVDA
Sbjct  799  ELPDIVAEAAKHCDILRRAAEAGGLLVDA  827



>ref|XP_006600640.1| PREDICTED: pantothenate kinase 2-like isoform X2 [Glycine max]
Length=901

 Score =   365 bits (938),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 191/209 (91%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA LLE+REECLREFHFFDAY +IKQRENEASLAVLPDLLMELD M+
Sbjct  593  RLMEEPAAYGKLGLARLLEMREECLREFHFFDAYISIKQRENEASLAVLPDLLMELDSMD  652

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFD FK+R
Sbjct  653  EETRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDAFKQR  712

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLG+G+ KP PH+RALLFVDN+GADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM
Sbjct  713  MLGTGDKKPPPHRRALLFVDNAGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  772

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVAEAAKHC ILR AAE+GGLLVDA
Sbjct  773  ELPDIVAEAAKHCDILRRAAESGGLLVDA  801



>ref|XP_006600639.1| PREDICTED: pantothenate kinase 2-like isoform X1 [Glycine max]
Length=902

 Score =   365 bits (938),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 191/209 (91%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA LLE+REECLREFHFFDAY +IKQRENEASLAVLPDLLMELD M+
Sbjct  594  RLMEEPAAYGKLGLARLLEMREECLREFHFFDAYISIKQRENEASLAVLPDLLMELDSMD  653

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFD FK+R
Sbjct  654  EETRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDAFKQR  713

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLG+G+ KP PH+RALLFVDN+GADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM
Sbjct  714  MLGTGDKKPPPHRRALLFVDNAGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  773

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVAEAAKHC ILR AAE+GGLLVDA
Sbjct  774  ELPDIVAEAAKHCDILRRAAESGGLLVDA  802



>ref|XP_007210380.1| hypothetical protein PRUPE_ppa001094mg [Prunus persica]
 gb|EMJ11579.1| hypothetical protein PRUPE_ppa001094mg [Prunus persica]
Length=910

 Score =   365 bits (938),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 193/209 (92%), Positives = 199/209 (95%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAYR+IKQRENEASLAVL DLLMELD M 
Sbjct  602  RLMEEPAAYGKLGLANLLELREECLREFQFVDAYRSIKQRENEASLAVLADLLMELDSMT  661

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFD FKER
Sbjct  662  EETRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDVFKER  721

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGSG+ KPRPHKRALLFVDNSGAD++LGMLPLARELLRRGTEVVLVANSLPALNDVTAM
Sbjct  722  MLGSGDKKPRPHKRALLFVDNSGADVILGMLPLARELLRRGTEVVLVANSLPALNDVTAM  781

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELP+IVAEAAKHC ILR AAEAGGLLVDA
Sbjct  782  ELPEIVAEAAKHCDILRRAAEAGGLLVDA  810



>ref|XP_008239770.1| PREDICTED: pantothenate kinase 2 [Prunus mume]
Length=910

 Score =   365 bits (938),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 193/209 (92%), Positives = 199/209 (95%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAYR+IKQRENEASLAVL DLLMELD M 
Sbjct  602  RLMEEPAAYGKLGLANLLELREECLREFQFVDAYRSIKQRENEASLAVLADLLMELDSMT  661

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFD FKER
Sbjct  662  EETRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDVFKER  721

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGSG+ KPRPHKRALLFVDNSGAD++LGMLPLARELLRRGTEVVLVANSLPALNDVTAM
Sbjct  722  MLGSGDKKPRPHKRALLFVDNSGADVILGMLPLARELLRRGTEVVLVANSLPALNDVTAM  781

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELP+IVAEAAKHC ILR AAEAGGLLVDA
Sbjct  782  ELPEIVAEAAKHCDILRRAAEAGGLLVDA  810



>gb|KJB53157.1| hypothetical protein B456_008G295400 [Gossypium raimondii]
Length=867

 Score =   364 bits (934),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 194/209 (93%), Positives = 199/209 (95%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAYR+IKQRENEASLAVLPDLL+ELD M+
Sbjct  558  RLMEEPAAYGKLGLANLLELREECLREFQFLDAYRSIKQRENEASLAVLPDLLLELDHMD  617

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFD FKER
Sbjct  618  EETRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDLFKER  677

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGS   KPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM
Sbjct  678  MLGSEGKKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  737

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVAEAAKHC +LR AAEAGGLLVDA
Sbjct  738  ELPDIVAEAAKHCDVLRRAAEAGGLLVDA  766



>ref|XP_010243061.1| PREDICTED: pantothenate kinase 2 isoform X1 [Nelumbo nucifera]
 ref|XP_010243063.1| PREDICTED: pantothenate kinase 2 isoform X1 [Nelumbo nucifera]
 ref|XP_010243064.1| PREDICTED: pantothenate kinase 2 isoform X1 [Nelumbo nucifera]
Length=908

 Score =   365 bits (937),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 192/209 (92%), Positives = 199/209 (95%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREFHF DAYR+IKQRENEASLAVLPDLLMELD MN
Sbjct  600  RLMEEPAAYGKLGLANLLELREECLREFHFVDAYRSIKQRENEASLAVLPDLLMELDSMN  659

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLL LIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSR KMQRPW+VDD+D FKER
Sbjct  660  EETRLLALIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRKKMQRPWQVDDYDIFKER  719

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGSGE  PRPH+RALLFVDNSGADIVLGMLPLARELLRRGTEVVL+ANSLPALNDVTAM
Sbjct  720  MLGSGEKNPRPHRRALLFVDNSGADIVLGMLPLARELLRRGTEVVLIANSLPALNDVTAM  779

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELP+IVAEAAKHC ILR AAEAGGLLVDA
Sbjct  780  ELPEIVAEAAKHCDILRKAAEAGGLLVDA  808



>gb|KDP31092.1| hypothetical protein JCGZ_11468 [Jatropha curcas]
Length=911

 Score =   365 bits (937),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 194/209 (93%), Positives = 199/209 (95%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAYR+IKQRENEASLAVLPDLL ELDGM 
Sbjct  603  RLMEEPAAYGKLGLANLLELREECLREFQFVDAYRSIKQRENEASLAVLPDLLTELDGMT  662

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLL LIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSR+KMQRPWRVDDFD FKER
Sbjct  663  EETRLLMLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRDKMQRPWRVDDFDVFKER  722

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGSG+ KPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM
Sbjct  723  MLGSGDNKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  782

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELP+IVAEAAKHC ILR AAEAGGLLVDA
Sbjct  783  ELPEIVAEAAKHCDILRRAAEAGGLLVDA  811



>emb|CBI15019.3| unnamed protein product [Vitis vinifera]
Length=988

 Score =   366 bits (939),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 193/209 (92%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREFHF DAYR+IKQRENEASLAVLPDLLME+D MN
Sbjct  680  RLMEEPAAYGKLGLANLLELREECLREFHFVDAYRSIKQRENEASLAVLPDLLMEIDSMN  739

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSR KMQRPWRVDDFD F+ER
Sbjct  740  EETRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRKKMQRPWRVDDFDIFEER  799

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGS + KPRPHKRALLFVDNSGAD++LGMLPLARELLRRGTEVVLVANSLPALNDVTAM
Sbjct  800  MLGSEDKKPRPHKRALLFVDNSGADVILGMLPLARELLRRGTEVVLVANSLPALNDVTAM  859

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVAEAAKHC ILR AAEAGGLLVDA
Sbjct  860  ELPDIVAEAAKHCDILRRAAEAGGLLVDA  888



>gb|KJB53156.1| hypothetical protein B456_008G295400 [Gossypium raimondii]
 gb|KJB53158.1| hypothetical protein B456_008G295400 [Gossypium raimondii]
Length=922

 Score =   364 bits (935),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 194/209 (93%), Positives = 199/209 (95%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAYR+IKQRENEASLAVLPDLL+ELD M+
Sbjct  613  RLMEEPAAYGKLGLANLLELREECLREFQFLDAYRSIKQRENEASLAVLPDLLLELDHMD  672

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFD FKER
Sbjct  673  EETRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDLFKER  732

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGS   KPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM
Sbjct  733  MLGSEGKKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  792

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVAEAAKHC +LR AAEAGGLLVDA
Sbjct  793  ELPDIVAEAAKHCDVLRRAAEAGGLLVDA  821



>ref|XP_010101220.1| Pantothenate kinase 2 [Morus notabilis]
 gb|EXB87894.1| Pantothenate kinase 2 [Morus notabilis]
Length=912

 Score =   363 bits (933),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 192/209 (92%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEP AYGKLGLA+LLELREECLREF F DAYR+IKQRENEASLAVLPDLLMELD M+
Sbjct  604  RLMEEPTAYGKLGLANLLELREECLREFQFVDAYRSIKQRENEASLAVLPDLLMELDSMS  663

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLY+KGTIIEIYRMSR+KMQRPWRVDDFD FKER
Sbjct  664  EEARLLTLIEGVLAANIFDWGSRACVDLYNKGTIIEIYRMSRDKMQRPWRVDDFDVFKER  723

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGSG+ KPRPHKRALLFVDNSGAD+VLGMLPLARELLRRGTEVVLVANSLPALNDVTAM
Sbjct  724  MLGSGDQKPRPHKRALLFVDNSGADVVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  783

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVAEAAKHC +LR AAEAGGLLVDA
Sbjct  784  ELPDIVAEAAKHCDVLRRAAEAGGLLVDA  812



>ref|XP_011028555.1| PREDICTED: pantothenate kinase 2-like [Populus euphratica]
 ref|XP_011028556.1| PREDICTED: pantothenate kinase 2-like [Populus euphratica]
Length=936

 Score =   364 bits (934),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 192/209 (92%), Positives = 198/209 (95%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F D YR+IKQRENEASLAVLPDLL ELD M 
Sbjct  628  RLMEEPAAYGKLGLANLLELREECLREFQFVDVYRSIKQRENEASLAVLPDLLAELDSMT  687

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACV+LYHKGTIIEIYRMSRNKMQRPWRVDDFD FKER
Sbjct  688  EETRLLTLIEGVLAANIFDWGSRACVELYHKGTIIEIYRMSRNKMQRPWRVDDFDVFKER  747

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGSG+ KPRPHKRALLFVDNSGAD+VLGMLPLARELL+RGTEVVLVANSLPALNDVTAM
Sbjct  748  MLGSGDKKPRPHKRALLFVDNSGADVVLGMLPLARELLQRGTEVVLVANSLPALNDVTAM  807

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVAEAAKHC ILR AAEAGGLLVDA
Sbjct  808  ELPDIVAEAAKHCDILRRAAEAGGLLVDA  836



>ref|XP_011071870.1| PREDICTED: pantothenate kinase 2 [Sesamum indicum]
 ref|XP_011071871.1| PREDICTED: pantothenate kinase 2 [Sesamum indicum]
Length=922

 Score =   363 bits (931),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 191/209 (91%), Positives = 198/209 (95%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREFHF DAYR+IKQRENEASLAVLPDLLME+D M+
Sbjct  613  RLMEEPAAYGKLGLANLLELREECLREFHFLDAYRSIKQRENEASLAVLPDLLMEIDSMD  672

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPW VDDFD FKER
Sbjct  673  EETRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWGVDDFDIFKER  732

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGS   KPR +KRALLFVDNSGAD+VLGMLPLARE LRRGTEVVLVANSLPALNDVTAM
Sbjct  733  MLGSAGKKPRQYKRALLFVDNSGADVVLGMLPLAREFLRRGTEVVLVANSLPALNDVTAM  792

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVAEAAKHC +LRGAAEAGGLLVDA
Sbjct  793  ELPDIVAEAAKHCDVLRGAAEAGGLLVDA  821



>gb|KHG28314.1| hypothetical protein F383_13494 [Gossypium arboreum]
Length=950

 Score =   363 bits (933),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 194/209 (93%), Positives = 199/209 (95%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAYR+IKQRENEASLAVLPDLL+ELD M+
Sbjct  641  RLMEEPAAYGKLGLANLLELREECLREFQFLDAYRSIKQRENEASLAVLPDLLLELDHMD  700

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPW+VDDFD FKER
Sbjct  701  EETRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWQVDDFDLFKER  760

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGS   KPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM
Sbjct  761  MLGSEGKKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  820

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVAEAAKHC ILR AAEAGGLLVDA
Sbjct  821  ELPDIVAEAAKHCDILRRAAEAGGLLVDA  849



>gb|KHG02710.1| hypothetical protein F383_25888 [Gossypium arboreum]
Length=810

 Score =   360 bits (924),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 192/209 (92%), Positives = 198/209 (95%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAYR+IKQRENE SLAVLPDLLMELD M+
Sbjct  502  RLMEEPAAYGKLGLANLLELREECLREFQFLDAYRSIKQRENEVSLAVLPDLLMELDRMD  561

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTII+IYRMSRNKMQRPWRVDDFD F+ER
Sbjct  562  EEARLLTLIEGVLAANIFDWGSRACVDLYHKGTIIDIYRMSRNKMQRPWRVDDFDLFRER  621

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGS   KPRPHKRALLFVDNSGAD+VLGMLPLARELLRRGTEVVLVANSLPALNDVTAM
Sbjct  622  MLGSEGKKPRPHKRALLFVDNSGADVVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  681

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVAEAAKHC ILR AAEAGGLLVDA
Sbjct  682  ELPDIVAEAAKHCDILRRAAEAGGLLVDA  710



>ref|XP_002318651.1| hypothetical protein POPTR_0012s08310g [Populus trichocarpa]
 gb|EEE96871.1| hypothetical protein POPTR_0012s08310g [Populus trichocarpa]
Length=939

 Score =   363 bits (931),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 191/209 (91%), Positives = 198/209 (95%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAYR+IKQRENEASLAVLPDLL+ELD M 
Sbjct  631  RLMEEPAAYGKLGLANLLELREECLREFQFVDAYRSIKQRENEASLAVLPDLLVELDSMT  690

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACV+LYHKGTIIEIYRMSRNKMQRPWRVDDFD FKER
Sbjct  691  EETRLLTLIEGVLAANIFDWGSRACVELYHKGTIIEIYRMSRNKMQRPWRVDDFDAFKER  750

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGSG+ KP PHKRALLFVDNSGAD++LGMLPLARELLR GTEVVLVANSLPALNDVTAM
Sbjct  751  MLGSGDKKPCPHKRALLFVDNSGADVILGMLPLARELLRHGTEVVLVANSLPALNDVTAM  810

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVAEAAKHC ILR AAEAGGLLVDA
Sbjct  811  ELPDIVAEAAKHCDILRRAAEAGGLLVDA  839



>ref|XP_009363012.1| PREDICTED: pantothenate kinase 2 [Pyrus x bretschneideri]
 ref|XP_009363013.1| PREDICTED: pantothenate kinase 2 [Pyrus x bretschneideri]
 ref|XP_009363015.1| PREDICTED: pantothenate kinase 2 [Pyrus x bretschneideri]
Length=915

 Score =   361 bits (927),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 190/209 (91%), Positives = 199/209 (95%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAYR+IKQRENEASLAVL DLLMELD M+
Sbjct  607  RLMEEPAAYGKLGLANLLELREECLREFQFVDAYRSIKQRENEASLAVLADLLMELDSMS  666

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFD FKER
Sbjct  667  EEARLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDVFKER  726

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGSG+ KPRPHKRALLFVDN+GAD++LGMLPLARELLR GTEVVLVANSLPALNDVTAM
Sbjct  727  MLGSGDKKPRPHKRALLFVDNAGADVILGMLPLARELLRHGTEVVLVANSLPALNDVTAM  786

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELP+IVAE+AKHC ILR AAEAGGLLVDA
Sbjct  787  ELPEIVAESAKHCDILRRAAEAGGLLVDA  815



>ref|XP_007036235.1| Pantothenate kinase 2 isoform 2, partial [Theobroma cacao]
 gb|EOY20736.1| Pantothenate kinase 2 isoform 2, partial [Theobroma cacao]
Length=919

 Score =   361 bits (927),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 192/209 (92%), Positives = 198/209 (95%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAYR+IKQRENEASLAVLPDLLMELD M+
Sbjct  623  RLMEEPAAYGKLGLANLLELREECLREFQFHDAYRSIKQRENEASLAVLPDLLMELDCMD  682

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFD FKER
Sbjct  683  EEARLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDLFKER  742

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGS   KP+PH RALLFVDNSGAD+VLGMLPLAREL+RRGTEVVLVANSLPALNDVTAM
Sbjct  743  MLGSEGKKPQPHNRALLFVDNSGADVVLGMLPLARELIRRGTEVVLVANSLPALNDVTAM  802

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVAEAAKHC ILR AAEAGGLLVDA
Sbjct  803  ELPDIVAEAAKHCDILRRAAEAGGLLVDA  831



>gb|KJB39190.1| hypothetical protein B456_007G001600 [Gossypium raimondii]
 gb|KJB39192.1| hypothetical protein B456_007G001600 [Gossypium raimondii]
Length=924

 Score =   361 bits (926),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 192/209 (92%), Positives = 198/209 (95%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAYR+IKQRENE SLAVLPDLLMELD M+
Sbjct  616  RLMEEPAAYGKLGLANLLELREECLREFQFLDAYRSIKQRENEVSLAVLPDLLMELDRMD  675

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTII+IYRMSRNKMQRPWRVDDFD F+ER
Sbjct  676  EEARLLTLIEGVLAANIFDWGSRACVDLYHKGTIIDIYRMSRNKMQRPWRVDDFDLFRER  735

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGS   KPRPHKRALLFVDNSGAD+VLGMLPLARELLRRGTEVVLVANSLPALNDVTAM
Sbjct  736  MLGSEGKKPRPHKRALLFVDNSGADVVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  795

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVAEAAKHC ILR AAEAGGLLVDA
Sbjct  796  ELPDIVAEAAKHCDILRRAAEAGGLLVDA  824



>ref|XP_008393029.1| PREDICTED: pantothenate kinase 2 [Malus domestica]
Length=907

 Score =   360 bits (925),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 190/209 (91%), Positives = 197/209 (94%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGL +LLELREECLREF F DAYR+IKQRENEASLAVL DLLMELD M+
Sbjct  599  RLMEEPAAYGKLGLVNLLELREECLREFQFVDAYRSIKQRENEASLAVLADLLMELDSMS  658

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRAC DLYHKGTIIEIYRMSRNKMQRPWRVDDFD FKER
Sbjct  659  EEARLLTLIEGVLAANIFDWGSRACXDLYHKGTIIEIYRMSRNKMQRPWRVDDFDVFKER  718

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGSG+ KPRPHKRALLFVDNSGAD++LGMLPLARELLRRGTEVVLVANSLPALND TAM
Sbjct  719  MLGSGDXKPRPHKRALLFVDNSGADVILGMLPLARELLRRGTEVVLVANSLPALNDATAM  778

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELP+IVAEAAKHC ILR AAEAGGLLVDA
Sbjct  779  ELPEIVAEAAKHCDILRRAAEAGGLLVDA  807



>ref|XP_011001529.1| PREDICTED: pantothenate kinase 2-like [Populus euphratica]
 ref|XP_011001530.1| PREDICTED: pantothenate kinase 2-like [Populus euphratica]
Length=935

 Score =   360 bits (925),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 190/209 (91%), Positives = 197/209 (94%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAYR+IK RENEASLAVLPDLL+ELD M 
Sbjct  627  RLMEEPAAYGKLGLANLLELREECLREFQFVDAYRSIKHRENEASLAVLPDLLVELDSMT  686

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACV+LYHKGTIIEIYRMSRNKMQRPWRVDDFD FKER
Sbjct  687  EETRLLTLIEGVLAANIFDWGSRACVELYHKGTIIEIYRMSRNKMQRPWRVDDFDAFKER  746

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGSG+ KP PHKRALLFVDNSGAD++LGMLPLARELLR GTEVVLVANSLPALNDVTAM
Sbjct  747  MLGSGDKKPCPHKRALLFVDNSGADVILGMLPLARELLRHGTEVVLVANSLPALNDVTAM  806

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVAEAAKHC ILR AAEAGGLLVDA
Sbjct  807  ELPDIVAEAAKHCDILRRAAEAGGLLVDA  835



>ref|XP_010534230.1| PREDICTED: pantothenate kinase 2 [Tarenaya hassleriana]
 ref|XP_010534231.1| PREDICTED: pantothenate kinase 2 [Tarenaya hassleriana]
 ref|XP_010534232.1| PREDICTED: pantothenate kinase 2 [Tarenaya hassleriana]
Length=923

 Score =   360 bits (924),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 191/209 (91%), Positives = 195/209 (93%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAYR+IKQRENEASLAVLPDLL ELD M+
Sbjct  613  RLMEEPAAYGKLGLANLLELREECLREFQFVDAYRSIKQRENEASLAVLPDLLEELDSMS  672

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFD FKER
Sbjct  673  EEARLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDAFKER  732

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGSG  KP PHKRALLFVDNSGADI+LGMLPLARE LRRGTEVVLVANS PALNDVTAM
Sbjct  733  MLGSGSEKPHPHKRALLFVDNSGADIILGMLPLAREFLRRGTEVVLVANSHPALNDVTAM  792

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVAEAAKHC ILR AAE GGLLVDA
Sbjct  793  ELPDIVAEAAKHCDILRRAAETGGLLVDA  821



>ref|XP_007036234.1| Pantothenate kinase 2 isoform 1 [Theobroma cacao]
 gb|EOY20735.1| Pantothenate kinase 2 isoform 1 [Theobroma cacao]
Length=973

 Score =   361 bits (926),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 192/209 (92%), Positives = 198/209 (95%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAYR+IKQRENEASLAVLPDLLMELD M+
Sbjct  665  RLMEEPAAYGKLGLANLLELREECLREFQFHDAYRSIKQRENEASLAVLPDLLMELDCMD  724

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFD FKER
Sbjct  725  EEARLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDLFKER  784

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGS   KP+PH RALLFVDNSGAD+VLGMLPLAREL+RRGTEVVLVANSLPALNDVTAM
Sbjct  785  MLGSEGKKPQPHNRALLFVDNSGADVVLGMLPLARELIRRGTEVVLVANSLPALNDVTAM  844

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVAEAAKHC ILR AAEAGGLLVDA
Sbjct  845  ELPDIVAEAAKHCDILRRAAEAGGLLVDA  873



>ref|XP_007155432.1| hypothetical protein PHAVU_003G200700g [Phaseolus vulgaris]
 gb|ESW27426.1| hypothetical protein PHAVU_003G200700g [Phaseolus vulgaris]
Length=867

 Score =   358 bits (919),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 189/209 (90%), Positives = 199/209 (95%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA LLE+REECLREFHFFDAY +IKQRENEAS+AVLPDLLMELD ++
Sbjct  559  RLMEEPAAYGKLGLARLLEMREECLREFHFFDAYISIKQRENEASIAVLPDLLMELDSLD  618

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLY KGTIIEIYRMSRNKMQRPWRVDDFD FKER
Sbjct  619  EETRLLTLIEGVLAANIFDWGSRACVDLYLKGTIIEIYRMSRNKMQRPWRVDDFDVFKER  678

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            +LG+G+ KP PH+RALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM
Sbjct  679  ILGTGDKKPPPHRRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  738

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVAEAAKHC ILR AAE+GGLLVDA
Sbjct  739  ELPDIVAEAAKHCDILRRAAESGGLLVDA  767



>ref|XP_003601259.1| Pantothenate kinase [Medicago truncatula]
 gb|AES71510.1| pantothenate kinase [Medicago truncatula]
Length=893

 Score =   358 bits (919),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 188/209 (90%), Positives = 198/209 (95%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEP+AYGKLGLA+LLE+REECLREF F DAYR+IKQRENEASLAVLPDL +ELD M+
Sbjct  586  RLMEEPSAYGKLGLANLLEMREECLREFQFVDAYRSIKQRENEASLAVLPDLFVELDSMD  645

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKM+RPWRVDDFD FKER
Sbjct  646  EETRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMRRPWRVDDFDLFKER  705

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLG+G+ K  PH+RALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM
Sbjct  706  MLGTGDKKKAPHRRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  765

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVAEAAKHC ILR AAEAGGLLVDA
Sbjct  766  ELPDIVAEAAKHCDILRRAAEAGGLLVDA  794



>ref|XP_004298946.1| PREDICTED: pantothenate kinase 2 [Fragaria vesca subsp. vesca]
 ref|XP_011464015.1| PREDICTED: pantothenate kinase 2 [Fragaria vesca subsp. vesca]
Length=908

 Score =   357 bits (916),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 187/209 (89%), Positives = 199/209 (95%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAYR+IKQRENEASLAVLPDLLMELD M+
Sbjct  600  RLMEEPAAYGKLGLANLLELREECLREFQFVDAYRSIKQRENEASLAVLPDLLMELDSMS  659

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE R+L+LIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSR+KMQRPWRVD+FD F++R
Sbjct  660  EETRMLSLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRDKMQRPWRVDNFDAFQKR  719

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            M GSG+ KP PHKRALLFVDNSGAD+VLGMLPLARELLRRGTEVVLVANSLPALNDVTAM
Sbjct  720  MFGSGDKKPCPHKRALLFVDNSGADVVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  779

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELP+IVAEAAKHC ILR AAEAGGLLVDA
Sbjct  780  ELPEIVAEAAKHCDILRRAAEAGGLLVDA  808



>ref|XP_003528148.1| PREDICTED: pantothenate kinase 2-like [Glycine max]
Length=912

 Score =   356 bits (913),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 189/209 (90%), Positives = 198/209 (95%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEP+AYGKLGLA+LLE+REECLREF F DAYR+IKQRENEASLAVLPDLL+ELD M+
Sbjct  604  RLMEEPSAYGKLGLANLLEMREECLREFQFVDAYRSIKQRENEASLAVLPDLLVELDSMD  663

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKM RPWRVDDFD+FKER
Sbjct  664  EESRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMCRPWRVDDFDDFKER  723

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLG+G+ K   HKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM
Sbjct  724  MLGTGDKKMPHHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  783

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVAEAAKHC ILR AAEAGGLLVDA
Sbjct  784  ELPDIVAEAAKHCDILRRAAEAGGLLVDA  812



>gb|ACN39905.1| unknown [Picea sitchensis]
Length=895

 Score =   355 bits (911),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 189/209 (90%), Positives = 196/209 (94%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREFHF DAY+TIKQRENEASLAVL DLLMELD M+
Sbjct  586  RLMEEPAAYGKLGLANLLELREECLREFHFSDAYKTIKQRENEASLAVLQDLLMELDSMD  645

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLL LIEGVLAANIFDWGSRACV+LYHKGTIIEIYRMSR KMQRPWRVD+FD FKER
Sbjct  646  EEKRLLALIEGVLAANIFDWGSRACVELYHKGTIIEIYRMSRKKMQRPWRVDNFDTFKER  705

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGSG  KP+PHKRALLFVDNSGADIVLGMLPL RELLRRGTEVVLVANSLPALNDVTA 
Sbjct  706  MLGSGGEKPKPHKRALLFVDNSGADIVLGMLPLTRELLRRGTEVVLVANSLPALNDVTAS  765

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELP+IVAEAAKHC ILR AAEAGGLLVDA
Sbjct  766  ELPNIVAEAAKHCDILRKAAEAGGLLVDA  794



>ref|XP_010447428.1| PREDICTED: pantothenate kinase 2 isoform X2 [Camelina sativa]
Length=765

 Score =   351 bits (900),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 186/209 (89%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAYR+IKQRENEASLAVLPDLL ELD M+
Sbjct  456  RLMEEPAAYGKLGLANLLELREECLREFQFVDAYRSIKQRENEASLAVLPDLLEELDSMS  515

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWR+DDFD FKER
Sbjct  516  EEARLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRIDDFDAFKER  575

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGSG  +P  HKRALLFVDNSGAD++LGMLPLARE +RRGTEVVLVANSLPALNDVTAM
Sbjct  576  MLGSGGKQPHRHKRALLFVDNSGADVILGMLPLAREFIRRGTEVVLVANSLPALNDVTAM  635

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVA AAKHC ILR AAE GGLLVDA
Sbjct  636  ELPDIVAGAAKHCDILRRAAEMGGLLVDA  664



>ref|XP_004501924.1| PREDICTED: pantothenate kinase 2-like isoform X1 [Cicer arietinum]
 ref|XP_004501925.1| PREDICTED: pantothenate kinase 2-like isoform X2 [Cicer arietinum]
 ref|XP_004501926.1| PREDICTED: pantothenate kinase 2-like isoform X3 [Cicer arietinum]
 ref|XP_004501927.1| PREDICTED: pantothenate kinase 2-like isoform X4 [Cicer arietinum]
Length=910

 Score =   355 bits (910),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 187/209 (89%), Positives = 197/209 (94%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEP+AYGKLGLA+LLE+REECLREF F DAYR+IKQRENEASLAVLPDL +ELD M+
Sbjct  603  RLMEEPSAYGKLGLANLLEMREECLREFQFVDAYRSIKQRENEASLAVLPDLFVELDSMD  662

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKM+RPWRVDDFD FKER
Sbjct  663  EETRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMRRPWRVDDFDVFKER  722

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            ML +G+ K  PH+RALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM
Sbjct  723  MLRTGDKKRPPHRRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  782

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVAEAAKHC ILR AAEAGGLLVDA
Sbjct  783  ELPDIVAEAAKHCDILRRAAEAGGLLVDA  811



>gb|AAM20690.1| putative protein [Arabidopsis thaliana]
Length=870

 Score =   352 bits (904),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 188/209 (90%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAYR+IKQRENEASLAVLPDLL ELD M+
Sbjct  561  RLMEEPAAYGKLGLANLLELREECLREFQFVDAYRSIKQRENEASLAVLPDLLEELDSMS  620

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFD FKER
Sbjct  621  EEARLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDAFKER  680

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGSG  +P  HKRALLFVDNSGAD++LGMLPLARE LRRGTEVVLVANSLPALNDVTAM
Sbjct  681  MLGSGGKQPHRHKRALLFVDNSGADVILGMLPLAREFLRRGTEVVLVANSLPALNDVTAM  740

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVA AAKHC ILR AAE GGLLVDA
Sbjct  741  ELPDIVAGAAKHCDILRRAAEMGGLLVDA  769



>ref|NP_194945.3| pantothenate kinase 2 [Arabidopsis thaliana]
 sp|Q8L5Y9.2|PANK2_ARATH RecName: Full=Pantothenate kinase 2; Short=AtPANK2; AltName: 
Full=Pantothenic acid kinase 2 [Arabidopsis thaliana]
 gb|AEE86015.1| pantothenate kinase 2 [Arabidopsis thaliana]
Length=901

 Score =   353 bits (905),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 188/209 (90%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAYR+IKQRENEASLAVLPDLL ELD M+
Sbjct  592  RLMEEPAAYGKLGLANLLELREECLREFQFVDAYRSIKQRENEASLAVLPDLLEELDSMS  651

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFD FKER
Sbjct  652  EEARLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDAFKER  711

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGSG  +P  HKRALLFVDNSGAD++LGMLPLARE LRRGTEVVLVANSLPALNDVTAM
Sbjct  712  MLGSGGKQPHRHKRALLFVDNSGADVILGMLPLAREFLRRGTEVVLVANSLPALNDVTAM  771

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVA AAKHC ILR AAE GGLLVDA
Sbjct  772  ELPDIVAGAAKHCDILRRAAEMGGLLVDA  800



>ref|XP_002867254.1| ATPANK2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43513.1| ATPANK2 [Arabidopsis lyrata subsp. lyrata]
Length=902

 Score =   353 bits (905),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 188/209 (90%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAYR+IKQRENEASLAVLPDLL ELD M+
Sbjct  593  RLMEEPAAYGKLGLANLLELREECLREFQFVDAYRSIKQRENEASLAVLPDLLEELDSMS  652

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFD FKER
Sbjct  653  EEARLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDAFKER  712

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGSG  +P  HKRALLFVDNSGAD++LGMLPLARE LRRGTEVVLVANSLPALNDVTAM
Sbjct  713  MLGSGGKQPHRHKRALLFVDNSGADVILGMLPLAREFLRRGTEVVLVANSLPALNDVTAM  772

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVA AAKHC ILR AAE GGLLVDA
Sbjct  773  ELPDIVAGAAKHCDILRRAAEMGGLLVDA  801



>ref|XP_009108890.1| PREDICTED: pantothenate kinase 2 [Brassica rapa]
 emb|CDY61390.1| BnaA08g30620D [Brassica napus]
Length=899

 Score =   352 bits (903),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 188/209 (90%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAYR+IKQRENEASLAVLPDLL ELD M 
Sbjct  589  RLMEEPAAYGKLGLANLLELREECLREFQFVDAYRSIKQRENEASLAVLPDLLEELDSMT  648

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFD FKER
Sbjct  649  EEARLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDAFKER  708

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGSG  +P  HKRALLFVDNSGAD++LGMLPLARE LRRGTEVVLVANSLPALNDVTAM
Sbjct  709  MLGSGGKQPHRHKRALLFVDNSGADVILGMLPLAREFLRRGTEVVLVANSLPALNDVTAM  768

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVA AAKHC ILR AAE GGLLVDA
Sbjct  769  ELPDIVAGAAKHCDILRRAAEMGGLLVDA  797



>ref|XP_010940070.1| PREDICTED: pantothenate kinase 2-like isoform X2 [Elaeis guineensis]
Length=908

 Score =   352 bits (902),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 188/209 (90%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAY TIKQRENEASLAVLPDLL+ELD MN
Sbjct  592  RLMEEPAAYGKLGLANLLELREECLREFQFVDAYITIKQRENEASLAVLPDLLIELDSMN  651

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLL LIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSR KMQRPWRVDDFD FK+R
Sbjct  652  EEERLLALIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRKKMQRPWRVDDFDMFKKR  711

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLG G  KP PH+RALLFVDNSGAD+VLGMLPLARELLRRGTEVVLVANSLPALNDVTA 
Sbjct  712  MLGCGAKKPPPHRRALLFVDNSGADVVLGMLPLARELLRRGTEVVLVANSLPALNDVTAN  771

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELP+IVAEAAKHC ILR AAEAGGLLVDA
Sbjct  772  ELPEIVAEAAKHCDILRKAAEAGGLLVDA  800



>emb|CDX68824.1| BnaC01g06290D [Brassica napus]
Length=906

 Score =   352 bits (902),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 188/209 (90%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAYR+IKQRENEASLAVLPDLL ELD MN
Sbjct  594  RLMEEPAAYGKLGLANLLELREECLREFQFLDAYRSIKQRENEASLAVLPDLLEELDSMN  653

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLY KGTIIEIYRMSRNKMQRPWRVDDFD FKER
Sbjct  654  EEARLLTLIEGVLAANIFDWGSRACVDLYRKGTIIEIYRMSRNKMQRPWRVDDFDAFKER  713

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGSG  +P  HKRALLFVDNSGAD++LGMLPLARE LRRGTEVVLVANSLPALNDVTAM
Sbjct  714  MLGSGGKQPHRHKRALLFVDNSGADVILGMLPLAREFLRRGTEVVLVANSLPALNDVTAM  773

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVA AAKHC ILR AAE GGLLVDA
Sbjct  774  ELPDIVAGAAKHCDILRRAAEMGGLLVDA  802



>ref|XP_006840740.1| hypothetical protein AMTR_s00096p00130150 [Amborella trichopoda]
 gb|ERN02415.1| hypothetical protein AMTR_s00096p00130150 [Amborella trichopoda]
Length=919

 Score =   352 bits (902),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 188/209 (90%), Positives = 195/209 (93%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAY TIKQRENEASLAVL DLLMELD M+
Sbjct  606  RLMEEPAAYGKLGLANLLELREECLREFQFSDAYITIKQRENEASLAVLHDLLMELDSMD  665

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLL LIEGVLAANIFDWGSRACVDLYHKGTII+IYRMSR KMQRPWRVDDFD F+ER
Sbjct  666  EETRLLALIEGVLAANIFDWGSRACVDLYHKGTIIDIYRMSRKKMQRPWRVDDFDTFRER  725

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGSG+ KP PH+RALLFVDNSGAD+VLGMLPLARELLRRGTEVVLVANSLPALNDVTA 
Sbjct  726  MLGSGDQKPLPHRRALLFVDNSGADVVLGMLPLARELLRRGTEVVLVANSLPALNDVTAN  785

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVAEAAKHC ILR AAEAGGLLVDA
Sbjct  786  ELPDIVAEAAKHCDILRKAAEAGGLLVDA  814



>ref|XP_010447427.1| PREDICTED: pantothenate kinase 2 isoform X1 [Camelina sativa]
Length=905

 Score =   351 bits (901),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 186/209 (89%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAYR+IKQRENEASLAVLPDLL ELD M+
Sbjct  596  RLMEEPAAYGKLGLANLLELREECLREFQFVDAYRSIKQRENEASLAVLPDLLEELDSMS  655

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWR+DDFD FKER
Sbjct  656  EEARLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRIDDFDAFKER  715

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGSG  +P  HKRALLFVDNSGAD++LGMLPLARE +RRGTEVVLVANSLPALNDVTAM
Sbjct  716  MLGSGGKQPHRHKRALLFVDNSGADVILGMLPLAREFIRRGTEVVLVANSLPALNDVTAM  775

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVA AAKHC ILR AAE GGLLVDA
Sbjct  776  ELPDIVAGAAKHCDILRRAAEMGGLLVDA  804



>ref|XP_010432761.1| PREDICTED: pantothenate kinase 2-like [Camelina sativa]
Length=902

 Score =   351 bits (901),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 187/209 (89%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAYR+IKQRENEASL VLPDLL ELD M+
Sbjct  593  RLMEEPAAYGKLGLANLLELREECLREFQFVDAYRSIKQRENEASLTVLPDLLEELDSMS  652

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFD FKER
Sbjct  653  EEARLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDAFKER  712

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGSG  +P  HKRALLFVDNSGAD++LGMLPLARE LRRGTEVVLVANSLPALNDVTAM
Sbjct  713  MLGSGGKQPHRHKRALLFVDNSGADVILGMLPLAREFLRRGTEVVLVANSLPALNDVTAM  772

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVA AAKHC ILR AAE GGLLVDA
Sbjct  773  ELPDIVAGAAKHCDILRRAAEMGGLLVDA  801



>ref|XP_006282554.1| hypothetical protein CARUB_v10004099mg [Capsella rubella]
 gb|EOA15452.1| hypothetical protein CARUB_v10004099mg [Capsella rubella]
Length=905

 Score =   351 bits (900),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 187/209 (89%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAYR+IKQRENEASL VLPDLL ELD M+
Sbjct  596  RLMEEPAAYGKLGLANLLELREECLREFQFVDAYRSIKQRENEASLTVLPDLLEELDSMS  655

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFD FKER
Sbjct  656  EEARLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDAFKER  715

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGSG  +P  HKRALLFVDNSGAD++LGMLPLARE LRRGTEVVLVANSLPALNDVTAM
Sbjct  716  MLGSGGKQPHRHKRALLFVDNSGADVILGMLPLAREFLRRGTEVVLVANSLPALNDVTAM  775

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVA AAKHC ILR AAE GGLLVDA
Sbjct  776  ELPDIVAGAAKHCDILRRAAEMGGLLVDA  804



>ref|XP_010437940.1| PREDICTED: pantothenate kinase 2-like [Camelina sativa]
Length=902

 Score =   351 bits (900),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 187/209 (89%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAYR+IKQRENEASL VLPDLL ELD M+
Sbjct  593  RLMEEPAAYGKLGLANLLELREECLREFQFVDAYRSIKQRENEASLTVLPDLLEELDSMS  652

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFD FKER
Sbjct  653  EEARLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDAFKER  712

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGSG  +P  HKRALLFVDNSGAD++LGMLPLARE LRRGTEVVLVANSLPALNDVTAM
Sbjct  713  MLGSGGQQPHRHKRALLFVDNSGADVILGMLPLAREFLRRGTEVVLVANSLPALNDVTAM  772

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVA AAKHC ILR AAE GGLLVDA
Sbjct  773  ELPDIVAWAAKHCDILRRAAEMGGLLVDA  801



>ref|XP_007138072.1| hypothetical protein PHAVU_009G178200g [Phaseolus vulgaris]
 ref|XP_007138073.1| hypothetical protein PHAVU_009G178200g [Phaseolus vulgaris]
 gb|ESW10066.1| hypothetical protein PHAVU_009G178200g [Phaseolus vulgaris]
 gb|ESW10067.1| hypothetical protein PHAVU_009G178200g [Phaseolus vulgaris]
Length=915

 Score =   351 bits (900),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 186/209 (89%), Positives = 195/209 (93%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEP+AYGKLGLA+LLE+REECLREF F DAYR+IKQRENEASLAVLPDLL+ELD M+
Sbjct  607  RLMEEPSAYGKLGLANLLEMREECLREFQFVDAYRSIKQRENEASLAVLPDLLVELDSMD  666

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKM+RPWRVDDFD+FKER
Sbjct  667  EESRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMRRPWRVDDFDDFKER  726

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLG    K   HKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM
Sbjct  727  MLGGRNKKNPRHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  786

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDI+AEAAKHC ILR AAE GGLLVDA
Sbjct  787  ELPDIIAEAAKHCDILRRAAEVGGLLVDA  815



>ref|XP_009126332.1| PREDICTED: pantothenate kinase 2 [Brassica rapa]
Length=910

 Score =   350 bits (899),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 187/209 (89%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAYR+IKQRENEASLAVLPDLL ELD MN
Sbjct  598  RLMEEPAAYGKLGLANLLELREECLREFQFLDAYRSIKQRENEASLAVLPDLLEELDSMN  657

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLY KGTIIEIYRMSRNKMQRPWRVDDFD FKER
Sbjct  658  EEARLLTLIEGVLAANIFDWGSRACVDLYRKGTIIEIYRMSRNKMQRPWRVDDFDAFKER  717

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLG+G  +P  HKRALLFVDNSGAD++LGMLPLARE LRRGTEVVLVANSLPALNDVTAM
Sbjct  718  MLGTGGKQPHRHKRALLFVDNSGADVILGMLPLAREFLRRGTEVVLVANSLPALNDVTAM  777

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVA AAKHC ILR AAE GGLLVDA
Sbjct  778  ELPDIVAGAAKHCDILRRAAEMGGLLVDA  806



>ref|XP_010678776.1| PREDICTED: pantothenate kinase 2 [Beta vulgaris subsp. vulgaris]
Length=899

 Score =   350 bits (898),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 188/209 (90%), Positives = 195/209 (93%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLME+PAAYGKLGLA+LLELREECLREF F DAYR+IKQRENEASLAVLPDLL ELDGM+
Sbjct  591  RLMEDPAAYGKLGLANLLELREECLREFQFTDAYRSIKQRENEASLAVLPDLLTELDGMS  650

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RL TLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSR KM+RPWRVDDFD  KER
Sbjct  651  EEDRLFTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRKKMRRPWRVDDFDILKER  710

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGSG  KP PHKRALLFVDNSGAD+VLGMLP ARELLRRGTEVVLVANSLPALNDVTAM
Sbjct  711  MLGSGGKKPPPHKRALLFVDNSGADVVLGMLPFARELLRRGTEVVLVANSLPALNDVTAM  770

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVAEAAK+C ILR AAEAGGLLVDA
Sbjct  771  ELPDIVAEAAKNCDILRRAAEAGGLLVDA  799



>emb|CDX75226.1| BnaA01g04760D [Brassica napus]
Length=910

 Score =   350 bits (898),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 187/209 (89%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAYR+IKQRENEASLAVLPDLL ELD MN
Sbjct  598  RLMEEPAAYGKLGLANLLELREECLREFQFVDAYRSIKQRENEASLAVLPDLLEELDSMN  657

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLY KGTIIEIYRMSRNKMQRPWRVDDFD FKER
Sbjct  658  EEARLLTLIEGVLAANIFDWGSRACVDLYRKGTIIEIYRMSRNKMQRPWRVDDFDAFKER  717

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLG+G  +P  HKRALLFVDNSGAD++LGMLPLARE LRRGTEVVLVANSLPALNDVTAM
Sbjct  718  MLGTGGKQPHRHKRALLFVDNSGADVILGMLPLAREFLRRGTEVVLVANSLPALNDVTAM  777

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVA AAKHC ILR AAE GGLLVDA
Sbjct  778  ELPDIVAGAAKHCDILRRAAEMGGLLVDA  806



>gb|KFK29830.1| hypothetical protein AALP_AA7G184400 [Arabis alpina]
Length=891

 Score =   349 bits (896),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 187/209 (89%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAYR+IKQRENEASLAVLPDLL ELD M+
Sbjct  578  RLMEEPAAYGKLGLANLLELREECLREFQFVDAYRSIKQRENEASLAVLPDLLEELDSMS  637

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFD FKER
Sbjct  638  EEARLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDAFKER  697

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGS   +P  HKRALLFVDNSGAD++LGMLPLARE LRRGTEVVLVANSLPALNDVTAM
Sbjct  698  MLGSDGKQPHRHKRALLFVDNSGADVILGMLPLAREFLRRGTEVVLVANSLPALNDVTAM  757

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVA AAKHC ILR AAE GGLLVDA
Sbjct  758  ELPDIVAGAAKHCDILRRAAEMGGLLVDA  786



>ref|XP_008795923.1| PREDICTED: pantothenate kinase 2-like isoform X2 [Phoenix dactylifera]
 ref|XP_008795924.1| PREDICTED: pantothenate kinase 2-like isoform X2 [Phoenix dactylifera]
Length=909

 Score =   349 bits (895),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 186/209 (89%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAY TIKQRENEASLAVLPDLL+ELD MN
Sbjct  593  RLMEEPAAYGKLGLANLLELREECLREFQFVDAYITIKQRENEASLAVLPDLLIELDSMN  652

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLL LIEGVLAANIFDWGSRACVDLYH+GTIIEIYRMSR KMQRPWRVDDFD FK+R
Sbjct  653  EEERLLALIEGVLAANIFDWGSRACVDLYHEGTIIEIYRMSRKKMQRPWRVDDFDMFKKR  712

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLG G+ KP PH+RALLFVDNSGAD+VLGMLPLARELLRRGTEV LVANSLPALNDVTA 
Sbjct  713  MLGCGDKKPPPHRRALLFVDNSGADVVLGMLPLARELLRRGTEVFLVANSLPALNDVTAN  772

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELP+IVAEAAKHC ILR AAEAGGLLVDA
Sbjct  773  ELPEIVAEAAKHCDILRKAAEAGGLLVDA  801



>ref|XP_008795922.1| PREDICTED: pantothenate kinase 2-like isoform X1 [Phoenix dactylifera]
Length=913

 Score =   349 bits (895),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 186/209 (89%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAY TIKQRENEASLAVLPDLL+ELD MN
Sbjct  593  RLMEEPAAYGKLGLANLLELREECLREFQFVDAYITIKQRENEASLAVLPDLLIELDSMN  652

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLL LIEGVLAANIFDWGSRACVDLYH+GTIIEIYRMSR KMQRPWRVDDFD FK+R
Sbjct  653  EEERLLALIEGVLAANIFDWGSRACVDLYHEGTIIEIYRMSRKKMQRPWRVDDFDMFKKR  712

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLG G+ KP PH+RALLFVDNSGAD+VLGMLPLARELLRRGTEV LVANSLPALNDVTA 
Sbjct  713  MLGCGDKKPPPHRRALLFVDNSGADVVLGMLPLARELLRRGTEVFLVANSLPALNDVTAN  772

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELP+IVAEAAKHC ILR AAEAGGLLVDA
Sbjct  773  ELPEIVAEAAKHCDILRKAAEAGGLLVDA  801



>ref|XP_006412505.1| hypothetical protein EUTSA_v10024357mg [Eutrema salsugineum]
 gb|ESQ53958.1| hypothetical protein EUTSA_v10024357mg [Eutrema salsugineum]
Length=901

 Score =   346 bits (887),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 186/209 (89%), Positives = 192/209 (92%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAYR+IK RENEASLAVLPDLL ELD M+
Sbjct  589  RLMEEPAAYGKLGLANLLELREECLREFQFVDAYRSIKLRENEASLAVLPDLLEELDSMS  648

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFD FKER
Sbjct  649  EEARLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDAFKER  708

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGS   +P  HKRALLFVDNSGAD++LGMLPLARE LRRGTEVVLVANSLPALNDVTAM
Sbjct  709  MLGSVGKQPHRHKRALLFVDNSGADVILGMLPLAREFLRRGTEVVLVANSLPALNDVTAM  768

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVA AAKHC ILR AAE GGLLVDA
Sbjct  769  ELPDIVAGAAKHCDILRRAAEMGGLLVDA  797



>ref|XP_009403915.1| PREDICTED: pantothenate kinase 2 [Musa acuminata subsp. malaccensis]
 ref|XP_009403916.1| PREDICTED: pantothenate kinase 2 [Musa acuminata subsp. malaccensis]
Length=899

 Score =   345 bits (884),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 182/209 (87%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA LLELREECLREF F DAY TIK+RENEASLAVLPDLL+ELD MN
Sbjct  587  RLMEEPAAYGKLGLAKLLELREECLREFQFMDAYITIKERENEASLAVLPDLLIELDSMN  646

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLL LIEGVLAANIFDWGSRACVDLYHKGTII+IYRMSR KMQRPWRVDDFD FKE+
Sbjct  647  EEDRLLALIEGVLAANIFDWGSRACVDLYHKGTIIDIYRMSRKKMQRPWRVDDFDMFKEK  706

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            ML SG+ K +P+KRAL FVDNSGAD+VLGMLPLARELLRRGTEVVLVANSLPALNDVTA+
Sbjct  707  MLSSGDKKSQPYKRALFFVDNSGADVVLGMLPLARELLRRGTEVVLVANSLPALNDVTAL  766

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELP+IVAEAAKHC I+R AAEAGGLL+DA
Sbjct  767  ELPEIVAEAAKHCDIIRKAAEAGGLLMDA  795



>gb|KHN48232.1| Pantothenate kinase 2 [Glycine soja]
Length=868

 Score =   344 bits (882),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 187/209 (89%), Positives = 194/209 (93%), Gaps = 6/209 (3%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEP+AYGKLGLA+LLE+REECLREF F DAYR+IKQRENEASLAVLPDLL+ELD M+
Sbjct  566  RLMEEPSAYGKLGLANLLEMREECLREFQFADAYRSIKQRENEASLAVLPDLLVELDSMD  625

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKM+RPWRVDDFDEFKER
Sbjct  626  EESRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMRRPWRVDDFDEFKER  685

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            M      K   HKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM
Sbjct  686  M------KMPCHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  739

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVAEAAKHC ILR AAEAGGLLVDA
Sbjct  740  ELPDIVAEAAKHCDILRRAAEAGGLLVDA  768



>ref|XP_008782481.1| PREDICTED: pantothenate kinase 2-like [Phoenix dactylifera]
 ref|XP_008782482.1| PREDICTED: pantothenate kinase 2-like [Phoenix dactylifera]
 ref|XP_008782483.1| PREDICTED: pantothenate kinase 2-like [Phoenix dactylifera]
Length=904

 Score =   345 bits (884),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 184/209 (88%), Positives = 195/209 (93%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAY TIK+RENEASLAVLPDLL+ELDGMN
Sbjct  593  RLMEEPAAYGKLGLANLLELREECLREFQFVDAYITIKKRENEASLAVLPDLLIELDGMN  652

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLL LIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSR KMQRPWRVDDFD FK+R
Sbjct  653  EEERLLALIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRKKMQRPWRVDDFDMFKKR  712

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLG G+ K  P++RALLFVDNSGAD+VLGMLPLARELL+RGTEVVLVANSLPALNDVTA 
Sbjct  713  MLGCGDKKLAPYRRALLFVDNSGADVVLGMLPLARELLKRGTEVVLVANSLPALNDVTAN  772

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELP+IVAEAAKHC +LR AAEAGGLLVDA
Sbjct  773  ELPEIVAEAAKHCDVLRKAAEAGGLLVDA  801



>ref|XP_003542534.2| PREDICTED: pantothenate kinase 2-like isoform X1 [Glycine max]
Length=910

 Score =   344 bits (883),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 187/209 (89%), Positives = 194/209 (93%), Gaps = 6/209 (3%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEP+AYGKLGLA+LLE+REECLREF F DAYR+IKQRENEASLAVLPDLL+ELD M+
Sbjct  608  RLMEEPSAYGKLGLANLLEMREECLREFQFADAYRSIKQRENEASLAVLPDLLVELDSMD  667

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKM+RPWRVDDFDEFKER
Sbjct  668  EESRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMRRPWRVDDFDEFKER  727

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            M      K   HKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM
Sbjct  728  M------KMPCHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  781

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVAEAAKHC ILR AAEAGGLLVDA
Sbjct  782  ELPDIVAEAAKHCDILRRAAEAGGLLVDA  810



>ref|XP_006594169.1| PREDICTED: pantothenate kinase 2-like isoform X2 [Glycine max]
Length=920

 Score =   342 bits (877),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 193/208 (93%), Gaps = 6/208 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            LMEEP+AYGKLGLA+LLE+REECLREF F DAYR+IKQRENEASLAVLPDLL+ELD M+E
Sbjct  619  LMEEPSAYGKLGLANLLEMREECLREFQFADAYRSIKQRENEASLAVLPDLLVELDSMDE  678

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKM+RPWRVDDFDEFKERM
Sbjct  679  ESRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMRRPWRVDDFDEFKERM  738

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
                  K   HKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME
Sbjct  739  ------KMPCHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  792

Query  544  LPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            LPDIVAEAAKHC ILR AAEAGGLLVDA
Sbjct  793  LPDIVAEAAKHCDILRRAAEAGGLLVDA  820



>ref|XP_010940068.1| PREDICTED: pantothenate kinase 2-like isoform X1 [Elaeis guineensis]
 ref|XP_010940069.1| PREDICTED: pantothenate kinase 2-like isoform X1 [Elaeis guineensis]
Length=922

 Score =   342 bits (877),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 188/223 (84%), Positives = 194/223 (87%), Gaps = 14/223 (6%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAY TIKQRENEASLAVLPDLL+ELD MN
Sbjct  592  RLMEEPAAYGKLGLANLLELREECLREFQFVDAYITIKQRENEASLAVLPDLLIELDSMN  651

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWR----------  330
            EE RLL LIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSR KMQRPWR          
Sbjct  652  EEERLLALIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRKKMQRPWRASSYRNKDLL  711

Query  331  ----VDDFDEFKERMLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVL  498
                VDDFD FK+RMLG G  KP PH+RALLFVDNSGAD+VLGMLPLARELLRRGTEVVL
Sbjct  712  SKDKVDDFDMFKKRMLGCGAKKPPPHRRALLFVDNSGADVVLGMLPLARELLRRGTEVVL  771

Query  499  VANSLPALNDVTAMELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            VANSLPALNDVTA ELP+IVAEAAKHC ILR AAEAGGLLVDA
Sbjct  772  VANSLPALNDVTANELPEIVAEAAKHCDILRKAAEAGGLLVDA  814



>ref|XP_010936708.1| PREDICTED: pantothenate kinase 2-like [Elaeis guineensis]
Length=903

 Score =   340 bits (871),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 181/209 (87%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAY TIK+RENEASLAVLPDLL+ELD MN
Sbjct  593  RLMEEPAAYGKLGLANLLELREECLREFQFVDAYVTIKKRENEASLAVLPDLLIELDSMN  652

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RL+ LIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSR KMQRPWRVDDFD FK+R
Sbjct  653  EEERLVALIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRKKMQRPWRVDDFDMFKKR  712

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLG G+ K  P++RALLFVDNSGAD+VLGMLPLARELL+RG EVVLVANSLPALNDVTA 
Sbjct  713  MLGCGDKKLSPYRRALLFVDNSGADVVLGMLPLARELLKRGIEVVLVANSLPALNDVTAN  772

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELP+IVAEAAKHC +LR AAEAGGLLVDA
Sbjct  773  ELPEIVAEAAKHCDVLRKAAEAGGLLVDA  801



>dbj|BAD33319.1| putative pantothenate kinase 4 [Oryza sativa Japonica Group]
 dbj|BAD46028.1| putative pantothenate kinase 4 [Oryza sativa Japonica Group]
Length=697

 Score =   335 bits (858),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 180/209 (86%), Positives = 190/209 (91%), Gaps = 2/209 (1%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGK GLA+LLELREECLREF F DAY +IKQRENEASLAVLPDLLMELD MN
Sbjct  391  RLMEEPAAYGKFGLANLLELREECLREFQFVDAYVSIKQRENEASLAVLPDLLMELDSMN  450

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLL LIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSR KMQRPWR+DDFD FK+R
Sbjct  451  EEARLLALIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRKKMQRPWRIDDFDMFKKR  510

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            ML   + K +P+KRALLFVDNSGAD+VLGM+PLARELLR GTEVVLVANSLPALNDVTA 
Sbjct  511  ML--ADKKGQPYKRALLFVDNSGADVVLGMIPLARELLRNGTEVVLVANSLPALNDVTAN  568

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELP IVAEAAKHCGILR AAEAGGL+ DA
Sbjct  569  ELPGIVAEAAKHCGILRKAAEAGGLIFDA  597



>ref|XP_006439829.1| hypothetical protein CICLE_v10018751mg [Citrus clementina]
 gb|ESR53069.1| hypothetical protein CICLE_v10018751mg [Citrus clementina]
Length=828

 Score =   337 bits (863),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 176/191 (92%), Positives = 184/191 (96%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAYR+IKQRENEASLAVLPDLL+ELD M+
Sbjct  619  RLMEEPAAYGKLGLANLLELREECLREFQFLDAYRSIKQRENEASLAVLPDLLVELDSMS  678

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            +E RLL LIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFD FKER
Sbjct  679  KETRLLMLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDAFKER  738

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGSG+ KPRPHKRALLFVDNSGAD+VLGMLPLARELLRRGTEVVLVANSLPALND+TAM
Sbjct  739  MLGSGDNKPRPHKRALLFVDNSGADVVLGMLPLARELLRRGTEVVLVANSLPALNDITAM  798

Query  541  ELPDIVAEAAK  573
            ELPDIVAEAAK
Sbjct  799  ELPDIVAEAAK  809



>ref|NP_001063766.1| Os09g0533100 [Oryza sativa Japonica Group]
 dbj|BAF25680.1| Os09g0533100, partial [Oryza sativa Japonica Group]
Length=755

 Score =   334 bits (857),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 180/209 (86%), Positives = 190/209 (91%), Gaps = 2/209 (1%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGK GLA+LLELREECLREF F DAY +IKQRENEASLAVLPDLLMELD MN
Sbjct  449  RLMEEPAAYGKFGLANLLELREECLREFQFVDAYVSIKQRENEASLAVLPDLLMELDSMN  508

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLL LIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSR KMQRPWR+DDFD FK+R
Sbjct  509  EEARLLALIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRKKMQRPWRIDDFDMFKKR  568

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            ML   + K +P+KRALLFVDNSGAD+VLGM+PLARELLR GTEVVLVANSLPALNDVTA 
Sbjct  569  ML--ADKKGQPYKRALLFVDNSGADVVLGMIPLARELLRNGTEVVLVANSLPALNDVTAN  626

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELP IVAEAAKHCGILR AAEAGGL+ DA
Sbjct  627  ELPGIVAEAAKHCGILRKAAEAGGLIFDA  655



>ref|XP_004957459.1| PREDICTED: pantothenate kinase 2-like [Setaria italica]
Length=897

 Score =   335 bits (860),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 180/209 (86%), Positives = 192/209 (92%), Gaps = 2/209 (1%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGK GLA+LLELREECLREF F DAY +IKQRENEASLAVLPDLLMELD MN
Sbjct  591  RLMEEPAAYGKFGLANLLELREECLREFQFVDAYISIKQRENEASLAVLPDLLMELDSMN  650

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLL LIEGVLAANIFDWGSRACV+LYHKGTIIEIYRMSR KMQRPWR+DDFD FK+R
Sbjct  651  EEARLLALIEGVLAANIFDWGSRACVELYHKGTIIEIYRMSRKKMQRPWRIDDFDMFKKR  710

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            ML   + K +P+KRALLFVDNSGAD+VLGMLPLARELLR GTEVVLVANSLPALNDVTA 
Sbjct  711  ML--TDRKNQPYKRALLFVDNSGADVVLGMLPLARELLRHGTEVVLVANSLPALNDVTAN  768

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELP+I+AEA+KHCGILR AAEAGGLLVDA
Sbjct  769  ELPEIIAEASKHCGILRKAAEAGGLLVDA  797



>gb|EEE70109.1| hypothetical protein OsJ_30119 [Oryza sativa Japonica Group]
Length=872

 Score =   334 bits (856),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 180/209 (86%), Positives = 190/209 (91%), Gaps = 2/209 (1%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGK GLA+LLELREECLREF F DAY +IKQRENEASLAVLPDLLMELD MN
Sbjct  566  RLMEEPAAYGKFGLANLLELREECLREFQFVDAYVSIKQRENEASLAVLPDLLMELDSMN  625

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLL LIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSR KMQRPWR+DDFD FK+R
Sbjct  626  EEARLLALIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRKKMQRPWRIDDFDMFKKR  685

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            ML   + K +P+KRALLFVDNSGAD+VLGM+PLARELLR GTEVVLVANSLPALNDVTA 
Sbjct  686  ML--ADKKGQPYKRALLFVDNSGADVVLGMIPLARELLRNGTEVVLVANSLPALNDVTAN  743

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELP IVAEAAKHCGILR AAEAGGL+ DA
Sbjct  744  ELPGIVAEAAKHCGILRKAAEAGGLIFDA  772



>gb|EEC84941.1| hypothetical protein OsI_32156 [Oryza sativa Indica Group]
Length=903

 Score =   334 bits (857),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 180/209 (86%), Positives = 190/209 (91%), Gaps = 2/209 (1%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGK GLA+LLELREECLREF F DAY +IKQRENEASLAVLPDLLMELD MN
Sbjct  597  RLMEEPAAYGKFGLANLLELREECLREFQFVDAYVSIKQRENEASLAVLPDLLMELDSMN  656

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLL LIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSR KMQRPWR+DDFD FK+R
Sbjct  657  EEARLLALIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRKKMQRPWRIDDFDMFKKR  716

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            ML   + K +P+KRALLFVDNSGAD+VLGM+PLARELLR GTEVVLVANSLPALNDVTA 
Sbjct  717  ML--ADKKGQPYKRALLFVDNSGADVVLGMIPLARELLRNGTEVVLVANSLPALNDVTAN  774

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELP IVAEAAKHCGILR AAEAGGL+ DA
Sbjct  775  ELPGIVAEAAKHCGILRKAAEAGGLIFDA  803



>sp|Q0J035.2|PANK2_ORYSJ RecName: Full=Pantothenate kinase 2; AltName: Full=Pantothenic 
acid kinase 2 [Oryza sativa Japonica Group]
Length=904

 Score =   334 bits (857),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 180/209 (86%), Positives = 190/209 (91%), Gaps = 2/209 (1%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGK GLA+LLELREECLREF F DAY +IKQRENEASLAVLPDLLMELD MN
Sbjct  598  RLMEEPAAYGKFGLANLLELREECLREFQFVDAYVSIKQRENEASLAVLPDLLMELDSMN  657

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLL LIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSR KMQRPWR+DDFD FK+R
Sbjct  658  EEARLLALIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRKKMQRPWRIDDFDMFKKR  717

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            ML   + K +P+KRALLFVDNSGAD+VLGM+PLARELLR GTEVVLVANSLPALNDVTA 
Sbjct  718  ML--ADKKGQPYKRALLFVDNSGADVVLGMIPLARELLRNGTEVVLVANSLPALNDVTAN  775

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELP IVAEAAKHCGILR AAEAGGL+ DA
Sbjct  776  ELPGIVAEAAKHCGILRKAAEAGGLIFDA  804



>ref|XP_006660887.1| PREDICTED: pantothenate kinase 2-like [Oryza brachyantha]
Length=859

 Score =   332 bits (852),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 179/209 (86%), Positives = 189/209 (90%), Gaps = 2/209 (1%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGK GL +LLELREECLREF F DAY +IKQRENEASLAVLPDLLMELD MN
Sbjct  553  RLMEEPAAYGKFGLVNLLELREECLREFQFVDAYVSIKQRENEASLAVLPDLLMELDSMN  612

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLL LIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSR KMQRPWR+DDFD FK+R
Sbjct  613  EEARLLALIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRKKMQRPWRIDDFDMFKKR  672

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            ML   + K +P+KRALLFVDNSGAD+VLGM+PLARELLR GTEVVLVANSLPALNDVTA 
Sbjct  673  ML--TDKKGQPYKRALLFVDNSGADVVLGMIPLARELLRHGTEVVLVANSLPALNDVTAN  730

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELP IVAEAAKHCGILR AAEAGGL+ DA
Sbjct  731  ELPGIVAEAAKHCGILRKAAEAGGLIFDA  759



>ref|XP_002460569.1| hypothetical protein SORBIDRAFT_02g030920 [Sorghum bicolor]
 gb|EER97090.1| hypothetical protein SORBIDRAFT_02g030920 [Sorghum bicolor]
Length=902

 Score =   333 bits (853),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 178/209 (85%), Positives = 191/209 (91%), Gaps = 2/209 (1%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGK GL +LLELREECLREF F DAY +IKQRENEASLAVLPDLLMELD MN
Sbjct  596  RLMEEPAAYGKFGLVNLLELREECLREFQFVDAYISIKQRENEASLAVLPDLLMELDSMN  655

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLL LIEGVLAANIFDWGSRACV+LYHKGTIIEIYRMSR KMQRPWR+DDFD FK+R
Sbjct  656  EEARLLALIEGVLAANIFDWGSRACVELYHKGTIIEIYRMSRKKMQRPWRIDDFDMFKKR  715

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            ML   + K +P+KRALLFVDNSGAD+VLGMLPLARELLRRGTEVVLVANSLPALNDVTA 
Sbjct  716  ML--TDRKDQPYKRALLFVDNSGADVVLGMLPLARELLRRGTEVVLVANSLPALNDVTAN  773

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELP+I+AEA+KHC ILR AAEAGGL+VDA
Sbjct  774  ELPEIIAEASKHCSILRKAAEAGGLIVDA  802



>ref|XP_008652990.1| PREDICTED: pantothenate kinase 2 [Zea mays]
 ref|XP_008652991.1| PREDICTED: pantothenate kinase 2 [Zea mays]
 ref|XP_008652992.1| PREDICTED: pantothenate kinase 2 [Zea mays]
 ref|XP_008652993.1| PREDICTED: pantothenate kinase 2 [Zea mays]
Length=903

 Score =   331 bits (848),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 177/209 (85%), Positives = 191/209 (91%), Gaps = 2/209 (1%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGK GLA+LLELREECLREF F DAY +IKQRENEASLAVLPDLLMELD MN
Sbjct  597  RLMEEPAAYGKFGLANLLELREECLREFQFVDAYISIKQRENEASLAVLPDLLMELDSMN  656

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLL LIEGVLAANIFDWGSRACV+LYHKGTIIEIYRMSR KMQRPWR+DDFD FK+R
Sbjct  657  EEARLLALIEGVLAANIFDWGSRACVELYHKGTIIEIYRMSRKKMQRPWRIDDFDMFKKR  716

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            ML   + K + +KRALLFVDNSGAD+VLGMLPLARELLR GTEVVLVANSLPALNDVTA 
Sbjct  717  ML--TDRKDQSYKRALLFVDNSGADVVLGMLPLARELLRHGTEVVLVANSLPALNDVTAN  774

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELP+++AEA+KHCGILR AAEAGGL+VDA
Sbjct  775  ELPEVIAEASKHCGILRKAAEAGGLIVDA  803



>ref|XP_003576771.1| PREDICTED: pantothenate kinase 2 [Brachypodium distachyon]
Length=912

 Score =   330 bits (846),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 176/209 (84%), Positives = 188/209 (90%), Gaps = 4/209 (2%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGK GLA+LLELREECLREF FFDAY +IKQRENEASLAVLPDLLMELD MN
Sbjct  593  RLMEEPAAYGKFGLANLLELREECLREFQFFDAYVSIKQRENEASLAVLPDLLMELDSMN  652

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLL LIEGVLAANIFDWGS+ACVDLYH+GTIIEIYRMSR KMQRPWR+DDFD FK+R
Sbjct  653  EEARLLALIEGVLAANIFDWGSKACVDLYHQGTIIEIYRMSRKKMQRPWRIDDFDMFKKR  712

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            ML     K +P+KRAL+ VDNSGAD+VLGMLPLARE LR G EVVLVANSLPALND+TA 
Sbjct  713  ML----KKDKPYKRALISVDNSGADVVLGMLPLAREFLRHGIEVVLVANSLPALNDITAN  768

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELP IVAEAAKHCGILR AAEAGGL+VDA
Sbjct  769  ELPGIVAEAAKHCGILRKAAEAGGLIVDA  797



>ref|NP_001031768.1| pantothenate kinase 2 [Arabidopsis thaliana]
 ref|NP_001119092.1| pantothenate kinase 2 [Arabidopsis thaliana]
 gb|AEE86016.1| pantothenate kinase 2 [Arabidopsis thaliana]
 gb|AEE86017.1| pantothenate kinase 2 [Arabidopsis thaliana]
Length=783

 Score =   325 bits (833),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 173/191 (91%), Positives = 179/191 (94%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAYR+IKQRENEASLAVLPDLL ELD M+
Sbjct  592  RLMEEPAAYGKLGLANLLELREECLREFQFVDAYRSIKQRENEASLAVLPDLLEELDSMS  651

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFD FKER
Sbjct  652  EEARLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDAFKER  711

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGSG  +P  HKRALLFVDNSGAD++LGMLPLARE LRRGTEVVLVANSLPALNDVTAM
Sbjct  712  MLGSGGKQPHRHKRALLFVDNSGADVILGMLPLAREFLRRGTEVVLVANSLPALNDVTAM  771

Query  541  ELPDIVAEAAK  573
            ELPDIVA AAK
Sbjct  772  ELPDIVAGAAK  782



>ref|XP_002991207.1| hypothetical protein SELMODRAFT_161467 [Selaginella moellendorffii]
 gb|EFJ07751.1| hypothetical protein SELMODRAFT_161467 [Selaginella moellendorffii]
Length=711

 Score =   311 bits (798),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 167/209 (80%), Positives = 180/209 (86%), Gaps = 5/209 (2%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RL EEPAAYGKLGLA+LLELREECLREFHF DAYR IKQRENEASLAVLPDL  ELD M+
Sbjct  407  RLREEPAAYGKLGLANLLELREECLREFHFTDAYRAIKQRENEASLAVLPDLFSELDTMD  466

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
             E RLLT+IEGVLAANIFDWGSRACV+LY  GTIIEIYRMSRNKMQRPWRVDDFD F+ R
Sbjct  467  TETRLLTIIEGVLAANIFDWGSRACVELYQSGTIIEIYRMSRNKMQRPWRVDDFDAFRNR  526

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
             +       +PH RALLFVDNSGADIVLGMLP ARELLRRGTEVVLVAN+LPA+NDVT M
Sbjct  527  WMSG-----KPHYRALLFVDNSGADIVLGMLPFARELLRRGTEVVLVANTLPAINDVTYM  581

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELP +VA AA HC ILR AA AGG+L++A
Sbjct  582  ELPTVVAAAATHCSILREAAIAGGVLLNA  610



>ref|XP_002991270.1| hypothetical protein SELMODRAFT_269774 [Selaginella moellendorffii]
 gb|EFJ07698.1| hypothetical protein SELMODRAFT_269774 [Selaginella moellendorffii]
Length=696

 Score =   311 bits (796),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 166/209 (79%), Positives = 180/209 (86%), Gaps = 5/209 (2%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RL EEPAAYGKLGLA+LLELREECLREFHF DAYR IKQRENEASLAVLPDL  ELD M+
Sbjct  392  RLREEPAAYGKLGLANLLELREECLREFHFTDAYRAIKQRENEASLAVLPDLFSELDTMD  451

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
             E RLLT+IEGVLAANIFDWGSRACV+LY  GTIIEIYRMSRNKMQRPWRVDDFD F+ R
Sbjct  452  TETRLLTIIEGVLAANIFDWGSRACVELYQSGTIIEIYRMSRNKMQRPWRVDDFDAFRNR  511

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
             +       +PH RALLFVDNSGADIVLGMLP ARELLRRGTEVVLVAN+LPA+NDVT M
Sbjct  512  WMSG-----KPHYRALLFVDNSGADIVLGMLPFARELLRRGTEVVLVANTLPAINDVTYM  566

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELP +VA AA HC ILR AA AGG+L+++
Sbjct  567  ELPTVVAAAATHCSILREAAIAGGVLLNS  595



>pir||T05410 hypothetical protein F10M6.180 - Arabidopsis thaliana
 emb|CAA16972.1| putative protein [Arabidopsis thaliana]
 emb|CAB79936.1| putative protein [Arabidopsis thaliana]
Length=838

 Score =   314 bits (804),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 174/209 (83%), Positives = 179/209 (86%), Gaps = 19/209 (9%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAYR+IKQRENEASLAVLPDLL ELD M+
Sbjct  577  RLMEEPAAYGKLGLANLLELREECLREFQFVDAYRSIKQRENEASLAVLPDLLEELDSMS  636

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFD FKER
Sbjct  637  EEARLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDAFKER  696

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGSG                   D++LGMLPLARE LRRGTEVVLVANSLPALNDVTAM
Sbjct  697  MLGSG-------------------DVILGMLPLAREFLRRGTEVVLVANSLPALNDVTAM  737

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVA AAKHC ILR AAE GGLLVDA
Sbjct  738  ELPDIVAGAAKHCDILRRAAEMGGLLVDA  766



>ref|XP_001768632.1| predicted protein [Physcomitrella patens]
 gb|EDQ66570.1| predicted protein [Physcomitrella patens]
Length=700

 Score =   303 bits (776),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 164/210 (78%), Positives = 178/210 (85%), Gaps = 2/210 (1%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RL EEPAAYG+LGLA+LLE+REECLREFHF D Y  IKQRENEAS+ VLPDLL ELD + 
Sbjct  395  RLREEPAAYGQLGLANLLEMREECLREFHFEDVYLAIKQRENEASMVVLPDLLAELDSLA  454

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
               RLL LIEGVLAANIFDWGSRACV+LY  GTI+EIYRMSRNKM+RPWRVDDFD F  R
Sbjct  455  PSARLLALIEGVLAANIFDWGSRACVELYRSGTILEIYRMSRNKMKRPWRVDDFDSFSRR  514

Query  361  MLGSGETKP--RPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVT  534
            M+   +T    +PHKRALLFVDNSGADIVLGM+PLARELLRRGTEVVLVANSLPA+NDVT
Sbjct  515  MIVDNDTGVPLKPHKRALLFVDNSGADIVLGMIPLARELLRRGTEVVLVANSLPAINDVT  574

Query  535  AMELPDIVAEAAKHCGILRGAAEAGGLLVD  624
            A+ELP IV  AAKHC ILR AA AGGLL D
Sbjct  575  AVELPSIVVAAAKHCEILRRAATAGGLLFD  604



>ref|XP_001757682.1| predicted protein [Physcomitrella patens]
 gb|EDQ77322.1| predicted protein [Physcomitrella patens]
Length=884

 Score =   296 bits (759),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 162/209 (78%), Positives = 177/209 (85%), Gaps = 2/209 (1%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L EEPAAYG+LGLA+LLE+REECLREFHF D Y  IKQRENEAS+ VLPDLL ELD +  
Sbjct  573  LREEPAAYGQLGLANLLEMREECLREFHFQDVYLAIKQRENEASMVVLPDLLAELDSLEP  632

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
              RLL LIEGVLAANIFDWGSRACV+LY  GTI+EIYRMSRNKM+RPWRVDDFD F +RM
Sbjct  633  SARLLALIEGVLAANIFDWGSRACVELYRSGTILEIYRMSRNKMRRPWRVDDFDSFCDRM  692

Query  364  LGSGETKP--RPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTA  537
              +  T    +PHKRALLFVDNSGADIVLGM+PLARELL RGTEVVLVANSLP +NDVTA
Sbjct  693  RVNEITGIPLKPHKRALLFVDNSGADIVLGMIPLARELLMRGTEVVLVANSLPTINDVTA  752

Query  538  MELPDIVAEAAKHCGILRGAAEAGGLLVD  624
            +ELP I+A AAKHC ILR AA AGGLLVD
Sbjct  753  VELPSIIAAAAKHCEILRKAATAGGLLVD  781



>pir||T04627 hypothetical protein F10N7.10 - Arabidopsis thaliana  (fragment)
 emb|CAA16571.1| hypothetical protein [Arabidopsis thaliana]
Length=233

 Score =   273 bits (699),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 134/149 (90%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = +1

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            +E RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFD FKER
Sbjct  28   QEARLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDAFKER  87

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLGSG  +P  HKRALLFVDNSGAD++LGMLPLARE LRRGTEVVLVANSLPALNDVTAM
Sbjct  88   MLGSGGKQPHRHKRALLFVDNSGADVILGMLPLAREFLRRGTEVVLVANSLPALNDVTAM  147

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVA AAKHC ILR AAE GGLLVDA
Sbjct  148  ELPDIVAGAAKHCDILRRAAEMGGLLVDA  176



>gb|KHN18454.1| Pantothenate kinase 2 [Glycine soja]
Length=755

 Score =   249 bits (636),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA LLE+REECLREFHFFDAY +IKQRENEASLAVLPDLLMELD M+
Sbjct  597  RLMEEPAAYGKLGLARLLEMREECLREFHFFDAYISIKQRENEASLAVLPDLLMELDSMD  656

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE  LLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFD FK+R
Sbjct  657  EETTLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDAFKQR  716

Query  361  MLGSGETKPRPHKRALLFVDNSGADIV  441
            MLG+G+ KP PH+RALLFVDN+GAD +
Sbjct  717  MLGTGDKKPPPHRRALLFVDNAGADTI  743



>ref|XP_003056202.1| pantothenate kinase [Micromonas pusilla CCMP1545]
 gb|EEH59578.1| pantothenate kinase [Micromonas pusilla CCMP1545]
Length=928

 Score =   237 bits (605),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 158/202 (78%), Gaps = 1/202 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RL EEP+AYG++GL+ L ELREECLR + F DAY  +K++EN A+LAVLPDL  ELDGM 
Sbjct  626  RLREEPSAYGRIGLSGLFELREECLRAYGFRDAYFQVKKQENAAALAVLPDLFSELDGML  685

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            +E RLL LIEGVLA NIFDWGS++CVDLY+KGT++EIYR +R  + RPW VD FD+F+  
Sbjct  686  DEERLLVLIEGVLAGNIFDWGSQSCVDLYNKGTVLEIYRRARASVARPWAVDCFDKFRAV  745

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
              G+G  +   + +ALLF DNSGADIVLGMLP ARELL+RGT+V LVANSLPA+NDVTA 
Sbjct  746  FFGNG-IRVCQYNKALLFCDNSGADIVLGMLPFARELLKRGTDVCLVANSLPAINDVTAQ  804

Query  541  ELPDIVAEAAKHCGILRGAAEA  606
            EL ++V  AA++C  L  A  A
Sbjct  805  ELREVVHLAAENCKTLTLALSA  826



>ref|XP_005849803.1| hypothetical protein CHLNCDRAFT_34679 [Chlorella variabilis]
 gb|EFN57701.1| hypothetical protein CHLNCDRAFT_34679 [Chlorella variabilis]
Length=815

 Score =   231 bits (588),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 155/203 (76%), Gaps = 5/203 (2%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RL  +P AYG+LGLADL ELREECLREF F D YR    REN A+L VLPDLL ELD M 
Sbjct  513  RLRSKPGAYGQLGLADLFELREECLREFGFADVYRQAAWRENSAALEVLPDLLAELDQMP  572

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKM-QRPWRVDDFDEFKE  357
               RLL L  GVLAANIFDWG++ACVDLY   TI+E+YR +R K+ QRPWRVDDFDEF E
Sbjct  573  PPQRLLAL--GVLAANIFDWGAKACVDLYLNATILEMYREARTKLSQRPWRVDDFDEFAE  630

Query  358  RMLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTA  537
              + S  T   P++R ++FVDN+GAD+VLGMLP ARELLR G EVVLVANSLPA+ND+TA
Sbjct  631  ASINS--TVVSPYQRVMMFVDNAGADVVLGMLPFARELLRMGAEVVLVANSLPAINDITA  688

Query  538  MELPDIVAEAAKHCGILRGAAEA  606
             EL  +VA+AA+ C I+R A +A
Sbjct  689  GELRSVVAKAAEACPIIRAARDA  711



>ref|XP_002507494.1| pantothenate kinase [Micromonas sp. RCC299]
 gb|ACO68752.1| pantothenate kinase [Micromonas sp. RCC299]
Length=940

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 162/221 (73%), Gaps = 18/221 (8%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RL +EPAAYG++GL++LLE+REECLR F F D Y  IKQ+EN A+LAVLPDLL +LD ++
Sbjct  616  RLRDEPAAYGRIGLSELLEMREECLRAFGFKDVYSAIKQQENAAALAVLPDLLADLDVLH  675

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE R+L LIEGVLA NIFDWGS++CVDLY  GTI+EIY+  R+ + RPW VD FD+F+E 
Sbjct  676  EEERVLALIEGVLAGNIFDWGSQSCVDLYKNGTILEIYKNVRSSIARPWAVDCFDDFREA  735

Query  361  MLG---------SGETKPRP---------HKRALLFVDNSGADIVLGMLPLARELLRRGT  486
            +LG          GE + +          +K+AL+F DNSGAD+VLG++P ARELLR+GT
Sbjct  736  LLGIDQQRTTSLVGEKQQQQDVSSVYHSRYKKALVFCDNSGADVVLGIIPFARELLRQGT  795

Query  487  EVVLVANSLPALNDVTAMELPDIVAEAAKHCGILRGAAEAG  609
            +V LVANSLPA+NDVTA E+ D++  AA  C I+  A   G
Sbjct  796  DVCLVANSLPAINDVTADEMRDVLRRAAHMCEIVSSAIARG  836



>ref|XP_003078604.1| eukaryotic pantothenate kinase family protein (ISS) [Ostreococcus 
tauri]
 emb|CAL51484.1| Type II pantothenate kinase [Ostreococcus tauri]
Length=901

 Score =   225 bits (573),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 118/205 (58%), Positives = 154/205 (75%), Gaps = 3/205 (1%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RL EEPAAYG++GL DL E+REECLR F F D Y  +K++ENE++L VLPDLL E+D +N
Sbjct  611  RLREEPAAYGRIGLGDLFEMREECLRFFRFTDVYEDVKKQENESALLVLPDLLAEIDSLN  670

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            ++ RLL +IEGVLA NIFDWGS+  +DLY  GTI+EIYR +R+ + RPW +DD+D  +ER
Sbjct  671  DDERLLAIIEGVLAGNIFDWGSQGTLDLYRNGTILEIYRKARSTVNRPWAIDDYDALRER  730

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            M G    K R +++ALLF DNSGAD++LGM+P ARELL+RG +VVL+AN LPA+ND+TA 
Sbjct  731  MNG---PKARNYRKALLFCDNSGADVILGMIPFARELLKRGADVVLIANGLPAINDITAN  787

Query  541  ELPDIVAEAAKHCGILRGAAEAGGL  615
            EL  ++  AA     L  A  +G L
Sbjct  788  ELEVVLRSAASLDLCLSDAITSGAL  812



>ref|XP_001417152.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95445.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=772

 Score =   224 bits (570),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 153/205 (75%), Gaps = 3/205 (1%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RL EEPAAYG++GLADL E+REECLR F F D Y  +K++ENE++L VLPDLL E+D +N
Sbjct  487  RLREEPAAYGRIGLADLFEMREECLRFFRFNDVYEDVKKQENESALLVLPDLLAEIDSLN  546

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            ++ RLL ++EGVLA NIFDWGS+  +DLY  GTI+EIYR +R+ + RPW +DD+D  ++R
Sbjct  547  DDERLLAIVEGVLAGNIFDWGSQGTLDLYRNGTILEIYRNARSTVNRPWAIDDYDALRDR  606

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            +        + +++ALLF DNSGADI+LGMLP ARELL+RGT VVLVANSLPA+ND+TA 
Sbjct  607  L---NAPNAKQYRKALLFCDNSGADIILGMLPFARELLKRGTSVVLVANSLPAINDITAT  663

Query  541  ELPDIVAEAAKHCGILRGAAEAGGL  615
            EL  I+         L  A ++G L
Sbjct  664  ELTGILQATKSLDSQLEIAIDSGAL  688



>ref|XP_011395801.1| Pantothenate kinase 2 [Auxenochlorella protothecoides]
 gb|KFM22935.1| Pantothenate kinase 2 [Auxenochlorella protothecoides]
Length=951

 Score =   219 bits (559),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 125/217 (58%), Positives = 154/217 (71%), Gaps = 15/217 (7%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RL  EP AYG+LGLADL ELREECLREF F D YR  K+REN A+L  LPDLL E+D ++
Sbjct  552  RLSAEPGAYGQLGLADLFELREECLREFGFEDVYRMDKERENAAALEALPDLLDEVDKLD  611

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKM-QRPWRVDDFDEFKE  357
               RLL LI+G LAANIFDWG++ACVDLY   TI+E+YR +R K+ QRPW VD++D F  
Sbjct  612  GPERLLALIQGSLAANIFDWGAKACVDLYQNATILEMYRQARTKLSQRPWHVDNYDAFAA  671

Query  358  RMLGS-----------GETKPR---PHKRALLFVDNSGADIVLGMLPLARELLRRGTEVV  495
                +           G   P+   P KR L+FVDN+GADIVLGM+PLARE LR G EV+
Sbjct  672  AWFSTSAASDVGDGHRGGAAPKSSPPFKRVLMFVDNAGADIVLGMIPLAREFLRLGAEVI  731

Query  496  LVANSLPALNDVTAMELPDIVAEAAKHCGILRGAAEA  606
            +VAN+LPA+ND+TA EL  +VA AA+ C I+R A +A
Sbjct  732  MVANALPAINDITAAELRGVVARAAETCPIIRAARDA  768



>ref|XP_005649526.1| fumble-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE24982.1| fumble-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=890

 Score =   218 bits (554),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 122/207 (59%), Positives = 151/207 (73%), Gaps = 10/207 (5%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            ++  EP AYG+LGL+DLLE+RE+CLREF F D YR  K REN A+L VLPDLL ELDGM 
Sbjct  596  KMRSEPGAYGQLGLSDLLEMREDCLREFRFTDVYRLDKARENAAALEVLPDLLTELDGMA  655

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKM-QRPWRVDDFDEFKE  357
               RL  LIEG LAANIFDWG++ACVDLYH GTI+EIYR +R K+ +RPWRVD FD    
Sbjct  656  PAPRLTALIEGCLAANIFDWGAKACVDLYHNGTILEIYREARTKLSRRPWRVDTFDALAA  715

Query  358  RMLGS------GETK--PR-PHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANS  510
               G+      GE+   PR P +R ++FVDN+GADIVLGM+P ARELLR G EVV+ ANS
Sbjct  716  NWFGASSSDTLGESSAVPRSPFRRVIMFVDNAGADIVLGMIPFARELLRMGAEVVMCANS  775

Query  511  LPALNDVTAMELPDIVAEAAKHCGILR  591
             PA+ND+TA EL  ++ + A  C +++
Sbjct  776  QPAINDITAPELRALLNQVAAVCPVIK  802



>gb|EMT07573.1| Pantothenate kinase 2 [Aegilops tauschii]
Length=832

 Score =   208 bits (530),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 142/209 (68%), Gaps = 53/209 (25%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RL EEPAAYGK GLA+LLELREECLREF FFDAY +IKQRENEASLAVLPDLLMELD M+
Sbjct  577  RLTEEPAAYGKFGLANLLELREECLREFQFFDAYVSIKQRENEASLAVLPDLLMELDSMD  636

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            E                                                 +DDFD FK R
Sbjct  637  E-------------------------------------------------IDDFDTFKSR  647

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            ML     K +P+KRAL+ VDN+GAD+VLGMLPLARE LRRG EVVLVANSLPALND+TA 
Sbjct  648  ML----KKDQPYKRALISVDNAGADVVLGMLPLAREFLRRGVEVVLVANSLPALNDITAN  703

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELP+IVAEAAKHCGILR AAEAGGL+VDA
Sbjct  704  ELPEIVAEAAKHCGILRKAAEAGGLIVDA  732



>gb|EMS60500.1| Pantothenate kinase 2 [Triticum urartu]
Length=828

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 142/209 (68%), Gaps = 53/209 (25%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RL EEPAAYGK GLA+LLELREECLREF FFDAY +IKQRENEASLAVLPDLLMELD M+
Sbjct  573  RLTEEPAAYGKFGLANLLELREECLREFQFFDAYVSIKQRENEASLAVLPDLLMELDSMD  632

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            E                                                 +DDFD FK R
Sbjct  633  E-------------------------------------------------IDDFDTFKSR  643

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            ML     K +P+KRAL+ VDN+GAD+VLGMLPLARE LRRG EVVLVANSLPALND+TA 
Sbjct  644  ML----KKDQPYKRALISVDNAGADVVLGMLPLAREFLRRGVEVVLVANSLPALNDITAN  699

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELP+IVAEAAKHCGILR AAEAGGL+VDA
Sbjct  700  ELPEIVAEAAKHCGILRKAAEAGGLIVDA  728



>ref|XP_001692949.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP03518.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=673

 Score =   202 bits (515),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 128/209 (61%), Positives = 158/209 (76%), Gaps = 7/209 (3%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTI-KQRENEASLAVLPDLLMELDGM  177
            +L  EP +YG LGL +L E+REECLREF F D YR + KQREN A+LA LPDLL ELD  
Sbjct  359  KLQAEPGSYGALGLGELFEMREECLREFGFTDVYRCVFKQRENAAALAALPDLLRELDSE  418

Query  178  NE-EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKM-QRPWRVDDFDEF  351
                 RLL L+EGVLAANIFDWGS+ACV LY  GTI++IYR +R+++ +RPW +D+FD F
Sbjct  419  QPLPARLLCLVEGVLAANIFDWGSQACVALYRDGTILDIYRSARDRLGKRPWALDNFDAF  478

Query  352  KERML---GSGETKPRP-HKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPA  519
              R++   G G T  RP ++R ++FVDNSGADIVLGMLP ARELLR G EVVLVANSLPA
Sbjct  479  AARIMSAVGDGPTPLRPPYRRVMMFVDNSGADIVLGMLPFARELLRLGCEVVLVANSLPA  538

Query  520  LNDVTAMELPDIVAEAAKHCGILRGAAEA  606
            +ND+TA EL  ++A AA+ C +L+ A EA
Sbjct  539  INDITAPELRSLLAAAAESCPLLKAAREA  567



>ref|XP_002951581.1| hypothetical protein VOLCADRAFT_61514 [Volvox carteri f. nagariensis]
 gb|EFJ47392.1| hypothetical protein VOLCADRAFT_61514 [Volvox carteri f. nagariensis]
Length=842

 Score =   199 bits (507),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 121/211 (57%), Positives = 151/211 (72%), Gaps = 9/211 (4%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RL  EP  YG LGLA+L  +REECLREF F D YR  KQREN A+LAVLPDLL ELD   
Sbjct  517  RLQSEPGCYGALGLAELFTMREECLREFGFGDVYRLDKQRENAAALAVLPDLLRELDAEE  576

Query  181  E-EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKM-QRPWRVDDFDEFK  354
                RLL+L+EGVLAANIFDWGS+ACV LY  GTI++IYR +R ++ +RPW  ++ +E  
Sbjct  577  PLSSRLLSLVEGVLAANIFDWGSQACVALYRNGTILDIYRSARLRLSKRPWAQEEEEEKG  636

Query  355  ERMLGSGETKPRP-------HKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSL  513
            ER  G+      P       ++R ++FVDNSGADIVLGMLP ARE+L+ G EVVLVANSL
Sbjct  637  ERKDGAAAVAKPPPPPPPPPYRRVMMFVDNSGADIVLGMLPFAREMLKLGCEVVLVANSL  696

Query  514  PALNDVTAMELPDIVAEAAKHCGILRGAAEA  606
            PA+ND+TA EL  +++ AA  C +++ A EA
Sbjct  697  PAINDITAPELRALLSTAAAVCPVIKAAREA  727



>emb|CDP12422.1| unnamed protein product [Coffea canephora]
Length=804

 Score =   193 bits (491),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREFHFFDAYR+IKQRENEASLAVLPDLLME+D M+
Sbjct  675  RLMEEPAAYGKLGLANLLELREECLREFHFFDAYRSIKQRENEASLAVLPDLLMEIDSMD  734

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKER  360
            EE RLL L+EGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPW+      F ++
Sbjct  735  EETRLLKLVEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWQASIMKTFLQK  794

Query  361  ML  366
            +L
Sbjct  795  LL  796



>gb|KJB53155.1| hypothetical protein B456_008G295400 [Gossypium raimondii]
Length=730

 Score =   188 bits (477),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 102/110 (93%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMN  180
            RLMEEPAAYGKLGLA+LLELREECLREF F DAYR+IKQRENEASLAVLPDLL+ELD M+
Sbjct  613  RLMEEPAAYGKLGLANLLELREECLREFQFLDAYRSIKQRENEASLAVLPDLLLELDHMD  672

Query  181  EEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWR  330
            EE RLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWR
Sbjct  673  EETRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWR  722



>ref|XP_007512793.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17393.1| predicted protein [Bathycoccus prasinos]
Length=1064

 Score =   183 bits (465),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 151/202 (75%), Gaps = 8/202 (4%)
 Frame = +1

Query  1    RLMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGM-  177
            RL+++P   GK+ L+ L E REECLR+  F DAY  +KQREN+A+L VLP+LL EL+ M 
Sbjct  755  RLLKDPFGCGKISLSSLFEAREECLRDCGFADAYADVKQRENDAALVVLPELLEELEQME  814

Query  178  NEEMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQR-PWRVDDFDEFK  354
            +E  RL+ ++EGVLA N+FDWGS+ACVDLY+ GTI++IY+ +R    R  W++D F+EF 
Sbjct  815  DESQRLIQIVEGVLAGNVFDWGSQACVDLYNNGTILDIYKAARKNATRLSWKIDGFEEFA  874

Query  355  ERMLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVT  534
            +++     +    +K+A +FVDNSGADIVLG+LP   ELLRRGTEVVLVAN+LPALNDVT
Sbjct  875  KKL-----SSNDGYKKAHIFVDNSGADIVLGVLPFVVELLRRGTEVVLVANALPALNDVT  929

Query  535  AMELPDIVAEAAKHC-GILRGA  597
            A EL  ++  AA+ C GIL+ A
Sbjct  930  ADELSSLLDRAAETCGGILKSA  951



>emb|CDP12421.1| unnamed protein product [Coffea canephora]
Length=189

 Score =   159 bits (402),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +1

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            MLG G+ KP  HKRALLFVDNSGADI+LGMLPLARELLRRGTEVVLVANSLPALNDVTAM
Sbjct  1    MLGFGDKKPYQHKRALLFVDNSGADIILGMLPLARELLRRGTEVVLVANSLPALNDVTAM  60

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLVDA  627
            ELPDIVAEAAKHC ILR AAEAGGLLVDA
Sbjct  61   ELPDIVAEAAKHCDILRRAAEAGGLLVDA  89



>ref|XP_002593150.1| hypothetical protein BRAFLDRAFT_72767 [Branchiostoma floridae]
 gb|EEN49161.1| hypothetical protein BRAFLDRAFT_72767 [Branchiostoma floridae]
Length=771

 Score =   158 bits (399),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 94/193 (49%), Positives = 126/193 (65%), Gaps = 8/193 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L E P AYG L +  LL+ RE+CL EFHF D Y+ IKQ+ENEA+L +LP+ L  LD +  
Sbjct  488  LREHPFAYGSLTVRSLLDTREQCLNEFHFADPYQHIKQQENEAALRILPERLQHLDSLEF  547

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQ-RPWRVDDFDEFKER  360
              R + L EG+LA N+FDWG++A   L  +G     +  + +K+Q RPW VDD D + ER
Sbjct  548  RARQVALAEGLLAGNVFDWGAKAITRLM-EGDDSFGFEEAMSKLQARPWLVDDLDPWLER  606

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            +      +  PHK AL+F DNSG DI+LG+ P ARE++ RGT+V+L ANS PALNDVT  
Sbjct  607  L------QDHPHKCALIFADNSGLDIILGVFPFAREMVLRGTQVILCANSKPALNDVTYG  660

Query  541  ELPDIVAEAAKHC  579
            EL  +  + A+ C
Sbjct  661  ELKILAKKVAELC  673



>ref|XP_002593157.1| hypothetical protein BRAFLDRAFT_72760 [Branchiostoma floridae]
 gb|EEN49168.1| hypothetical protein BRAFLDRAFT_72760 [Branchiostoma floridae]
Length=771

 Score =   157 bits (398),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 94/193 (49%), Positives = 126/193 (65%), Gaps = 8/193 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L E P AYG L +  LL+ RE+CL EFHF D Y+ IKQ+ENEA+L +LP+ L  LD +  
Sbjct  488  LREHPFAYGSLTVRSLLDTREQCLNEFHFADPYQHIKQQENEAALRILPERLQHLDSLEF  547

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQ-RPWRVDDFDEFKER  360
              R + L EG+LA N+FDWG++A   L  +G     +  + +K+Q RPW VDD D + ER
Sbjct  548  RERQVALAEGLLAGNVFDWGAKAITRLM-EGDDSFGFEEAMSKLQARPWLVDDLDPWLER  606

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            +      +  PHK AL+F DNSG DI+LG+ P ARE++ RGT+V+L ANS PALNDVT  
Sbjct  607  L------QDHPHKCALIFADNSGLDIILGVFPFAREMVLRGTQVILCANSKPALNDVTYG  660

Query  541  ELPDIVAEAAKHC  579
            EL  +  + A+ C
Sbjct  661  ELKILAKKVAELC  673



>ref|XP_004531491.1| PREDICTED: pantothenate kinase 4-like [Ceratitis capitata]
Length=363

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 113/183 (62%), Gaps = 7/183 (4%)
 Frame = +1

Query  82   FHFFDAYRTIKQRENEASLAVLPDLLMELDGMNEEM-RLLTLIEGVLAANIFDWGSRACV  258
            + F D +R  K+ EN A+LA L   L ELD + +   R   LI GVLA N+FDWG++A  
Sbjct  107  YGFGDPWRKQKELENTAALAALSKRLEELDAITDNTARWTELIRGVLAGNMFDWGAQAVT  166

Query  259  DLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERMLGSGETKPRPHKRALLFVDNSGADI  438
             +  + +   ++       +RPW VD+ D + +RMLG      + HK AL+FVDNSG D+
Sbjct  167  SILEEDSNFGLHSALDRIEKRPWLVDNLDNWLQRMLG------KAHKCALVFVDNSGVDV  220

Query  439  VLGMLPLARELLRRGTEVVLVANSLPALNDVTAMELPDIVAEAAKHCGILRGAAEAGGLL  618
            VLG+LP  R LL+RGT+V+L ANS P+LNDVT  EL D++ +A  HC +L  A +   LL
Sbjct  221  VLGILPFVRALLQRGTKVLLCANSEPSLNDVTNRELTDLLIKACTHCSVLAKARQEETLL  280

Query  619  VDA  627
            + A
Sbjct  281  LYA  283



>ref|XP_010784124.1| PREDICTED: pantothenate kinase 4 isoform X1 [Notothenia coriiceps]
Length=782

 Score =   153 bits (386),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 91/206 (44%), Positives = 122/206 (59%), Gaps = 6/206 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  IKQ+EN+ +L      +  LDG+  
Sbjct  491  LRHQPFAYGSLTVRSLLDTREHCLNEFNFPDPYCKIKQQENDMALKYYQKAVKALDGLCW  550

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R   L+ GVLA N+FDWG++A  D+          +  R   +RPW VD +D++ ER+
Sbjct  551  EQRQFALVRGVLAGNVFDWGAKAVSDVLESDPEFGFEQAKRQLEERPWLVDSYDQWFERL  610

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL FVDNSG DI+LG++P  RELL RGTEVVL +NS PALNDVT  E
Sbjct  611  KGP------PHKCALFFVDNSGVDIILGVMPFVRELLSRGTEVVLASNSGPALNDVTNGE  664

Query  544  LPDIVAEAAKHCGILRGAAEAGGLLV  621
            L  +    A    +++ + E   L++
Sbjct  665  LQILTESIAAMDPVIQSSLEEDRLIL  690



>ref|XP_007900304.1| PREDICTED: pantothenate kinase 4 isoform X1 [Callorhinchus milii]
Length=781

 Score =   153 bits (386),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 87/206 (42%), Positives = 120/206 (58%), Gaps = 6/206 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  +KQREN+ +L     ++  L+ +N 
Sbjct  499  LRHQPFAYGSLTVRSLLDTREHCLNEFNFPDPYSKVKQRENDVALKHFQKVVQALESLNM  558

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R   L++G+LA N+FDWG++A  D+             +    RPW VD +D++ ER+
Sbjct  559  EQRQFALVKGLLAGNVFDWGAKAVSDVLETDPAFGFEEAKKQLQARPWLVDAYDDWLERL  618

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL FVDNSG D++LG+ P  RELL RGTE++L +NS PALNDVT  E
Sbjct  619  KGP------PHKCALFFVDNSGIDLILGVFPFVRELLSRGTEIILASNSGPALNDVTCSE  672

Query  544  LPDIVAEAAKHCGILRGAAEAGGLLV  621
            L  +    A    ++R A     LL+
Sbjct  673  LAIVTERIAAMDTVIRTALNQDKLLL  698



>ref|XP_007900305.1| PREDICTED: pantothenate kinase 4 isoform X2 [Callorhinchus milii]
Length=779

 Score =   153 bits (386),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 87/206 (42%), Positives = 120/206 (58%), Gaps = 6/206 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  +KQREN+ +L     ++  L+ +N 
Sbjct  497  LRHQPFAYGSLTVRSLLDTREHCLNEFNFPDPYSKVKQRENDVALKHFQKVVQALESLNM  556

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R   L++G+LA N+FDWG++A  D+             +    RPW VD +D++ ER+
Sbjct  557  EQRQFALVKGLLAGNVFDWGAKAVSDVLETDPAFGFEEAKKQLQARPWLVDAYDDWLERL  616

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL FVDNSG D++LG+ P  RELL RGTE++L +NS PALNDVT  E
Sbjct  617  KGP------PHKCALFFVDNSGIDLILGVFPFVRELLSRGTEIILASNSGPALNDVTCSE  670

Query  544  LPDIVAEAAKHCGILRGAAEAGGLLV  621
            L  +    A    ++R A     LL+
Sbjct  671  LAIVTERIAAMDTVIRTALNQDKLLL  696



>ref|XP_005729718.1| PREDICTED: pantothenate kinase 4-like [Pundamilia nyererei]
Length=782

 Score =   153 bits (386),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 113/181 (62%), Gaps = 6/181 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  IKQREN+ +L      +  LD ++ 
Sbjct  488  LRQQPFAYGSLTVRSLLDTREHCLNEFNFPDPYSKIKQRENDTALKYYQKAVKSLDELSW  547

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E +   L++GVLA N+FDWG++A  D+             R   +RPW VD +D++ ER+
Sbjct  548  EEKQFALVQGVLAGNVFDWGAKAVSDVLESDPEFGFEEAKRQLEERPWLVDSYDQWLERL  607

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL FVDNSG DI+LG++P  RELL RGTEVVL +NS PALNDVT  E
Sbjct  608  KGP------PHKCALFFVDNSGVDIILGVMPFVRELLSRGTEVVLASNSGPALNDVTNGE  661

Query  544  L  546
            L
Sbjct  662  L  662



>ref|XP_010784125.1| PREDICTED: pantothenate kinase 4 isoform X2 [Notothenia coriiceps]
Length=780

 Score =   153 bits (386),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 91/206 (44%), Positives = 122/206 (59%), Gaps = 6/206 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  IKQ+EN+ +L      +  LDG+  
Sbjct  489  LRHQPFAYGSLTVRSLLDTREHCLNEFNFPDPYCKIKQQENDMALKYYQKAVKALDGLCW  548

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R   L+ GVLA N+FDWG++A  D+          +  R   +RPW VD +D++ ER+
Sbjct  549  EQRQFALVRGVLAGNVFDWGAKAVSDVLESDPEFGFEQAKRQLEERPWLVDSYDQWFERL  608

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL FVDNSG DI+LG++P  RELL RGTEVVL +NS PALNDVT  E
Sbjct  609  KGP------PHKCALFFVDNSGVDIILGVMPFVRELLSRGTEVVLASNSGPALNDVTNGE  662

Query  544  LPDIVAEAAKHCGILRGAAEAGGLLV  621
            L  +    A    +++ + E   L++
Sbjct  663  LQILTESIAAMDPVIQSSLEEDRLIL  688



>ref|XP_008957661.1| PREDICTED: pantothenate kinase 4 [Pan paniscus]
Length=626

 Score =   151 bits (382),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 114/187 (61%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  +KQREN  +L   P ++  LD +  
Sbjct  344  LRQQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQRENGVALRCFPGVVRSLDALGW  403

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A  D+             R   +RPW VD + E+ +R+
Sbjct  404  EERQLALVKGLLAGNVFDWGAKAVSDVLESNPYFGFEEAKRKLQERPWLVDSYSEWLQRL  463

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  464  KGP------PHKCALIFADNSGIDIILGVFPFVRELLLRGTEVILACNSGPALNDVTHSE  517

Query  544  LPDIVAE  564
               IVAE
Sbjct  518  -SLIVAE  523



>ref|XP_004547490.1| PREDICTED: pantothenate kinase 4-like isoform X2 [Maylandia zebra]
Length=782

 Score =   152 bits (384),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 113/181 (62%), Gaps = 6/181 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  IKQREN+ +L      +  LD ++ 
Sbjct  488  LRQQPFAYGSLTVRSLLDTREHCLNEFNFPDPYSKIKQRENDIALKYYQKAVKSLDELSW  547

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E +   L++GVLA N+FDWG++A  D+             R   +RPW VD +D++ ER+
Sbjct  548  EEKQFALVQGVLAGNVFDWGAKAVSDVLESDPEFGFEEAKRQLEERPWLVDSYDQWLERL  607

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL FVDNSG DI+LG++P  RELL RGTEVVL +NS PALNDVT  E
Sbjct  608  KGP------PHKCALFFVDNSGVDIILGVMPFVRELLSRGTEVVLASNSGPALNDVTNGE  661

Query  544  L  546
            L
Sbjct  662  L  662



>ref|XP_005469711.1| PREDICTED: pantothenate kinase 4-like isoform X4 [Oreochromis 
niloticus]
Length=640

 Score =   151 bits (381),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 112/181 (62%), Gaps = 6/181 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  IKQREN+ +L      +  LD ++ 
Sbjct  346  LRQQPFAYGSLTVRSLLDTREHCLNEFNFPDPYSKIKQRENDIALKYYQKAVKSLDELSW  405

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E +   L+ GVLA N+FDWG++A  D+             R   +RPW VD +D++ ER+
Sbjct  406  EEKQFALVRGVLAGNVFDWGAKAVSDVLESDPEFGFEEAKRQLEERPWLVDSYDQWLERL  465

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL FVDNSG DI+LG++P  RELL RGTEVVL +NS PALNDVT  E
Sbjct  466  KGP------PHKCALFFVDNSGVDIILGVMPFVRELLSRGTEVVLASNSGPALNDVTNGE  519

Query  544  L  546
            L
Sbjct  520  L  520



>ref|XP_004547489.1| PREDICTED: pantothenate kinase 4-like isoform X1 [Maylandia zebra]
Length=784

 Score =   152 bits (384),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 113/181 (62%), Gaps = 6/181 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  IKQREN+ +L      +  LD ++ 
Sbjct  490  LRQQPFAYGSLTVRSLLDTREHCLNEFNFPDPYSKIKQRENDIALKYYQKAVKSLDELSW  549

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E +   L++GVLA N+FDWG++A  D+             R   +RPW VD +D++ ER+
Sbjct  550  EEKQFALVQGVLAGNVFDWGAKAVSDVLESDPEFGFEEAKRQLEERPWLVDSYDQWLERL  609

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL FVDNSG DI+LG++P  RELL RGTEVVL +NS PALNDVT  E
Sbjct  610  KGP------PHKCALFFVDNSGVDIILGVMPFVRELLSRGTEVVLASNSGPALNDVTNGE  663

Query  544  L  546
            L
Sbjct  664  L  664



>ref|XP_002051981.1| GJ24127 [Drosophila virilis]
 gb|EDW64136.1| GJ24127 [Drosophila virilis]
Length=362

 Score =   148 bits (373),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 115/183 (63%), Gaps = 3/183 (2%)
 Frame = +1

Query  82   FHFFDAYRTIKQRENEASLAVLPDLLMELDGM-NEEMRLLTLIEGVLAANIFDWGSRACV  258
            F F D +   KQ+EN ++ A L   L E+D + NE+ R   L+ GVLA N+FDWG++A  
Sbjct  102  FGFTDPWLRQKQQENASAKARLKQRLQEIDAIENEDARWTELVRGVLAGNMFDWGAQAIA  161

Query  259  DLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERMLGSGETKPRPHKRALLFVDNSGADI  438
             +  + +   ++       QRPW +D+ D + +RM  +   +P PHK A++FVDNSG D+
Sbjct  162  SILEQDSNFGLHAALERIEQRPWLLDNLDAWLQRMHITA-AQP-PHKCAVIFVDNSGVDV  219

Query  439  VLGMLPLARELLRRGTEVVLVANSLPALNDVTAMELPDIVAEAAKHCGILRGAAEAGGLL  618
            VLG+LP  RELLRRGT+V+L ANS P+LNDVT+ EL  ++ + A  C IL  A  +  LL
Sbjct  220  VLGVLPFVRELLRRGTKVLLCANSEPSLNDVTSRELSALLDDCACQCSILDSAWRSHRLL  279

Query  619  VDA  627
            V A
Sbjct  280  VYA  282



>gb|KDR11647.1| hypothetical protein L798_13976, partial [Zootermopsis nevadensis]
Length=693

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 122/205 (60%), Gaps = 7/205 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+  E C++EF F D Y   KQ EN+ +L +L   L  LD +  
Sbjct  405  LKHQPCAYGNLSVRSLLDTIEHCMKEFDFPDPYLLQKQMENDKALGLLGKRLQYLDSLEW  464

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
             +R  TL+  VLA N+FDWG+R   DL  + T    +   R    RPW VD  D + +R+
Sbjct  465  FLRQETLVTSVLAGNMFDWGAREVADLM-ENTDFGFHEAHRKIQARPWLVDGLDAWLDRL  523

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK A +FVDNSG DIVLG+LP AR+LL RGT+V+L ANS PALNDVT  E
Sbjct  524  KGP------PHKCAAVFVDNSGIDIVLGILPFARDLLLRGTKVMLCANSAPALNDVTHPE  577

Query  544  LPDIVAEAAKHCGILRGAAEAGGLL  618
            L  ++ +AA  C ++  A  AG L+
Sbjct  578  LVVVLKQAAAICQVIHKALNAGTLM  602



>ref|XP_005469709.1| PREDICTED: pantothenate kinase 4-like isoform X2 [Oreochromis 
niloticus]
 ref|XP_005469710.1| PREDICTED: pantothenate kinase 4-like isoform X3 [Oreochromis 
niloticus]
Length=784

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 112/181 (62%), Gaps = 6/181 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  IKQREN+ +L      +  LD ++ 
Sbjct  490  LRQQPFAYGSLTVRSLLDTREHCLNEFNFPDPYSKIKQRENDIALKYYQKAVKSLDELSW  549

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E +   L+ GVLA N+FDWG++A  D+             R   +RPW VD +D++ ER+
Sbjct  550  EEKQFALVRGVLAGNVFDWGAKAVSDVLESDPEFGFEEAKRQLEERPWLVDSYDQWLERL  609

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL FVDNSG DI+LG++P  RELL RGTEVVL +NS PALNDVT  E
Sbjct  610  KGP------PHKCALFFVDNSGVDIILGVMPFVRELLSRGTEVVLASNSGPALNDVTNGE  663

Query  544  L  546
            L
Sbjct  664  L  664



>ref|XP_003447770.1| PREDICTED: pantothenate kinase 4-like isoform X1 [Oreochromis 
niloticus]
Length=782

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 112/181 (62%), Gaps = 6/181 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  IKQREN+ +L      +  LD ++ 
Sbjct  488  LRQQPFAYGSLTVRSLLDTREHCLNEFNFPDPYSKIKQRENDIALKYYQKAVKSLDELSW  547

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E +   L+ GVLA N+FDWG++A  D+             R   +RPW VD +D++ ER+
Sbjct  548  EEKQFALVRGVLAGNVFDWGAKAVSDVLESDPEFGFEEAKRQLEERPWLVDSYDQWLERL  607

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL FVDNSG DI+LG++P  RELL RGTEVVL +NS PALNDVT  E
Sbjct  608  KGP------PHKCALFFVDNSGVDIILGVMPFVRELLSRGTEVVLASNSGPALNDVTNGE  661

Query  544  L  546
            L
Sbjct  662  L  662



>dbj|BAE72988.1| hypothetical protein [Macaca fascicularis]
Length=626

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 114/187 (61%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  +KQREN  +L   P ++  LD +  
Sbjct  344  LRQQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQRENGVALRCFPGVVRSLDTLGW  403

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A  D+             R   +RPW VD + E+ +R+
Sbjct  404  EERQLALVKGLLAGNVFDWGAKAVSDVLESDPYFGFEEAKRKLQERPWLVDSYSEWLQRL  463

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  464  KGP------PHKCALIFADNSGIDIILGVFPFVRELLLRGTEVILACNSGPALNDVTHGE  517

Query  544  LPDIVAE  564
               IVAE
Sbjct  518  -SLIVAE  523



>ref|XP_006782994.1| PREDICTED: pantothenate kinase 4-like isoform X2 [Neolamprologus 
brichardi]
Length=782

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 112/181 (62%), Gaps = 6/181 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  IKQREN+ +L      +  LD ++ 
Sbjct  488  LRQQPFAYGSLTVRSLLDTREHCLNEFNFPDPYSKIKQRENDIALKYYQKAVKSLDELSW  547

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E +   L+ GVLA N+FDWG++A  D+             R   +RPW VD +D++ ER+
Sbjct  548  EEKQFALVRGVLAGNVFDWGAKAVSDVLESDPEFGFEEAKRQLEERPWLVDSYDQWLERL  607

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL FVDNSG DI+LG++P  RELL RGTEVVL +NS PALNDVT  E
Sbjct  608  KGP------PHKCALFFVDNSGVDIILGVMPFVRELLSRGTEVVLASNSGPALNDVTNGE  661

Query  544  L  546
            L
Sbjct  662  L  662



>ref|NP_001127619.1| pantothenate kinase 4 [Pongo abelii]
 sp|Q5R5F8.1|PANK4_PONAB RecName: Full=Pantothenate kinase 4; AltName: Full=Pantothenic 
acid kinase 4 [Pongo abelii]
 emb|CAH93008.1| hypothetical protein [Pongo abelii]
Length=773

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 114/187 (61%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  +KQREN  +L   P ++  LD +  
Sbjct  491  LRQQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQRENGVALRCFPGVVRSLDALGW  550

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A  D+             R   +RPW VD + E+ +R+
Sbjct  551  EERQLALVKGLLAGNVFDWGAKAVSDVLESDPCFGFEEAKRKLQERPWLVDSYSEWLQRL  610

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  611  KGP------PHKCALIFADNSGIDIILGVFPFVRELLLRGTEVILACNSGPALNDVTHSE  664

Query  544  LPDIVAE  564
               IVAE
Sbjct  665  -SLIVAE  670



>ref|XP_006782993.1| PREDICTED: pantothenate kinase 4-like isoform X1 [Neolamprologus 
brichardi]
Length=784

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 112/181 (62%), Gaps = 6/181 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  IKQREN+ +L      +  LD ++ 
Sbjct  490  LRQQPFAYGSLTVRSLLDTREHCLNEFNFPDPYSKIKQRENDIALKYYQKAVKSLDELSW  549

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E +   L+ GVLA N+FDWG++A  D+             R   +RPW VD +D++ ER+
Sbjct  550  EEKQFALVRGVLAGNVFDWGAKAVSDVLESDPEFGFEEAKRQLEERPWLVDSYDQWLERL  609

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL FVDNSG DI+LG++P  RELL RGTEVVL +NS PALNDVT  E
Sbjct  610  KGP------PHKCALFFVDNSGVDIILGVMPFVRELLSRGTEVVLASNSGPALNDVTNGE  663

Query  544  L  546
            L
Sbjct  664  L  664



>ref|XP_010374471.1| PREDICTED: LOW QUALITY PROTEIN: pantothenate kinase 4 [Rhinopithecus 
roxellana]
Length=754

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 114/187 (61%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  +KQREN  +L   P ++  LD +  
Sbjct  472  LRQQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQRENGVALRCFPGVVRSLDTLGW  531

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A  D+             R   +RPW VD + E+ +R+
Sbjct  532  EERQLALVKGLLAGNVFDWGAKAVSDVLESDPCFGFEEAKRKLQERPWLVDSYSEWLQRL  591

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  592  KGP------PHKCALIFADNSGIDIILGVFPFVRELLLRGTEVILACNSGPALNDVTHSE  645

Query  544  LPDIVAE  564
               IVAE
Sbjct  646  -SLIVAE  651



>ref|XP_008305151.1| PREDICTED: pantothenate kinase 4 isoform X2 [Stegastes partitus]
Length=783

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 112/181 (62%), Gaps = 6/181 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  IKQREN+ +L      +  L+ ++ 
Sbjct  489  LRNQPFAYGSLTVRSLLDTREHCLNEFNFPDPYSKIKQRENDVALKYYQKAVKSLEELSW  548

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R   L+ GVLA N+FDWG++A  D+          +  R   +RPW VD +D++ ER+
Sbjct  549  EERQFALVRGVLAGNVFDWGAKAVSDVLESDPEFGFEQAKRQLEERPWLVDSYDQWLERL  608

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL FVDNSG DI+LG++P  RELL RGTEVVL +NS PALNDVT  E
Sbjct  609  KGP------PHKCALFFVDNSGVDIILGVMPFVRELLSRGTEVVLASNSGPALNDVTNGE  662

Query  544  L  546
            L
Sbjct  663  L  663



>ref|XP_005917899.1| PREDICTED: LOW QUALITY PROTEIN: pantothenate kinase 4-like [Haplochromis 
burtoni]
Length=796

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 112/181 (62%), Gaps = 6/181 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  IKQREN+ +L      +  LD ++ 
Sbjct  502  LRQQPFAYGSLTVRSLLDTREHCLNEFNFPDPYSKIKQRENDIALKYYQKAVKSLDELSW  561

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E +   L+ GVLA N+FDWG++A  D+             R   +RPW VD +D++ ER+
Sbjct  562  EEKQFALVRGVLAGNVFDWGAKAVSDVLESDPEFGFEEAKRQLEERPWLVDSYDQWLERL  621

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL FVDNSG DI+LG++P  RELL RGTEVVL +NS PALNDVT  E
Sbjct  622  KGP------PHKCALFFVDNSGVDIILGVMPFVRELLSRGTEVVLASNSGPALNDVTNGE  675

Query  544  L  546
            L
Sbjct  676  L  676



>ref|XP_008305150.1| PREDICTED: pantothenate kinase 4 isoform X1 [Stegastes partitus]
Length=785

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 112/181 (62%), Gaps = 6/181 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  IKQREN+ +L      +  L+ ++ 
Sbjct  491  LRNQPFAYGSLTVRSLLDTREHCLNEFNFPDPYSKIKQRENDVALKYYQKAVKSLEELSW  550

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R   L+ GVLA N+FDWG++A  D+          +  R   +RPW VD +D++ ER+
Sbjct  551  EERQFALVRGVLAGNVFDWGAKAVSDVLESDPEFGFEQAKRQLEERPWLVDSYDQWLERL  610

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL FVDNSG DI+LG++P  RELL RGTEVVL +NS PALNDVT  E
Sbjct  611  KGP------PHKCALFFVDNSGVDIILGVMPFVRELLSRGTEVVLASNSGPALNDVTNGE  664

Query  544  L  546
            L
Sbjct  665  L  665



>ref|XP_009445038.1| PREDICTED: pantothenate kinase 4 isoform X2 [Pan troglodytes]
Length=758

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 114/187 (61%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  +KQREN  +L   P ++  LD +  
Sbjct  499  LRQQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQRENGVALRCFPGVVRSLDALGW  558

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A  D+             R   +RPW VD + E+ +R+
Sbjct  559  EERQLALVKGLLAGNVFDWGAKAVSDVLESDPYFGFEEAKRKLQERPWLVDSYSEWLQRL  618

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  619  KGP------PHKCALIFADNSGIDIILGVFPFVRELLLRGTEVILACNSGPALNDVTHSE  672

Query  544  LPDIVAE  564
               IVAE
Sbjct  673  -SLIVAE  678



>ref|XP_524846.3| PREDICTED: pantothenate kinase 4 isoform X1 [Pan troglodytes]
Length=781

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 114/187 (61%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  +KQREN  +L   P ++  LD +  
Sbjct  499  LRQQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQRENGVALRCFPGVVRSLDALGW  558

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A  D+             R   +RPW VD + E+ +R+
Sbjct  559  EERQLALVKGLLAGNVFDWGAKAVSDVLESDPYFGFEEAKRKLQERPWLVDSYSEWLQRL  618

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  619  KGP------PHKCALIFADNSGIDIILGVFPFVRELLLRGTEVILACNSGPALNDVTHSE  672

Query  544  LPDIVAE  564
               IVAE
Sbjct  673  -SLIVAE  678



>ref|XP_004024565.1| PREDICTED: pantothenate kinase 4 [Gorilla gorilla gorilla]
Length=626

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 113/187 (60%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  +KQREN  +L   P ++  LD +  
Sbjct  344  LRQQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQRENGVALRCFPGVVRSLDALGW  403

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A  D+             R   +RPW VD + E+  R+
Sbjct  404  EDRQLALVKGLLAGNVFDWGAKAVSDVLESDPYFGFEEAKRKLQERPWLVDSYSEWLRRL  463

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  464  KGP------PHKCALIFADNSGIDIILGVFPFVRELLLRGTEVILACNSGPALNDVTHSE  517

Query  544  LPDIVAE  564
               IVAE
Sbjct  518  -SLIVAE  523



>ref|XP_009212778.1| PREDICTED: pantothenate kinase 4 isoform X1 [Papio anubis]
Length=788

 Score =   150 bits (380),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 114/187 (61%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  +KQREN  +L   P ++  LD +  
Sbjct  499  LRQQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQRENGVALRCFPGVVRSLDTLGW  558

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A  D+             R   +RPW VD + E+ +R+
Sbjct  559  EERQLALVKGLLAGNVFDWGAKAVSDVLESDPYFGFEEAKRKLQERPWLVDSYSEWLQRL  618

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  619  KGP------PHKCALIFADNSGIDIILGVFPFVRELLLRGTEVILACNSGPALNDVTHSE  672

Query  544  LPDIVAE  564
               IVAE
Sbjct  673  -SLIVAE  678



>emb|CBN80684.1| Pantothenate kinase 4 [Dicentrarchus labrax]
Length=775

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 112/181 (62%), Gaps = 6/181 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  IKQ+EN+ +L      +  L+ ++ 
Sbjct  504  LRQQPFAYGSLTVRSLLDTREHCLNEFNFPDPYSKIKQKENDMALKYYQKAVKSLEELSW  563

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R   L+ GVLA N+FDWG++A  D+             R   +RPW VD +D++ ER+
Sbjct  564  EQRQFALVRGVLAGNVFDWGAKAVSDVLESDPEFGFEEAKRQLEERPWLVDSYDQWFERL  623

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL FVDNSG DI+LG++P  RELL RGTEVVL +NS PALNDVT  E
Sbjct  624  KGP------PHKCALFFVDNSGVDIILGVMPFVRELLSRGTEVVLASNSGPALNDVTNGE  677

Query  544  L  546
            L
Sbjct  678  L  678



>ref|XP_011482908.1| PREDICTED: pantothenate kinase 4 [Oryzias latipes]
Length=544

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 110/181 (61%), Gaps = 6/181 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  IKQREN+++L      +  L+ ++ 
Sbjct  260  LRHQPFAYGSLTVRSLLDTREHCLNEFNFPDPYSKIKQRENDSALKYFQKAVKALEQLSW  319

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R   L+ GVLA N+FDWG++A  D+             R    RPW VD FD + ER+
Sbjct  320  EDRQFALVRGVLAGNVFDWGAKAVSDVLESDPEFGFEEAKRQLEVRPWLVDCFDRWLERL  379

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL FVDNSG DI+LG++P  RELL RGTEVVL +NS PALNDVT  E
Sbjct  380  KGP------PHKCALFFVDNSGVDIILGVMPFVRELLSRGTEVVLASNSGPALNDVTNGE  433

Query  544  L  546
            L
Sbjct  434  L  434



>ref|XP_003891046.1| PREDICTED: pantothenate kinase 4 isoform X2 [Papio anubis]
Length=781

 Score =   150 bits (379),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 114/187 (61%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  +KQREN  +L   P ++  LD +  
Sbjct  499  LRQQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQRENGVALRCFPGVVRSLDTLGW  558

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A  D+             R   +RPW VD + E+ +R+
Sbjct  559  EERQLALVKGLLAGNVFDWGAKAVSDVLESDPYFGFEEAKRKLQERPWLVDSYSEWLQRL  618

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  619  KGP------PHKCALIFADNSGIDIILGVFPFVRELLLRGTEVILACNSGPALNDVTHSE  672

Query  544  LPDIVAE  564
               IVAE
Sbjct  673  -SLIVAE  678



>ref|XP_007979099.1| PREDICTED: pantothenate kinase 4 isoform X1 [Chlorocebus sabaeus]
Length=798

 Score =   150 bits (379),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 114/187 (61%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  +KQREN  +L   P ++  LD +  
Sbjct  516  LRQQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQRENGVALRCFPGVVRSLDTLGW  575

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A  D+             R   +RPW VD + E+ +R+
Sbjct  576  EERQLALVKGLLAGNVFDWGAKAVSDVLESDPYFGFEEAKRKLQERPWLVDSYSEWLQRL  635

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  636  KGP------PHKCALIFADNSGIDIILGVFPFVRELLLRGTEVILACNSGPALNDVTHSE  689

Query  544  LPDIVAE  564
               IVAE
Sbjct  690  -SLIVAE  695



>emb|CDQ63015.1| unnamed protein product [Oncorhynchus mykiss]
Length=757

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 87/200 (44%), Positives = 119/200 (60%), Gaps = 6/200 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  IKQREN+ +L      +  L+ ++ 
Sbjct  461  LRHQPFAYGSLTVRSLLDTREHCLNEFNFPDPYSKIKQRENDMALKYFQKAVKSLEELSW  520

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R   L+ G+LA N+FDWG++A  D+          +  R   +RPW +D++D++ ER+
Sbjct  521  EQRQFALVRGLLAGNVFDWGAKAVSDVLESDPEFGFEQAKRQLEERPWLIDNYDQWLERL  580

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL FVDNSG DI+LG+ P  RELL RGTEVVL +NS PALNDVT  E
Sbjct  581  NGP------PHKCALFFVDNSGIDIILGVFPFVRELLCRGTEVVLASNSSPALNDVTNNE  634

Query  544  LPDIVAEAAKHCGILRGAAE  603
            L  +    A    +++ A +
Sbjct  635  LQILTERIAAMDPVIQSAVK  654



>ref|XP_002801781.1| PREDICTED: pantothenate kinase 4 [Macaca mulatta]
Length=734

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 114/187 (61%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  +KQREN  +L   P ++  LD +  
Sbjct  452  LRQQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQRENGVALRCFPGVVRSLDTLGW  511

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A  D+             R   +RPW VD + E+ +R+
Sbjct  512  EERQLALVKGLLAGNVFDWGAKAVSDVLESDPYFGFEEAKRKLQERPWLVDSYSEWLQRL  571

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  572  KGP------PHKCALIFADNSGIDIILGVFPFVRELLLRGTEVILACNSGPALNDVTHGE  625

Query  544  LPDIVAE  564
               IVAE
Sbjct  626  -SLIVAE  631



>gb|EHH14245.1| hypothetical protein EGK_00136, partial [Macaca mulatta]
Length=751

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 114/187 (61%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  +KQREN  +L   P ++  LD +  
Sbjct  469  LRQQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQRENGVALRCFPGVVRSLDTLGW  528

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A  D+             R   +RPW VD + E+ +R+
Sbjct  529  EERQLALVKGLLAGNVFDWGAKAVSDVLESDPYFGFEEAKRKLQERPWLVDSYSEWLQRL  588

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  589  KGP------PHKCALIFADNSGIDIILGVFPFVRELLLRGTEVILACNSGPALNDVTHGE  642

Query  544  LPDIVAE  564
               IVAE
Sbjct  643  -SLIVAE  648



>gb|EHH49476.1| hypothetical protein EGM_00139, partial [Macaca fascicularis]
Length=751

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 114/187 (61%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  +KQREN  +L   P ++  LD +  
Sbjct  469  LRQQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQRENGVALRCFPGVVRSLDTLGW  528

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A  D+             R   +RPW VD + E+ +R+
Sbjct  529  EERQLALVKGLLAGNVFDWGAKAVSDVLESDPYFGFEEAKRKLQERPWLVDSYSEWLQRL  588

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  589  KGP------PHKCALIFADNSGIDIILGVFPFVRELLLRGTEVILACNSGPALNDVTHGE  642

Query  544  LPDIVAE  564
               IVAE
Sbjct  643  -SLIVAE  648



>ref|XP_010880004.1| PREDICTED: pantothenate kinase 4 isoform X5 [Esox lucius]
Length=768

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 112/181 (62%), Gaps = 6/181 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  IKQREN+ +L      +  L+ ++ 
Sbjct  472  LRQQPFAYGSLTVRSLLDTREHCLNEFNFPDPYSKIKQRENDIALKYFQKAIKSLEELSW  531

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R   L+ G+LA N+FDWG++A  D+          +  R   +RPW VD +D++ ER+
Sbjct  532  EQRQFALVRGLLAGNVFDWGAKAVSDVLESDPEFGFEQAKRQLEERPWLVDAYDQWLERL  591

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL FVDNSG DI+LG+ P  RELL RGTEVVL +NS PALNDVT  E
Sbjct  592  KGP------PHKCALFFVDNSGIDIILGVFPFIRELLCRGTEVVLASNSSPALNDVTNSE  645

Query  544  L  546
            L
Sbjct  646  L  646



>ref|XP_010880001.1| PREDICTED: pantothenate kinase 4 isoform X2 [Esox lucius]
Length=808

 Score =   150 bits (379),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 112/181 (62%), Gaps = 6/181 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  IKQREN+ +L      +  L+ ++ 
Sbjct  512  LRQQPFAYGSLTVRSLLDTREHCLNEFNFPDPYSKIKQRENDIALKYFQKAIKSLEELSW  571

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R   L+ G+LA N+FDWG++A  D+          +  R   +RPW VD +D++ ER+
Sbjct  572  EQRQFALVRGLLAGNVFDWGAKAVSDVLESDPEFGFEQAKRQLEERPWLVDAYDQWLERL  631

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL FVDNSG DI+LG+ P  RELL RGTEVVL +NS PALNDVT  E
Sbjct  632  KGP------PHKCALFFVDNSGIDIILGVFPFIRELLCRGTEVVLASNSSPALNDVTNSE  685

Query  544  L  546
            L
Sbjct  686  L  686



>ref|XP_010880000.1| PREDICTED: pantothenate kinase 4 isoform X1 [Esox lucius]
Length=810

 Score =   150 bits (379),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 112/181 (62%), Gaps = 6/181 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  IKQREN+ +L      +  L+ ++ 
Sbjct  514  LRQQPFAYGSLTVRSLLDTREHCLNEFNFPDPYSKIKQRENDIALKYFQKAIKSLEELSW  573

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R   L+ G+LA N+FDWG++A  D+          +  R   +RPW VD +D++ ER+
Sbjct  574  EQRQFALVRGLLAGNVFDWGAKAVSDVLESDPEFGFEQAKRQLEERPWLVDAYDQWLERL  633

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL FVDNSG DI+LG+ P  RELL RGTEVVL +NS PALNDVT  E
Sbjct  634  KGP------PHKCALFFVDNSGIDIILGVFPFIRELLCRGTEVVLASNSSPALNDVTNSE  687

Query  544  L  546
            L
Sbjct  688  L  688



>ref|XP_010880002.1| PREDICTED: pantothenate kinase 4 isoform X3 [Esox lucius]
Length=791

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 112/181 (62%), Gaps = 6/181 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  IKQREN+ +L      +  L+ ++ 
Sbjct  495  LRQQPFAYGSLTVRSLLDTREHCLNEFNFPDPYSKIKQRENDIALKYFQKAIKSLEELSW  554

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R   L+ G+LA N+FDWG++A  D+          +  R   +RPW VD +D++ ER+
Sbjct  555  EQRQFALVRGLLAGNVFDWGAKAVSDVLESDPEFGFEQAKRQLEERPWLVDAYDQWLERL  614

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL FVDNSG DI+LG+ P  RELL RGTEVVL +NS PALNDVT  E
Sbjct  615  KGP------PHKCALFFVDNSGIDIILGVFPFIRELLCRGTEVVLASNSSPALNDVTNSE  668

Query  544  L  546
            L
Sbjct  669  L  669



>sp|Q4R4U1.2|PANK4_MACFA RecName: Full=Pantothenate kinase 4; AltName: Full=Pantothenic 
acid kinase 4 [Macaca fascicularis]
Length=773

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 114/187 (61%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  +KQREN  +L   P ++  LD +  
Sbjct  491  LRQQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQRENGVALRCFPGVVRSLDTLGW  550

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A  D+             R   +RPW VD + E+ +R+
Sbjct  551  EERQLALVKGLLAGNVFDWGAKAVSDVLESDPYFGFEEAKRKLQERPWLVDSYSEWLQRL  610

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  611  KGP------PHKCALIFADNSGIDIILGVFPFVRELLLRGTEVILACNSGPALNDVTHGE  664

Query  544  LPDIVAE  564
               IVAE
Sbjct  665  -SLIVAE  670



>ref|NP_001270249.1| pantothenate kinase 4 [Macaca fascicularis]
 dbj|BAE01884.1| unnamed protein product [Macaca fascicularis]
Length=773

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 114/187 (61%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  +KQREN  +L   P ++  LD +  
Sbjct  491  LRQQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQRENGVALRCFPGVVRSLDTLGW  550

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A  D+             R   +RPW VD + E+ +R+
Sbjct  551  EERQLALVKGLLAGNVFDWGAKAVSDVLESDPYFGFEEAKRKLQERPWLVDSYSEWLQRL  610

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  611  KGP------PHKCALIFADNSGIDIILGVFPFVRELLLRGTEVILACNSGPALNDVTHGE  664

Query  544  LPDIVAE  564
               IVAE
Sbjct  665  -SLIVAE  670



>ref|XP_010880003.1| PREDICTED: pantothenate kinase 4 isoform X4 [Esox lucius]
Length=789

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 112/181 (62%), Gaps = 6/181 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  IKQREN+ +L      +  L+ ++ 
Sbjct  493  LRQQPFAYGSLTVRSLLDTREHCLNEFNFPDPYSKIKQRENDIALKYFQKAIKSLEELSW  552

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R   L+ G+LA N+FDWG++A  D+          +  R   +RPW VD +D++ ER+
Sbjct  553  EQRQFALVRGLLAGNVFDWGAKAVSDVLESDPEFGFEQAKRQLEERPWLVDAYDQWLERL  612

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL FVDNSG DI+LG+ P  RELL RGTEVVL +NS PALNDVT  E
Sbjct  613  KGP------PHKCALFFVDNSGIDIILGVFPFIRELLCRGTEVVLASNSSPALNDVTNSE  666

Query  544  L  546
            L
Sbjct  667  L  667



>ref|XP_003279784.1| PREDICTED: pantothenate kinase 4 [Nomascus leucogenys]
Length=894

 Score =   150 bits (379),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 112/183 (61%), Gaps = 7/183 (4%)
 Frame = +1

Query  16   PAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNEEMRL  195
            P+AYG L +  LL+ RE CL EF+F D Y  +KQREN  +L   P ++  LD +  E R 
Sbjct  616  PSAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQRENGVALRCFPGVVRSLDALGWEERQ  675

Query  196  LTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERMLGSG  375
            L L++G+LA N+FDWG++A  D+             R   +RPW VD + E+ +R+ G  
Sbjct  676  LALVKGLLAGNVFDWGAKAVSDVLESDPYFGFEEAKRKLQERPWLVDSYSEWLQRLKGP-  734

Query  376  ETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAMELPDI  555
                 PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E   I
Sbjct  735  -----PHKCALIFADNSGIDIILGVFPFVRELLLRGTEVILACNSGPALNDVTHSE-SLI  788

Query  556  VAE  564
            VAE
Sbjct  789  VAE  791



>ref|XP_001962564.1| GF14376 [Drosophila ananassae]
 gb|EDV31785.1| GF14376 [Drosophila ananassae]
Length=361

 Score =   145 bits (367),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 86/207 (42%), Positives = 132/207 (64%), Gaps = 9/207 (4%)
 Frame = +1

Query  16   PAAYGK--LGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGM-NEE  186
            P   GK  LG ++LL + E  LR + F D + + K+ EN +++A L + L ELD + +++
Sbjct  79   PQNSGKVVLGTSELLNINETMLRRYGFTDPWLSQKKLENASAVANLKERLKELDSLQDQD  138

Query  187  MRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERML  366
             R   L+ GVLA N+FDWG++A  ++  + +   ++    +  +RPW +D+ D + +R+ 
Sbjct  139  ARWTELVRGVLAGNMFDWGAQAIANILEQNSSFGLHSALDSIEERPWLLDNLDNWLQRLK  198

Query  367  GSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAMEL  546
            G       PHK A++FVDNSG D+VLG+LP ARELL+RGT+V+L ANS PALNDVT+ EL
Sbjct  199  GP------PHKCAVVFVDNSGVDVVLGVLPFARELLKRGTKVILCANSEPALNDVTSREL  252

Query  547  PDIVAEAAKHCGILRGAAEAGGLLVDA  627
              ++ E A  C ++  A ++  LLV A
Sbjct  253  EALLDECAPECEVIAEAWKSRRLLVYA  279



>ref|XP_007228568.1| PREDICTED: pantothenate kinase 4-like isoform X4 [Astyanax mexicanus]
Length=633

 Score =   148 bits (374),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 115/187 (61%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  IKQREN+ +L     ++  L+ ++ 
Sbjct  346  LRHQPFAYGSLTVRSLLDTREHCLNEFNFPDPYSKIKQRENDMALKYYQKVVRSLEELSW  405

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R   L+ G+LA N+FDWG++A  D+          +  +   +RPW VD ++++ ER+
Sbjct  406  EQRQFALVRGILAGNVFDWGAKAVSDVLESDPEFGFEQAKQQLQERPWLVDAYNQWVERL  465

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL FVDNSG DI+LG+ P  RELL RGTEVVL +NS PALNDVT  E
Sbjct  466  KGP------PHKCALFFVDNSGMDIILGVFPFVRELLLRGTEVVLASNSGPALNDVTNSE  519

Query  544  LPDIVAE  564
            L  IV E
Sbjct  520  L-QIVTE  525



>ref|XP_001086116.2| PREDICTED: pantothenate kinase 4 isoform 2 [Macaca mulatta]
Length=781

 Score =   150 bits (378),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 114/187 (61%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  +KQREN  +L   P ++  LD +  
Sbjct  499  LRQQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQRENGVALRCFPGVVRSLDTLGW  558

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A  D+             R   +RPW VD + E+ +R+
Sbjct  559  EERQLALVKGLLAGNVFDWGAKAVSDVLESDPYFGFEEAKRKLQERPWLVDSYSEWLQRL  618

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  619  KGP------PHKCALIFADNSGIDIILGVFPFVRELLLRGTEVILACNSGPALNDVTHGE  672

Query  544  LPDIVAE  564
               IVAE
Sbjct  673  -SLIVAE  678



>ref|XP_001356515.2| GA19161 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL33579.2| GA19161 [Drosophila pseudoobscura pseudoobscura]
Length=363

 Score =   145 bits (366),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 116/183 (63%), Gaps = 3/183 (2%)
 Frame = +1

Query  82   FHFFDAYRTIKQRENEASLAVLPDLLMELDGM-NEEMRLLTLIEGVLAANIFDWGSRACV  258
            F F D +R+ KQ EN ++ A L   L E+D + N + +   L+ GVLA N+FDWG++A  
Sbjct  102  FGFTDPWRSQKQMENASAKARLKLRLEEIDAIQNPDDKWTELVRGVLAGNMFDWGAQAIS  161

Query  259  DLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERMLGSGETKPRPHKRALLFVDNSGADI  438
            ++  + +   ++       +RPW +D+ D + +R+  S + +P  HK A++FVDNSG D+
Sbjct  162  NILEQDSSFGLHSALDRIEKRPWLLDNLDNWLKRLRISSDQQP--HKCAVVFVDNSGVDV  219

Query  439  VLGMLPLARELLRRGTEVVLVANSLPALNDVTAMELPDIVAEAAKHCGILRGAAEAGGLL  618
            VLG+LP  RELLRRGT+V+L ANS P+LNDVT+ EL  ++ E A  C +L  A  +  LL
Sbjct  220  VLGILPFVRELLRRGTKVLLCANSEPSLNDVTSRELSALLDECAGECAVLSSAWSSARLL  279

Query  619  VDA  627
            V A
Sbjct  280  VYA  282



>ref|XP_002014710.1| GL18804 [Drosophila persimilis]
 gb|EDW28706.1| GL18804 [Drosophila persimilis]
Length=363

 Score =   145 bits (365),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 116/183 (63%), Gaps = 3/183 (2%)
 Frame = +1

Query  82   FHFFDAYRTIKQRENEASLAVLPDLLMELDGM-NEEMRLLTLIEGVLAANIFDWGSRACV  258
            F F D +R+ KQ EN ++ A L   L E+D + N + +   L+ GVLA N+FDWG++A  
Sbjct  102  FGFTDPWRSQKQLENASAKARLKLRLEEIDAIQNPDDKWTELVRGVLAGNMFDWGAQAIS  161

Query  259  DLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERMLGSGETKPRPHKRALLFVDNSGADI  438
            ++  + +   ++       +RPW +D+ D + +R+  S + +P  HK A++FVDNSG D+
Sbjct  162  NILEQDSSFGLHSALDRIEKRPWLLDNLDNWLKRLRISSDQQP--HKCAVVFVDNSGVDV  219

Query  439  VLGMLPLARELLRRGTEVVLVANSLPALNDVTAMELPDIVAEAAKHCGILRGAAEAGGLL  618
            VLG+LP  RELLRRGT+V+L ANS P+LNDVT+ EL  ++ E A  C +L  A  +  LL
Sbjct  220  VLGILPFVRELLRRGTKVLLCANSEPSLNDVTSRELSALLDECAGECAVLSSAWSSARLL  279

Query  619  VDA  627
            V A
Sbjct  280  VYA  282



>ref|XP_002001690.1| GI16988 [Drosophila mojavensis]
 gb|EDW11132.1| GI16988 [Drosophila mojavensis]
Length=359

 Score =   145 bits (365),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 115/183 (63%), Gaps = 6/183 (3%)
 Frame = +1

Query  82   FHFFDAYRTIKQRENEASLAVLPDLLMELDGM-NEEMRLLTLIEGVLAANIFDWGSRACV  258
            + F D +   KQ+EN ++ A L   L E+D + NE+ R   L+ GVLA N+FDWG++A  
Sbjct  102  YGFTDPWLRQKQQENASAKARLKQRLQEIDDIANEDARWTELVRGVLAGNMFDWGAQAIA  161

Query  259  DLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERMLGSGETKPRPHKRALLFVDNSGADI  438
             +  + +   ++       QRPW +D+ D + +R+  S       HK A++FVDNSG D+
Sbjct  162  TILEQDSNFGLHAALERIEQRPWLLDNLDAWLQRLHLSP-----AHKCAVIFVDNSGVDV  216

Query  439  VLGMLPLARELLRRGTEVVLVANSLPALNDVTAMELPDIVAEAAKHCGILRGAAEAGGLL  618
            VLG+LP ARELLRRGT+V+L ANS P+LNDVT+ EL +++ + A  C +L  A  +G LL
Sbjct  217  VLGVLPFARELLRRGTKVLLCANSEPSLNDVTSRELSELLDDCACQCDVLDSAWRSGRLL  276

Query  619  VDA  627
            V A
Sbjct  277  VYA  279



>ref|XP_011187412.1| PREDICTED: pantothenate kinase 4 [Bactrocera cucurbitae]
Length=363

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 114/183 (62%), Gaps = 7/183 (4%)
 Frame = +1

Query  82   FHFFDAYRTIKQRENEASLAVLPDLLMELDGMNEEM-RLLTLIEGVLAANIFDWGSRACV  258
            F F D ++  KQ EN A++A L   L+ELD + +   R   L+ GVLA N+FDWG++A  
Sbjct  107  FGFDDPWKQQKQLENTAAIATLKSRLLELDAIEDNAARWTELVRGVLAGNMFDWGAQAVA  166

Query  259  DLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERMLGSGETKPRPHKRALLFVDNSGADI  438
             + ++ +   ++       +RPW +D+ D + +R+ G+       HK AL+FVDNSG D+
Sbjct  167  TILNEDSNFGLHAALERIQKRPWLIDNLDAWLQRLRGNA------HKCALIFVDNSGVDV  220

Query  439  VLGMLPLARELLRRGTEVVLVANSLPALNDVTAMELPDIVAEAAKHCGILRGAAEAGGLL  618
            +LG+LP  R LL+RGT+V+L AN+ P+LNDVT+ EL +++ +   HC +L  A +   LL
Sbjct  221  ILGILPFVRALLQRGTKVLLCANTEPSLNDVTSGELTELLDQCCIHCSVLAKARQEQNLL  280

Query  619  VDA  627
            V A
Sbjct  281  VYA  283



>ref|XP_010727835.1| PREDICTED: pantothenate kinase 4 isoform X1 [Larimichthys crocea]
Length=785

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 110/181 (61%), Gaps = 6/181 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  IKQ+EN+ +L      +  L+ +  
Sbjct  491  LRHQPFAYGSLTVRSLLDTREHCLNEFNFPDPYSKIKQKENDIALKYYQKAMKSLEELTW  550

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R   L+ GVLA N+FDWG++A  D+             R   +RPW VD +D++ ER+
Sbjct  551  EERQFALVRGVLAGNVFDWGAKAVSDVLESDPEFGFEEAKRQLEERPWLVDSYDQWLERL  610

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL FVDNSG DI+LG++P  RELL RGTEVVL +NS PALNDVT  E
Sbjct  611  KGP------PHKCALFFVDNSGVDIILGVIPFVRELLSRGTEVVLASNSGPALNDVTNGE  664

Query  544  L  546
            L
Sbjct  665  L  665



>ref|XP_010727836.1| PREDICTED: pantothenate kinase 4 isoform X2 [Larimichthys crocea]
Length=783

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 110/181 (61%), Gaps = 6/181 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  IKQ+EN+ +L      +  L+ +  
Sbjct  489  LRHQPFAYGSLTVRSLLDTREHCLNEFNFPDPYSKIKQKENDIALKYYQKAMKSLEELTW  548

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R   L+ GVLA N+FDWG++A  D+             R   +RPW VD +D++ ER+
Sbjct  549  EERQFALVRGVLAGNVFDWGAKAVSDVLESDPEFGFEEAKRQLEERPWLVDSYDQWLERL  608

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL FVDNSG DI+LG++P  RELL RGTEVVL +NS PALNDVT  E
Sbjct  609  KGP------PHKCALFFVDNSGVDIILGVIPFVRELLSRGTEVVLASNSGPALNDVTNGE  662

Query  544  L  546
            L
Sbjct  663  L  663



>ref|XP_007943625.1| PREDICTED: pantothenate kinase 4 [Orycteropus afer afer]
Length=773

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 118/206 (57%), Gaps = 6/206 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  +KQ+EN  +L     ++  LD +  
Sbjct  491  LRHQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQKENGVALKCFQRVVQSLDALGW  550

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L+EG+LA N+FDWG++A  D+             R   +RPW VD ++E+ +R+
Sbjct  551  EERQLALVEGLLAGNVFDWGAKAVSDVLESDPQFGFEEAKRKLQERPWLVDSYNEWLQRL  610

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  611  KGP------PHKCALIFADNSGVDIILGVFPFVRELLFRGTEVILACNSGPALNDVTYSE  664

Query  544  LPDIVAEAAKHCGILRGAAEAGGLLV  621
               +    A    I+  A E   LL+
Sbjct  665  SLIVAERIAAMDPIIHSALEEERLLL  690



>ref|XP_007228566.1| PREDICTED: pantothenate kinase 4-like isoform X2 [Astyanax mexicanus]
Length=779

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 115/187 (61%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  IKQREN+ +L     ++  L+ ++ 
Sbjct  492  LRHQPFAYGSLTVRSLLDTREHCLNEFNFPDPYSKIKQRENDMALKYYQKVVRSLEELSW  551

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R   L+ G+LA N+FDWG++A  D+          +  +   +RPW VD ++++ ER+
Sbjct  552  EQRQFALVRGILAGNVFDWGAKAVSDVLESDPEFGFEQAKQQLQERPWLVDAYNQWVERL  611

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL FVDNSG DI+LG+ P  RELL RGTEVVL +NS PALNDVT  E
Sbjct  612  KGP------PHKCALFFVDNSGMDIILGVFPFVRELLLRGTEVVLASNSGPALNDVTNSE  665

Query  544  LPDIVAE  564
            L  IV E
Sbjct  666  L-QIVTE  671



>ref|XP_007228565.1| PREDICTED: pantothenate kinase 4-like isoform X1 [Astyanax mexicanus]
Length=781

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 115/187 (61%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  IKQREN+ +L     ++  L+ ++ 
Sbjct  494  LRHQPFAYGSLTVRSLLDTREHCLNEFNFPDPYSKIKQRENDMALKYYQKVVRSLEELSW  553

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R   L+ G+LA N+FDWG++A  D+          +  +   +RPW VD ++++ ER+
Sbjct  554  EQRQFALVRGILAGNVFDWGAKAVSDVLESDPEFGFEQAKQQLQERPWLVDAYNQWVERL  613

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL FVDNSG DI+LG+ P  RELL RGTEVVL +NS PALNDVT  E
Sbjct  614  KGP------PHKCALFFVDNSGMDIILGVFPFVRELLLRGTEVVLASNSGPALNDVTNSE  667

Query  544  LPDIVAE  564
            L  IV E
Sbjct  668  L-QIVTE  673



>ref|XP_007228567.1| PREDICTED: pantothenate kinase 4-like isoform X3 [Astyanax mexicanus]
Length=778

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 115/187 (61%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  IKQREN+ +L     ++  L+ ++ 
Sbjct  491  LRHQPFAYGSLTVRSLLDTREHCLNEFNFPDPYSKIKQRENDMALKYYQKVVRSLEELSW  550

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R   L+ G+LA N+FDWG++A  D+          +  +   +RPW VD ++++ ER+
Sbjct  551  EQRQFALVRGILAGNVFDWGAKAVSDVLESDPEFGFEQAKQQLQERPWLVDAYNQWVERL  610

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL FVDNSG DI+LG+ P  RELL RGTEVVL +NS PALNDVT  E
Sbjct  611  KGP------PHKCALFFVDNSGMDIILGVFPFVRELLLRGTEVVLASNSGPALNDVTNSE  664

Query  544  LPDIVAE  564
            L  IV E
Sbjct  665  L-QIVTE  670



>ref|XP_001520417.3| PREDICTED: pantothenate kinase 4, partial [Ornithorhynchus anatinus]
Length=463

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 112/187 (60%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  +KQ+EN  +L     ++  LD +  
Sbjct  274  LRHQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQKENGIALKCFQRVISSLDSLGW  333

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R   L++G+LA N+FDWG++A  D+             R   +RPW VD +D + ERM
Sbjct  334  EERQFALVKGLLAGNVFDWGAKAVSDVLESEPHFGFEEAKRKLQERPWLVDSYDVWLERM  393

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG DI+LG+ PL RELL RGTEV+L  NS PALNDVT  E
Sbjct  394  KGP------PHKCALIFADNSGIDIILGVFPLVRELLFRGTEVILACNSGPALNDVTYSE  447

Query  544  LPDIVAE  564
               IVAE
Sbjct  448  -SLIVAE  453



>ref|XP_008998534.1| PREDICTED: pantothenate kinase 4 [Callithrix jacchus]
Length=781

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 114/187 (61%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  +KQREN  +L   P ++  LD +  
Sbjct  499  LRQQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQRENGVALRCFPGVVRSLDALGW  558

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A  D+             R   +RPW VD + ++ +R+
Sbjct  559  EERQLALVKGLLAGNVFDWGAKAVSDVLESDPHFGFEEAKRKLQERPWLVDSYSKWLQRL  618

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  619  KGP------PHKCALIFADNSGIDIILGVFPFVRELLLRGTEVILACNSGPALNDVTHSE  672

Query  544  LPDIVAE  564
               IVAE
Sbjct  673  -SLIVAE  678



>ref|XP_011431671.1| PREDICTED: pantothenate kinase 4-like [Crassostrea gigas]
 gb|EKC32144.1| Pantothenate kinase 4 [Crassostrea gigas]
Length=776

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 115/191 (60%), Gaps = 9/191 (5%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L E P AYG L +  LL+     L+EF F D Y  +KQ ENE SL  L +   EL+ M+ 
Sbjct  489  LKENPCAYGSLTVRSLLDTSSHYLQEFMFNDPYLQLKQTENEHSLKYLAEYFQELERMDF  548

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQ-RPWRVDDFDEFKER  360
            E R L L +GV+A N+FDWG+R    +    +    ++ +  K+Q RPW  DDFD +  R
Sbjct  549  EDRQLALAKGVIAGNVFDWGAREVTQIMETQSFG--FKEATEKLQERPWLFDDFDAWLSR  606

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            + G      +PHK A +FVDNSGADI+LG+ P  R++L RGT+V+L ANS PALNDV   
Sbjct  607  IKG------KPHKCAAIFVDNSGADIILGIFPFIRDMLSRGTKVILCANSRPALNDVIYN  660

Query  541  ELPDIVAEAAK  573
            EL  +V   A+
Sbjct  661  ELVILVKRVAE  671



>ref|XP_009304208.1| PREDICTED: pantothenate kinase 4 isoform X8 [Danio rerio]
Length=389

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 118/198 (60%), Gaps = 6/198 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  IKQ+EN+ +L     ++  ++ ++ 
Sbjct  102  LRHQPFAYGSLTVRSLLDTREHCLNEFNFPDPYSKIKQKENDMALKYYLKVVKSVEELSW  161

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R   L++G+LA N+FDWG++A  D+          +  +   +RPW VD + ++ ERM
Sbjct  162  EQRQFALVKGLLAGNVFDWGAKAVSDVLETDPEFGFEQAKQQLQERPWLVDAYSQWIERM  221

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL FVDNSG DI+LG+ P  RELL RGTEVVL +NS PALNDVT  E
Sbjct  222  KGP------PHKCALFFVDNSGIDIILGVFPFIRELLLRGTEVVLASNSGPALNDVTNSE  275

Query  544  LPDIVAEAAKHCGILRGA  597
            L  +    A    +++ A
Sbjct  276  LQILTERIAAMDPVIQSA  293



>dbj|BAG58281.1| unnamed protein product [Homo sapiens]
Length=781

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 113/187 (60%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  +KQREN  +L   P ++  LD +  
Sbjct  499  LRQQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQRENGVALRCFPGVVRSLDALGW  558

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A   +             R   +RPW VD + E+ +R+
Sbjct  559  EERQLALVKGLLAGNVFDWGAKAVSAVLESDPYFGFEEAKRKLQERPWLVDSYSEWLQRL  618

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  619  KGP------PHKCALIFADNSGIDIILGVFPFVRELLLRGTEVILACNSGPALNDVTHSE  672

Query  544  LPDIVAE  564
               IVAE
Sbjct  673  -SLIVAE  678



>sp|Q9NVE7.1|PANK4_HUMAN RecName: Full=Pantothenate kinase 4; Short=hPanK4; AltName: Full=Pantothenic 
acid kinase 4 [Homo sapiens]
 dbj|BAA91805.1| unnamed protein product [Homo sapiens]
 tpg|DAA00006.1| TPA_exp: pantothenate kinase 4; PANK4 [Homo sapiens]
 gb|AAH43496.1| Pantothenate kinase 4 [Homo sapiens]
 gb|EAW56097.1| pantothenate kinase 4, isoform CRA_a [Homo sapiens]
 gb|AIC51744.1| PANK4, partial [synthetic construct]
Length=773

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 113/187 (60%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  +KQREN  +L   P ++  LD +  
Sbjct  491  LRQQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQRENGVALRCFPGVVRSLDALGW  550

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A   +             R   +RPW VD + E+ +R+
Sbjct  551  EERQLALVKGLLAGNVFDWGAKAVSAVLESDPYFGFEEAKRKLQERPWLVDSYSEWLQRL  610

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  611  KGP------PHKCALIFADNSGIDIILGVFPFVRELLLRGTEVILACNSGPALNDVTHSE  664

Query  544  LPDIVAE  564
               IVAE
Sbjct  665  -SLIVAE  670



>dbj|BAD97266.1| pantothenate kinase 4 variant [Homo sapiens]
Length=773

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 113/187 (60%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  +KQREN  +L   P ++  LD +  
Sbjct  491  LRQQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQRENGVALRCFPGVVRSLDALGW  550

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A   +             R   +RPW VD + E+ +R+
Sbjct  551  EERQLALVKGLLAGNVFDWGAKAVSAVLESDPYFGFEEAKRKLQERPWLVDSYSEWLQRL  610

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  611  KGP------PHKCALIFADNSGIDIILGVFPFVRELLLRGTEVILACNSGPALNDVTHSE  664

Query  544  LPDIVAE  564
               IVAE
Sbjct  665  -SLIVAE  670



>ref|XP_001619295.1| hypothetical protein NEMVEDRAFT_v1g151759 [Nematostella vectensis]
 gb|EDO27195.1| predicted protein, partial [Nematostella vectensis]
Length=278

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 110/181 (61%), Gaps = 3/181 (2%)
 Frame = +1

Query  82   FHFFDAYRTIKQRENEASLAVLPDLLMELDGMNEEMRLLTLIEGVLAANIFDWGSRACVD  261
            F F D Y  +KQ+ENE +L +    + ELD M  E R + L+ G+LA N+FDWG+R   D
Sbjct  12   FDFPDPYAELKQQENEEALKMFTRRIRELDKMESEQRQIALVRGMLAGNVFDWGAREVSD  71

Query  262  LYHKGTIIEIYRMSRNKMQRPWRVDDFDEF--KERMLGSGETKPRPHKRALLFVDNSGAD  435
            L  K  +     M R +  RPW  DD DE+  + ++      +  P+K A++FVDNSG D
Sbjct  72   LMEKNLLGFDTAMDRLE-ARPWLKDDLDEWISRTKLASVICLQGPPYKLAVVFVDNSGVD  130

Query  436  IVLGMLPLARELLRRGTEVVLVANSLPALNDVTAMELPDIVAEAAKHCGILRGAAEAGGL  615
            I+LG++P  REL+ RGT+V+L ANS PALNDV   EL  ++   AK C  L+ A ++G L
Sbjct  131  IILGVMPFVRELVSRGTKVILAANSYPALNDVMHGELVILIERLAKLCPALKSAVKSGRL  190

Query  616  L  618
            +
Sbjct  191  V  191



>ref|NP_060686.2| pantothenate kinase 4 [Homo sapiens]
Length=781

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 113/187 (60%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  +KQREN  +L   P ++  LD +  
Sbjct  499  LRQQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQRENGVALRCFPGVVRSLDALGW  558

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A   +             R   +RPW VD + E+ +R+
Sbjct  559  EERQLALVKGLLAGNVFDWGAKAVSAVLESDPYFGFEEAKRKLQERPWLVDSYSEWLQRL  618

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  619  KGP------PHKCALIFADNSGIDIILGVFPFVRELLLRGTEVILACNSGPALNDVTHSE  672

Query  544  LPDIVAE  564
               IVAE
Sbjct  673  -SLIVAE  678



>ref|XP_006642013.1| PREDICTED: pantothenate kinase 4-like [Lepisosteus oculatus]
Length=770

 Score =   148 bits (373),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 112/181 (62%), Gaps = 6/181 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  IKQREN+ +L     ++  L+ ++ 
Sbjct  487  LRHQPFAYGSLTVRSLLDTREHCLNEFNFPDPYSKIKQRENDLALKYFQKVVKSLEVLSW  546

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R   L++G+LA N+FDWG++A  D+             +   +RPW VD ++E+ ER+
Sbjct  547  EERQFALVKGLLAGNVFDWGAKAVSDVLESDAGFGFEEAKQKLQERPWLVDSYNEWIERL  606

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL FVDNSG DI+LG+ P  RELL RGTEVVL +NS PALNDVT  E
Sbjct  607  KGP------PHKCALFFVDNSGIDIILGVFPFVRELLCRGTEVVLASNSGPALNDVTYSE  660

Query  544  L  546
            L
Sbjct  661  L  661



>ref|XP_006885881.1| PREDICTED: pantothenate kinase 4 isoform X2 [Elephantulus edwardii]
Length=734

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 118/206 (57%), Gaps = 6/206 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  +KQ+EN  +L     ++  LD +  
Sbjct  452  LRHQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQKENGVALKCFQRVVQSLDTLGW  511

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L+EG+LA N+FDWG++A  D+             R   +RPW VD ++E+ +R+
Sbjct  512  EERQLALVEGLLAGNVFDWGAKAVSDVLESDPQFGFEEAKRKLQERPWLVDSYNEWLQRL  571

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  572  KGP------PHKCALIFADNSGVDIILGVFPFIRELLFRGTEVILACNSGPALNDVTHSE  625

Query  544  LPDIVAEAAKHCGILRGAAEAGGLLV  621
               +    A    I+  A E   LL+
Sbjct  626  SLIVAERIAAMDPIIHSALEEDRLLL  651



>ref|XP_006871793.1| PREDICTED: pantothenate kinase 4 [Chrysochloris asiatica]
Length=777

 Score =   148 bits (373),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 113/187 (60%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  +KQ+EN  +L     ++  LD +  
Sbjct  495  LRHQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQKENGVALKCFQRVVQSLDTLGW  554

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L+EG+LA N+FDWG++A  D+             R   +RPW VD ++E+ +R+
Sbjct  555  EERQLALVEGLLAGNVFDWGAKAVSDVLESDPQFGFEEAKRKLQERPWLVDSYNEWLQRL  614

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  615  KGP------PHKCALIFADNSGVDIILGVFPFVRELLCRGTEVILACNSGPALNDVTYSE  668

Query  544  LPDIVAE  564
               IVAE
Sbjct  669  -SLIVAE  674



>ref|XP_006885880.1| PREDICTED: pantothenate kinase 4 isoform X1 [Elephantulus edwardii]
Length=773

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 118/206 (57%), Gaps = 6/206 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  +KQ+EN  +L     ++  LD +  
Sbjct  491  LRHQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQKENGVALKCFQRVVQSLDTLGW  550

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L+EG+LA N+FDWG++A  D+             R   +RPW VD ++E+ +R+
Sbjct  551  EERQLALVEGLLAGNVFDWGAKAVSDVLESDPQFGFEEAKRKLQERPWLVDSYNEWLQRL  610

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  611  KGP------PHKCALIFADNSGVDIILGVFPFIRELLFRGTEVILACNSGPALNDVTHSE  664

Query  544  LPDIVAEAAKHCGILRGAAEAGGLLV  621
               +    A    I+  A E   LL+
Sbjct  665  SLIVAERIAAMDPIIHSALEEDRLLL  690



>ref|XP_005645866.1| hypothetical protein COCSUDRAFT_53962 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21322.1| hypothetical protein COCSUDRAFT_53962 [Coccomyxa subellipsoidea 
C-169]
Length=377

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 109/169 (64%), Gaps = 10/169 (6%)
 Frame = +1

Query  88   FFDAYRTIKQRENEASLAVLPDLLMELDGMNE-EMRLLTLIEGVLAANIFDWGSRACVDL  264
            F D +R++K  EN+ +LA+LP+LL ELD + +   RL T++ GV A NIFD G+ +  DL
Sbjct  123  FEDVFRSVKAEENDKALALLPELLRELDSITDHSQRLETVLRGVFAGNIFDLGAASSADL  182

Query  265  YH-KGTIIEIYRMSRNKMQRPWRVDDFDEFKERMLGSGETKPRPHKRALLFVDNSGADIV  441
            +   G   +  R   N + RPW VDD D   +        K + + +ALLFVDN+G+D++
Sbjct  183  FSANGAAFDSTRA--NLLARPWAVDDLDTILDIY------KQKHYSKALLFVDNAGSDVI  234

Query  442  LGMLPLARELLRRGTEVVLVANSLPALNDVTAMELPDIVAEAAKHCGIL  588
            LGMLPLARELL+RGT VVL ANS P++ND+TA EL  +V  AA    IL
Sbjct  235  LGMLPLARELLQRGTAVVLAANSQPSINDITADELQGVVQRAAPSDAIL  283



>dbj|BAG64233.1| unnamed protein product [Homo sapiens]
Length=734

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 113/187 (60%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  +KQREN  +L   P ++  LD +  
Sbjct  452  LRQQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQRENGVALRCFPGVVRSLDVLGW  511

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A   +             R   +RPW VD + E+ +R+
Sbjct  512  EERQLALVKGLLAGNVFDWGAKAVFAVLESDPYFGFEEAKRKLQERPWLVDSYSEWLQRL  571

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  572  KGP------PHKCALIFADNSGIDIILGVFPFVRELLLRGTEVILACNSGPALNDVTHSE  625

Query  544  LPDIVAE  564
               IVAE
Sbjct  626  -SLIVAE  631



>ref|XP_004473587.1| PREDICTED: pantothenate kinase 4 [Dasypus novemcinctus]
Length=745

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 108/180 (60%), Gaps = 6/180 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF F D Y  +KQ+EN  +L   P +L  LD +  
Sbjct  491  LRQQPFAYGTLTVRSLLDTREHCLNEFSFPDPYSKVKQKENGVALKCFPSVLRGLDALCW  550

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG+RA  D+             R    RPW VD + E+ +R+
Sbjct  551  EDRQLALVQGLLAGNVFDWGARAVSDVLESDPQFGFEEAKRKLQARPWLVDSYGEWLQRL  610

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG D++LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  611  KGP------PHKCALIFADNSGIDLILGVFPFVRELLFRGTEVILACNSGPALNDVTHSE  664



>ref|XP_003939688.1| PREDICTED: pantothenate kinase 4 [Saimiri boliviensis boliviensis]
Length=781

 Score =   147 bits (372),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 112/187 (60%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF F D Y  +KQREN  +L   P ++  LD +  
Sbjct  499  LRQQPFAYGTLTVRSLLDTREHCLNEFSFPDPYSKVKQRENGVALRCFPGVVRSLDALGW  558

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A  D+             R   +RPW VD +  + +R+
Sbjct  559  EERQLALVKGLLAGNVFDWGAKAVSDVLESDPHFGFEEAKRKLQERPWLVDSYSRWLQRL  618

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  619  KGP------PHKCALIFADNSGIDIILGVFPFVRELLLRGTEVILACNSGPALNDVTHSE  672

Query  544  LPDIVAE  564
               IVAE
Sbjct  673  -SLIVAE  678



>ref|XP_006299387.1| hypothetical protein CARUB_v10015546mg [Capsella rubella]
 gb|EOA32285.1| hypothetical protein CARUB_v10015546mg [Capsella rubella]
Length=361

 Score =   143 bits (361),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 112/181 (62%), Gaps = 8/181 (4%)
 Frame = +1

Query  88   FFDAYRTIKQRENEASLAVLPDLLMELDGMNEEM-RLLTLIEGVLAANIFDWGSRACVDL  264
            F D ++ +K  EN  ++++ P+++   D + ++  RL  L+ G+ A NIFD GS    ++
Sbjct  110  FMDIFKKVKDEENAKAISLFPEVVSLSDAIEDDTERLENLVRGIFAGNIFDLGSAQLAEV  169

Query  265  YHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERMLGSGETKPRPHKRALLFVDNSGADIVL  444
            + +  I       +N + RPW +DD D F+ + +       RP K+A++FVDNSGADI+L
Sbjct  170  FSRDGI-SFLASCQNLVPRPWVIDDLDNFQTKWIK------RPWKKAVIFVDNSGADIIL  222

Query  445  GMLPLARELLRRGTEVVLVANSLPALNDVTAMELPDIVAEAAKHCGILRGAAEAGGLLVD  624
            G+LP ARELLRRGT+VVL AN LPA+NDVT  EL DIV++     G L G   +  L+ +
Sbjct  223  GILPFARELLRRGTQVVLAANELPAINDVTYTELTDIVSQLKDENGQLLGVDTSKLLIAN  282

Query  625  A  627
            +
Sbjct  283  S  283



>ref|XP_004425561.1| PREDICTED: pantothenate kinase 4 [Ceratotherium simum simum]
Length=773

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 112/187 (60%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  +KQREN  +L     ++  LD +  
Sbjct  491  LRHQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQRENGVALKSFQSVIRTLDALGW  550

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L LIEG+LA N+FDWG++A  D+             R   +RPW VD + ++ +R+
Sbjct  551  EERQLALIEGLLAGNVFDWGAKAVSDVLESDPQFGFEEAKRKLQERPWLVDTYSKWLQRL  610

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG D++LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  611  KGP------PHKCALIFADNSGVDVILGVFPFVRELLSRGTEVILACNSGPALNDVTYSE  664

Query  544  LPDIVAE  564
               IVAE
Sbjct  665  -SLIVAE  670



>ref|XP_001989026.1| GH11492 [Drosophila grimshawi]
 gb|EDW03893.1| GH11492 [Drosophila grimshawi]
Length=370

 Score =   143 bits (361),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 109/173 (63%), Gaps = 3/173 (2%)
 Frame = +1

Query  82   FHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE-EMRLLTLIEGVLAANIFDWGSRACV  258
            F F D +R  KQ+EN ++   L   L E+D + + + R   L+ GVLA N+FDWG++A  
Sbjct  108  FGFSDPWRRQKQQENASAKGRLKQRLQEIDAITDGDARWTELVRGVLAGNMFDWGAQAVA  167

Query  259  DLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERMLGSGETKPRPHKRALLFVDNSGADI  438
             +  + +   ++       QRPW +D+ D + +RM  S E +   HK A++FVDNSG D+
Sbjct  168  TILEQDSNFGLHAALERIEQRPWLLDNLDAWLQRMRNSPEQQA--HKCAVVFVDNSGVDV  225

Query  439  VLGMLPLARELLRRGTEVVLVANSLPALNDVTAMELPDIVAEAAKHCGILRGA  597
            VLG+LP  RELLRRGT+V+L ANS P+LNDVT++EL  ++ E A  C IL  A
Sbjct  226  VLGILPFVRELLRRGTKVLLCANSEPSLNDVTSVELSLLLDECACECSILAHA  278



>ref|XP_003793256.1| PREDICTED: pantothenate kinase 4 isoform 2 [Otolemur garnettii]
Length=734

 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 86/187 (46%), Positives = 113/187 (60%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  +KQ+EN  +L   P  +  LD +  
Sbjct  452  LRQQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQKENGIALKCFPKTVHSLDSLGW  511

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A  D+             R   +RPW VD + ++ +R+
Sbjct  512  EERQLALVKGLLAGNVFDWGAKAVSDVLESDPQFGFEEAKRKLQERPWLVDTYSKWLQRL  571

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  572  KGP------PHKCALIFADNSGIDIILGVFPFVRELLLRGTEVILACNSGPALNDVTYSE  625

Query  544  LPDIVAE  564
               IVAE
Sbjct  626  AL-IVAE  631



>ref|XP_003413554.1| PREDICTED: pantothenate kinase 4 [Loxodonta africana]
Length=773

 Score =   147 bits (371),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 86/187 (46%), Positives = 113/187 (60%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  +KQ+EN  +L     ++  LD +  
Sbjct  491  LRHQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQKENGVALKCFQRVIQSLDALGW  550

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L+EG+LA N+FDWG++A  D+             R   +RPW VD ++++ +R+
Sbjct  551  EERQLALVEGLLAGNVFDWGAKAVSDVLESDPQFGFEEAKRKLQERPWLVDSYNDWLQRL  610

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  611  KGP------PHKCALIFADNSGVDIILGVFPFVRELLFRGTEVILACNSGPALNDVTYSE  664

Query  544  LPDIVAE  564
               IVAE
Sbjct  665  -SLIVAE  670



>ref|XP_004384378.1| PREDICTED: pantothenate kinase 4 [Trichechus manatus latirostris]
Length=773

 Score =   147 bits (371),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 86/187 (46%), Positives = 113/187 (60%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  +KQ+EN  +L     ++  LD +  
Sbjct  491  LRHQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQKENGVALKCFQQVVRSLDALGW  550

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L+EG+LA N+FDWG++A  D+             R   +RPW VD ++++ +R+
Sbjct  551  EERQLALVEGLLAGNVFDWGAKAVSDVLESDPQFGFEEAKRKLQERPWLVDSYNDWLQRL  610

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  611  KGP------PHKCALIFADNSGVDIILGVFPFVRELLFRGTEVILACNSGPALNDVTYSE  664

Query  544  LPDIVAE  564
               IVAE
Sbjct  665  -SLIVAE  670



>ref|XP_004705533.1| PREDICTED: pantothenate kinase 4 [Echinops telfairi]
Length=773

 Score =   147 bits (370),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 108/180 (60%), Gaps = 6/180 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF F D Y  +KQ+EN A+L     ++  LD +  
Sbjct  491  LRHQPFAYGTLTVRSLLDTREHCLNEFSFPDPYSKVKQKENGAALKCFLRVVQALDALGW  550

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L+EG+LA N+FDWG++A  ++             R    RPW VD +DE+ +R+
Sbjct  551  EERQLVLVEGLLAGNVFDWGAKAISNVLESDPQFGFEEAKRKLQARPWLVDSYDEWLQRL  610

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  611  KGP------PHKCALIFADNSGVDIILGVFPFVRELLCRGTEVILACNSGPALNDVTYSE  664



>ref|XP_003793255.1| PREDICTED: pantothenate kinase 4 isoform 1 [Otolemur garnettii]
Length=773

 Score =   147 bits (370),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 86/187 (46%), Positives = 113/187 (60%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  +KQ+EN  +L   P  +  LD +  
Sbjct  491  LRQQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQKENGIALKCFPKTVHSLDSLGW  550

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A  D+             R   +RPW VD + ++ +R+
Sbjct  551  EERQLALVKGLLAGNVFDWGAKAVSDVLESDPQFGFEEAKRKLQERPWLVDTYSKWLQRL  610

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  611  KGP------PHKCALIFADNSGIDIILGVFPFVRELLLRGTEVILACNSGPALNDVTYSE  664

Query  544  LPDIVAE  564
               IVAE
Sbjct  665  AL-IVAE  670



>ref|XP_004596209.1| PREDICTED: pantothenate kinase 4 [Ochotona princeps]
Length=736

 Score =   146 bits (369),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 82/180 (46%), Positives = 110/180 (61%), Gaps = 6/180 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  +KQREN  +L     ++  LD +  
Sbjct  454  LRQQPCAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQRENGVALRCFQSVIRALDALAW  513

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A  D+             R   +RPW VD ++E+ +R 
Sbjct  514  EERQLALVKGLLAGNVFDWGAKAVSDVLESDPNFGFEEAKRKLQERPWLVDSYNEWLQR-  572

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
                 +K  PHK AL+F DNSG D++LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  573  -----SKGPPHKCALIFADNSGVDLILGVFPFVRELLLRGTEVILACNSGPALNDVTHSE  627



>emb|CAC09438.1| hypothetical protein [Homo sapiens]
Length=768

 Score =   147 bits (370),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 113/187 (60%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  +KQREN  +L   P ++  LD +  
Sbjct  486  LRQQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQRENGVALRCFPGVVRSLDVLGW  545

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A   +             R   +RPW VD + E+ +R+
Sbjct  546  EERQLALVKGLLAGNVFDWGAKAVSAVLESDPYFGFEEAKRKLQERPWLVDSYSEWLQRL  605

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  606  KGP------PHKCALIFADNSGIDIILGVFPFVRELLLRGTEVILACNSGPALNDVTHSE  659

Query  544  LPDIVAE  564
               IVAE
Sbjct  660  -SLIVAE  665



>ref|XP_011200749.1| PREDICTED: pantothenate kinase 4 [Bactrocera dorsalis]
Length=363

 Score =   142 bits (359),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 113/183 (62%), Gaps = 7/183 (4%)
 Frame = +1

Query  82   FHFFDAYRTIKQRENEASLAVLPDLLMELDGMNEEM-RLLTLIEGVLAANIFDWGSRACV  258
            F F D ++  K  EN A++A L   L ELD +++   R   L+ GVLA N+FDWG++A  
Sbjct  107  FGFDDPWKQQKLLENTAAVANLKKRLEELDAIDDNAARWTELVRGVLAGNMFDWGAQAVA  166

Query  259  DLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERMLGSGETKPRPHKRALLFVDNSGADI  438
             + ++ T   ++       +RPW +D+ D + +R+ G+       HK AL+FVDNSG D+
Sbjct  167  SILNEDTNFGLHAALERIQKRPWLIDNLDAWLQRLRGNA------HKCALIFVDNSGVDV  220

Query  439  VLGMLPLARELLRRGTEVVLVANSLPALNDVTAMELPDIVAEAAKHCGILRGAAEAGGLL  618
            VLGMLP  R LL+RGT+V+L AN+ P+LNDVT+ EL +++ +   HC +L  A +   LL
Sbjct  221  VLGMLPFVRALLQRGTKVLLCANTEPSLNDVTSGELSELLDKCCIHCSVLAKAKQEQNLL  280

Query  619  VDA  627
            V A
Sbjct  281  VYA  283



>ref|XP_008319266.1| PREDICTED: pantothenate kinase 4 isoform X3 [Cynoglossus semilaevis]
Length=783

 Score =   147 bits (370),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 115/189 (61%), Gaps = 6/189 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  IK++EN+ +L     ++  L+ +  
Sbjct  489  LRHQPFAYGSLTVRSLLDTREHCLNEFNFPDPYLKIKEKENDMALKYYLKVVKSLEELGW  548

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L+ GVLA N+FDWG++A  D+             R   +RPW VD +D++ +R+
Sbjct  549  EQRQLALVRGVLAGNVFDWGAKAVSDVLESDPEFGFEEAKRQLEERPWLVDSYDQWLQRL  608

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL FVDNSG DI+LG++P  RELL RGTEVVL +NS PALNDVT  E
Sbjct  609  KGP------PHKCALFFVDNSGMDIILGVMPFVRELLSRGTEVVLASNSGPALNDVTNGE  662

Query  544  LPDIVAEAA  570
            L  ++   A
Sbjct  663  LQILIERIA  671



>ref|XP_008319264.1| PREDICTED: pantothenate kinase 4 isoform X1 [Cynoglossus semilaevis]
Length=785

 Score =   146 bits (369),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 115/189 (61%), Gaps = 6/189 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  IK++EN+ +L     ++  L+ +  
Sbjct  491  LRHQPFAYGSLTVRSLLDTREHCLNEFNFPDPYLKIKEKENDMALKYYLKVVKSLEELGW  550

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L+ GVLA N+FDWG++A  D+             R   +RPW VD +D++ +R+
Sbjct  551  EQRQLALVRGVLAGNVFDWGAKAVSDVLESDPEFGFEEAKRQLEERPWLVDSYDQWLQRL  610

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL FVDNSG DI+LG++P  RELL RGTEVVL +NS PALNDVT  E
Sbjct  611  KGP------PHKCALFFVDNSGMDIILGVMPFVRELLSRGTEVVLASNSGPALNDVTNGE  664

Query  544  LPDIVAEAA  570
            L  ++   A
Sbjct  665  LQILIERIA  673



>ref|XP_008067465.1| PREDICTED: pantothenate kinase 4 [Tarsius syrichta]
Length=773

 Score =   146 bits (369),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 113/187 (60%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  +KQ+EN  +L   P ++  LD ++ 
Sbjct  491  LRHQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQKENGLALKCFPGVIRSLDALSW  550

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A  D+             R   +RPW VD   E+ +R+
Sbjct  551  EDRQLALVKGLLAGNVFDWGAKAVSDVLESDPQFGFEEAKRKLQERPWLVDSCSEWLQRL  610

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  611  KGP------PHKCALIFADNSGIDIILGVFPFVRELLFRGTEVILACNSGPALNDVTHSE  664

Query  544  LPDIVAE  564
               IVAE
Sbjct  665  -SLIVAE  670



>ref|XP_004319339.1| PREDICTED: pantothenate kinase 4 [Tursiops truncatus]
Length=720

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 85/206 (41%), Positives = 119/206 (58%), Gaps = 6/206 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  +KQ++N  +L     ++  LD +  
Sbjct  438  LRQQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQKDNGVALKCFQRVIHSLDALGW  497

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A  D+             R   +RPW VD + ++ +R+
Sbjct  498  EERQLALVKGLLAGNVFDWGAKAVSDVLESDPQFGFEEAKRKLQERPWLVDSYSKWLQRL  557

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG D++LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  558  KGP------PHKCALIFADNSGVDVILGVFPFVRELLSRGTEVILACNSGPALNDVTYSE  611

Query  544  LPDIVAEAAKHCGILRGAAEAGGLLV  621
               +    A    ++R A   G LL+
Sbjct  612  SLIVAERIAAMDPVVRSALGEGRLLL  637



>ref|XP_005811885.1| PREDICTED: pantothenate kinase 4-like [Xiphophorus maculatus]
Length=774

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 110/181 (61%), Gaps = 6/181 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  IK+REN+ +L      +  L+ ++ 
Sbjct  489  LRHQPFAYGSLTVRSLLDTREHCLNEFNFPDPYSKIKERENDIALKYYQKAVKSLEELSW  548

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R   L+ GVLA N+FDWG++A  ++             R    RPW VD FD++ ER+
Sbjct  549  EDRQFALVRGVLAGNVFDWGAKAVSEVLESNPEFGFEEAKRRLEDRPWLVDSFDQWLERL  608

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PH+ AL FVDNSG DI+LG++P  RELL RGTEVVL +NS PALNDVT  E
Sbjct  609  KGP------PHRCALFFVDNSGVDIILGVIPFVRELLSRGTEVVLASNSGPALNDVTNSE  662

Query  544  L  546
            L
Sbjct  663  L  663



>ref|XP_002886109.1| hypothetical protein ARALYDRAFT_900074 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62368.1| hypothetical protein ARALYDRAFT_900074 [Arabidopsis lyrata subsp. 
lyrata]
Length=361

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 112/183 (61%), Gaps = 8/183 (4%)
 Frame = +1

Query  82   FHFFDAYRTIKQRENEASLAVLPDLLMELDGMNEE-MRLLTLIEGVLAANIFDWGSRACV  258
            F F D ++ +K  EN  ++++ P+++   D + ++  RL  L+ G+ A NIFD GS    
Sbjct  108  FGFKDIFKKVKDEENAKAISLFPEVVSLSDAIEDDGKRLENLVRGIFAGNIFDLGSAQLA  167

Query  259  DLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERMLGSGETKPRPHKRALLFVDNSGADI  438
            + + K  I       +N + RPW +DD D F+ + +       +P K+A++FVDNSGADI
Sbjct  168  EAFSKDGI-SFLATCQNLVPRPWVIDDLDNFQAKWIK------KPWKKAVIFVDNSGADI  220

Query  439  VLGMLPLARELLRRGTEVVLVANSLPALNDVTAMELPDIVAEAAKHCGILRGAAEAGGLL  618
            +LG+LP ARELLRRGT+VVL AN LPA+NDVT  EL DIV++     G L G   +  L+
Sbjct  221  ILGILPFARELLRRGTQVVLAANELPAINDVTYTELTDIVSQLKDGNGQLIGVDTSKLLI  280

Query  619  VDA  627
             ++
Sbjct  281  ANS  283



>ref|XP_007547099.1| PREDICTED: pantothenate kinase 4 [Poecilia formosa]
Length=774

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 110/181 (61%), Gaps = 6/181 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  IK+REN+ +L      +  L+ ++ 
Sbjct  489  LRHQPFAYGSLTVRSLLDTREHCLNEFNFPDPYSKIKERENDIALKYYEKAVKSLEELSW  548

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R   L+ GVLA N+FDWG++A  ++             R    RPW VD FD++ ER+
Sbjct  549  EDRQFALVRGVLAGNVFDWGAKAVSEVLESNPEFGFEEAKRRLEDRPWLVDSFDQWLERL  608

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PH+ AL FVDNSG DI+LG++P  RELL RGTEVVL +NS PALNDVT  E
Sbjct  609  KGP------PHRCALFFVDNSGVDIILGVMPFVRELLSRGTEVVLASNSGPALNDVTNSE  662

Query  544  L  546
            L
Sbjct  663  L  663



>ref|XP_006161261.1| PREDICTED: pantothenate kinase 4 [Tupaia chinensis]
Length=793

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 86/187 (46%), Positives = 113/187 (60%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF F D Y  +KQ+EN  +L     ++  LD ++ 
Sbjct  512  LRHQPFAYGTLTVRSLLDTREHCLNEFSFPDPYSKVKQKENGIALKCFQSVIRSLDSLDW  571

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A  D+             R   +RPW VD ++E+ +R+
Sbjct  572  EERQLALVKGLLAGNVFDWGAKAVSDVLESDPQFGFEEAKRKLQERPWLVDSYNEWLQRL  631

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  632  KGP------PHKCALIFADNSGIDIILGVFPFIRELLFRGTEVILACNSGPALNDVTYSE  685

Query  544  LPDIVAE  564
               IVAE
Sbjct  686  -SLIVAE  691



>ref|XP_008407352.1| PREDICTED: pantothenate kinase 4 isoform X1 [Poecilia reticulata]
Length=778

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 110/181 (61%), Gaps = 6/181 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  IK+REN+ +L      +  L+ ++ 
Sbjct  491  LRHQPFAYGSLTVRSLLDTREHCLNEFNFPDPYSKIKERENDIALKYYEKAVKSLEELSW  550

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R   L+ GVLA N+FDWG++A  ++             R    RPW VD FD++ ER+
Sbjct  551  EDRQFALVRGVLAGNVFDWGAKAVSEVLESNPEFGFEEAKRRLEDRPWLVDSFDQWLERL  610

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PH+ AL FVDNSG DI+LG++P  RELL RGTEVVL +NS PALNDVT  E
Sbjct  611  KGP------PHRCALFFVDNSGVDIILGVMPFVRELLSRGTEVVLASNSGPALNDVTNSE  664

Query  544  L  546
            L
Sbjct  665  L  665



>ref|XP_008407353.1| PREDICTED: pantothenate kinase 4 isoform X2 [Poecilia reticulata]
Length=776

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 110/181 (61%), Gaps = 6/181 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  IK+REN+ +L      +  L+ ++ 
Sbjct  489  LRHQPFAYGSLTVRSLLDTREHCLNEFNFPDPYSKIKERENDIALKYYEKAVKSLEELSW  548

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R   L+ GVLA N+FDWG++A  ++             R    RPW VD FD++ ER+
Sbjct  549  EDRQFALVRGVLAGNVFDWGAKAVSEVLESNPEFGFEEAKRRLEDRPWLVDSFDQWLERL  608

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PH+ AL FVDNSG DI+LG++P  RELL RGTEVVL +NS PALNDVT  E
Sbjct  609  KGP------PHRCALFFVDNSGVDIILGVMPFVRELLSRGTEVVLASNSGPALNDVTNSE  662

Query  544  L  546
            L
Sbjct  663  L  663



>ref|XP_004272348.1| PREDICTED: pantothenate kinase 4 [Orcinus orca]
Length=773

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 85/206 (41%), Positives = 119/206 (58%), Gaps = 6/206 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  +KQ++N  +L     ++  LD +  
Sbjct  491  LRQQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQKDNGVALKCFQRVIHSLDALGW  550

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A  D+             R   +RPW VD + ++ +R+
Sbjct  551  EERQLALVKGLLAGNVFDWGAKAVSDVLESDPQFGFEEAKRKLQERPWLVDSYSKWLQRL  610

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG D++LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  611  KGP------PHKCALIFADNSGVDVILGVFPFVRELLSRGTEVILACNSGPALNDVTYSE  664

Query  544  LPDIVAEAAKHCGILRGAAEAGGLLV  621
               +    A    ++R A   G LL+
Sbjct  665  SLIVAERIAAMDPVVRSALGEGRLLL  690



>ref|XP_004607250.1| PREDICTED: pantothenate kinase 4 [Sorex araneus]
Length=781

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/187 (46%), Positives = 111/187 (59%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  +KQ+EN A+L     ++  LD +  
Sbjct  499  LRHQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQKENGAALKCFQKVVSSLDTLGW  558

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L+ G+LA N+FDWG++A  D+             R   +RPW VD + E+  R+
Sbjct  559  EERQLALVRGLLAGNVFDWGAKAVSDVLESDPQFGFEEAKRKLQERPWLVDSYGEWLRRL  618

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG D++LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  619  RGP------PHKCALIFADNSGVDVILGVFPFVRELLSRGTEVILACNSGPALNDVTYSE  672

Query  544  LPDIVAE  564
               IVAE
Sbjct  673  -SLIVAE  678



>ref|XP_008508488.1| PREDICTED: pantothenate kinase 4, partial [Equus przewalskii]
Length=740

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 85/187 (45%), Positives = 111/187 (59%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF F D Y  +KQREN  +L     ++  LD +  
Sbjct  458  LRHQPFAYGTLTVRSLLDTREHCLNEFSFPDPYSKVKQRENGVALKCFQRVIRSLDALGW  517

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A  D+             R   +RPW VD + ++ +R+
Sbjct  518  EERQLALVKGLLAGNVFDWGAKAVSDVLESDPQFGFEEAKRKLQERPWLVDSYSKWLQRL  577

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG D++LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  578  KGP------PHKCALIFADNSGVDVILGVFPFVRELLSRGTEVILACNSGPALNDVTYSE  631

Query  544  LPDIVAE  564
               IVAE
Sbjct  632  -SLIVAE  637



>ref|XP_008123957.1| PREDICTED: pantothenate kinase 4 [Anolis carolinensis]
Length=272

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 106/180 (59%), Gaps = 6/180 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  +KQ+EN  +L     ++  LD +  
Sbjct  83   LRQQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQKENGIALKCYQSVIESLDSLGW  142

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R   L++G+LA N+FDWG++A  D+                 +RPW  D + E+ ER+
Sbjct  143  EERQFALVKGLLAGNVFDWGAKAVSDVLETEPQFGFEEAKEKLQERPWLEDSYPEWLERL  202

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
                  K  PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  203  ------KAPPHKCALIFADNSGIDIILGVFPFVRELLSRGTEVILACNSGPALNDVTYSE  256



>ref|XP_007449007.1| PREDICTED: pantothenate kinase 4 [Lipotes vexillifer]
Length=773

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 85/206 (41%), Positives = 118/206 (57%), Gaps = 6/206 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  +KQ++N  +L     ++  LD +  
Sbjct  491  LRHQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQKDNGVALKCFQRVIRALDALGW  550

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A  D+             R   +RPW VD + ++ +R+
Sbjct  551  EERQLALVKGLLAGNVFDWGAKAVSDVLESDPQFGFEEAKRQLQERPWLVDSYSKWLQRL  610

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG D++LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  611  KGP------PHKCALIFADNSGVDVILGVFPFVRELLSRGTEVILACNSGPALNDVTYSE  664

Query  544  LPDIVAEAAKHCGILRGAAEAGGLLV  621
               +    A    ++R A   G LL+
Sbjct  665  SLIVAERIAAMDPVVRSALREGRLLL  690



>ref|NP_608907.1| CG5828, isoform A [Drosophila melanogaster]
 ref|NP_001260085.1| CG5828, isoform B [Drosophila melanogaster]
 gb|AAF52219.1| CG5828, isoform A [Drosophila melanogaster]
 gb|ACL87102.1| CG5828-PA, partial [synthetic construct]
 gb|AGB92621.1| CG5828, isoform B [Drosophila melanogaster]
Length=361

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 86/207 (42%), Positives = 127/207 (61%), Gaps = 9/207 (4%)
 Frame = +1

Query  16   PAAYGK--LGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGM-NEE  186
            P   GK  LG ++LL+L E  LR + F D +   K+ EN +++A L   L ELD + +E+
Sbjct  78   PVNKGKVILGTSELLKLNETLLRRYGFTDPWLRQKRLENASAVARLKQRLQELDALADED  137

Query  187  MRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERML  366
             R   L+ GVLA N+FDWG++A  ++  + +   ++       +RPW +D+ D +  R+ 
Sbjct  138  TRWTELVRGVLAGNMFDWGAQAISNILEQDSNFGLHSALDRIEKRPWLLDNLDSWLNRLK  197

Query  367  GSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAMEL  546
            G       PHK A++FVDNSG D+VLG+LP  R LL+RGT+V+L ANS PALNDVT+ EL
Sbjct  198  GE------PHKCAVVFVDNSGVDVVLGVLPFVRGLLKRGTKVLLCANSEPALNDVTSEEL  251

Query  547  PDIVAEAAKHCGILRGAAEAGGLLVDA  627
              ++ + ++ C +L  A   G LLV A
Sbjct  252  KSLLDDCSRECEVLEQAWSKGQLLVYA  278



>ref|XP_009304206.1| PREDICTED: pantothenate kinase 4 isoform X6 [Danio rerio]
Length=748

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 112/181 (62%), Gaps = 6/181 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  IKQ+EN+ +L     ++  ++ ++ 
Sbjct  461  LRHQPFAYGSLTVRSLLDTREHCLNEFNFPDPYSKIKQKENDMALKYYLKVVKSVEELSW  520

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R   L++G+LA N+FDWG++A  D+          +  +   +RPW VD + ++ ERM
Sbjct  521  EQRQFALVKGLLAGNVFDWGAKAVSDVLETDPEFGFEQAKQQLQERPWLVDAYSQWIERM  580

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL FVDNSG DI+LG+ P  RELL RGTEVVL +NS PALNDVT  E
Sbjct  581  KGP------PHKCALFFVDNSGIDIILGVFPFIRELLLRGTEVVLASNSGPALNDVTNSE  634

Query  544  L  546
            L
Sbjct  635  L  635



>ref|XP_009304205.1| PREDICTED: pantothenate kinase 4 isoform X5 [Danio rerio]
Length=752

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 112/181 (62%), Gaps = 6/181 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  IKQ+EN+ +L     ++  ++ ++ 
Sbjct  465  LRHQPFAYGSLTVRSLLDTREHCLNEFNFPDPYSKIKQKENDMALKYYLKVVKSVEELSW  524

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R   L++G+LA N+FDWG++A  D+          +  +   +RPW VD + ++ ERM
Sbjct  525  EQRQFALVKGLLAGNVFDWGAKAVSDVLETDPEFGFEQAKQQLQERPWLVDAYSQWIERM  584

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL FVDNSG DI+LG+ P  RELL RGTEVVL +NS PALNDVT  E
Sbjct  585  KGP------PHKCALFFVDNSGIDIILGVFPFIRELLLRGTEVVLASNSGPALNDVTNSE  638

Query  544  L  546
            L
Sbjct  639  L  639



>ref|XP_008319265.1| PREDICTED: pantothenate kinase 4 isoform X2 [Cynoglossus semilaevis]
Length=784

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 85/189 (45%), Positives = 115/189 (61%), Gaps = 5/189 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  IK++EN+ +L     ++  L+ +  
Sbjct  489  LRHQPFAYGSLTVRSLLDTREHCLNEFNFPDPYLKIKEKENDMALKYYLKVVKSLEELGW  548

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L+ GVLA N+FDWG++A  D+             R   +RPW VD +D++ +R+
Sbjct  549  EQRQLALVRGVLAGNVFDWGAKAVSDVLESDPEFGFEEAKRQLEERPWLVDSYDQWLQRL  608

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
                  +  PHK AL FVDNSG DI+LG++P  RELL RGTEVVL +NS PALNDVT  E
Sbjct  609  -----KQGPPHKCALFFVDNSGMDIILGVMPFVRELLSRGTEVVLASNSGPALNDVTNGE  663

Query  544  LPDIVAEAA  570
            L  ++   A
Sbjct  664  LQILIERIA  672



>ref|XP_002037921.1| GM18528 [Drosophila sechellia]
 gb|EDW54339.1| GM18528 [Drosophila sechellia]
Length=361

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 86/207 (42%), Positives = 127/207 (61%), Gaps = 9/207 (4%)
 Frame = +1

Query  16   PAAYGK--LGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGM-NEE  186
            P   GK  LG ++LL+L E  LR + F D +   K+ EN +++A L   L ELD + +E+
Sbjct  78   PVNKGKVILGTSELLKLNETLLRRYGFADPWLRQKRLENASAMARLKQRLQELDALADED  137

Query  187  MRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERML  366
             R   L+ GVLA N+FDWG++A  ++  + +   ++       +RPW +D+ D +  R+ 
Sbjct  138  TRWTELVRGVLAGNMFDWGAQAISNILEQDSNFGLHSALDRIEKRPWLLDNLDSWLNRLK  197

Query  367  GSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAMEL  546
            G       PHK A++FVDNSG D+VLG+LP  R LL+RGT+V+L ANS PALNDVT+ EL
Sbjct  198  GE------PHKCAVVFVDNSGVDVVLGVLPFVRGLLKRGTKVLLCANSEPALNDVTSEEL  251

Query  547  PDIVAEAAKHCGILRGAAEAGGLLVDA  627
              ++ + ++ C +L  A   G LLV A
Sbjct  252  RSLLDDCSRECEVLEQAWSQGQLLVYA  278



>gb|AAM52026.1| RE73673p [Drosophila melanogaster]
Length=389

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 86/207 (42%), Positives = 127/207 (61%), Gaps = 9/207 (4%)
 Frame = +1

Query  16   PAAYGK--LGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGM-NEE  186
            P   GK  LG ++LL+L E  LR + F D +   K+ EN +++A L   L ELD + +E+
Sbjct  106  PVNKGKVILGTSELLKLNETLLRRYGFTDPWLRQKRLENASAVARLKQRLQELDALADED  165

Query  187  MRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERML  366
             R   L+ GVLA N+FDWG++A  ++  + +   ++       +RPW +D+ D +  R+ 
Sbjct  166  TRWTELVRGVLAGNMFDWGAQAISNILEQDSNFGLHSALDRIEKRPWLLDNLDSWLNRLK  225

Query  367  GSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAMEL  546
            G       PHK A++FVDNSG D+VLG+LP  R LL+RGT+V+L ANS PALNDVT+ EL
Sbjct  226  GE------PHKCAVVFVDNSGVDVVLGVLPFVRGLLKRGTKVLLCANSEPALNDVTSEEL  279

Query  547  PDIVAEAAKHCGILRGAAEAGGLLVDA  627
              ++ + ++ C +L  A   G LLV A
Sbjct  280  KSLLDDCSRECEVLEQAWSKGQLLVYA  306



>ref|XP_001968771.1| GG25052 [Drosophila erecta]
 gb|EDV57830.1| GG25052 [Drosophila erecta]
Length=361

 Score =   140 bits (353),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 86/207 (42%), Positives = 127/207 (61%), Gaps = 9/207 (4%)
 Frame = +1

Query  16   PAAYGK--LGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGM-NEE  186
            P   GK  LG ++LL+L E  LR + F D +   K+ EN +++A L   L ELD + +E+
Sbjct  78   PVNKGKVVLGTSELLQLNETLLRRYGFADPWLRQKKLENASAVARLKQRLQELDALEDED  137

Query  187  MRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERML  366
             R   L+ GVLA N+FDWG++A  ++  + +   ++       +RPW +D+ D +  R+ 
Sbjct  138  TRWTELVRGVLAGNMFDWGAQAISNILEQDSNFGLHSALDRIEKRPWLLDNLDNWLNRLK  197

Query  367  GSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAMEL  546
            G       PHK A++FVDNSG D+VLG+LP  R LL+RGT+V+L ANS PALNDVT+ EL
Sbjct  198  GE------PHKCAVVFVDNSGVDVVLGVLPFVRGLLKRGTKVLLCANSEPALNDVTSEEL  251

Query  547  PDIVAEAAKHCGILRGAAEAGGLLVDA  627
              ++ + ++ C +L  A   G LLV A
Sbjct  252  RSLLDDCSRECEVLEHAWSKGQLLVYA  278



>ref|XP_005155852.1| PREDICTED: pantothenate kinase 4 isoform X2 [Danio rerio]
Length=778

 Score =   144 bits (364),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 112/181 (62%), Gaps = 6/181 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  IKQ+EN+ +L     ++  ++ ++ 
Sbjct  491  LRHQPFAYGSLTVRSLLDTREHCLNEFNFPDPYSKIKQKENDMALKYYLKVVKSVEELSW  550

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R   L++G+LA N+FDWG++A  D+          +  +   +RPW VD + ++ ERM
Sbjct  551  EQRQFALVKGLLAGNVFDWGAKAVSDVLETDPEFGFEQAKQQLQERPWLVDAYSQWIERM  610

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL FVDNSG DI+LG+ P  RELL RGTEVVL +NS PALNDVT  E
Sbjct  611  KGP------PHKCALFFVDNSGIDIILGVFPFIRELLLRGTEVVLASNSGPALNDVTNSE  664

Query  544  L  546
            L
Sbjct  665  L  665



>ref|XP_009304204.1| PREDICTED: pantothenate kinase 4 isoform X3 [Danio rerio]
Length=776

 Score =   144 bits (364),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 112/181 (62%), Gaps = 6/181 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  IKQ+EN+ +L     ++  ++ ++ 
Sbjct  489  LRHQPFAYGSLTVRSLLDTREHCLNEFNFPDPYSKIKQKENDMALKYYLKVVKSVEELSW  548

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R   L++G+LA N+FDWG++A  D+          +  +   +RPW VD + ++ ERM
Sbjct  549  EQRQFALVKGLLAGNVFDWGAKAVSDVLETDPEFGFEQAKQQLQERPWLVDAYSQWIERM  608

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL FVDNSG DI+LG+ P  RELL RGTEVVL +NS PALNDVT  E
Sbjct  609  KGP------PHKCALFFVDNSGIDIILGVFPFIRELLLRGTEVVLASNSGPALNDVTNSE  662

Query  544  L  546
            L
Sbjct  663  L  663



>ref|XP_005155853.1| PREDICTED: pantothenate kinase 4 isoform X4 [Danio rerio]
Length=774

 Score =   144 bits (364),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 112/181 (62%), Gaps = 6/181 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  IKQ+EN+ +L     ++  ++ ++ 
Sbjct  487  LRHQPFAYGSLTVRSLLDTREHCLNEFNFPDPYSKIKQKENDMALKYYLKVVKSVEELSW  546

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R   L++G+LA N+FDWG++A  D+          +  +   +RPW VD + ++ ERM
Sbjct  547  EQRQFALVKGLLAGNVFDWGAKAVSDVLETDPEFGFEQAKQQLQERPWLVDAYSQWIERM  606

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL FVDNSG DI+LG+ P  RELL RGTEVVL +NS PALNDVT  E
Sbjct  607  KGP------PHKCALFFVDNSGIDIILGVFPFIRELLLRGTEVVLASNSGPALNDVTNSE  660

Query  544  L  546
            L
Sbjct  661  L  661



>ref|XP_009304203.1| PREDICTED: pantothenate kinase 4 isoform X1 [Danio rerio]
Length=780

 Score =   144 bits (364),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 112/181 (62%), Gaps = 6/181 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  IKQ+EN+ +L     ++  ++ ++ 
Sbjct  493  LRHQPFAYGSLTVRSLLDTREHCLNEFNFPDPYSKIKQKENDMALKYYLKVVKSVEELSW  552

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R   L++G+LA N+FDWG++A  D+          +  +   +RPW VD + ++ ERM
Sbjct  553  EQRQFALVKGLLAGNVFDWGAKAVSDVLETDPEFGFEQAKQQLQERPWLVDAYSQWIERM  612

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL FVDNSG DI+LG+ P  RELL RGTEVVL +NS PALNDVT  E
Sbjct  613  KGP------PHKCALFFVDNSGIDIILGVFPFIRELLLRGTEVVLASNSGPALNDVTNSE  666

Query  544  L  546
            L
Sbjct  667  L  667



>ref|XP_004768800.1| PREDICTED: pantothenate kinase 4 [Mustela putorius furo]
 ref|XP_004783992.1| PREDICTED: pantothenate kinase 4 [Mustela putorius furo]
Length=773

 Score =   144 bits (363),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 84/187 (45%), Positives = 112/187 (60%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  +KQ+EN  +L   P ++  LD +  
Sbjct  491  LRHQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQKENGVALKCFPRVIRCLDALGW  550

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A  D+                 +RPW VD + ++ +R+
Sbjct  551  EERQLALVKGLLAGNVFDWGAKAVSDVLESDPQFGFEEAKMKLQERPWLVDSYSKWLQRL  610

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG D++LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  611  KGP------PHKCALIFADNSGVDVILGVFPFVRELLSRGTEVILACNSGPALNDVTYCE  664

Query  544  LPDIVAE  564
               IVAE
Sbjct  665  -SLIVAE  670



>ref|XP_002078206.1| GD23321 [Drosophila simulans]
 gb|EDX03791.1| GD23321 [Drosophila simulans]
Length=361

 Score =   140 bits (353),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 86/207 (42%), Positives = 127/207 (61%), Gaps = 9/207 (4%)
 Frame = +1

Query  16   PAAYGK--LGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGM-NEE  186
            P   GK  LG ++LL+L E  LR + F D +   K+ EN +++A L   L ELD + +E+
Sbjct  78   PVNKGKVILGTSELLKLNETLLRRYGFADPWLRQKRLENASAVARLKQRLQELDALADED  137

Query  187  MRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERML  366
             R   L+ GVLA N+FDWG++A  ++  + +   ++       +RPW +D+ D +  R+ 
Sbjct  138  TRWTELVRGVLAGNMFDWGAQAISNILEQDSNFGLHSALDRIEKRPWLLDNLDSWLNRLK  197

Query  367  GSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAMEL  546
            G       PHK A++FVDNSG D+VLG+LP  R LL+RGT+V+L ANS PALNDVT+ EL
Sbjct  198  GE------PHKCAVVFVDNSGVDVVLGVLPFVRGLLKRGTKVLLCANSEPALNDVTSEEL  251

Query  547  PDIVAEAAKHCGILRGAAEAGGLLVDA  627
              ++ + ++ C +L  A   G LLV A
Sbjct  252  RSLLDDCSRECEVLEQAWSQGQLLVYA  278



>ref|XP_002088669.1| GE11338 [Drosophila yakuba]
 gb|EDW88381.1| GE11338 [Drosophila yakuba]
Length=361

 Score =   140 bits (353),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 86/207 (42%), Positives = 127/207 (61%), Gaps = 9/207 (4%)
 Frame = +1

Query  16   PAAYGK--LGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGM-NEE  186
            P   GK  LG ++LL+L E  LR + F D +   K+ EN +++A L   L ELD + +E+
Sbjct  78   PVNKGKVVLGTSELLKLNETLLRRYGFADPWLRQKKLENASAVARLKQRLQELDALEDED  137

Query  187  MRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERML  366
             R   L+ GVLA N+FDWG++A  ++  + +   ++       +RPW +D+ D +  R+ 
Sbjct  138  TRWTELVRGVLAGNMFDWGAQAISNILEQDSNFGLHSALERIEKRPWLLDNLDNWLNRLK  197

Query  367  GSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAMEL  546
            G       PHK A++FVDNSG D+VLG+LP  R LL+RGT+V+L ANS PALNDVT+ EL
Sbjct  198  GE------PHKCAVVFVDNSGVDVVLGVLPFVRGLLKRGTKVLLCANSEPALNDVTSEEL  251

Query  547  PDIVAEAAKHCGILRGAAEAGGLLVDA  627
              ++ + ++ C +L  A   G LLV A
Sbjct  252  RSLLDDCSRECEVLGQAWSKGQLLVYA  278



>ref|XP_008575565.1| PREDICTED: pantothenate kinase 4 [Galeopterus variegatus]
Length=774

 Score =   144 bits (363),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 84/187 (45%), Positives = 113/187 (60%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  +KQ+EN  +L     ++  LD +  
Sbjct  492  LRHQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQKENGIALKCFQRVICNLDTLGW  551

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A  D+             +   +RPW VD ++E+ +R+
Sbjct  552  EDRQLALVKGLLAGNVFDWGAKAVSDVLESNPQFGFEEAKKKLQERPWLVDSYNEWLQRL  611

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG D++LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  612  KGP------PHKCALIFADNSGVDVILGVFPFVRELLLRGTEVILACNSGPALNDVTHSE  665

Query  544  LPDIVAE  564
               IVAE
Sbjct  666  -SLIVAE  671



>ref|XP_010515184.1| PREDICTED: uncharacterized protein At2g17340-like isoform X2 
[Camelina sativa]
Length=346

 Score =   139 bits (351),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 111/181 (61%), Gaps = 8/181 (4%)
 Frame = +1

Query  88   FFDAYRTIKQRENEASLAVLPDLLMELDGMNEE-MRLLTLIEGVLAANIFDWGSRACVDL  264
            F D ++ +K  EN  ++++  +++   D + +E  RL  L+ G+ A NIFD GS    ++
Sbjct  110  FMDIFKKVKDEENAKAISLFTEVVSLSDAIEDEGERLENLVRGIFAGNIFDLGSAQLAEV  169

Query  265  YHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERMLGSGETKPRPHKRALLFVDNSGADIVL  444
            + K  I       +N + RPW +DD D F+ + +       +P K+A++FVDNSGADI+L
Sbjct  170  FSKDGI-SFLATCQNLVPRPWVIDDLDNFQAKWIK------KPWKKAVIFVDNSGADIIL  222

Query  445  GMLPLARELLRRGTEVVLVANSLPALNDVTAMELPDIVAEAAKHCGILRGAAEAGGLLVD  624
            G+LP ARELLRRGT+VVL AN LPA+NDVT  EL DIV++     G L G   +  L+ +
Sbjct  223  GILPFARELLRRGTQVVLAANELPAINDVTYTELIDIVSQLKDENGQLLGVDTSKLLIAN  282

Query  625  A  627
            +
Sbjct  283  S  283



>ref|XP_011229536.1| PREDICTED: pantothenate kinase 4 [Ailuropoda melanoleuca]
Length=773

 Score =   144 bits (362),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 84/187 (45%), Positives = 112/187 (60%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  +KQ+EN  +L   P ++  LD +  
Sbjct  491  LRHQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQKENGVALKCFPRVIRCLDALGW  550

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A  D+                 +RPW VD + ++ +R+
Sbjct  551  EERQLALVKGLLAGNVFDWGAKAVSDVLESDPQFGFEEAKMKLQERPWLVDSYSKWLQRL  610

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG D++LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  611  KGP------PHKCALIFADNSGIDVILGVFPFVRELLSRGTEVILACNSGPALNDVTYCE  664

Query  544  LPDIVAE  564
               IVAE
Sbjct  665  -SLIVAE  670



>gb|EFB20669.1| hypothetical protein PANDA_013754 [Ailuropoda melanoleuca]
Length=771

 Score =   144 bits (362),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 84/187 (45%), Positives = 112/187 (60%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  +KQ+EN  +L   P ++  LD +  
Sbjct  489  LRHQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQKENGVALKCFPRVIRCLDALGW  548

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A  D+                 +RPW VD + ++ +R+
Sbjct  549  EERQLALVKGLLAGNVFDWGAKAVSDVLESDPQFGFEEAKMKLQERPWLVDSYSKWLQRL  608

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG D++LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  609  KGP------PHKCALIFADNSGIDVILGVFPFVRELLSRGTEVILACNSGPALNDVTYCE  662

Query  544  LPDIVAE  564
               IVAE
Sbjct  663  -SLIVAE  668



>ref|XP_536718.2| PREDICTED: pantothenate kinase 4 [Canis lupus familiaris]
Length=773

 Score =   144 bits (362),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 84/187 (45%), Positives = 112/187 (60%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  +KQ+EN  +L   P ++  LD +  
Sbjct  491  LRHQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQKENGVALKCFPRVIRCLDALGW  550

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A  D+                 +RPW VD + ++ +R+
Sbjct  551  EERQLALVKGLLAGNVFDWGAKAVSDVLESDPQFGFEEAKMKLQERPWLVDSYSKWLQRL  610

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG D++LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  611  KGP------PHKCALIFADNSGIDVILGVFPFVRELLSRGTEVILACNSGPALNDVTYCE  664

Query  544  LPDIVAE  564
               IVAE
Sbjct  665  -SLIVAE  670



>ref|XP_008150047.1| PREDICTED: pantothenate kinase 4 [Eptesicus fuscus]
Length=759

 Score =   144 bits (362),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 107/176 (61%), Gaps = 6/176 (3%)
 Frame = +1

Query  16   PAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNEEMRL  195
            P+AYG L +  LL+ RE CL EF+F D Y  +KQ+EN  +L     ++  LD ++ E R 
Sbjct  481  PSAYGTLTVRSLLDTREHCLNEFNFPDPYSQVKQKENGVALRCFQRVVQALDALDWEERQ  540

Query  196  LTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERMLGSG  375
            L L+ G+LA N+FDWG++A  D+             R   +RPW VD +D + +R+ G  
Sbjct  541  LALVRGLLAGNVFDWGAKAVSDVLESDPQFGFEEAKRKLEERPWLVDSYDRWLQRLKGP-  599

Query  376  ETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
                 PHK AL+F DNSG D++LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  600  -----PHKCALIFADNSGVDVILGVFPFVRELLSRGTEVILACNSGPALNDVTYGE  650



>ref|XP_011282738.1| PREDICTED: pantothenate kinase 4 [Felis catus]
Length=822

 Score =   144 bits (363),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 108/180 (60%), Gaps = 6/180 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  +KQ+EN  +L   P ++  LD +  
Sbjct  540  LRHQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQKENGVALKCFPRVIRCLDALGW  599

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A  D+                 +RPW VD + ++ +R+
Sbjct  600  EERQLALVKGLLAGNVFDWGAKAVSDVLESDPQFGFEEAKSKLQERPWLVDSYGKWLQRL  659

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG D++LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  660  KGP------PHKCALIFADNSGIDVILGVFPFVRELLSRGTEVILACNSGPALNDVTYCE  713



>ref|XP_001366436.1| PREDICTED: pantothenate kinase 4 [Monodelphis domestica]
Length=773

 Score =   144 bits (362),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 111/187 (59%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LLE RE CL EF+F D Y  +KQREN  +L     ++  LD +  
Sbjct  491  LRHQPFAYGTLTVRSLLETREHCLNEFNFPDPYSKVKQRENGIALKCFQRVIRSLDSLGW  550

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R   L++G+LA N+FDWG++A  D+             R   +RPW VD + E+ +R+
Sbjct  551  EERQFALVKGLLAGNVFDWGAKAVSDVLESEPQFGFEEAKRKLQERPWLVDSYGEWLQRL  610

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  611  KGP------PHKCALIFADNSGIDIILGVFPFVRELLFRGTEVILACNSGPALNDVTYNE  664

Query  544  LPDIVAE  564
               IVAE
Sbjct  665  -SLIVAE  670



>ref|XP_010515176.1| PREDICTED: uncharacterized protein At2g17340-like isoform X1 
[Camelina sativa]
Length=361

 Score =   140 bits (352),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 111/181 (61%), Gaps = 8/181 (4%)
 Frame = +1

Query  88   FFDAYRTIKQRENEASLAVLPDLLMELDGMNEE-MRLLTLIEGVLAANIFDWGSRACVDL  264
            F D ++ +K  EN  ++++  +++   D + +E  RL  L+ G+ A NIFD GS    ++
Sbjct  110  FMDIFKKVKDEENAKAISLFTEVVSLSDAIEDEGERLENLVRGIFAGNIFDLGSAQLAEV  169

Query  265  YHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERMLGSGETKPRPHKRALLFVDNSGADIVL  444
            + K  I       +N + RPW +DD D F+ + +       +P K+A++FVDNSGADI+L
Sbjct  170  FSKDGI-SFLATCQNLVPRPWVIDDLDNFQAKWIK------KPWKKAVIFVDNSGADIIL  222

Query  445  GMLPLARELLRRGTEVVLVANSLPALNDVTAMELPDIVAEAAKHCGILRGAAEAGGLLVD  624
            G+LP ARELLRRGT+VVL AN LPA+NDVT  EL DIV++     G L G   +  L+ +
Sbjct  223  GILPFARELLRRGTQVVLAANELPAINDVTYTELIDIVSQLKDENGQLLGVDTSKLLIAN  282

Query  625  A  627
            +
Sbjct  283  S  283



>ref|XP_005184448.1| PREDICTED: pantothenate kinase 4 [Musca domestica]
Length=364

 Score =   139 bits (351),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 108/181 (60%), Gaps = 5/181 (3%)
 Frame = +1

Query  82   FHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE-EMRLLTLIEGVLAANIFDWGSRACV  258
            + F D +   K+ ENEA+L +    + E+D +++   R   L++GVLA N+FDWG++A  
Sbjct  107  YGFPDPWLDQKKSENEAALELFAKRIHEIDDISDYRQRWTELVKGVLAGNMFDWGAQAVT  166

Query  259  DLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERMLGSGETKPRPHKRALLFVDNSGADI  438
            ++        ++       +RPW +DD D + +R+   GE     HK A +FVDN G D+
Sbjct  167  NIILNDKTFGLHAALERIQKRPWLMDDLDNWLDRLSNGGEV----HKCAAIFVDNCGVDV  222

Query  439  VLGMLPLARELLRRGTEVVLVANSLPALNDVTAMELPDIVAEAAKHCGILRGAAEAGGLL  618
            VLG+LP ARELLRRGT V+L AN+ P+LNDVT  EL  I+   + HC I++ A  +  L 
Sbjct  223  VLGILPFARELLRRGTRVILCANNEPSLNDVTISELSSILDTCSCHCAIIKEARTSKRLT  282

Query  619  V  621
            +
Sbjct  283  I  283



>ref|XP_006746516.1| PREDICTED: pantothenate kinase 4 [Leptonychotes weddellii]
Length=773

 Score =   143 bits (361),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 84/187 (45%), Positives = 112/187 (60%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  +KQ+EN  +L   P ++  LD +  
Sbjct  491  LRHQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQKENGVALKCFPRVIRGLDALGW  550

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A  D+                 +RPW VD + ++ +R+
Sbjct  551  EDRQLALVKGLLAGNVFDWGAKAVSDVLESDPQFGFEEAKMKLQERPWLVDSYSKWLQRL  610

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG D++LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  611  KGP------PHKCALIFADNSGIDVILGVFPFVRELLSRGTEVILACNSGPALNDVTYCE  664

Query  544  LPDIVAE  564
               IVAE
Sbjct  665  -SLIVAE  670



>ref|XP_004407420.1| PREDICTED: pantothenate kinase 4 [Odobenus rosmarus divergens]
Length=773

 Score =   143 bits (361),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 84/187 (45%), Positives = 112/187 (60%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  +KQ+EN  +L   P ++  LD +  
Sbjct  491  LRHQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQKENGVALKCFPRVIRGLDALGW  550

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A  D+                 +RPW VD + ++ +R+
Sbjct  551  EDRQLALVKGLLAGNVFDWGAKAVSDVLESDPQFGFEEAKMKLQERPWLVDSYSKWLQRL  610

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG D++LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  611  KGP------PHKCALIFADNSGIDVILGVFPFVRELLSRGTEVILACNSGPALNDVTYCE  664

Query  544  LPDIVAE  564
               IVAE
Sbjct  665  -SLIVAE  670



>ref|XP_004013820.1| PREDICTED: pantothenate kinase 4 [Ovis aries]
Length=777

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 114/187 (61%), Gaps = 3/187 (2%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  +KQ++N  +L     ++  LD ++ 
Sbjct  491  LRHQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQKDNGVALKCFQRVVSALDALDW  550

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A  D+             +   +RPW VD + ++ +R+
Sbjct  551  EERQLALVKGLLAGNVFDWGAKAVSDVLESDPQFGFEEAKKKLQERPWLVDSYGKWLQRL  610

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G G     PHK AL+F DNSG D++LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  611  KGHGGGP--PHKCALIFADNSGVDVILGVFPFVRELLSRGTEVILACNSGPALNDVTYSE  668

Query  544  LPDIVAE  564
               IVAE
Sbjct  669  -SLIVAE  674



>ref|XP_009011203.1| hypothetical protein HELRODRAFT_109215 [Helobdella robusta]
 gb|ESO10934.1| hypothetical protein HELRODRAFT_109215 [Helobdella robusta]
Length=834

 Score =   144 bits (362),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 87/207 (42%), Positives = 124/207 (60%), Gaps = 16/207 (8%)
 Frame = +1

Query  16   PAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNEEMRL  195
            P +YG L +  LL+ RE CL EFHF D Y   KQ+ENE +L+   + + ELD +N + + 
Sbjct  541  PCSYGSLTVRSLLDTREHCLEEFHFVDPYSLQKQQENEQALSQFKERINELDLLNFDSQW  600

Query  196  LTLIEGVLAANIFDWGSRACVDLYHKGTIIEI----YRMSRNKM-QRPWRVDDFDEFKER  360
              L+ GVLA N+FDWG++A         +IE     +  + NK+ +RPW +D+FD +  R
Sbjct  601  FELVRGVLAGNVFDWGAKAVT------AVIEYQQFGFHEALNKIPERPWLIDNFDSWMLR  654

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            +      K  P+K  ++FVDNSG DI+LG+ P +R LL+ G++V+L ANS P LNDVT  
Sbjct  655  V-----EKGVPYKCVVIFVDNSGLDIILGIFPFSRALLKMGSKVILCANSRPVLNDVTYH  709

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLLV  621
            EL  +    AK C ++  A   G LLV
Sbjct  710  ELIILTKRLAKQCDVINLALNDGRLLV  736



>ref|XP_007529566.1| PREDICTED: pantothenate kinase 4 isoform X2 [Erinaceus europaeus]
Length=734

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 86/187 (46%), Positives = 111/187 (59%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  +KQ+EN  +L     ++  LD +  
Sbjct  452  LRHQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQQENGVALKCFQRVVRALDTLGW  511

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L EG+LA N+FDWG++A  D+             R    RPW VD +D++ +R+
Sbjct  512  EERQLALAEGLLAGNVFDWGAKAVSDVLESDPQFGFEEAKRKLQARPWLVDAYDKWLQRL  571

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG D++LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  572  KGP------PHKCALIFADNSGVDVILGVFPFVRELLSRGTEVILACNSGPALNDVTYSE  625

Query  544  LPDIVAE  564
               IVAE
Sbjct  626  -SLIVAE  631



>ref|XP_005850909.1| hypothetical protein CHLNCDRAFT_19893 [Chlorella variabilis]
 gb|EFN58807.1| hypothetical protein CHLNCDRAFT_19893 [Chlorella variabilis]
Length=350

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 110/170 (65%), Gaps = 14/170 (8%)
 Frame = +1

Query  88   FFDAYRTIKQRENEASLAVLPDLLMELDG-MNEEMRLLTLIEGVLAANIFDWGSRACVDL  264
            F D +  IK +EN ++LA+LPD+  E+D  + +  R  T++ GV A NIFD G +A  D 
Sbjct  97   FTDIFLPIKAKENASALALLPDVCAEVDQHVQQRDRWETVVRGVFAGNIFDLGCKATTDA  156

Query  265  YHKGTIIEIYRMSRNKM-QRPWRVDDFDEFKERMLGSGETKPRPHKRALLFVDNSGADIV  441
            YH+  +   +  +R+K+  RPW +D  +   +R++         ++RA+LFVDN+GADI+
Sbjct  157  YHEDGVS--FHTTRDKLLPRPWVIDHLEALLDRLVS------HRYRRAILFVDNAGADIM  208

Query  442  LGMLPLARELLRRGTEVVLVANSLPALNDVTAME----LPDIVAEAAKHC  579
            LGMLPLARELLR GT V++ ANSLP++ND+TA E    LP I A  ++ C
Sbjct  209  LGMLPLARELLRLGTTVIIAANSLPSINDITAAELEALLPQICAADSELC  258



>ref|XP_005143769.1| PREDICTED: pantothenate kinase 4, partial [Melopsittacus undulatus]
Length=737

 Score =   142 bits (359),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 85/206 (41%), Positives = 118/206 (57%), Gaps = 6/206 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  IKQ+EN  +L     ++  LD ++ 
Sbjct  455  LRQQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKIKQKENGIALKCFHSVIESLDSLDW  514

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R   L++G+LA N+FDWG++A  D+                 +RPW  D ++++ ER+
Sbjct  515  EERQFALVKGLLAGNVFDWGAKAVSDVLESEPQFGFEEAKSKLQERPWLQDSYNQWLERL  574

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  575  KGP------PHKCALIFADNSGIDIILGVFPFVRELLSRGTEVILACNSGPALNDVTYSE  628

Query  544  LPDIVAEAAKHCGILRGAAEAGGLLV  621
               +    A    I++ A +   LL+
Sbjct  629  SLIVTERIAAMDPIIQSALKEEKLLL  654



>ref|XP_003397673.1| PREDICTED: pantothenate kinase 4-like [Bombus terrestris]
Length=790

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 89/200 (45%), Positives = 124/200 (62%), Gaps = 16/200 (8%)
 Frame = +1

Query  13   EPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNEEMR  192
            +P AYG L +  LL+  E C++EF F D Y   K++ENE +L  L   +  LD +    +
Sbjct  478  QPFAYGTLTVRVLLDTIEHCMKEFDFPDPYLHQKKKENEEALTYLKSRITALDELEGAEK  537

Query  193  LLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQ-----RPWRVDDFDEFKE  357
            +  LI GVL+ N+FDWG++A        T++E       + Q     RPW  DD D++ E
Sbjct  538  IKALIVGVLSGNMFDWGAQAV------ATLMETTNFGFAEAQAKIPGRPWLQDDLDDWIE  591

Query  358  RMLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTA  537
            R+    +T P PHK A +F+DNSG DIVLG+LP AR+LL+RGT+V+L ANS+PALNDVT 
Sbjct  592  RL----KTGP-PHKCAAIFIDNSGVDIVLGILPFARDLLQRGTKVILCANSMPALNDVTY  646

Query  538  MELPDIVAEAAKHCGILRGA  597
             EL   + +AAK C ++R A
Sbjct  647  PELVVTLRDAAKICKVIRQA  666



>ref|XP_010022564.1| PREDICTED: pantothenate kinase 4 [Nestor notabilis]
Length=735

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/206 (41%), Positives = 118/206 (57%), Gaps = 6/206 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  IKQ+EN  +L     ++  LD ++ 
Sbjct  453  LRQQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKIKQKENGIALKCFHSVIESLDSLDW  512

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R   L++G+LA N+FDWG++A  D+                 +RPW  D ++++ ER+
Sbjct  513  EERQFALVKGLLAGNVFDWGAKAVSDVLESEPQFGFEEAKSKLQERPWLQDSYNQWLERL  572

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  573  KGP------PHKCALIFADNSGIDIILGVFPFVRELLSRGTEVILACNSGPALNDVTYSE  626

Query  544  LPDIVAEAAKHCGILRGAAEAGGLLV  621
               +    A    I++ A +   LL+
Sbjct  627  SLIVTERIAAMDPIIQSALKEEKLLL  652



>ref|XP_007529565.1| PREDICTED: pantothenate kinase 4 isoform X1 [Erinaceus europaeus]
Length=783

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 86/187 (46%), Positives = 111/187 (59%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  +KQ+EN  +L     ++  LD +  
Sbjct  501  LRHQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQQENGVALKCFQRVVRALDTLGW  560

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L EG+LA N+FDWG++A  D+             R    RPW VD +D++ +R+
Sbjct  561  EERQLALAEGLLAGNVFDWGAKAVSDVLESDPQFGFEEAKRKLQARPWLVDAYDKWLQRL  620

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG D++LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  621  KGP------PHKCALIFADNSGVDVILGVFPFVRELLSRGTEVILACNSGPALNDVTYSE  674

Query  544  LPDIVAE  564
               IVAE
Sbjct  675  -SLIVAE  680



>ref|XP_009053272.1| hypothetical protein LOTGIDRAFT_116077 [Lottia gigantea]
 gb|ESO96157.1| hypothetical protein LOTGIDRAFT_116077 [Lottia gigantea]
Length=780

 Score =   142 bits (359),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 83/190 (44%), Positives = 115/190 (61%), Gaps = 8/190 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L E P AYG L +  LL+   + L E +F D Y   KQ ENE ++ +L   L ELD ++ 
Sbjct  488  LKENPCAYGSLTVRSLLDTSSQYLSELYFTDPYSQQKQFENEQAVKLLSSHLSELDKLDW  547

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQ-RPWRVDDFDEFKER  360
              R L L++G+LA N+FDWG++    L   G     ++ +R ++Q RPW  DDFD + +R
Sbjct  548  HQRQLELVQGILAGNMFDWGAKEVCKLMETGEFG--FKEARLRLQSRPWLFDDFDLWCKR  605

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
                   KP  HK A++F DNSG DI+LG+ P+ARELL +GT+V+L  NS P LNDVT  
Sbjct  606  F----SVKPN-HKCAVIFCDNSGCDIILGIFPMARELLSQGTKVILCVNSRPTLNDVTYS  660

Query  541  ELPDIVAEAA  570
            EL  +V + A
Sbjct  661  ELVILVKKVA  670



>gb|EFN73794.1| Pantothenate kinase 4 [Camponotus floridanus]
Length=781

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 127/206 (62%), Gaps = 8/206 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+  E C++EF F D Y   K++ENE +L  L D +  LD +  
Sbjct  464  LHTQPVAYGALTVRILLDTIEHCMKEFDFPDPYLHQKKKENEEALRHLHDRITTLDKLEG  523

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQ-RPWRVDDFDEFKER  360
              ++  LI GVL+ NIFDWG++    L    T    ++ ++ K+  RPW  D+ D++  R
Sbjct  524  AEKIKALILGVLSGNIFDWGAKDVAKLLE--TTDFGFKEAQTKIPGRPWLEDNLDDWIHR  581

Query  361  MLGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAM  540
            +        +PHK A +FVDNSG DI+LG+LP AR+LL+RGT+V+L ANSLPALNDVT  
Sbjct  582  LQNG-----QPHKCAAIFVDNSGVDIILGILPFARDLLQRGTKVILCANSLPALNDVTYP  636

Query  541  ELPDIVAEAAKHCGILRGAAEAGGLL  618
            EL   + +AAK C +++ A E   L+
Sbjct  637  ELVVTLRDAAKICNVIKQALEDNTLI  662



>ref|XP_005079304.1| PREDICTED: pantothenate kinase 4 [Mesocricetus auratus]
Length=773

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/187 (45%), Positives = 111/187 (59%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  +KQ+EN  +L     +   LD +  
Sbjct  491  LRHQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQKENGLALKCFQSVTRSLDSLGW  550

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A  D+             R   +RPW VD + ++ +R+
Sbjct  551  EERQLALVKGLLAGNVFDWGAKAVSDVLESDPQFGFEEAKRKLQERPWLVDSYTKWLQRL  610

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  611  KGP------PHKCALIFADNSGIDIILGVFPFVRELLFRGTEVILACNSGPALNDVTYSE  664

Query  544  LPDIVAE  564
               IVAE
Sbjct  665  -SLIVAE  670



>gb|EMP25953.1| Pantothenate kinase 4 [Chelonia mydas]
Length=682

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 111/187 (59%), Gaps = 6/187 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L ++P AYG L +  LL+ RE CL EF+F D Y  +KQ+EN  +L   P ++  LD +  
Sbjct  459  LRQQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQKENGIALKCFPSVIESLDSLGW  518

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R   L++G+LA N+FDWG++A  D+                 +RPW  D + E+ +R+
Sbjct  519  EERQFALVKGLLAGNVFDWGAKAVSDVLESEPQFGFEEAKEKLQERPWLEDSYSEWIQRL  578

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
                  +  PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  579  -----KEGPPHKCALIFADNSGIDIILGVFPFVRELLSRGTEVILACNSGPALNDVTYSE  633

Query  544  LPDIVAE  564
               IVAE
Sbjct  634  -SLIVAE  639



>ref|XP_005339283.1| PREDICTED: pantothenate kinase 4 [Ictidomys tridecemlineatus]
Length=773

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 108/180 (60%), Gaps = 6/180 (3%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF F D Y  +KQ+EN  +L     ++  LD +  
Sbjct  491  LRHQPFAYGTLTVRSLLDTREHCLNEFSFPDPYSKVKQKENGIALKCFQGVVHALDSLGW  550

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A  D+             R   +RPW VD ++++ +R+
Sbjct  551  EERQLALVKGLLAGNVFDWGAKAVSDVLESDPQFGFEEAKRKLQERPWLVDSYNKWLQRL  610

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  611  KGP------PHKCALIFADNSGIDIILGVFPFVRELLFRGTEVILACNSGPALNDVTYNE  664



>ref|NP_766578.2| pantothenate kinase 4 [Mus musculus]
Length=773

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/187 (45%), Positives = 111/187 (59%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  +KQ+EN  +L     +   LD +  
Sbjct  491  LRHQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQKENGLALKCFQSVTRSLDSLGW  550

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A  D+             R   +RPW VD + ++ +R+
Sbjct  551  EERQLALVKGLLAGNVFDWGAKAVSDVLESDPQFGFEEAKRKLQERPWLVDSYTKWLQRL  610

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  611  KGP------PHKCALIFADNSGIDIILGVFPFVRELLFRGTEVILACNSGPALNDVTYSE  664

Query  544  LPDIVAE  564
               IVAE
Sbjct  665  -SLIVAE  670



>gb|EDL14988.1| pantothenate kinase 4, isoform CRA_b [Mus musculus]
Length=773

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/187 (45%), Positives = 111/187 (59%), Gaps = 7/187 (4%)
 Frame = +1

Query  4    LMEEPAAYGKLGLADllelreeclreFHFFDAYRTIKQRENEASLAVLPDLLMELDGMNE  183
            L  +P AYG L +  LL+ RE CL EF+F D Y  +KQ+EN  +L     +   LD +  
Sbjct  491  LRHQPFAYGTLTVRSLLDTREHCLNEFNFPDPYSKVKQKENGLALKCFQSVTRSLDSLGW  550

Query  184  EMRLLTLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDEFKERM  363
            E R L L++G+LA N+FDWG++A  D+             R   +RPW VD + ++ +R+
Sbjct  551  EERQLALVKGLLAGNVFDWGAKAVSDVLESDPQFGFEEAKRKLQERPWLVDSYTKWLQRL  610

Query  364  LGSGETKPRPHKRALLFVDNSGADIVLGMLPLARELLRRGTEVVLVANSLPALNDVTAME  543
             G       PHK AL+F DNSG DI+LG+ P  RELL RGTEV+L  NS PALNDVT  E
Sbjct  611  KGP------PHKCALIFADNSGIDIILGVFPFVRELLFRGTEVILACNSGPALNDVTYSE  664

Query  544  LPDIVAE  564
               IVAE
Sbjct  665  -SLIVAE  670



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250