BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS082D10

Length=632
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004248008.1|  PREDICTED: phosphoglucan, water dikinase, ch...    390   7e-124   Solanum lycopersicum
ref|XP_006358813.1|  PREDICTED: phosphoglucan, water dikinase, ch...    387   8e-123   Solanum tuberosum [potatoes]
ref|XP_006358812.1|  PREDICTED: phosphoglucan, water dikinase, ch...    387   9e-123   Solanum tuberosum [potatoes]
ref|NP_001274870.1|  glucan/water dikinase                              386   1e-122   Solanum tuberosum [potatoes]
ref|XP_009599199.1|  PREDICTED: phosphoglucan, water dikinase, ch...    382   4e-121   Nicotiana tomentosiformis
ref|XP_011074900.1|  PREDICTED: phosphoglucan, water dikinase, ch...    382   7e-121   Sesamum indicum [beniseed]
gb|KDO57834.1|  hypothetical protein CISIN_1g015140mg                   358   1e-119   Citrus sinensis [apfelsine]
ref|XP_006421075.1|  hypothetical protein CICLE_v10004968mg             358   3e-119   
ref|XP_009777858.1|  PREDICTED: phosphoglucan, water dikinase, ch...    377   4e-119   Nicotiana sylvestris
emb|CDP10310.1|  unnamed protein product                                372   1e-117   Coffea canephora [robusta coffee]
ref|XP_010069404.1|  PREDICTED: phosphoglucan, water dikinase, ch...    371   8e-117   Eucalyptus grandis [rose gum]
gb|EYU23932.1|  hypothetical protein MIMGU_mgv1a000391mg                370   2e-116   Erythranthe guttata [common monkey flower]
ref|XP_002301739.2|  hypothetical protein POPTR_0002s23550g             368   3e-116   
gb|KDP32558.1|  hypothetical protein JCGZ_13108                         365   5e-115   Jatropha curcas
ref|XP_011042749.1|  PREDICTED: phosphoglucan, water dikinase, ch...    365   6e-115   Populus euphratica
ref|XP_004296959.2|  PREDICTED: phosphoglucan, water dikinase, ch...    365   2e-114   Fragaria vesca subsp. vesca
ref|XP_002518612.1|  chloroplast alpha-glucan water dikinase, put...    363   3e-114   Ricinus communis
ref|XP_008393850.1|  PREDICTED: phosphoglucan, water dikinase, ch...    359   4e-114   
ref|XP_008222722.1|  PREDICTED: phosphoglucan, water dikinase, ch...    363   6e-114   Prunus mume [ume]
ref|XP_008393849.1|  PREDICTED: phosphoglucan, water dikinase, ch...    358   1e-113   
emb|CBI39424.3|  unnamed protein product                                362   1e-113   Vitis vinifera
ref|XP_002265211.1|  PREDICTED: phosphoglucan, water dikinase, ch...    362   2e-113   Vitis vinifera
ref|XP_006493516.1|  PREDICTED: phosphoglucan, water dikinase, ch...    362   2e-113   Citrus sinensis [apfelsine]
gb|KJB71923.1|  hypothetical protein B456_011G147600                    360   3e-113   Gossypium raimondii
ref|XP_010107197.1|  Phosphoglucan, water dikinase                      353   2e-112   
gb|KJB71921.1|  hypothetical protein B456_011G147600                    359   2e-112   Gossypium raimondii
gb|KJB71922.1|  hypothetical protein B456_011G147600                    359   2e-112   Gossypium raimondii
ref|XP_007034117.1|  Catalytics,carbohydrate kinases,phosphoglucan      359   2e-112   
ref|NP_001119280.1|  phosphoglucan, water dikinase                      352   4e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010454991.1|  PREDICTED: phosphoglucan, water dikinase, ch...    352   5e-112   Camelina sativa [gold-of-pleasure]
ref|XP_007225436.1|  hypothetical protein PRUPE_ppa000429mg             358   5e-112   Prunus persica
gb|AFO83531.1|  glucan water dikinase 3                                 355   1e-111   Manihot esculenta [manioc]
ref|XP_002320442.2|  hypothetical protein POPTR_0014s14510g             356   2e-111   
gb|KHF99077.1|  Phosphoglucan, water dikinase, chloroplastic -lik...    355   3e-111   Gossypium arboreum [tree cotton]
ref|XP_006394878.1|  hypothetical protein EUTSA_v10003634mg             350   3e-111   
ref|XP_009371117.1|  PREDICTED: phosphoglucan, water dikinase, ch...    351   7e-111   Pyrus x bretschneideri [bai li]
ref|XP_011000022.1|  PREDICTED: LOW QUALITY PROTEIN: phosphogluca...    354   1e-110   Populus euphratica
ref|XP_002872212.1|  hypothetical protein ARALYDRAFT_489476             354   1e-110   
gb|AAU93516.1|  chloroplast alpha-glucan water dikinase isoform 3       353   2e-110   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198009.3|  phosphoglucan, water dikinase                         353   2e-110   Arabidopsis thaliana [mouse-ear cress]
gb|KJB37918.1|  hypothetical protein B456_006G226300                    347   3e-110   Gossypium raimondii
ref|XP_010493900.1|  PREDICTED: phosphoglucan, water dikinase, ch...    353   3e-110   Camelina sativa [gold-of-pleasure]
ref|XP_010454990.1|  PREDICTED: phosphoglucan, water dikinase, ch...    353   3e-110   Camelina sativa [gold-of-pleasure]
ref|XP_010493901.1|  PREDICTED: phosphoglucan, water dikinase, ch...    353   3e-110   Camelina sativa [gold-of-pleasure]
ref|XP_007142602.1|  hypothetical protein PHAVU_007G001400g             349   3e-110   Phaseolus vulgaris [French bean]
ref|XP_010546804.1|  PREDICTED: phosphoglucan, water dikinase, ch...    352   5e-110   Tarenaya hassleriana [spider flower]
ref|XP_010546803.1|  PREDICTED: phosphoglucan, water dikinase, ch...    352   5e-110   Tarenaya hassleriana [spider flower]
ref|XP_010424348.1|  PREDICTED: phosphoglucan, water dikinase, ch...    352   5e-110   Camelina sativa [gold-of-pleasure]
ref|XP_009371116.1|  PREDICTED: phosphoglucan, water dikinase, ch...    352   5e-110   Pyrus x bretschneideri [bai li]
ref|XP_010551754.1|  PREDICTED: phosphoglucan, water dikinase, ch...    352   8e-110   Tarenaya hassleriana [spider flower]
gb|KFK26410.1|  hypothetical protein AALP_AA8G245000                    352   8e-110   Arabis alpina [alpine rockcress]
ref|XP_004952076.1|  PREDICTED: phosphoglucan, water dikinase, ch...    352   8e-110   Setaria italica
ref|XP_009129923.1|  PREDICTED: phosphoglucan, water dikinase, ch...    351   1e-109   Brassica rapa
ref|XP_010907528.1|  PREDICTED: phosphoglucan, water dikinase, ch...    346   3e-109   
emb|CDY65142.1|  BnaC02g48400D                                          351   7e-109   Brassica napus [oilseed rape]
ref|XP_004497422.1|  PREDICTED: phosphoglucan, water dikinase, ch...    349   7e-109   Cicer arietinum [garbanzo]
ref|XP_010673296.1|  PREDICTED: phosphoglucan, water dikinase, ch...    349   9e-109   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB37917.1|  hypothetical protein B456_006G226300                    348   1e-108   Gossypium raimondii
ref|XP_004497421.1|  PREDICTED: phosphoglucan, water dikinase, ch...    349   1e-108   
gb|KHN37254.1|  Phosphoglucan, water dikinase, chloroplastic            347   4e-108   Glycine soja [wild soybean]
ref|XP_006589801.1|  PREDICTED: LOW QUALITY PROTEIN: phosphogluca...    347   6e-108   
gb|KEH27294.1|  phosphoglucan, water dikinase                           347   8e-108   Medicago truncatula
ref|XP_006845104.1|  hypothetical protein AMTR_s00005p00168970          346   9e-108   Amborella trichopoda
ref|XP_006286926.1|  hypothetical protein CARUB_v10000070mg             347   1e-107   Capsella rubella
ref|XP_008799788.1|  PREDICTED: phosphoglucan, water dikinase, ch...    337   1e-107   
emb|CDY05529.1|  BnaA02g31620D                                          347   2e-107   
ref|XP_002453659.1|  hypothetical protein SORBIDRAFT_04g010020          345   3e-107   Sorghum bicolor [broomcorn]
ref|XP_008454007.1|  PREDICTED: phosphoglucan, water dikinase, ch...    344   6e-107   Cucumis melo [Oriental melon]
ref|XP_004152111.1|  PREDICTED: phosphoglucan, water dikinase, ch...    343   2e-106   
gb|KGN53052.1|  hypothetical protein Csa_4G012480                       343   2e-106   Cucumis sativus [cucumbers]
ref|XP_008454006.1|  PREDICTED: phosphoglucan, water dikinase, ch...    343   2e-106   Cucumis melo [Oriental melon]
ref|XP_009416602.1|  PREDICTED: phosphoglucan, water dikinase, ch...    343   3e-106   
ref|XP_009111699.1|  PREDICTED: phosphoglucan, water dikinase, ch...    338   1e-104   Brassica rapa
emb|CDX87051.1|  BnaC09g03660D                                          338   1e-104   
emb|CDY19771.1|  BnaA09g04240D                                          338   1e-104   Brassica napus [oilseed rape]
ref|XP_006663965.1|  PREDICTED: phosphoglucan, water dikinase, ch...    337   2e-104   Oryza brachyantha
gb|ABG21981.1|  chloroplast alpha-glucan water dikinase isoform 3...    327   9e-104   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010244064.1|  PREDICTED: phosphoglucan, water dikinase, ch...    335   1e-103   Nelumbo nucifera [Indian lotus]
gb|KHG00248.1|  Phosphoglucan, water dikinase, chloroplastic -lik...    333   1e-103   Gossypium arboreum [tree cotton]
ref|XP_010228078.1|  PREDICTED: phosphoglucan, water dikinase, ch...    331   3e-102   Brachypodium distachyon [annual false brome]
ref|NP_001066613.1|  Os12g0297500                                       329   3e-101   
emb|CAX51387.1|  phosphoglucan water dikinase                           303   2e-100   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT02873.1|  Phosphoglucan, water dikinase, chloroplastic            323   4e-100   
ref|XP_001752167.1|  predicted protein                                  318   8e-98    
gb|EEE53074.1|  hypothetical protein OsJ_35828                          317   4e-97    Oryza sativa Japonica Group [Japonica rice]
gb|EEC69133.1|  hypothetical protein OsI_38056                          317   4e-97    Oryza sativa Indica Group [Indian rice]
ref|XP_002973212.1|  hypothetical protein SELMODRAFT_99378              313   7e-96    
ref|XP_002976638.1|  hypothetical protein SELMODRAFT_105597             307   8e-94    
gb|AAC26245.1|  contains similarity glycosyl hydrolases                 286   1e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001758857.1|  predicted protein                                  270   3e-80    
gb|KEH27295.1|  phosphoglucan, water dikinase                           268   4e-80    Medicago truncatula
gb|EPS59827.1|  glucan/water dikinase                                   251   3e-79    Genlisea aurea
ref|XP_011396449.1|  Phosphoglucan, water dikinase, chloroplastic       242   2e-70    Auxenochlorella protothecoides
ref|XP_005849428.1|  hypothetical protein CHLNCDRAFT_21770              243   2e-70    Chlorella variabilis
gb|EMS54440.1|  Phosphoglucan, water dikinase, chloroplastic            228   1e-65    Triticum urartu
gb|KIZ07735.1|  hypothetical protein MNEG_0234                          221   3e-63    Monoraphidium neglectum
ref|XP_002949771.1|  hypothetical protein VOLCADRAFT_90138              221   1e-62    Volvox carteri f. nagariensis
gb|KDD72859.1|  hypothetical protein H632_c2807p0                       210   2e-62    Helicosporidium sp. ATCC 50920
ref|XP_005648862.1|  hypothetical protein COCSUDRAFT_47226              215   2e-60    Coccomyxa subellipsoidea C-169
ref|XP_003080699.1|  phosphoglucan, water dikinase (ISS)                211   3e-60    
emb|CEG01409.1|  Carbohydrate binding module family 20                  213   5e-60    Ostreococcus tauri
ref|XP_001419310.1|  predicted protein                                  207   2e-58    Ostreococcus lucimarinus CCE9901
ref|XP_003059536.1|  predicted protein                                  202   2e-56    Micromonas pusilla CCMP1545
ref|XP_002504762.1|  alpha phosphoglucan water dikinase                 201   1e-55    Micromonas commoda
ref|XP_001697099.1|  phosphoglucan water dikinase                       199   2e-55    Chlamydomonas reinhardtii
ref|XP_007511444.1|  predicted protein                                  197   4e-54    Bathycoccus prasinos
gb|KJB71924.1|  hypothetical protein B456_011G147600                    195   4e-54    Gossypium raimondii
ref|XP_001417570.1|  predicted protein                                  193   7e-53    Ostreococcus lucimarinus CCE9901
gb|KFG31055.1|  pyruvate phosphate dikinase, pep/pyruvate binding...    184   9e-52    Toxoplasma gondii p89
ref|XP_003078935.1|  chloroplast alpha-glucan water dikinase isof...    188   2e-51    
emb|CEF97682.1|  Pyruvate phosphate dikinase,PEP/pyruvate-binding       189   2e-51    Ostreococcus tauri
gb|KFG99968.1|  pyruvate phosphate dikinase, pep/pyruvate binding...    183   9e-51    Toxoplasma gondii VAND
gb|KFH05191.1|  pyruvate phosphate dikinase, pep/pyruvate binding...    184   1e-50    Toxoplasma gondii MAS
ref|XP_006421076.1|  hypothetical protein CICLE_v10004968mg             177   6e-50    
gb|KFG42300.1|  pyruvate phosphate dikinase, pep/pyruvate binding...    184   8e-50    Toxoplasma gondii GAB2-2007-GAL-DOM2
gb|ESS33912.1|  pyruvate phosphate dikinase, pep/pyruvate binding...    184   1e-49    Toxoplasma gondii VEG
gb|KFG62834.1|  pyruvate phosphate dikinase, pep/pyruvate binding...    184   1e-49    Toxoplasma gondii RUB
gb|EPR59823.1|  pyruvate phosphate dikinase, pep/pyruvate binding...    184   1e-49    Toxoplasma gondii GT1
gb|EPT28056.1|  pyruvate phosphate dikinase, pep/pyruvate binding...    184   1e-49    Toxoplasma gondii ME49
ref|XP_002368480.1|  phosphoglucan, water dikinase protein, putative    184   1e-49    
gb|KFG41384.1|  pyruvate phosphate dikinase, pep/pyruvate binding...    178   5e-49    Toxoplasma gondii FOU
ref|XP_008889223.1|  pyruvate phosphate dikinase, pep/pyruvate bi...    181   3e-48    
ref|XP_005716854.1|  Phosphoglucan water dikinase, PWD                  174   4e-46    Chondrus crispus [carageen]
emb|CDI76079.1|  Carbohydrate-binding module family 20 protein, r...    166   2e-44    Eimeria acervulina
ref|XP_008662597.1|  PREDICTED: phosphoglucan, water dikinase, ch...    159   1e-43    
ref|XP_005827807.1|  hypothetical protein GUITHDRAFT_164559             166   2e-43    Guillardia theta CCMP2712
emb|CDJ47310.1|  Carbohydrate-binding module family 20 protein, r...    154   5e-40    Eimeria brunetti
gb|KEH44553.1|  phosphoglucan, water dikinase, putative                 154   8e-39    Medicago truncatula
gb|EJY83942.1|  hypothetical protein OXYTRI_18322                       144   1e-35    Oxytricha trifallax
emb|CDW77583.1|  water chloroplastic-like                               139   9e-34    Stylonychia lemnae
ref|XP_011129379.1|  putative phosphoglucan, water dikinase             128   5e-30    Gregarina niphandrodes
ref|XP_006421074.1|  hypothetical protein CICLE_v10004968mg           98.6    4e-27    
ref|XP_002502953.1|  carbohydrate-binding module family 20 protein      120   4e-27    Micromonas commoda
ref|XP_003881249.1|  phosphoenolpyruvate synthase, related              111   4e-24    Neospora caninum Liverpool
emb|CDJ67755.1|  phosphoglucan, water dikinase protein, putative        110   6e-24    Eimeria necatrix
ref|XP_007513823.1|  predicted protein                                94.7    2e-18    Bathycoccus prasinos
ref|XP_006596061.1|  PREDICTED: phosphoglucan, water dikinase, ch...  52.0    7e-06    



>ref|XP_004248008.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Solanum 
lycopersicum]
Length=1202

 Score =   390 bits (1001),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 180/210 (86%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            FVRSNDQ   +KNRKWDTSGL  I LKLVEGDKN++NWWRKLEVVR+L+VEN++S+HRLE
Sbjct  236  FVRSNDQLDSDKNRKWDTSGLTGISLKLVEGDKNARNWWRKLEVVRELVVENMDSSHRLE  295

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            ALTY+A+YLKWINTGQIPC EDGGHHRPNRHAEISRLIF E+E++L RKD TLQEILVIR
Sbjct  296  ALTYAAVYLKWINTGQIPCLEDGGHHRPNRHAEISRLIFREVEKVLSRKDTTLQEILVIR  355

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            K+ PCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLV+TE
Sbjct  356  KMQPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVSTE  415

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             MLERITK PG+YSEAFVEQFKIFH+ELKD
Sbjct  416  AMLERITKQPGQYSEAFVEQFKIFHNELKD  445



>ref|XP_006358813.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Solanum tuberosum]
Length=1202

 Score =   387 bits (994),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 179/210 (85%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            FVRSNDQ   +KNRKWDTSGL  I LKLVEGDKN++NWWRKLEVVR+L+VEN++S+HRLE
Sbjct  236  FVRSNDQLDSDKNRKWDTSGLTGISLKLVEGDKNARNWWRKLEVVRELVVENMDSSHRLE  295

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            ALTY+A+YLKWINTGQIPC EDGGHHRPNRHAEISRLIF E+E++L R+D TLQEILVIR
Sbjct  296  ALTYAAVYLKWINTGQIPCLEDGGHHRPNRHAEISRLIFREVEKVLSRRDTTLQEILVIR  355

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            K+ PCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLV+TE
Sbjct  356  KMQPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVSTE  415

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             MLERITK PG+YSEAFVEQFKIFH+ELKD
Sbjct  416  AMLERITKQPGQYSEAFVEQFKIFHNELKD  445



>ref|XP_006358812.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Solanum tuberosum]
Length=1206

 Score =   387 bits (994),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 179/210 (85%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            FVRSNDQ   +KNRKWDTSGL  I LKLVEGDKN++NWWRKLEVVR+L+VEN++S+HRLE
Sbjct  236  FVRSNDQLDSDKNRKWDTSGLTGISLKLVEGDKNARNWWRKLEVVRELVVENMDSSHRLE  295

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            ALTY+A+YLKWINTGQIPC EDGGHHRPNRHAEISRLIF E+E++L R+D TLQEILVIR
Sbjct  296  ALTYAAVYLKWINTGQIPCLEDGGHHRPNRHAEISRLIFREVEKVLSRRDTTLQEILVIR  355

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            K+ PCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLV+TE
Sbjct  356  KMQPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVSTE  415

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             MLERITK PG+YSEAFVEQFKIFH+ELKD
Sbjct  416  AMLERITKQPGQYSEAFVEQFKIFHNELKD  445



>ref|NP_001274870.1| glucan/water dikinase [Solanum tuberosum]
 gb|ACZ66259.1| glucan/water dikinase [Solanum tuberosum]
Length=1202

 Score =   386 bits (992),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 179/210 (85%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            FVRSNDQ   +KNRKWDTSGL  I LKLVEGDKN++NWWRKLEVVR+L+VEN++S+HRLE
Sbjct  236  FVRSNDQLDSDKNRKWDTSGLTGISLKLVEGDKNARNWWRKLEVVRELVVENMDSSHRLE  295

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            ALTY+A+YLKWINTGQIPC EDGGHHRPNRHAEISRLIF E+E++L R+D TLQEILVIR
Sbjct  296  ALTYAAVYLKWINTGQIPCLEDGGHHRPNRHAEISRLIFREVEKVLSRRDTTLQEILVIR  355

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            K+ PCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLV+TE
Sbjct  356  KMQPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVSTE  415

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             MLERITK PG+YSEAFVEQFKIFH+ELKD
Sbjct  416  AMLERITKRPGQYSEAFVEQFKIFHNELKD  445



>ref|XP_009599199.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Nicotiana 
tomentosiformis]
Length=1202

 Score =   382 bits (982),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 177/210 (84%), Positives = 195/210 (93%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            FVRS D+   EKNRKWDTSGL  I LKLVEGDKN++NWWRKLEVVR+L+VEN++S+ RLE
Sbjct  236  FVRSKDELDSEKNRKWDTSGLTGISLKLVEGDKNARNWWRKLEVVRELVVENMDSSQRLE  295

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            ALTY+A+YLKWINTGQIPC EDGGHHRPNRHAEISRLIF E+E++L R+DATLQEILVIR
Sbjct  296  ALTYAAVYLKWINTGQIPCLEDGGHHRPNRHAEISRLIFREVEKVLSRRDATLQEILVIR  355

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            K+ PCLPSFKAEFT SVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLV+TE
Sbjct  356  KMQPCLPSFKAEFTQSVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVSTE  415

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             MLERITK PG+YSEAFVEQFKIFH+ELKD
Sbjct  416  AMLERITKKPGQYSEAFVEQFKIFHNELKD  445



>ref|XP_011074900.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Sesamum 
indicum]
Length=1209

 Score =   382 bits (981),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 182/210 (87%), Positives = 191/210 (91%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            FVRS D    EKNR WDTSGL  I LKLVEGD++++NWWRKLEVVR+L+VEN+E+  RLE
Sbjct  245  FVRSKDHFDAEKNRNWDTSGLEGIALKLVEGDRSARNWWRKLEVVRELVVENIENAKRLE  304

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF ELERI  RKD +LQEILVIR
Sbjct  305  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRELERISSRKDTSLQEILVIR  364

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE
Sbjct  365  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  424

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML RITK PGEYSEAFVEQFKIFH ELKD
Sbjct  425  AMLARITKKPGEYSEAFVEQFKIFHRELKD  454



>gb|KDO57834.1| hypothetical protein CISIN_1g015140mg [Citrus sinensis]
Length=412

 Score =   358 bits (919),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 172/210 (82%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+R++D    E  RKWDTSGL  + LKLVEGD+ ++NWWRKLEVVR+LIVEN++S  RLE
Sbjct  151  FMRADDHWNREMERKWDTSGLQGLTLKLVEGDQRARNWWRKLEVVRELIVENLQSDERLE  210

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL YSAIYLKWINTG+IPCFEDGGHHRPNRHAEISRLIF ELE+I  RKDA+ QE+LVIR
Sbjct  211  ALIYSAIYLKWINTGKIPCFEDGGHHRPNRHAEISRLIFRELEQISCRKDASPQEVLVIR  270

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLK EIKHTIQNKLHRNAGPEDLVATE
Sbjct  271  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKLEIKHTIQNKLHRNAGPEDLVATE  330

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML +ITKNPGEYSE+FVEQFK+FH ELKD
Sbjct  331  AMLAKITKNPGEYSESFVEQFKMFHSELKD  360



>ref|XP_006421075.1| hypothetical protein CICLE_v10004968mg [Citrus clementina]
 gb|ESR34315.1| hypothetical protein CICLE_v10004968mg [Citrus clementina]
Length=445

 Score =   358 bits (918),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 173/210 (82%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+R++D    E  RKWDTSGL  + LKLVEGD+ ++NWWRKLEVVR+LIVEN++S  RLE
Sbjct  227  FMRADDHWNREMERKWDTSGLQGLTLKLVEGDQRARNWWRKLEVVRELIVENLQSDERLE  286

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL YSAIYLKWINTG+IPCFEDGGHHRPNRHAEISRLIF ELERI  RKDA+ QE+LVIR
Sbjct  287  ALIYSAIYLKWINTGKIPCFEDGGHHRPNRHAEISRLIFRELERISCRKDASPQEVLVIR  346

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLK EIKHTIQNKLHRNAGPEDLVATE
Sbjct  347  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKLEIKHTIQNKLHRNAGPEDLVATE  406

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML +ITKNPGEYSE+FVEQFK+FH ELKD
Sbjct  407  AMLAKITKNPGEYSESFVEQFKMFHSELKD  436



>ref|XP_009777858.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Nicotiana 
sylvestris]
Length=1200

 Score =   377 bits (968),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 174/210 (83%), Positives = 193/210 (92%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            FVRS D+   + NRKWDTSGL  I LKLVEGDKN++NWWRKLEVVR+L+VEN++S+ RLE
Sbjct  234  FVRSKDELDSQTNRKWDTSGLTGISLKLVEGDKNARNWWRKLEVVRELVVENMDSSQRLE  293

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            ALTY+A+YLKWINTGQIPC EDGGHHRPNRHAEISRLIF E+E++L R+D TLQEILVIR
Sbjct  294  ALTYAAVYLKWINTGQIPCLEDGGHHRPNRHAEISRLIFREVEKLLSRRDTTLQEILVIR  353

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            K+ PCLPSFKAEFT SVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLV+TE
Sbjct  354  KMQPCLPSFKAEFTQSVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVSTE  413

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             MLERITK PG+YSEAFVEQFKIFH+ELKD
Sbjct  414  AMLERITKKPGQYSEAFVEQFKIFHNELKD  443



>emb|CDP10310.1| unnamed protein product [Coffea canephora]
Length=1144

 Score =   372 bits (955),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 176/210 (84%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            FVRS +Q  +EK RKWD SGL  I LKLVEGDK S+NWWRKLEVVR+++V N+ES HRLE
Sbjct  184  FVRSKEQLNIEKERKWDISGLEGIALKLVEGDKKSRNWWRKLEVVREIVVGNIESGHRLE  243

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF ELERI   KD + QEILVIR
Sbjct  244  ALAYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRELERISYGKDTSPQEILVIR  303

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIH CLPSFKAEFT SVPLTRIRDIAHRNDIPH+LKQEIKHTIQNKLHRNAGPEDLVATE
Sbjct  304  KIHACLPSFKAEFTTSVPLTRIRDIAHRNDIPHELKQEIKHTIQNKLHRNAGPEDLVATE  363

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
            +MLE++TKNPGEY+EAFVEQFKIFH ELKD
Sbjct  364  VMLEKVTKNPGEYNEAFVEQFKIFHRELKD  393



>ref|XP_010069404.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Eucalyptus 
grandis]
 gb|KCW57742.1| hypothetical protein EUGRSUZ_H00494 [Eucalyptus grandis]
Length=1189

 Score =   371 bits (952),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 173/210 (82%), Positives = 190/210 (90%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+ SN+ R  E   +WDTSGL  + LKLVEGD+N++NWWRKLEVVR+LIVEN++  +RLE
Sbjct  241  FMSSNEHRNRETEMRWDTSGLEGVALKLVEGDRNARNWWRKLEVVRELIVENLQGENRLE  300

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL  SAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF ELERI  RKDA+ +E+LV+R
Sbjct  301  ALVNSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRELERIACRKDASPKEVLVVR  360

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE
Sbjct  361  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATE  420

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML RITKNPG+YSEAFVEQFKIFHHELKD
Sbjct  421  AMLARITKNPGQYSEAFVEQFKIFHHELKD  450



>gb|EYU23932.1| hypothetical protein MIMGU_mgv1a000391mg [Erythranthe guttata]
Length=1190

 Score =   370 bits (950),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 173/210 (82%), Positives = 190/210 (90%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            FVRSND+   EKN  WDTSGL  I LKLVEGD++++NWWRKLEVVR+L+ EN+E+ +RLE
Sbjct  237  FVRSNDRTNEEKNINWDTSGLEGISLKLVEGDRSARNWWRKLEVVRELVAENIENGNRLE  296

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            ALTYSA+YLKWINTGQIPC EDG HHRPN+HAEISRLIF E+ERI GRKD +LQEILVIR
Sbjct  297  ALTYSAVYLKWINTGQIPCSEDGAHHRPNKHAEISRLIFREIERISGRKDTSLQEILVIR  356

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTA VPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHR AGPEDL++TE
Sbjct  357  KIHPCLPSFKAEFTAPVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRCAGPEDLISTE  416

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML RITKNPGEY+EAFVEQFKIFH ELKD
Sbjct  417  AMLARITKNPGEYNEAFVEQFKIFHRELKD  446



>ref|XP_002301739.2| hypothetical protein POPTR_0002s23550g [Populus trichocarpa]
 gb|EEE81012.2| hypothetical protein POPTR_0002s23550g [Populus trichocarpa]
Length=1138

 Score =   368 bits (945),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 174/210 (83%), Positives = 187/210 (89%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+ R  E  R+WDTSGL    LKLV+GD N++NWWRKLEVVR+L+V +++S  RLE
Sbjct  223  FMRSNEHRNREAERRWDTSGLQGFALKLVQGDLNARNWWRKLEVVRELLVGSLQSEDRLE  282

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
             L YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF ELERI  RKD + QE+LVIR
Sbjct  283  VLVYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRELERISSRKDTSPQEVLVIR  342

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTASVPLTRIRDIAHR DIPHDLKQEIKHTIQNKLHRNAGPEDLVATE
Sbjct  343  KIHPCLPSFKAEFTASVPLTRIRDIAHRGDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  402

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML RITKNPGEYSEAFVEQFKIFHHELKD
Sbjct  403  AMLARITKNPGEYSEAFVEQFKIFHHELKD  432



>gb|KDP32558.1| hypothetical protein JCGZ_13108 [Jatropha curcas]
Length=1114

 Score =   365 bits (936),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 173/210 (82%), Positives = 185/210 (88%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+    E  RKWDTSGL  +   LVEGD+N++NWWRKLE+VR L+VEN++   RLE
Sbjct  157  FMRSNEHHNRETERKWDTSGLEGLAFALVEGDRNARNWWRKLELVRQLLVENLQIADRLE  216

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF ELERI  RKD + +EILVIR
Sbjct  217  ALVYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRELERISCRKDTSPKEILVIR  276

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTASVPLTRIRDIAHR DIPHDLKQEIKHTIQNKLHRNAGPEDLVATE
Sbjct  277  KIHPCLPSFKAEFTASVPLTRIRDIAHRGDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  336

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML RITKNPGEYSEAFVEQFKIFH ELKD
Sbjct  337  AMLARITKNPGEYSEAFVEQFKIFHQELKD  366



>ref|XP_011042749.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Populus euphratica]
Length=1178

 Score =   365 bits (938),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 173/210 (82%), Positives = 187/210 (89%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+ R  +  R+WDTSGL    LKLV+GD N++NWWRKLEVVR+L+V +++S  RLE
Sbjct  223  FMRSNEHRNRKAERRWDTSGLQGFALKLVQGDLNARNWWRKLEVVRELLVGSLQSEDRLE  282

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL  SAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF ELERI  RKD + QE+LVIR
Sbjct  283  ALVCSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRELERISSRKDTSPQEVLVIR  342

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTASVPLTRIRDIAHR DIPHDLKQEIKHTIQNKLHRNAGPEDLVATE
Sbjct  343  KIHPCLPSFKAEFTASVPLTRIRDIAHRGDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  402

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML RITKNPGEYSEAFVEQFKIFHHELKD
Sbjct  403  AMLARITKNPGEYSEAFVEQFKIFHHELKD  432



>ref|XP_004296959.2| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=1191

 Score =   365 bits (936),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 170/210 (81%), Positives = 188/210 (90%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+ R  E  R WDTSGL  + LKLVEGD+N++NWWRKLEVVRD+++E+ +S  RL 
Sbjct  231  FMRSNEHRDRESGRNWDTSGLEGLSLKLVEGDRNARNWWRKLEVVRDILLESSQSEERLS  290

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL  S+IYLKWINTGQIPCFEDGGHHRPNRHAEISR+IF ELERI  +KD + QE+LVIR
Sbjct  291  ALINSSIYLKWINTGQIPCFEDGGHHRPNRHAEISRVIFRELERISCKKDTSPQEVLVIR  350

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE
Sbjct  351  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATE  410

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML RITKNPG+YSEAFVEQFKIFHHELKD
Sbjct  411  AMLARITKNPGQYSEAFVEQFKIFHHELKD  440



>ref|XP_002518612.1| chloroplast alpha-glucan water dikinase, putative [Ricinus communis]
 gb|EEF43754.1| chloroplast alpha-glucan water dikinase, putative [Ricinus communis]
Length=1174

 Score =   363 bits (933),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 188/210 (90%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+ R  E  RKWDTSGL  + L LVEGD++++NWWRKLEVVR L+V ++++  RL+
Sbjct  218  FMRSNEHRDRETERKWDTSGLEGLALALVEGDRDARNWWRKLEVVRQLLVGSLQTADRLD  277

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF ELERI  RKD + +EILVIR
Sbjct  278  ALIYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRELERISCRKDTSPKEILVIR  337

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTASVPLTRIRDIAHR DIPHDLKQEIKHTIQNKLHRNAGPEDLVATE
Sbjct  338  KIHPCLPSFKAEFTASVPLTRIRDIAHRGDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  397

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML RIT+NPGEYS+AFVEQFKIFHHELKD
Sbjct  398  AMLARITRNPGEYSDAFVEQFKIFHHELKD  427



>ref|XP_008393850.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Malus domestica]
Length=937

 Score =   359 bits (921),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 172/210 (82%), Positives = 188/210 (90%), Gaps = 1/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+  G  K  KWDTSGL  + LKLVEGD+N++NWW+KLEVVRDL+V +++S  RL+
Sbjct  224  FMRSNEH-GNRKGGKWDTSGLEGLALKLVEGDRNARNWWKKLEVVRDLLVGSLQSEDRLD  282

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL  SAIYLKWINTGQIPCFEDGGHHRPNRHAEISR+IF ELERI  RKD + QE+LVIR
Sbjct  283  ALINSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRVIFRELERISCRKDTSPQEVLVIR  342

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE
Sbjct  343  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  402

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML RITKNPGEY+ AFVEQFKIFHHELKD
Sbjct  403  AMLARITKNPGEYNGAFVEQFKIFHHELKD  432



>ref|XP_008222722.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Prunus 
mume]
Length=1190

 Score =   363 bits (932),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 172/210 (82%), Positives = 187/210 (89%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+    E  R WDTSGL  + LKLVEGD+N++NWWRKLEVVRDL+V + +S  RL+
Sbjct  228  FMRSNEHGNREAGRIWDTSGLEGLALKLVEGDRNARNWWRKLEVVRDLLVGSSQSEDRLD  287

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL  SAIYLKWINTGQIPCFEDGGHHRPNRHAEISR+IF ELERI  RKD + QE+LV+R
Sbjct  288  ALINSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRVIFRELERISCRKDTSTQEVLVVR  347

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE
Sbjct  348  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  407

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML RITKNPGEY+EAFVEQFKIFHHELKD
Sbjct  408  AMLARITKNPGEYNEAFVEQFKIFHHELKD  437



>ref|XP_008393849.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Malus domestica]
Length=965

 Score =   358 bits (919),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 172/210 (82%), Positives = 188/210 (90%), Gaps = 1/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+  G  K  KWDTSGL  + LKLVEGD+N++NWW+KLEVVRDL+V +++S  RL+
Sbjct  224  FMRSNEH-GNRKGGKWDTSGLEGLALKLVEGDRNARNWWKKLEVVRDLLVGSLQSEDRLD  282

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL  SAIYLKWINTGQIPCFEDGGHHRPNRHAEISR+IF ELERI  RKD + QE+LVIR
Sbjct  283  ALINSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRVIFRELERISCRKDTSPQEVLVIR  342

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE
Sbjct  343  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  402

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML RITKNPGEY+ AFVEQFKIFHHELKD
Sbjct  403  AMLARITKNPGEYNGAFVEQFKIFHHELKD  432



>emb|CBI39424.3| unnamed protein product [Vitis vinifera]
Length=1149

 Score =   362 bits (928),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 170/210 (81%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+ R  E  R+WDTSGL  +  KLVEGD+N++NWW+KLEVVR+L+V N+ES  RLE
Sbjct  223  FMRSNEHRNQETERRWDTSGLEGLARKLVEGDRNARNWWQKLEVVRELLVGNLESGDRLE  282

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL +SAIYLKWINTGQIPCFE GGHHRPNRHAEISRLIF ELERI   KD + QE+LVIR
Sbjct  283  ALIFSAIYLKWINTGQIPCFEGGGHHRPNRHAEISRLIFRELERISCMKDTSPQEVLVIR  342

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTASVPLTRIRDIAHR DIPHDLKQEIKHTIQNKLHRNAGPEDLVAT+
Sbjct  343  KIHPCLPSFKAEFTASVPLTRIRDIAHRGDIPHDLKQEIKHTIQNKLHRNAGPEDLVATD  402

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML RIT+NPGEYSE FVEQFKIFHHELKD
Sbjct  403  AMLARITRNPGEYSETFVEQFKIFHHELKD  432



>ref|XP_002265211.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Vitis 
vinifera]
Length=1188

 Score =   362 bits (929),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 170/210 (81%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+ R  E  R+WDTSGL  +  KLVEGD+N++NWW+KLEVVR+L+V N+ES  RLE
Sbjct  223  FMRSNEHRNQETERRWDTSGLEGLARKLVEGDRNARNWWQKLEVVRELLVGNLESGDRLE  282

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL +SAIYLKWINTGQIPCFE GGHHRPNRHAEISRLIF ELERI   KD + QE+LVIR
Sbjct  283  ALIFSAIYLKWINTGQIPCFEGGGHHRPNRHAEISRLIFRELERISCMKDTSPQEVLVIR  342

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTASVPLTRIRDIAHR DIPHDLKQEIKHTIQNKLHRNAGPEDLVAT+
Sbjct  343  KIHPCLPSFKAEFTASVPLTRIRDIAHRGDIPHDLKQEIKHTIQNKLHRNAGPEDLVATD  402

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML RIT+NPGEYSE FVEQFKIFHHELKD
Sbjct  403  AMLARITRNPGEYSETFVEQFKIFHHELKD  432



>ref|XP_006493516.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Citrus sinensis]
Length=1190

 Score =   362 bits (929),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 172/210 (82%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+R++D    E  RKWDTSGL  + LKLVEGD+ ++NWWRKLEVVR+LIVEN++S  RLE
Sbjct  229  FMRADDHWNREMERKWDTSGLQGLTLKLVEGDQRARNWWRKLEVVRELIVENLQSDERLE  288

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL YSAIYLKWINTG+IPCFEDGGHHRPNRHAEISRLIF ELE+I  RKDA+ QE+LVIR
Sbjct  289  ALIYSAIYLKWINTGKIPCFEDGGHHRPNRHAEISRLIFRELEQISCRKDASPQEVLVIR  348

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLK EIKHTIQNKLHRNAGPEDLVATE
Sbjct  349  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKLEIKHTIQNKLHRNAGPEDLVATE  408

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML +ITKNPGEYSE+FVEQFK+FH ELKD
Sbjct  409  AMLAKITKNPGEYSESFVEQFKMFHSELKD  438



>gb|KJB71923.1| hypothetical protein B456_011G147600 [Gossypium raimondii]
Length=1127

 Score =   360 bits (924),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 170/210 (81%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+    E  R+WDT+GL  + LKLVEGDK+++NWWRKLEVVR+L+V +++S  RLE
Sbjct  167  FMRSNEHHNRELERRWDTTGLEGLALKLVEGDKSARNWWRKLEVVRELLVGSLQSEERLE  226

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL  SAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF ELERI  RKD++ QE+LVIR
Sbjct  227  ALICSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRELERISSRKDSSPQELLVIR  286

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE
Sbjct  287  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  346

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML RIT++PG+YSEAFVEQFKIFH ELKD
Sbjct  347  AMLARITRDPGQYSEAFVEQFKIFHLELKD  376



>ref|XP_010107197.1| Phosphoglucan, water dikinase [Morus notabilis]
 gb|EXC14221.1| Phosphoglucan, water dikinase [Morus notabilis]
Length=894

 Score =   353 bits (907),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 170/212 (80%), Positives = 184/212 (87%), Gaps = 2/212 (1%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWD--TSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHR  176
            F+RSN+ R  E  R WD  TS L  + LKLVEGD+N++NWWRKLE++R+L+ EN ES  R
Sbjct  150  FMRSNEHRAHETERTWDRDTSDLERLALKLVEGDRNARNWWRKLEIIRELVAENSESEDR  209

Query  177  LEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILV  356
            L+AL YSAIYLKWINTGQIPC EDGGHHRPNRHAEISRLIF ELE I  RKD +LQE LV
Sbjct  210  LDALIYSAIYLKWINTGQIPCLEDGGHHRPNRHAEISRLIFRELEWIYSRKDTSLQERLV  269

Query  357  IRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVA  536
            IRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLV+
Sbjct  270  IRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVS  329

Query  537  TELMLERITKNPGEYSEAFVEQFKIFHHELKD  632
            TE ML RITKN GEYSEAFV+QFKIFH ELKD
Sbjct  330  TEAMLARITKNTGEYSEAFVDQFKIFHQELKD  361



>gb|KJB71921.1| hypothetical protein B456_011G147600 [Gossypium raimondii]
Length=1186

 Score =   359 bits (921),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 170/210 (81%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+    E  R+WDT+GL  + LKLVEGDK+++NWWRKLEVVR+L+V +++S  RLE
Sbjct  226  FMRSNEHHNRELERRWDTTGLEGLALKLVEGDKSARNWWRKLEVVRELLVGSLQSEERLE  285

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL  SAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF ELERI  RKD++ QE+LVIR
Sbjct  286  ALICSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRELERISSRKDSSPQELLVIR  345

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE
Sbjct  346  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  405

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML RIT++PG+YSEAFVEQFKIFH ELKD
Sbjct  406  AMLARITRDPGQYSEAFVEQFKIFHLELKD  435



>gb|KJB71922.1| hypothetical protein B456_011G147600 [Gossypium raimondii]
Length=1186

 Score =   359 bits (921),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 170/210 (81%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+    E  R+WDT+GL  + LKLVEGDK+++NWWRKLEVVR+L+V +++S  RLE
Sbjct  226  FMRSNEHHNRELERRWDTTGLEGLALKLVEGDKSARNWWRKLEVVRELLVGSLQSEERLE  285

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL  SAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF ELERI  RKD++ QE+LVIR
Sbjct  286  ALICSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRELERISSRKDSSPQELLVIR  345

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE
Sbjct  346  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  405

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML RIT++PG+YSEAFVEQFKIFH ELKD
Sbjct  406  AMLARITRDPGQYSEAFVEQFKIFHLELKD  435



>ref|XP_007034117.1| Catalytics,carbohydrate kinases,phosphoglucan [Theobroma cacao]
 gb|EOY05043.1| Catalytics,carbohydrate kinases,phosphoglucan [Theobroma cacao]
Length=1180

 Score =   359 bits (921),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 170/210 (81%), Positives = 185/210 (88%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+    E  RKWDT+GL  + LKLVEGDK+S+NWWRKLEVV +L+V +++S   LE
Sbjct  220  FMRSNEHHNRELERKWDTTGLEGLALKLVEGDKSSRNWWRKLEVVHELLVGSLQSGELLE  279

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL  SAIYLKWINTGQIPCFEDGGHHRPNRHAEISR IFCELERI  RKD + QE+LVIR
Sbjct  280  ALICSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRHIFCELERISSRKDTSPQEVLVIR  339

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVAT+
Sbjct  340  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATD  399

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML R+TKNPGEYSE FVEQFKIFH ELKD
Sbjct  400  AMLARVTKNPGEYSEPFVEQFKIFHQELKD  429



>ref|NP_001119280.1| phosphoglucan, water dikinase [Arabidopsis thaliana]
 gb|AED93556.1| phosphoglucan, water dikinase [Arabidopsis thaliana]
Length=865

 Score =   352 bits (903),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 166/210 (79%), Positives = 184/210 (88%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSND    E  R WDTSGL    LK+VEGD+NS+NWWRKLE+VR++IV +VE   RL+
Sbjct  225  FMRSNDHGNREVGRNWDTSGLEGTALKMVEGDRNSKNWWRKLEMVREVIVGSVEREERLK  284

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF ELE I  +KDAT +E+LV R
Sbjct  285  ALIYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRELEHICSKKDATPEEVLVAR  344

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTA+VPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE
Sbjct  345  KIHPCLPSFKAEFTAAVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATE  404

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML+RIT+ PG+YS  FVEQFKIFH+ELKD
Sbjct  405  AMLQRITETPGKYSGDFVEQFKIFHNELKD  434



>ref|XP_010454991.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=895

 Score =   352 bits (904),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 184/210 (88%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSND    E  R WDT+GL    LK+VEGD+NS+NWWRKLE+VR++IV +VE   RL+
Sbjct  219  FMRSNDHGNREVGRNWDTTGLEGTALKMVEGDRNSRNWWRKLEMVREVIVGSVEREERLK  278

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF ELE I  +KDAT +E+LV R
Sbjct  279  ALIYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRELEHICSKKDATAEEVLVAR  338

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTA+VPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE
Sbjct  339  KIHPCLPSFKAEFTAAVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATE  398

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML+RIT+ PG+YS  FVEQFKIFH+ELKD
Sbjct  399  AMLQRITETPGKYSGDFVEQFKIFHNELKD  428



>ref|XP_007225436.1| hypothetical protein PRUPE_ppa000429mg [Prunus persica]
 gb|EMJ26635.1| hypothetical protein PRUPE_ppa000429mg [Prunus persica]
Length=1191

 Score =   358 bits (919),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+    E  R  DTSGL  + LKLVEGD+N++NWWRKLEVVRDL+V + +S  RL+
Sbjct  229  FMRSNEHGNREAGRILDTSGLQGLALKLVEGDRNARNWWRKLEVVRDLLVGSSQSEDRLD  288

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL  SAIYLKWINTGQIPCFEDGGHHRPNRHAEISR+IF ELERI  RKD + QE+LV+R
Sbjct  289  ALINSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRVIFRELERISCRKDTSPQEVLVVR  348

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE
Sbjct  349  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  408

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML RITKNPGEY+EAFVEQFKIFHHELKD
Sbjct  409  AMLARITKNPGEYNEAFVEQFKIFHHELKD  438



>gb|AFO83531.1| glucan water dikinase 3, partial [Manihot esculenta]
Length=1084

 Score =   355 bits (911),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 168/210 (80%), Positives = 185/210 (88%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+ R  E  R WDTS L  + L +VEGD+N++NWWRKLEVVR+L+VEN+++  RLE
Sbjct  157  FMRSNEHRNRETERTWDTSDLEGLALTVVEGDRNARNWWRKLEVVRELLVENLDTGDRLE  216

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL  SAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF  LE+I  RKD +  EILVIR
Sbjct  217  ALICSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRGLEQISCRKDTSPNEILVIR  276

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTASVPLTRIRDIAHR DIPHDLKQEIKHTIQNKLHRNAGPEDLVATE
Sbjct  277  KIHPCLPSFKAEFTASVPLTRIRDIAHRGDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  336

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML RITKNPGE+S+AFVEQF+IFHHELKD
Sbjct  337  AMLARITKNPGEFSDAFVEQFRIFHHELKD  366



>ref|XP_002320442.2| hypothetical protein POPTR_0014s14510g [Populus trichocarpa]
 gb|EEE98757.2| hypothetical protein POPTR_0014s14510g [Populus trichocarpa]
Length=1159

 Score =   356 bits (913),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 184/210 (88%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSND       R+WDTSGL    LKLVEGD N++NW RKLEVV +L+V +++S  RLE
Sbjct  217  FMRSNDHGNRGSERRWDTSGLQGSVLKLVEGDLNARNWRRKLEVVCELLVGSLQSKDRLE  276

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL YSAIYLKWINTGQ+PCFEDGGHHRPNRHAEISRLIF ELE++  R+D + QE+LVIR
Sbjct  277  ALIYSAIYLKWINTGQVPCFEDGGHHRPNRHAEISRLIFQELEQVSSRRDTSAQEVLVIR  336

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTASVPLTRIRDIAHR DIPHDLKQEIKHTIQNKLHRNAGPEDLVATE
Sbjct  337  KIHPCLPSFKAEFTASVPLTRIRDIAHRGDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  396

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML RITKNPGEYSEAFVEQFKIFHHELKD
Sbjct  397  AMLARITKNPGEYSEAFVEQFKIFHHELKD  426



>gb|KHF99077.1| Phosphoglucan, water dikinase, chloroplastic -like protein [Gossypium 
arboreum]
Length=1169

 Score =   355 bits (912),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 187/210 (89%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+    E  R+WDT+GL  + LKLVEGDK+++NWWRKLEVVR+L+V +++   RLE
Sbjct  226  FMRSNEHHNRELERRWDTTGLEGLALKLVEGDKSARNWWRKLEVVRELLVGSLQREERLE  285

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL  SAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF ELERI  RKD++ QE+LVIR
Sbjct  286  ALICSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRELERISCRKDSSPQELLVIR  345

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE
Sbjct  346  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  405

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML RIT+ PG+YSEAFVEQFKIFH ELKD
Sbjct  406  AMLARITREPGQYSEAFVEQFKIFHRELKD  435



>ref|XP_006394878.1| hypothetical protein EUTSA_v10003634mg [Eutrema salsugineum]
 gb|ESQ32164.1| hypothetical protein EUTSA_v10003634mg [Eutrema salsugineum]
Length=880

 Score =   350 bits (898),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 164/210 (78%), Positives = 184/210 (88%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+    E  R WDT+GL    LK+VEGD+NS+NWWRKLE+VR++IV ++E   RL+
Sbjct  216  FMRSNEHGNREVGRNWDTTGLEGSALKMVEGDRNSRNWWRKLEMVREVIVGSLEREERLK  275

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL YSA+YLKWINTGQIPCFEDGGHHRPNRHAEISRLIF ELE I  +KDAT +E+LV R
Sbjct  276  ALIYSAVYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRELEHICSKKDATAEEVLVSR  335

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE
Sbjct  336  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATE  395

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             MLERIT+ PG+YS  FVEQFKIFH+ELKD
Sbjct  396  AMLERITETPGQYSGDFVEQFKIFHNELKD  425



>ref|XP_009371117.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Pyrus x bretschneideri]
Length=965

 Score =   351 bits (900),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 185/210 (88%), Gaps = 1/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+  G  +  KWDTSGL  + LKLVEGD+N++NWWRKLEVVRDL+V +++S  RL+
Sbjct  224  FMRSNEH-GNREGGKWDTSGLEGLALKLVEGDRNARNWWRKLEVVRDLLVGSLQSEDRLD  282

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL  S IYLKWINTGQIPCFE GGHHRPNRHAEISR+IF ELERI  RKD + QE+LVIR
Sbjct  283  ALINSTIYLKWINTGQIPCFEGGGHHRPNRHAEISRVIFRELERISCRKDTSPQEVLVIR  342

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE
Sbjct  343  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  402

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML RITKNPGEY+ AFVEQFKIFH ELKD
Sbjct  403  AMLARITKNPGEYNGAFVEQFKIFHRELKD  432



>ref|XP_011000022.1| PREDICTED: LOW QUALITY PROTEIN: phosphoglucan, water dikinase, 
chloroplastic-like [Populus euphratica]
Length=1172

 Score =   354 bits (908),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 168/210 (80%), Positives = 183/210 (87%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSND       R+WDTSGL    LKLVEGD N++NW RKLEVV +L+V +++S  RLE
Sbjct  217  FMRSNDHGNRGSERRWDTSGLQGSVLKLVEGDLNARNWRRKLEVVCELLVGSLQSKDRLE  276

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL YSAIYLKWINTGQ+PCFEDGGHHRPNRHAEISRLIF ELE++  R+D + QE+LVIR
Sbjct  277  ALIYSAIYLKWINTGQVPCFEDGGHHRPNRHAEISRLIFQELEQVSSRRDTSAQEVLVIR  336

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTASVPLTRIRDIAHR DIPHDLKQEI HTIQNKLHRNAGPEDLVATE
Sbjct  337  KIHPCLPSFKAEFTASVPLTRIRDIAHRGDIPHDLKQEIXHTIQNKLHRNAGPEDLVATE  396

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML RITKNPGEYSEAFVEQFKIFHHELKD
Sbjct  397  AMLARITKNPGEYSEAFVEQFKIFHHELKD  426



>ref|XP_002872212.1| hypothetical protein ARALYDRAFT_489476 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48471.1| hypothetical protein ARALYDRAFT_489476 [Arabidopsis lyrata subsp. 
lyrata]
Length=1193

 Score =   354 bits (908),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 164/210 (78%), Positives = 185/210 (88%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSND    E  R WDT+GL    LK+VEGD+NS+NWWRKLE+VR++IV +VE   RL+
Sbjct  222  FMRSNDHGNREVGRNWDTTGLEGTALKMVEGDRNSKNWWRKLEMVREVIVGSVEKEERLK  281

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL YS+IYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF ELE+I  +KDAT +E+LV R
Sbjct  282  ALIYSSIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRELEQICSKKDATAEEVLVAR  341

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTA+VPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE
Sbjct  342  KIHPCLPSFKAEFTAAVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATE  401

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML+RIT+ PG+YS  FVEQFKIFH+ELKD
Sbjct  402  AMLQRITETPGKYSGDFVEQFKIFHNELKD  431



>gb|AAU93516.1| chloroplast alpha-glucan water dikinase isoform 3 [Arabidopsis 
thaliana]
Length=1196

 Score =   353 bits (907),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 166/210 (79%), Positives = 184/210 (88%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSND    E  R WDTSGL    LK+VEGD+NS+NWWRKLE+VR++IV +VE   RL+
Sbjct  225  FMRSNDHGNREVGRNWDTSGLEGTALKMVEGDRNSKNWWRKLEMVREVIVGSVEREERLK  284

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF ELE I  +KDAT +E+LV R
Sbjct  285  ALIYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRELEHICSKKDATPEEVLVAR  344

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTA+VPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE
Sbjct  345  KIHPCLPSFKAEFTAAVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATE  404

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML+RIT+ PG+YS  FVEQFKIFH+ELKD
Sbjct  405  AMLQRITETPGKYSGDFVEQFKIFHNELKD  434



>ref|NP_198009.3| phosphoglucan, water dikinase [Arabidopsis thaliana]
 sp|Q6ZY51.1|PWD_ARATH RecName: Full=Phosphoglucan, water dikinase, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAG25776.1| phosphoglucan, water dikinase [Arabidopsis thaliana]
 gb|AED93555.1| phosphoglucan, water dikinase [Arabidopsis thaliana]
Length=1196

 Score =   353 bits (907),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 166/210 (79%), Positives = 184/210 (88%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSND    E  R WDTSGL    LK+VEGD+NS+NWWRKLE+VR++IV +VE   RL+
Sbjct  225  FMRSNDHGNREVGRNWDTSGLEGTALKMVEGDRNSKNWWRKLEMVREVIVGSVEREERLK  284

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF ELE I  +KDAT +E+LV R
Sbjct  285  ALIYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRELEHICSKKDATPEEVLVAR  344

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTA+VPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE
Sbjct  345  KIHPCLPSFKAEFTAAVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATE  404

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML+RIT+ PG+YS  FVEQFKIFH+ELKD
Sbjct  405  AMLQRITETPGKYSGDFVEQFKIFHNELKD  434



>gb|KJB37918.1| hypothetical protein B456_006G226300 [Gossypium raimondii]
Length=872

 Score =   347 bits (891),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 182/210 (87%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F++SN+    E  RKWDT+GL    LKLVE DKN++NWWRKLEVVR+LI E++E    LE
Sbjct  218  FIQSNEHHDREVERKWDTTGLKGFALKLVEEDKNARNWWRKLEVVRELIHESLEIGELLE  277

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL  SA+YLKW+NTGQIPCFEDGGHHRPN+HAEISR IFCELE+I  RKD + QE+LVIR
Sbjct  278  ALICSAVYLKWVNTGQIPCFEDGGHHRPNKHAEISRDIFCELEKITCRKDTSPQELLVIR  337

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTA VPLTRIRDIAHRNDI HDLKQEIKHTIQNKLHRNAGPEDLV+TE
Sbjct  338  KIHPCLPSFKAEFTAPVPLTRIRDIAHRNDISHDLKQEIKHTIQNKLHRNAGPEDLVSTE  397

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML RITKNPGEYSEAF+EQFKIFH ELKD
Sbjct  398  AMLARITKNPGEYSEAFIEQFKIFHQELKD  427



>ref|XP_010493900.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Camelina sativa]
Length=1194

 Score =   353 bits (906),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 184/210 (88%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSND    E  R WDT+GL    LK+VEGD+NS+NWWRKLE+VR++IV +VE   RL+
Sbjct  223  FMRSNDHGNREVGRNWDTTGLEGTALKMVEGDRNSRNWWRKLEMVREVIVGSVEREERLK  282

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF ELE I  +KDAT +E+LV R
Sbjct  283  ALIYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRELEHICSKKDATAEEVLVAR  342

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTA+VPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE
Sbjct  343  KIHPCLPSFKAEFTAAVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATE  402

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML+RIT+ PG+YS  FVEQFKIFH+ELKD
Sbjct  403  AMLQRITETPGKYSGDFVEQFKIFHNELKD  432



>ref|XP_010454990.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=1182

 Score =   353 bits (906),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 184/210 (88%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSND    E  R WDT+GL    LK+VEGD+NS+NWWRKLE+VR++IV +VE   RL+
Sbjct  219  FMRSNDHGNREVGRNWDTTGLEGTALKMVEGDRNSRNWWRKLEMVREVIVGSVEREERLK  278

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF ELE I  +KDAT +E+LV R
Sbjct  279  ALIYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRELEHICSKKDATAEEVLVAR  338

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTA+VPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE
Sbjct  339  KIHPCLPSFKAEFTAAVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATE  398

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML+RIT+ PG+YS  FVEQFKIFH+ELKD
Sbjct  399  AMLQRITETPGKYSGDFVEQFKIFHNELKD  428



>ref|XP_010493901.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Camelina sativa]
Length=1194

 Score =   353 bits (906),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 184/210 (88%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSND    E  R WDT+GL    LK+VEGD+NS+NWWRKLE+VR++IV +VE   RL+
Sbjct  223  FMRSNDHGNREVGRNWDTTGLEGTALKMVEGDRNSRNWWRKLEMVREVIVGSVEREERLK  282

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF ELE I  +KDAT +E+LV R
Sbjct  283  ALIYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRELEHICSKKDATAEEVLVAR  342

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTA+VPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE
Sbjct  343  KIHPCLPSFKAEFTAAVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATE  402

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML+RIT+ PG+YS  FVEQFKIFH+ELKD
Sbjct  403  AMLQRITETPGKYSGDFVEQFKIFHNELKD  432



>ref|XP_007142602.1| hypothetical protein PHAVU_007G001400g [Phaseolus vulgaris]
 gb|ESW14596.1| hypothetical protein PHAVU_007G001400g [Phaseolus vulgaris]
Length=952

 Score =   349 bits (895),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 164/210 (78%), Positives = 181/210 (86%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSND R  E   KWDTSGL  +PLK V+ D+N++NWWRKL++VRD+I   ++   RLE
Sbjct  230  FMRSNDHRTHETQMKWDTSGLHGLPLKFVQADQNARNWWRKLDIVRDIIAGGLQGEDRLE  289

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL YSAIYLKWINTGQI CFEDGGHHRPNRHAEISRLIF ELER   RKD + QE+LVIR
Sbjct  290  ALLYSAIYLKWINTGQITCFEDGGHHRPNRHAEISRLIFRELERHTARKDISPQEVLVIR  349

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLK +IKHTIQNKLHRNAGPEDLVATE
Sbjct  350  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKLQIKHTIQNKLHRNAGPEDLVATE  409

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML +ITKNPGEYSE FV++FKIFH ELKD
Sbjct  410  AMLAKITKNPGEYSEPFVKEFKIFHLELKD  439



>ref|XP_010546804.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Tarenaya hassleriana]
Length=1174

 Score =   352 bits (904),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 168/210 (80%), Positives = 186/210 (89%), Gaps = 1/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+ R  E +R W+T+GL    LKLVEGD+N++NWWRKLEVVR+LIV ++E   RLE
Sbjct  218  FMRSNEHRNREVDRIWNTTGLEGSALKLVEGDRNARNWWRKLEVVRELIVGSIEREERLE  277

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL YSAIYLKWINTGQIPC EDGGHHRPNRHAEISR IF ELERI   KDA+ +E+LV R
Sbjct  278  ALLYSAIYLKWINTGQIPCLEDGGHHRPNRHAEISRFIFRELERICC-KDASAEEVLVAR  336

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTASVPLTRIRDIAHR DIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE
Sbjct  337  KIHPCLPSFKAEFTASVPLTRIRDIAHRGDIPHDLKQEIKHTIQNKLHRNAGPEDLIATE  396

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             MLERITKNPGEY+EAFVEQF+IFH+ELKD
Sbjct  397  AMLERITKNPGEYNEAFVEQFRIFHNELKD  426



>ref|XP_010546803.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Tarenaya hassleriana]
Length=1176

 Score =   352 bits (904),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 168/210 (80%), Positives = 186/210 (89%), Gaps = 1/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+ R  E +R W+T+GL    LKLVEGD+N++NWWRKLEVVR+LIV ++E   RLE
Sbjct  218  FMRSNEHRNREVDRIWNTTGLEGSALKLVEGDRNARNWWRKLEVVRELIVGSIEREERLE  277

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL YSAIYLKWINTGQIPC EDGGHHRPNRHAEISR IF ELERI   KDA+ +E+LV R
Sbjct  278  ALLYSAIYLKWINTGQIPCLEDGGHHRPNRHAEISRFIFRELERICC-KDASAEEVLVAR  336

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTASVPLTRIRDIAHR DIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE
Sbjct  337  KIHPCLPSFKAEFTASVPLTRIRDIAHRGDIPHDLKQEIKHTIQNKLHRNAGPEDLIATE  396

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             MLERITKNPGEY+EAFVEQF+IFH+ELKD
Sbjct  397  AMLERITKNPGEYNEAFVEQFRIFHNELKD  426



>ref|XP_010424348.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Camelina sativa]
Length=1126

 Score =   352 bits (902),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 164/210 (78%), Positives = 184/210 (88%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSND    E  R WDT+GL    L++VEGD+NS+NWWRKLE+VR++IV +VE   RL+
Sbjct  213  FMRSNDHGNREVGRNWDTTGLEGTALRMVEGDRNSRNWWRKLEMVREVIVGSVEREERLK  272

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF ELE I  +KDAT +E+LV R
Sbjct  273  ALIYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRELEHICSKKDATAEEVLVAR  332

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTA+VPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE
Sbjct  333  KIHPCLPSFKAEFTAAVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATE  392

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML+RIT+ PG+YS  FVEQFKIFH+ELKD
Sbjct  393  AMLQRITETPGKYSGDFVEQFKIFHNELKD  422



>ref|XP_009371116.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Pyrus x bretschneideri]
Length=1185

 Score =   352 bits (904),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 185/210 (88%), Gaps = 1/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+  G  +  KWDTSGL  + LKLVEGD+N++NWWRKLEVVRDL+V +++S  RL+
Sbjct  224  FMRSNEH-GNREGGKWDTSGLEGLALKLVEGDRNARNWWRKLEVVRDLLVGSLQSEDRLD  282

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL  S IYLKWINTGQIPCFE GGHHRPNRHAEISR+IF ELERI  RKD + QE+LVIR
Sbjct  283  ALINSTIYLKWINTGQIPCFEGGGHHRPNRHAEISRVIFRELERISCRKDTSPQEVLVIR  342

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE
Sbjct  343  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  402

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML RITKNPGEY+ AFVEQFKIFH ELKD
Sbjct  403  AMLARITKNPGEYNGAFVEQFKIFHRELKD  432



>ref|XP_010551754.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Tarenaya hassleriana]
Length=1183

 Score =   352 bits (903),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 166/210 (79%), Positives = 183/210 (87%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+ R  E +R WDT+GL    LKLVEGD+N++NWWRKLEVVR+LIV ++E   RLE
Sbjct  224  FMRSNEHRNREVDRIWDTTGLEGSALKLVEGDRNARNWWRKLEVVRELIVGSIERKERLE  283

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL YSAIYLKWINTGQIPCFEDG H+RPNRHAEISRLIF ELE I   KDA+ +E+LV R
Sbjct  284  ALIYSAIYLKWINTGQIPCFEDGSHYRPNRHAEISRLIFRELEHICCTKDASAEEVLVAR  343

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFT SVPLTRIRDIAHR DIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE
Sbjct  344  KIHPCLPSFKAEFTVSVPLTRIRDIAHRGDIPHDLKQEIKHTIQNKLHRNAGPEDLIATE  403

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             MLERITKNPGEYS  FVEQF+IFH+ELKD
Sbjct  404  AMLERITKNPGEYSADFVEQFRIFHNELKD  433



>gb|KFK26410.1| hypothetical protein AALP_AA8G245000 [Arabis alpina]
Length=1180

 Score =   352 bits (903),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 183/210 (87%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSND    E  R WDT+GL    LK+VEGD+NS+NWWRKLE+VR+LIV ++E   RL+
Sbjct  220  FMRSNDHSNREVGRNWDTTGLKGTALKIVEGDQNSKNWWRKLEMVRELIVGSLEREERLQ  279

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF +LE I  +KDAT +E+LV R
Sbjct  280  ALIYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRQLEHICSKKDATAEEVLVAR  339

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHR AGPEDL+ATE
Sbjct  340  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRCAGPEDLIATE  399

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             MLERIT+ PG+YS  FVEQFKIFH+ELKD
Sbjct  400  AMLERITETPGKYSADFVEQFKIFHNELKD  429



>ref|XP_004952076.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Setaria italica]
Length=1206

 Score =   352 bits (903),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 162/210 (77%), Positives = 184/210 (88%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+    +  RKWDT+GL  +PL+LVEGDK S+NWWRKLE++R L+ ++V+   RLE
Sbjct  235  FMRSNEHGNKDSERKWDTTGLGAVPLQLVEGDKVSRNWWRKLELIRGLLSKSVDDQSRLE  294

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            ALTYSAIYLKWI TGQIPCFEDGGHHRPN+HAEISR IF E+ERI   K+ + Q++LVIR
Sbjct  295  ALTYSAIYLKWIYTGQIPCFEDGGHHRPNKHAEISREIFREIERIYYGKNTSAQDLLVIR  354

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFK+EFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE
Sbjct  355  KIHPCLPSFKSEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATE  414

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML RITK PGEYSEAFVEQFKIF+ ELKD
Sbjct  415  AMLARITKTPGEYSEAFVEQFKIFYSELKD  444



>ref|XP_009129923.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Brassica rapa]
Length=1156

 Score =   351 bits (901),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 183/210 (87%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+ SN+    E  R WDTSGL    LK+VEGD+NS+NWWRKLE+VR++IV +VE   RL+
Sbjct  204  FMSSNEHGDREVGRSWDTSGLEGPGLKMVEGDRNSRNWWRKLEMVREVIVGSVEREERLK  263

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL YSA+YLKWINTGQIPCFEDGGHHRPNRHAEISRLIF ELE I  +KDAT +E+LV R
Sbjct  264  ALIYSAVYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRELENICSKKDATAEEVLVAR  323

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE
Sbjct  324  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATE  383

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             MLERIT+ PG+YS  FVEQFKIFH+ELKD
Sbjct  384  AMLERITETPGKYSGDFVEQFKIFHNELKD  413



>ref|XP_010907528.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Elaeis 
guineensis]
Length=926

 Score =   346 bits (887),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 163/210 (78%), Positives = 184/210 (88%), Gaps = 1/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+ +  E  R WDT GL  + LKLVEGD+ ++NWWRKLEVVR+L++EN++    LE
Sbjct  223  FMRSNEHKSRETERTWDTDGLDGVVLKLVEGDRVARNWWRKLEVVRELLMENIKGDC-LE  281

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL Y AIYLKWIN GQIPCFEDGGHHRPNRHAEISRLIFCELERI   K+ + Q++LVI+
Sbjct  282  ALIYFAIYLKWINMGQIPCFEDGGHHRPNRHAEISRLIFCELERIYYGKNTSPQDLLVIQ  341

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTASVPLTRIRDIAHR+DIPH+LKQEIKHTIQNKLHRNAGPEDLVATE
Sbjct  342  KIHPCLPSFKAEFTASVPLTRIRDIAHRSDIPHNLKQEIKHTIQNKLHRNAGPEDLVATE  401

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML +ITK PGEYSEAF+EQFKIFHHELKD
Sbjct  402  AMLAKITKTPGEYSEAFIEQFKIFHHELKD  431



>emb|CDY65142.1| BnaC02g48400D [Brassica napus]
Length=1315

 Score =   351 bits (900),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 183/210 (87%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+ SN+    E  R WDTSGL    LK+VEGD+NS+NWWRKLE+VR++IV +VE   RL+
Sbjct  207  FMSSNEHGSREVGRSWDTSGLEGPCLKMVEGDRNSRNWWRKLEMVREVIVGSVEREERLK  266

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL YSA+YLKWINTGQIPCFEDGGHHRPNRHAEISRLIF ELE I  +KDAT +E+LV R
Sbjct  267  ALIYSAVYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRELENICSKKDATAEEVLVAR  326

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE
Sbjct  327  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATE  386

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             MLERIT+ PG+YS  FVEQFKIFH+ELKD
Sbjct  387  AMLERITETPGKYSGDFVEQFKIFHNELKD  416



>ref|XP_004497422.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=1180

 Score =   349 bits (896),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 182/210 (87%), Gaps = 1/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+R+N+ +  E  R WDTS L  +PLKLV+GD+  +NWWRKL++VRD IV NVE   RLE
Sbjct  221  FMRTNEHQSNEAGRTWDTSDLQGLPLKLVQGDQTGRNWWRKLDIVRD-IVGNVEGEDRLE  279

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL Y +IYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF +LER   RKD + QE+LVIR
Sbjct  280  ALIYCSIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRDLERYTSRKDISPQEVLVIR  339

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHD+K +IKHTIQNKLHRNAGPEDLVATE
Sbjct  340  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDVKLQIKHTIQNKLHRNAGPEDLVATE  399

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML +ITKNPGEYSEAFVEQFKIFH ELKD
Sbjct  400  AMLAKITKNPGEYSEAFVEQFKIFHEELKD  429



>ref|XP_010673296.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010673297.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=1189

 Score =   349 bits (896),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 185/210 (88%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+    E +R+WDTSGL  + LKLV+ D+N++NWWRKLEVVR+L+V ++++   LE
Sbjct  231  FMRSNEHHNRESDRRWDTSGLEGLALKLVQDDQNARNWWRKLEVVRELVVGSLDNNDHLE  290

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            ALT SAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF ELERI  R+D + QE LVIR
Sbjct  291  ALTLSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRELERIYCRRDTSPQERLVIR  350

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHP LPSFKAEFTASVPLTRIRDIAHRNDIPHD KQEIKHTIQNKLHRNAGPEDLVATE
Sbjct  351  KIHPSLPSFKAEFTASVPLTRIRDIAHRNDIPHDFKQEIKHTIQNKLHRNAGPEDLVATE  410

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML RITKNPGE+++AFVEQFKIFH ELKD
Sbjct  411  AMLARITKNPGEFNDAFVEQFKIFHEELKD  440



>gb|KJB37917.1| hypothetical protein B456_006G226300 [Gossypium raimondii]
Length=1161

 Score =   348 bits (893),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 182/210 (87%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F++SN+    E  RKWDT+GL    LKLVE DKN++NWWRKLEVVR+LI E++E    LE
Sbjct  218  FIQSNEHHDREVERKWDTTGLKGFALKLVEEDKNARNWWRKLEVVRELIHESLEIGELLE  277

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL  SA+YLKW+NTGQIPCFEDGGHHRPN+HAEISR IFCELE+I  RKD + QE+LVIR
Sbjct  278  ALICSAVYLKWVNTGQIPCFEDGGHHRPNKHAEISRDIFCELEKITCRKDTSPQELLVIR  337

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTA VPLTRIRDIAHRNDI HDLKQEIKHTIQNKLHRNAGPEDLV+TE
Sbjct  338  KIHPCLPSFKAEFTAPVPLTRIRDIAHRNDISHDLKQEIKHTIQNKLHRNAGPEDLVSTE  397

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML RITKNPGEYSEAF+EQFKIFH ELKD
Sbjct  398  AMLARITKNPGEYSEAFIEQFKIFHQELKD  427



>ref|XP_004497421.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=1212

 Score =   349 bits (895),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 182/210 (87%), Gaps = 1/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+R+N+ +  E  R WDTS L  +PLKLV+GD+  +NWWRKL++VRD IV NVE   RLE
Sbjct  221  FMRTNEHQSNEAGRTWDTSDLQGLPLKLVQGDQTGRNWWRKLDIVRD-IVGNVEGEDRLE  279

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL Y +IYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF +LER   RKD + QE+LVIR
Sbjct  280  ALIYCSIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRDLERYTSRKDISPQEVLVIR  339

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHD+K +IKHTIQNKLHRNAGPEDLVATE
Sbjct  340  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDVKLQIKHTIQNKLHRNAGPEDLVATE  399

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML +ITKNPGEYSEAFVEQFKIFH ELKD
Sbjct  400  AMLAKITKNPGEYSEAFVEQFKIFHEELKD  429



>gb|KHN37254.1| Phosphoglucan, water dikinase, chloroplastic [Glycine soja]
Length=1179

 Score =   347 bits (891),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 162/210 (77%), Positives = 182/210 (87%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+ R  E  RKWDTSGL  +PLK V+ D++++NWWRKL++VRD+I  +++   RLE
Sbjct  224  FMRSNEHRSHETERKWDTSGLQGLPLKFVQADQSARNWWRKLDIVRDIIAGSLQGEDRLE  283

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL YSAIYLKWINTGQI CFEDGGHHRPNRHAEISRLIF ELER   RKD + QE+LVIR
Sbjct  284  ALLYSAIYLKWINTGQISCFEDGGHHRPNRHAEISRLIFRELERHTSRKDISPQEVLVIR  343

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLK +IKHTIQNKLHRNAGPEDLVATE
Sbjct  344  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKLQIKHTIQNKLHRNAGPEDLVATE  403

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML +ITKNP EYSE FV++FKIFH ELKD
Sbjct  404  AMLAKITKNPAEYSEPFVKEFKIFHQELKD  433



>ref|XP_006589801.1| PREDICTED: LOW QUALITY PROTEIN: phosphoglucan, water dikinase, 
chloroplastic-like [Glycine max]
Length=1186

 Score =   347 bits (890),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 162/210 (77%), Positives = 181/210 (86%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+ R  E  RKWDTSGL  +PLK V+ D++++NWWRKL++VRD+I  +++   RLE
Sbjct  226  FMRSNEHRSHETERKWDTSGLQGLPLKFVQADQSARNWWRKLDIVRDIIAGSLQGEDRLE  285

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL YSAIYLKWINTGQI CFEDGGHHRPNRHAEISRLIF ELER   RKD + QE+LVIR
Sbjct  286  ALLYSAIYLKWINTGQISCFEDGGHHRPNRHAEISRLIFRELERHTSRKDISPQEVLVIR  345

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLK  IKHTIQNKLHRNAGPEDLVATE
Sbjct  346  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKXRIKHTIQNKLHRNAGPEDLVATE  405

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML RIT+NP EYSE FV++FKIFH ELKD
Sbjct  406  AMLARITRNPAEYSEPFVKEFKIFHQELKD  435



>gb|KEH27294.1| phosphoglucan, water dikinase [Medicago truncatula]
Length=1202

 Score =   347 bits (889),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 164/210 (78%), Positives = 183/210 (87%), Gaps = 1/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSND +  E  R WDTSG+  +PLK V+GD++++NWWRKL++VRD IV +V    +LE
Sbjct  243  FMRSNDHQTHETQRTWDTSGIQGLPLKFVQGDQSARNWWRKLDLVRD-IVGSVHGEDQLE  301

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL YS+IYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF ELE+   RKD + QE+LVIR
Sbjct  302  ALIYSSIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRELEQHTSRKDISPQEVLVIR  361

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLK +IKHTIQNKLHRNAGPEDLVATE
Sbjct  362  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKTQIKHTIQNKLHRNAGPEDLVATE  421

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML +ITKNPGEYSE FVEQFKIFH ELKD
Sbjct  422  AMLAKITKNPGEYSETFVEQFKIFHRELKD  451



>ref|XP_006845104.1| hypothetical protein AMTR_s00005p00168970 [Amborella trichopoda]
 gb|ERN06779.1| hypothetical protein AMTR_s00005p00168970 [Amborella trichopoda]
Length=1176

 Score =   346 bits (888),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 163/210 (78%), Positives = 181/210 (86%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F++SN     E  R+W+T  L    LKLV+GD+N++NWWRKLEVVR+L+ +N E   RLE
Sbjct  227  FMKSNKHGETESARRWNTESLEGPALKLVKGDQNARNWWRKLEVVRELLTQNTEEESRLE  286

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            +L YSAIYLK INTGQIPCFEDGGHHRPNRHAEISRLIFC+LERI   K+   +EIL+IR
Sbjct  287  SLIYSAIYLKLINTGQIPCFEDGGHHRPNRHAEISRLIFCDLERISYSKNTLPEEILIIR  346

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFK+EFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE
Sbjct  347  KIHPCLPSFKSEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATE  406

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML RITKNPGEYSEAFVEQFKIFH ELKD
Sbjct  407  AMLSRITKNPGEYSEAFVEQFKIFHGELKD  436



>ref|XP_006286926.1| hypothetical protein CARUB_v10000070mg [Capsella rubella]
 gb|EOA19824.1| hypothetical protein CARUB_v10000070mg [Capsella rubella]
Length=1195

 Score =   347 bits (889),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 162/210 (77%), Positives = 182/210 (87%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSND    E  R W+T+GL    LK+VEGD+NS+NWWRKLE+VR++IV  VE   +L+
Sbjct  224  FMRSNDHGNREVGRNWNTTGLEGTALKMVEGDRNSKNWWRKLEMVREVIVGTVEREEKLK  283

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF ELE I  +KDA+ +E+LV R
Sbjct  284  ALIYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRELEHICSKKDASAEEVLVAR  343

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTA+VPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE
Sbjct  344  KIHPCLPSFKAEFTAAVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATE  403

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML RIT+ PG+YS  FVEQFKIFH+ELKD
Sbjct  404  AMLLRITETPGKYSGDFVEQFKIFHNELKD  433



>ref|XP_008799788.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Phoenix dactylifera]
Length=758

 Score =   337 bits (865),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 161/210 (77%), Positives = 184/210 (88%), Gaps = 1/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+ +  E  R+WDT GL  + LKLVEGD+ ++NWWRKLEVVR+L++EN++    LE
Sbjct  223  FMRSNEHKSWEAERRWDTDGLDGVVLKLVEGDRVARNWWRKLEVVRELLMENIKGDC-LE  281

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL YSAIYLKWINTGQIPCFEDGGH RPNRHAEISRLIF ELE I   K+ + Q++LVIR
Sbjct  282  ALIYSAIYLKWINTGQIPCFEDGGHRRPNRHAEISRLIFRELEWIYYGKNTSPQDLLVIR  341

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFK+EFTASVPLTRIRDIAHR+DIPH+LKQEIKHTIQNKLHRNAGPEDL+ATE
Sbjct  342  KIHPCLPSFKSEFTASVPLTRIRDIAHRSDIPHNLKQEIKHTIQNKLHRNAGPEDLIATE  401

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML +ITK PGEYSEAF+EQFKIFHHELKD
Sbjct  402  AMLAKITKTPGEYSEAFIEQFKIFHHELKD  431



>emb|CDY05529.1| BnaA02g31620D [Brassica napus]
Length=1312

 Score =   347 bits (890),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 164/210 (78%), Positives = 182/210 (87%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+ SN+    E  R WDTSGL    LK+VEGD+NS+NWWRKLE+VR++IV +VE   RL+
Sbjct  204  FMSSNEHGDREVGRSWDTSGLEGPGLKMVEGDRNSRNWWRKLEMVREVIVGSVEREERLK  263

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL YSA+YLKWINTGQIPCFEDGGHHRPNRHAEISRLIF ELE I  +KDAT +E+LV R
Sbjct  264  ALIYSAVYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRELENICSKKDATAEEVLVAR  323

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIH CLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE
Sbjct  324  KIHLCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATE  383

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             MLERIT+ PG+YS  FVEQFKIFH+ELKD
Sbjct  384  AMLERITETPGKYSGDFVEQFKIFHNELKD  413



>ref|XP_002453659.1| hypothetical protein SORBIDRAFT_04g010020 [Sorghum bicolor]
 gb|EES06635.1| hypothetical protein SORBIDRAFT_04g010020 [Sorghum bicolor]
Length=1212

 Score =   345 bits (886),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 162/210 (77%), Positives = 180/210 (86%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+ R  E +RKWD +GL  + LKLVEGDK S+NWWRKLE+VR L+ E V     LE
Sbjct  245  FMRSNEHRNNESDRKWDMTGLDAVSLKLVEGDKASRNWWRKLELVRGLVSEYVHDQSHLE  304

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            ALTYSAIYLKWI TGQIPCFEDGGHHRPN+HAEISR IF E+ERI   ++ + Q++LVIR
Sbjct  305  ALTYSAIYLKWIYTGQIPCFEDGGHHRPNKHAEISRQIFREIERIYYGENTSAQDLLVIR  364

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFK+EFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE
Sbjct  365  KIHPCLPSFKSEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATE  424

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML RITK PGEYSEAFVEQFK F+ ELKD
Sbjct  425  AMLARITKTPGEYSEAFVEQFKTFYSELKD  454



>ref|XP_008454007.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Cucumis melo]
Length=1161

 Score =   344 bits (882),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 163/210 (78%), Positives = 184/210 (88%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+    E  R W+TS L  + L+LVEGDKN++NW RKL+VVR+L+VENV + + LE
Sbjct  195  FMRSNEHHNRESERIWNTSDLKGLALQLVEGDKNARNWRRKLDVVRELLVENVHAENCLE  254

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            +L YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISR+IF ELER+  +KD + Q  L+IR
Sbjct  255  SLIYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRIIFRELERLSSKKDISPQVALIIR  314

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFK+EFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE
Sbjct  315  KIHPCLPSFKSEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATE  374

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML RITKNPGEYSEAFVEQFKIF+ ELKD
Sbjct  375  AMLTRITKNPGEYSEAFVEQFKIFYQELKD  404



>ref|XP_004152111.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004156941.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Cucumis sativus]
Length=1217

 Score =   343 bits (881),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 162/210 (77%), Positives = 184/210 (88%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+    E  R W+TS L  + L+LVEGDKN++NW RKL+VVR+L+VENV + + LE
Sbjct  247  FMRSNEHHSRESERVWNTSDLKGLALQLVEGDKNARNWRRKLDVVRELLVENVHAENCLE  306

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            +L YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISR+IF ELER+  +KD + Q  L++R
Sbjct  307  SLIYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRIIFRELERLSSKKDISPQVALIVR  366

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFK+EFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE
Sbjct  367  KIHPCLPSFKSEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATE  426

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML RITKNPGEYSEAFVEQFKIF+ ELKD
Sbjct  427  AMLTRITKNPGEYSEAFVEQFKIFYQELKD  456



>gb|KGN53052.1| hypothetical protein Csa_4G012480 [Cucumis sativus]
Length=1241

 Score =   343 bits (881),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 162/210 (77%), Positives = 184/210 (88%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+    E  R W+TS L  + L+LVEGDKN++NW RKL+VVR+L+VENV + + LE
Sbjct  271  FMRSNEHHSRESERVWNTSDLKGLALQLVEGDKNARNWRRKLDVVRELLVENVHAENCLE  330

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            +L YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISR+IF ELER+  +KD + Q  L++R
Sbjct  331  SLIYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRIIFRELERLSSKKDISPQVALIVR  390

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFK+EFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE
Sbjct  391  KIHPCLPSFKSEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATE  450

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML RITKNPGEYSEAFVEQFKIF+ ELKD
Sbjct  451  AMLTRITKNPGEYSEAFVEQFKIFYQELKD  480



>ref|XP_008454006.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Cucumis melo]
Length=1237

 Score =   343 bits (880),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 163/210 (78%), Positives = 184/210 (88%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+    E  R W+TS L  + L+LVEGDKN++NW RKL+VVR+L+VENV + + LE
Sbjct  271  FMRSNEHHNRESERIWNTSDLKGLALQLVEGDKNARNWRRKLDVVRELLVENVHAENCLE  330

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            +L YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISR+IF ELER+  +KD + Q  L+IR
Sbjct  331  SLIYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRIIFRELERLSSKKDISPQVALIIR  390

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFK+EFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE
Sbjct  391  KIHPCLPSFKSEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATE  450

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML RITKNPGEYSEAFVEQFKIF+ ELKD
Sbjct  451  AMLTRITKNPGEYSEAFVEQFKIFYQELKD  480



>ref|XP_009416602.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Musa 
acuminata subsp. malaccensis]
Length=1264

 Score =   343 bits (880),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 164/210 (78%), Positives = 182/210 (87%), Gaps = 1/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSND    E  RKW+T GL    LKLVEGD++++NWWRKLEVVR+L+  N+   + LE
Sbjct  306  FMRSNDHASRETERKWNTDGLDGAALKLVEGDRSARNWWRKLEVVRELLTGNI-GGNCLE  364

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF ELERI   KD + Q++LVIR
Sbjct  365  ALIYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRELERIHYMKDTSPQDVLVIR  424

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFK+EFTASVPLTRIRDIAHR DIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE
Sbjct  425  KIHPCLPSFKSEFTASVPLTRIRDIAHRGDIPHDLKQEIKHTIQNKLHRNAGPEDLIATE  484

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML RITK PGEYS+AFVEQFKIF++ELKD
Sbjct  485  AMLARITKTPGEYSDAFVEQFKIFYNELKD  514



>ref|XP_009111699.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Brassica 
rapa]
Length=1184

 Score =   338 bits (867),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 159/210 (76%), Positives = 180/210 (86%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+    E  R WD SGL    LK+VEGD++S+NW +KLE+V ++IV +VE   RL+
Sbjct  217  FMRSNEHGNREVGRNWDASGLKGSALKMVEGDRSSRNWRKKLELVSEVIVGSVEREERLK  276

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL YSA+YLKWINTGQIPCFEDGGHHRPN HAEISRLIF ELE I  +KDAT +E+LV R
Sbjct  277  ALIYSAVYLKWINTGQIPCFEDGGHHRPNHHAEISRLIFRELENICSKKDATAEEVLVAR  336

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE
Sbjct  337  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATE  396

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             MLERIT+ PG+YS  FVEQF+IFH+ELKD
Sbjct  397  AMLERITETPGKYSGDFVEQFRIFHNELKD  426



>emb|CDX87051.1| BnaC09g03660D [Brassica napus]
Length=1182

 Score =   338 bits (867),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 159/210 (76%), Positives = 180/210 (86%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+    E  R WD SGL    LK+VEGD++S+NW +KLE+V ++IV +VE   RL+
Sbjct  220  FMRSNEHGSREVGRNWDASGLEGSALKMVEGDRSSRNWRKKLELVSEVIVGSVEREERLK  279

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL YSA+YLKWINTGQIPCFEDGGHHRPN HAEISRLIF ELE I  +KDAT +E+LV R
Sbjct  280  ALIYSAVYLKWINTGQIPCFEDGGHHRPNHHAEISRLIFRELENICSKKDATAEEVLVAR  339

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE
Sbjct  340  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATE  399

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             MLERIT+ PG+YS  FVEQF+IFH+ELKD
Sbjct  400  AMLERITETPGKYSGDFVEQFRIFHNELKD  429



>emb|CDY19771.1| BnaA09g04240D [Brassica napus]
Length=1179

 Score =   338 bits (866),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 159/210 (76%), Positives = 180/210 (86%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+    E  R WD SGL    LK+VEGD++S+NW +KLE+V ++IV +VE   RL+
Sbjct  217  FMRSNEHGNREVGRNWDASGLEGSALKMVEGDRSSRNWRKKLELVSEVIVGSVEREERLK  276

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL YSA+YLKWINTGQIPCFEDGGHHRPN HAEISRLIF ELE I  +KDAT +E+LV R
Sbjct  277  ALIYSAVYLKWINTGQIPCFEDGGHHRPNHHAEISRLIFRELENICSKKDATAEEVLVAR  336

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE
Sbjct  337  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATE  396

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             MLERIT+ PG+YS  FVEQF+IFH+ELKD
Sbjct  397  AMLERITETPGKYSGDFVEQFRIFHNELKD  426



>ref|XP_006663965.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Oryza brachyantha]
Length=1206

 Score =   337 bits (865),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 158/210 (75%), Positives = 179/210 (85%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RS++ R  E +R WDT+GL EI LKLVEGDK S+NWWRKLEVVR ++ E+ +   RLE
Sbjct  237  FMRSSEHRNKETDRMWDTTGLKEIALKLVEGDKASRNWWRKLEVVRGILSESYDDQSRLE  296

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL Y+AIYLKWI TGQ+ CFEDGGHHRPN+HAEISR IF +LE +   K  + Q+ILVIR
Sbjct  297  ALIYAAIYLKWIYTGQVACFEDGGHHRPNKHAEISRQIFRQLEMMYYGKTTSAQDILVIR  356

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            K+H CLPSFK+EFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE
Sbjct  357  KMHTCLPSFKSEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATE  416

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML RITK PGEYSEAFVEQFKIF+ ELKD
Sbjct  417  AMLARITKTPGEYSEAFVEQFKIFYSELKD  446



>gb|ABG21981.1| chloroplast alpha-glucan water dikinase isoform 3, putative, 
expressed [Oryza sativa Japonica Group]
Length=728

 Score =   327 bits (838),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 156/210 (74%), Positives = 175/210 (83%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+    E +R WDT+GL  I LKLVEGDK S+NWWRKLEVVR ++ E+ +   RL 
Sbjct  237  FMRSNEHLNKEADRMWDTTGLDGIALKLVEGDKASRNWWRKLEVVRGILSESFDDQSRLG  296

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL YSAIYLKWI TGQI CFEDGGHHRPN+HAEISR IF ELE +   K  + +++LVIR
Sbjct  297  ALVYSAIYLKWIYTGQISCFEDGGHHRPNKHAEISRQIFRELEMMYYGKTTSAKDVLVIR  356

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHP LPSFK+EFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE
Sbjct  357  KIHPFLPSFKSEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATE  416

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
            +ML RITK PGEYSE FVEQF IF+ ELKD
Sbjct  417  VMLARITKTPGEYSETFVEQFTIFYSELKD  446



>ref|XP_010244064.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Nelumbo nucifera]
 ref|XP_010244065.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Nelumbo nucifera]
Length=1197

 Score =   335 bits (860),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 158/210 (75%), Positives = 176/210 (84%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+    E  R W+T GL  + LK VEGD++++NWWRKLEVVR L+VE++++  R E
Sbjct  229  FMRSNEHTNRETERTWNTEGLEGLALKFVEGDRSARNWWRKLEVVRKLLVESLKNGDRFE  288

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL YSAIYLKWINTGQIPCFEDGGH RPN HAEIS  IF ELERI   KD + QE LVI 
Sbjct  289  ALIYSAIYLKWINTGQIPCFEDGGHRRPNMHAEISMFIFRELERISYGKDTSAQEKLVIS  348

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFK+EFTASVPLTRIRDIAHR DIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE
Sbjct  349  KIHPCLPSFKSEFTASVPLTRIRDIAHRGDIPHDLKQEIKHTIQNKLHRNAGPEDLIATE  408

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML RIT+ PGEYSEAF+EQFKIFH ELKD
Sbjct  409  AMLARITRTPGEYSEAFLEQFKIFHRELKD  438



>gb|KHG00248.1| Phosphoglucan, water dikinase, chloroplastic -like protein [Gossypium 
arboreum]
Length=1052

 Score =   333 bits (855),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 161/222 (73%), Positives = 181/222 (82%), Gaps = 12/222 (5%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRK------------LEVVRDL  146
            F++SN+    E  RKWDT+GL  + LKLVE DKN++NWWRK            LEVVR++
Sbjct  152  FMQSNEHHDREVERKWDTTGLKGLALKLVEEDKNARNWWRKVCPFIILDIAQHLEVVREI  211

Query  147  IVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGR  326
            I E++E    LEAL  SA+YLKW+NTGQIPCFEDGGHHRPN+HAEISR IFCELE+I   
Sbjct  212  IHESLEVGELLEALICSAVYLKWVNTGQIPCFEDGGHHRPNKHAEISRDIFCELEKITCS  271

Query  327  KDATLQEILVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLH  506
            KD + QE+LVIRKIHPCLPSFKAEFTA VPLTRIRDIAHRNDI HDLKQEIKHTIQNKLH
Sbjct  272  KDTSPQELLVIRKIHPCLPSFKAEFTAPVPLTRIRDIAHRNDISHDLKQEIKHTIQNKLH  331

Query  507  RNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIFHHELKD  632
            RNAGPEDLV+TE ML RITK+PGEYSEAF+E FKIFH ELKD
Sbjct  332  RNAGPEDLVSTEAMLARITKDPGEYSEAFIEHFKIFHQELKD  373



>ref|XP_010228078.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Brachypodium 
distachyon]
Length=1182

 Score =   331 bits (849),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 154/210 (73%), Positives = 179/210 (85%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+      +R WDTSGL  + LKLVEGDK S+NWW+KLE+VR+L+ E V+   RLE
Sbjct  223  FMRSNEHHNKSSDRMWDTSGLGGMTLKLVEGDKVSRNWWKKLELVRELLSEPVDDQSRLE  282

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL  SAIYLKWI TGQI CFEDGGH+RPN+HAEISR IF ELE++   K  + +++LVIR
Sbjct  283  ALICSAIYLKWIYTGQISCFEDGGHYRPNKHAEISRQIFRELEKMYYTKGISAEDVLVIR  342

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFK+EFTA+VPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHR+AGPEDL+ATE
Sbjct  343  KIHPCLPSFKSEFTATVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRSAGPEDLIATE  402

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML R+TKNPGEY+EAFVEQFKIF+ ELKD
Sbjct  403  AMLTRVTKNPGEYNEAFVEQFKIFYSELKD  432



>ref|NP_001066613.1| Os12g0297500 [Oryza sativa Japonica Group]
 sp|Q2QTC2.2|PWD_ORYSJ RecName: Full=Phosphoglucan, water dikinase, chloroplastic; Flags: 
Precursor [Oryza sativa Japonica Group]
 gb|ABA97816.2| chloroplast alpha-glucan water dikinase isoform 3, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF29632.1| Os12g0297500 [Oryza sativa Japonica Group]
Length=1206

 Score =   329 bits (843),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 156/210 (74%), Positives = 175/210 (83%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+    E +R WDT+GL  I LKLVEGDK S+NWWRKLEVVR ++ E+ +   RL 
Sbjct  237  FMRSNEHLNKEADRMWDTTGLDGIALKLVEGDKASRNWWRKLEVVRGILSESFDDQSRLG  296

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL YSAIYLKWI TGQI CFEDGGHHRPN+HAEISR IF ELE +   K  + +++LVIR
Sbjct  297  ALVYSAIYLKWIYTGQISCFEDGGHHRPNKHAEISRQIFRELEMMYYGKTTSAKDVLVIR  356

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHP LPSFK+EFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE
Sbjct  357  KIHPFLPSFKSEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATE  416

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
            +ML RITK PGEYSE FVEQF IF+ ELKD
Sbjct  417  VMLARITKTPGEYSETFVEQFTIFYSELKD  446



>emb|CAX51387.1| phosphoglucan water dikinase [Hordeum vulgare subsp. vulgare]
Length=261

 Score =   303 bits (777),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 170/194 (88%), Gaps = 1/194 (1%)
 Frame = +3

Query  54   TSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVE-STHRLEALTYSAIYLKWINTGQ  230
            T+GL  + LKLVEGDK+S+NWW+KL++VR L+ E V+  + RLEAL  SAIYLKWI TGQ
Sbjct  1    TAGLGGMALKLVEGDKSSKNWWQKLDLVRRLVSEPVDDQSSRLEALICSAIYLKWIYTGQ  60

Query  231  IPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFKAEFTAS  410
            I C EDGGH+RPN+HAEISR IF E+E++  RK  + +++LVIRKIHPCLPSFK+EFTA+
Sbjct  61   ISCSEDGGHYRPNKHAEISRQIFREIEKMYYRKGISPEDVLVIRKIHPCLPSFKSEFTAT  120

Query  411  VPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEA  590
            VPLTRIRDIAHRNDIPH+LKQEIKHTIQNKLHR+AGPEDLVATE ML RITKNPGEY++A
Sbjct  121  VPLTRIRDIAHRNDIPHELKQEIKHTIQNKLHRSAGPEDLVATEAMLTRITKNPGEYNDA  180

Query  591  FVEQFKIFHHELKD  632
            FVEQFKIF+ ELKD
Sbjct  181  FVEQFKIFYSELKD  194



>gb|EMT02873.1| Phosphoglucan, water dikinase, chloroplastic [Aegilops tauschii]
Length=998

 Score =   323 bits (828),  Expect = 4e-100, Method: Composition-based stats.
 Identities = 150/210 (71%), Positives = 177/210 (84%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+      +R WDT+GL  + LKLVEGDK+S+NWW+KL++VR L+ E V+   RLE
Sbjct  170  FMRSNEHGNKSSDRMWDTAGLGGMALKLVEGDKSSKNWWQKLDLVRRLVSEPVDDQSRLE  229

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL  SAIYLKWI TGQI C EDGGH+RPN+HAEISR IF ELE++   K  + +++LVIR
Sbjct  230  ALICSAIYLKWIYTGQISCSEDGGHYRPNKHAEISRQIFRELEKMYYTKGISPEDVLVIR  289

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            KIHPCLPSFK+EFTA+VPLTRIRDIAHRNDIPH+LKQEIKHTIQNKLHR+AGPEDLVATE
Sbjct  290  KIHPCLPSFKSEFTATVPLTRIRDIAHRNDIPHELKQEIKHTIQNKLHRSAGPEDLVATE  349

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML RITKNPGEY+ AFVEQF+IF+ ELKD
Sbjct  350  AMLTRITKNPGEYNGAFVEQFQIFYSELKD  379



>ref|XP_001752167.1| predicted protein [Physcomitrella patens]
 gb|EDQ82900.1| predicted protein [Physcomitrella patens]
Length=1094

 Score =   318 bits (816),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 146/200 (73%), Positives = 174/200 (87%), Gaps = 0/200 (0%)
 Frame = +3

Query  33   EKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLK  212
            E++ KWDT+GL    L++VEGDK++ NWWRKL+VVRDL+        RL+AL  +A+YLK
Sbjct  159  ERSGKWDTTGLGGPTLQIVEGDKSASNWWRKLDVVRDLLSGEAGKKDRLKALINAAVYLK  218

Query  213  WINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFK  392
            WINTGQI C+EDG H+RPN+HAEISR IF ELERI G+KD  L+E+LVI+KIHPCLP+FK
Sbjct  219  WINTGQIVCYEDGQHYRPNKHAEISRRIFVELERISGQKDVDLKELLVIQKIHPCLPAFK  278

Query  393  AEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNP  572
            AEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHR+AGPEDLVATE ML RIT+NP
Sbjct  279  AEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRSAGPEDLVATENMLARITRNP  338

Query  573  GEYSEAFVEQFKIFHHELKD  632
            G+Y+EAFV++F+IF+ ELKD
Sbjct  339  GQYNEAFVKEFQIFYAELKD  358



>gb|EEE53074.1| hypothetical protein OsJ_35828 [Oryza sativa Japonica Group]
Length=1188

 Score =   317 bits (813),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 156/230 (68%), Positives = 175/230 (76%), Gaps = 20/230 (9%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRK-------------------  125
            F+RSN+    E +R WDT+GL  I LKLVEGDK S+NWWRK                   
Sbjct  199  FMRSNEHLNKEADRMWDTTGLDGIALKLVEGDKASRNWWRKECTLCSDPASKALSYNASV  258

Query  126  -LEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFC  302
             LEVVR ++ E+ +   RL AL YSAIYLKWI TGQI CFEDGGHHRPN+HAEISR IF 
Sbjct  259  LLEVVRGILSESFDDQSRLGALVYSAIYLKWIYTGQISCFEDGGHHRPNKHAEISRQIFR  318

Query  303  ELERILGRKDATLQEILVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIK  482
            ELE +   K  + +++LVIRKIHP LPSFK+EFTASVPLTRIRDIAHRNDIPHDLKQEIK
Sbjct  319  ELEMMYYGKTTSAKDVLVIRKIHPFLPSFKSEFTASVPLTRIRDIAHRNDIPHDLKQEIK  378

Query  483  HTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIFHHELKD  632
            HTIQNKLHRNAGPEDL+ATE+ML RITK PGEYSE FVEQF IF+ ELKD
Sbjct  379  HTIQNKLHRNAGPEDLIATEVMLARITKTPGEYSETFVEQFTIFYSELKD  428



>gb|EEC69133.1| hypothetical protein OsI_38056 [Oryza sativa Indica Group]
Length=1191

 Score =   317 bits (813),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 156/230 (68%), Positives = 175/230 (76%), Gaps = 20/230 (9%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRK-------------------  125
            F+RSN+    E +R WDT+GL  I LKLVEGDK S+NWWRK                   
Sbjct  202  FMRSNEHLNKEADRMWDTTGLDGIALKLVEGDKASRNWWRKECTLCSDPASKALSYNASV  261

Query  126  -LEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFC  302
             LEVVR ++ E+ +   RL AL YSAIYLKWI TGQI CFEDGGHHRPN+HAEISR IF 
Sbjct  262  LLEVVRGILSESFDDQSRLGALVYSAIYLKWIYTGQISCFEDGGHHRPNKHAEISRQIFR  321

Query  303  ELERILGRKDATLQEILVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIK  482
            ELE     K  + +++LVIRKIHP LPSFK+EFTASVPLTRIRDIAHRNDIPHDLKQEIK
Sbjct  322  ELEMTYYGKTTSAKDVLVIRKIHPFLPSFKSEFTASVPLTRIRDIAHRNDIPHDLKQEIK  381

Query  483  HTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIFHHELKD  632
            HTIQNKLHRNAGPEDL+ATE+ML RITK PGEYSE+FVEQF IF+ ELKD
Sbjct  382  HTIQNKLHRNAGPEDLIATEVMLARITKTPGEYSESFVEQFTIFYSELKD  431



>ref|XP_002973212.1| hypothetical protein SELMODRAFT_99378 [Selaginella moellendorffii]
 gb|EFJ25586.1| hypothetical protein SELMODRAFT_99378 [Selaginella moellendorffii]
Length=1104

 Score =   313 bits (802),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 150/211 (71%), Positives = 173/211 (82%), Gaps = 2/211 (1%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+++N+    +   KW+T+GL    L++VEGDK S NWWRKLEVVRDL+ +++    RL+
Sbjct  156  FMKANEHTSRQGG-KWETAGLEGAALRIVEGDKKSGNWWRKLEVVRDLLTDDLGKADRLD  214

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEI-LVI  359
            AL YS+ YLKWI+TGQI CFEDGGH+RPN+HAEISR+IF ELE I   K  T  E  +VI
Sbjct  215  ALVYSSTYLKWISTGQIQCFEDGGHYRPNKHAEISRMIFRELESIYSDKTTTTTEERVVI  274

Query  360  RKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVAT  539
            RKIHPCLPSFKAEFTA+VPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVAT
Sbjct  275  RKIHPCLPSFKAEFTAAVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVAT  334

Query  540  ELMLERITKNPGEYSEAFVEQFKIFHHELKD  632
            E +L R+TK PGEYS AFVEQ KIFH ELKD
Sbjct  335  EALLARVTKTPGEYSAAFVEQLKIFHGELKD  365



>ref|XP_002976638.1| hypothetical protein SELMODRAFT_105597 [Selaginella moellendorffii]
 gb|EFJ22307.1| hypothetical protein SELMODRAFT_105597 [Selaginella moellendorffii]
Length=1101

 Score =   307 bits (787),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 147/212 (69%), Positives = 172/212 (81%), Gaps = 3/212 (1%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+++N+    +   KW+T+GL    L++VEGDK S NWWRKLEVVR+L+ +++    RL+
Sbjct  156  FMKANEHTSRQGG-KWETAGLDGAVLRIVEGDKKSGNWWRKLEVVRELLTDDLGKADRLD  214

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATL--QEILV  356
            AL YS+ YLKWI+TGQI CFEDGGH+RP +HAEISR+IF ELE I   K  T   +E +V
Sbjct  215  ALVYSSTYLKWISTGQIQCFEDGGHYRPKKHAEISRMIFRELESIYSDKTTTTTTEERVV  274

Query  357  IRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVA  536
            IR IHPCLPSFKAEFTA+VPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVA
Sbjct  275  IRNIHPCLPSFKAEFTAAVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVA  334

Query  537  TELMLERITKNPGEYSEAFVEQFKIFHHELKD  632
            TE +L R+TK PGEYS AFVEQ KIFH ELKD
Sbjct  335  TEALLARVTKTPGEYSAAFVEQLKIFHGELKD  366



>gb|AAC26245.1| contains similarity glycosyl hydrolases [Arabidopsis thaliana]
Length=491

 Score =   286 bits (732),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 147/233 (63%), Positives = 160/233 (69%), Gaps = 52/233 (22%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSND    E  R WDTSGL    LK+VEGD+NS+NWWRK                   
Sbjct  225  FMRSNDHGNREVGRNWDTSGLEGTALKMVEGDRNSKNWWRK-------------------  265

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQ------  344
                      WINTGQIPCFEDGGHHRPNRHAEISRLIF ELE I  +KDAT +      
Sbjct  266  ----------WINTGQIPCFEDGGHHRPNRHAEISRLIFRELEHICSKKDATPEVTHFFA  315

Query  345  -----------------EILVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQ  473
                             E+LV RKIHPCLPSFKAEFTA+VPLTRIRDIAHRNDIPHDLKQ
Sbjct  316  FKISTFKSLFSNICSWCEVLVARKIHPCLPSFKAEFTAAVPLTRIRDIAHRNDIPHDLKQ  375

Query  474  EIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIFHHELKD  632
            EIKHTIQNKLHRNAGPEDL+ATE ML+RIT+ PG+YS  FVEQFKIFH+ELKD
Sbjct  376  EIKHTIQNKLHRNAGPEDLIATEAMLQRITETPGKYSGDFVEQFKIFHNELKD  428



>ref|XP_001758857.1| predicted protein [Physcomitrella patens]
 gb|EDQ76363.1| predicted protein [Physcomitrella patens]
Length=1126

 Score =   270 bits (690),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 158/202 (78%), Gaps = 0/202 (0%)
 Frame = +3

Query  27   GMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIY  206
            G E+  KWDT+GL    L LVEGDKN++NWW+KLEVVR L+     +T RL+ L Y ++Y
Sbjct  165  GQERACKWDTTGLDGPALHLVEGDKNAKNWWQKLEVVRSLVSGEFGNTERLKTLVYISVY  224

Query  207  LKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPS  386
            LKWI TGQI C ED  H+  ++HAEISR IF ELERI+  + A+L+EILV+RKI P LP+
Sbjct  225  LKWIRTGQIACCEDAKHYSLDQHAEISRKIFAELERIIDDRSASLREILVVRKILPSLPA  284

Query  387  FKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITK  566
            FK ++TAS PLTRIRDIAHRNDIP DLK+EI+HT+Q+KL R+AGPEDLVATE +L R+ +
Sbjct  285  FKVQYTASDPLTRIRDIAHRNDIPQDLKKEIEHTLQSKLDRSAGPEDLVATEALLSRVNQ  344

Query  567  NPGEYSEAFVEQFKIFHHELKD  632
             PGEYSE FVE+ K F+ ELKD
Sbjct  345  KPGEYSEVFVEELKFFYTELKD  366



>gb|KEH27295.1| phosphoglucan, water dikinase [Medicago truncatula]
Length=893

 Score =   268 bits (684),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +3

Query  207  LKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPS  386
            ++WINTGQIPCFEDGGHHRPNRHAEISRLIF ELE+   RKD + QE+LVIRKIHPCLPS
Sbjct  1    MQWINTGQIPCFEDGGHHRPNRHAEISRLIFRELEQHTSRKDISPQEVLVIRKIHPCLPS  60

Query  387  FKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITK  566
            FKAEFTASVPLTRIRDIAHRNDIPHDLK +IKHTIQNKLHRNAGPEDLVATE ML +ITK
Sbjct  61   FKAEFTASVPLTRIRDIAHRNDIPHDLKTQIKHTIQNKLHRNAGPEDLVATEAMLAKITK  120

Query  567  NPGEYSEAFVEQFKIFHHELKD  632
            NPGEYSE FVEQFKIFH ELKD
Sbjct  121  NPGEYSETFVEQFKIFHRELKD  142



>gb|EPS59827.1| glucan/water dikinase, partial [Genlisea aurea]
Length=315

 Score =   251 bits (642),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 131/156 (84%), Gaps = 0/156 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            FV S D    EK   WDT GL  I LKLVEGD+N++NWWRKLEVVR +IVEN+E  +RL+
Sbjct  160  FVHSKDHLDSEKKAYWDTDGLDGIALKLVEGDRNARNWWRKLEVVRGIIVENIEDGNRLD  219

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            A  YSAIYLKWINTGQIPC EDGGHHRPN+HAEIS+LIF ELER  GRKD  ++E+LVIR
Sbjct  220  AFIYSAIYLKWINTGQIPCLEDGGHHRPNKHAEISQLIFRELERAYGRKDIPIEEMLVIR  279

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLK  470
            KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPH LK
Sbjct  280  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHGLK  315



>ref|XP_011396449.1| Phosphoglucan, water dikinase, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM23575.1| Phosphoglucan, water dikinase, chloroplastic [Auxenochlorella 
protothecoides]
Length=1068

 Score =   242 bits (618),  Expect = 2e-70, Method: Composition-based stats.
 Identities = 115/214 (54%), Positives = 153/214 (71%), Gaps = 5/214 (2%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTH-RL  179
            F++ N+    E+  +W+T GL    L++V GD+++ +W +KL V   L+V++      RL
Sbjct  122  FMQGNEH-SRERQGRWETEGLEGATLEIVNGDRDAGSWLQKLAVAEKLLVQSAPRLRPRL  180

Query  180  EALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERIL--GRKDATLQEI-  350
            +A+  + +YL+W+  G + C E GGHHRPN HAE++R +F  LE +L  G KD   Q + 
Sbjct  181  DAVAAAYVYLQWVGNGTLACAESGGHHRPNHHAELARSMFRSLEWVLAEGGKDGEAQALA  240

Query  351  LVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL  530
            L+ R++   LPSF A +TAS PLTRIRDIAHRNDIPH+LKQEIKHTIQNKLHRNAGPEDL
Sbjct  241  LLARRLQAYLPSFDAAYTASTPLTRIRDIAHRNDIPHELKQEIKHTIQNKLHRNAGPEDL  300

Query  531  VATELMLERITKNPGEYSEAFVEQFKIFHHELKD  632
            VATE ML RIT++PGEY +AFV +F+ FH EL D
Sbjct  301  VATEAMLRRITRHPGEYPDAFVGEFRRFHAELSD  334



>ref|XP_005849428.1| hypothetical protein CHLNCDRAFT_21770 [Chlorella variabilis]
 gb|EFN57326.1| hypothetical protein CHLNCDRAFT_21770 [Chlorella variabilis]
Length=1182

 Score =   243 bits (619),  Expect = 2e-70, Method: Composition-based stats.
 Identities = 118/216 (55%), Positives = 154/216 (71%), Gaps = 11/216 (5%)
 Frame = +3

Query  3    FVRSN----DQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENV-ES  167
            F++SN    D+RG+     WDT+GL    L LV GD+++ NW  KLEVV+ L+V+N  E 
Sbjct  203  FMQSNEHSRDRRGV-----WDTAGLEGPALHLVAGDRDAANWLGKLEVVKKLLVDNAPEL  257

Query  168  THRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQE  347
               L+AL ++ IY++W+ TG + C E GGHHRPNRHAE++R +F  LE ++G +      
Sbjct  258  RPSLDALAHAYIYMQWLATGAVECVEGGGHHRPNRHAELARSMFRSLEWVIGEQGHVSPA  317

Query  348  I-LVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPE  524
            + L  R++   LPSF  +FT SVPLTRIRDIAHRNDIP DLK EIKHT+QNKLHRNAGPE
Sbjct  318  VALAGRRLQSRLPSFTEQFTQSVPLTRIRDIAHRNDIPRDLKAEIKHTLQNKLHRNAGPE  377

Query  525  DLVATELMLERITKNPGEYSEAFVEQFKIFHHELKD  632
            DL  TE ML R+T NPGE+SE+FV +F++F  EL+D
Sbjct  378  DLHTTEAMLARVTANPGEFSESFVHEFRVFTAELRD  413



>gb|EMS54440.1| Phosphoglucan, water dikinase, chloroplastic [Triticum urartu]
Length=1059

 Score =   228 bits (582),  Expect = 1e-65, Method: Composition-based stats.
 Identities = 112/186 (60%), Positives = 139/186 (75%), Gaps = 9/186 (5%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+      +R WDT+GL  + LKLVEGDK+S+NWW+KL++VR L+ E V+   RLE
Sbjct  172  FMRSNEHGNKSSDRMWDTAGLGGMALKLVEGDKSSKNWWQKLDLVRRLVSEPVDDQSRLE  231

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
            AL  SAIYLKWI TGQI C EDGGH+RPN+HAEISR IF ELE++   K  + +++LVIR
Sbjct  232  ALICSAIYLKWIYTGQISCSEDGGHYRPNKHAEISRQIFRELEKMYYTKGISPEDVLVIR  291

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKH--TIQN-------KLHRNA  515
            KIHPCLPSFK+EFTA+VPLTRIRDIAHRNDIPH+LK+      T+ N       +L RN 
Sbjct  292  KIHPCLPSFKSEFTATVPLTRIRDIAHRNDIPHELKKTCMSLGTVWNCSIKRKKELPRNK  351

Query  516  GPEDLV  533
              EDL+
Sbjct  352  RIEDLL  357



>gb|KIZ07735.1| hypothetical protein MNEG_0234 [Monoraphidium neglectum]
Length=832

 Score =   221 bits (562),  Expect = 3e-63, Method: Composition-based stats.
 Identities = 118/219 (54%), Positives = 148/219 (68%), Gaps = 10/219 (5%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIP-LKLVEGDKNSQNWWRKLEVVRDLIVENVESTH-R  176
            F+RSND    E+  +WDTSGLA  P L+LV GD+ + NW  KL V R L+V+        
Sbjct  175  FMRSNDH-SRERAGRWDTSGLAAGPVLELVRGDEGAPNWLGKLGVARGLLVDAAPRMRPE  233

Query  177  LEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELE------RILGRKDAT  338
              +L  + +YL W+N+G I C E GGH+RPN HA  ++ IF  LE      R  G  D T
Sbjct  234  TPSLAAALVYLSWVNSGAIACAEGGGHYRPNHHARTAQQIFRSLEWAIEEDRPRGMSDTT  293

Query  339  LQEILVIRKIHPCL-PSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNA  515
            L+   ++ +      PSF A FT +VPLTRIRDIAHR+DIPHDLKQEIKHT+QNKLHRNA
Sbjct  294  LRLRALLARRLHARLPSFNANFTQTVPLTRIRDIAHRSDIPHDLKQEIKHTLQNKLHRNA  353

Query  516  GPEDLVATELMLERITKNPGEYSEAFVEQFKIFHHELKD  632
            GPEDLVAT+ ML RIT NPGEYS AFV++F++F  EL++
Sbjct  354  GPEDLVATQAMLARITANPGEYSGAFVDEFRVFAAELRE  392



>ref|XP_002949771.1| hypothetical protein VOLCADRAFT_90138 [Volvox carteri f. nagariensis]
 gb|EFJ49323.1| hypothetical protein VOLCADRAFT_90138 [Volvox carteri f. nagariensis]
Length=1125

 Score =   221 bits (563),  Expect = 1e-62, Method: Composition-based stats.
 Identities = 112/224 (50%), Positives = 152/224 (68%), Gaps = 15/224 (7%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRK--WDTSGLAEIPLKLVEGDKNSQN---WWRKLEVVRDLIVENVES  167
            FVRS  ++  E+ R   W T GL+ + L+LV GD+ + +   W +KL + + L+V+   +
Sbjct  160  FVRSR-RKDEEQLRGGVWRTEGLSGVALELVRGDEAASSECSWLKKLGLQKRLLVDEAPA  218

Query  168  THR-LEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILG-------  323
                LEA++Y  +Y  W+NTG +PC E G H+RPN HA ++  +F  LE I+G       
Sbjct  219  CRPGLEAMSYLYVYATWVNTGALPCAESGSHYRPNHHANLALAMFRSLEWIIGDATRGSG  278

Query  324  -RKDATLQEILVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNK  500
             R+  T + IL  R++H  LPSF  +F AS PLTRIRDIAHRNDIP +LK EIKHT+QNK
Sbjct  279  AREPVTERLILAARRMHSRLPSFSGQFRASTPLTRIRDIAHRNDIPKELKDEIKHTLQNK  338

Query  501  LHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIFHHELKD  632
            LHR AGPEDLVATE ML+R+T  PG+YSE+FVE+F+IF  EL++
Sbjct  339  LHRCAGPEDLVATEAMLQRVTAVPGQYSESFVEEFRIFTEELRE  382



>gb|KDD72859.1| hypothetical protein H632_c2807p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=386

 Score =   210 bits (535),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 108/224 (48%), Positives = 143/224 (64%), Gaps = 15/224 (7%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTH-RL  179
            F+RSN+    E+  +WD+S +      LVE D  S +W  KL+ +++L+V+  E     L
Sbjct  107  FMRSNEHS-RERRGRWDSSSVQGAARFLVEQDAESPSWLHKLQTLKELLVDRPERARPEL  165

Query  180  EALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRK----------  329
            +A+  + +Y +WI TG +PC E GGHHRP  HA +SR IF  LE  + +           
Sbjct  166  DAVAAAFVYAQWIATGAVPCVEGGGHHRPCHHATLSRDIFQSLEWAVEQALEGVGARQAS  225

Query  330  ---DATLQEILVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNK  500
               DA+    ++ RK+   LPSF++EF  S PLT IRDIAHRNDIP DLK EIKHTIQNK
Sbjct  226  EPDDASTSLAVLARKLQGRLPSFQSEFVQSTPLTSIRDIAHRNDIPQDLKLEIKHTIQNK  285

Query  501  LHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIFHHELKD  632
            LHRNAGPEDL+A+E ML R+T+ PGEY  +FVE F+ F  EL+D
Sbjct  286  LHRNAGPEDLIASEAMLARVTQTPGEYEPSFVEAFRSFVSELRD  329



>ref|XP_005648862.1| hypothetical protein COCSUDRAFT_47226 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE24318.1| hypothetical protein COCSUDRAFT_47226 [Coccomyxa subellipsoidea 
C-169]
Length=1158

 Score =   215 bits (547),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 108/210 (51%), Positives = 136/210 (65%), Gaps = 24/210 (11%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+  G +++  W+  GL    L +V GD+ S +W +K++V +              
Sbjct  202  FMRSNEHGG-DRSGVWNREGLEGAALSIVAGDEKSGSWLQKMQVAK--------------  246

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIR  362
                      +I+TG I C E GGH+RPN+HAE++R IF  LER+L    +  +  L+ R
Sbjct  247  ---------SFISTGAIECVEGGGHYRPNKHAELARDIFRALERLLADPSSAREPKLLAR  297

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
            K H  LPSF AEFTAS PLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE
Sbjct  298  KTHTKLPSFNAEFTASTPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  357

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             ML RI+     YS  FV +F++F  EL+D
Sbjct  358  EMLARISAPDAGYSGDFVNEFRVFTGELRD  387



>ref|XP_003080699.1| phosphoglucan, water dikinase (ISS), partial [Ostreococcus tauri]
Length=760

 Score =   211 bits (538),  Expect = 3e-60, Method: Composition-based stats.
 Identities = 115/202 (57%), Positives = 135/202 (67%), Gaps = 9/202 (4%)
 Frame = +3

Query  45   KWDTSGLAEI--PLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWI  218
            +WD SGL E      +V  D+N  +W+ KL  V + I    E T   E L   A YL+WI
Sbjct  207  QWDVSGLEETGAARAIVFADENGGSWFEKLAAVANQIGIGREITR--EKLAVCATYLRWI  264

Query  219  NTGQIPCFEDGGHHRPNRHAEISRLIFCELERILG---RKDATLQEI--LVIRKIHPCLP  383
            +TG I C E GGH RPN  A + R IF  LE+I G   R    L E+   V+R IHP LP
Sbjct  265  STGTILCVESGGHRRPNGPAMVGRGIFISLEQIQGAMYRHGTNLGEVERAVMRHIHPWLP  324

Query  384  SFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERIT  563
            SF AEFT+SVPLTRIRDIAHRNDIP +LK+ IKHTIQNKLHRNAGPEDL+ TE++LERIT
Sbjct  325  SFDAEFTSSVPLTRIRDIAHRNDIPDELKKTIKHTIQNKLHRNAGPEDLITTEVVLERIT  384

Query  564  KNPGEYSEAFVEQFKIFHHELK  629
               GEYS+ FV +FK FH ELK
Sbjct  385  ARDGEYSKDFVREFKEFHRELK  406



>emb|CEG01409.1| Carbohydrate binding module family 20 [Ostreococcus tauri]
Length=1117

 Score =   213 bits (543),  Expect = 5e-60, Method: Composition-based stats.
 Identities = 115/202 (57%), Positives = 135/202 (67%), Gaps = 9/202 (4%)
 Frame = +3

Query  45   KWDTSGLAEI--PLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWI  218
            +WD SGL E      +V  D+N  +W+ KL  V + I    E T   E L   A YL+WI
Sbjct  207  QWDVSGLEETGAARAIVFADENGGSWFEKLAAVANQIGIGREITR--EKLAVCATYLRWI  264

Query  219  NTGQIPCFEDGGHHRPNRHAEISRLIFCELERILG---RKDATLQEI--LVIRKIHPCLP  383
            +TG I C E GGH RPN  A + R IF  LE+I G   R    L E+   V+R IHP LP
Sbjct  265  STGTILCVESGGHRRPNGPAMVGRGIFISLEQIQGAMYRHGTNLGEVERAVMRHIHPWLP  324

Query  384  SFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERIT  563
            SF AEFT+SVPLTRIRDIAHRNDIP +LK+ IKHTIQNKLHRNAGPEDL+ TE++LERIT
Sbjct  325  SFDAEFTSSVPLTRIRDIAHRNDIPDELKKTIKHTIQNKLHRNAGPEDLITTEVVLERIT  384

Query  564  KNPGEYSEAFVEQFKIFHHELK  629
               GEYS+ FV +FK FH ELK
Sbjct  385  ARDGEYSKDFVREFKEFHRELK  406



>ref|XP_001419310.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97603.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=918

 Score =   207 bits (528),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 109/202 (54%), Positives = 135/202 (67%), Gaps = 9/202 (4%)
 Frame = +3

Query  45   KWDTSGLAEIPLK--LVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWI  218
            +WD   L E      +V  D++  +W+ KL  V + I    E T   + L  SA YL+WI
Sbjct  15   RWDVGNLEEASAARAVVLADESGGSWFEKLAAVANQIGIGKEITR--DKLAVSATYLRWI  72

Query  219  NTGQIPCFEDGGHHRPNRHAEISRLIFCELERILG---RKDATLQEI--LVIRKIHPCLP  383
            +TG I C E GGH RPN  A + R IF  +E++ G   R    L E+  +V+R++HP LP
Sbjct  73   STGTIKCVESGGHRRPNGPAMVGRGIFISMEQVQGAMYRHGTDLGEVERVVMRQVHPWLP  132

Query  384  SFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERIT  563
            SF  EFT +VPLTRIRDIAHRNDIP DLK+ IKHTIQNKLHRNAGPEDL+ATE++LERIT
Sbjct  133  SFNEEFTNAVPLTRIRDIAHRNDIPEDLKKTIKHTIQNKLHRNAGPEDLIATEVVLERIT  192

Query  564  KNPGEYSEAFVEQFKIFHHELK  629
               GEYSE FV +F+ FH ELK
Sbjct  193  AREGEYSEDFVREFREFHRELK  214



>ref|XP_003059536.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56668.1| predicted protein [Micromonas pusilla CCMP1545]
Length=975

 Score =   202 bits (515),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 93/213 (44%), Positives = 139/213 (65%), Gaps = 4/213 (2%)
 Frame = +3

Query  6    VRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEA  185
            ++ + +   +++ +W+   L +   ++VEGD++S +W +KL+ +  ++  +      ++A
Sbjct  14   LKGHREHNKDRHNQWNVDNLPDAARRIVEGDRDSPSWRQKLQALEGVLCFDDPGAMDMDA  73

Query  186  LTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRK  365
            L Y AIYL W+  G I C EDGGH+RPN HA+ ++ ++  +ER+            ++R+
Sbjct  74   LGYGAIYLFWVGVGAIACVEDGGHYRPNHHAKAAQHMYESIERVEKHHAGNGHVRALVRR  133

Query  366  IHPCLPSFKAEFTASVPLTRIRDIAH----RNDIPHDLKQEIKHTIQNKLHRNAGPEDLV  533
            +HP LP+F AEFT  VPLTRIRDIAH    R+    D++ EIKHTIQNKLHR AGPEDLV
Sbjct  134  LHPRLPAFTAEFTQQVPLTRIRDIAHGKGDRDGKCRDVRAEIKHTIQNKLHRCAGPEDLV  193

Query  534  ATELMLERITKNPGEYSEAFVEQFKIFHHELKD  632
            ATE ML ++T    +Y E F+E+F+IFH ELKD
Sbjct  194  ATEAMLAKLTAPGTDYPEEFIEEFRIFHRELKD  226



>ref|XP_002504762.1| alpha phosphoglucan water dikinase [Micromonas sp. RCC299]
 gb|ACO66020.1| alpha phosphoglucan water dikinase [Micromonas sp. RCC299]
Length=1001

 Score =   201 bits (510),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 105/208 (50%), Positives = 141/208 (68%), Gaps = 14/208 (7%)
 Frame = +3

Query  36   KNRKWDTSGLAEIPLKLVE-GDKNSQNWWRKLEVVRDLIVENVESTHR--LEALTYSAIY  206
            +NR      L E P K +  GDK + +W +KLE+++ ++ +     HR  L  L  +++Y
Sbjct  5    RNRSDGGVNLPEGPAKYIAAGDKEAPSWLQKLELIQSILGQG----HRITLARLGAASVY  60

Query  207  LKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGR-----KDATLQEILVIRKIH  371
            L+WI+TG + C EDG HHRPNR AEI+R IF  LE + G       +    E  ++R+IH
Sbjct  61   LRWISTGALFCAEDGNHHRPNRPAEIARDIFVSLETVAGELYKHGAEVGEAERQMMRQIH  120

Query  372  PCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELML  551
            P LPSF +EF  S PLTRIR+IAHR+DI  DLK++IKHTIQNKLHRNAGPEDLVATE  +
Sbjct  121  PWLPSFSSEFACSEPLTRIRNIAHRSDISEDLKKQIKHTIQNKLHRNAGPEDLVATEAFI  180

Query  552  ERIT--KNPGEYSEAFVEQFKIFHHELK  629
            +RIT   +PGE  +AFV++F +F+ ELK
Sbjct  181  KRITVDAHPGECPQAFVDEFMLFYDELK  208



>ref|XP_001697099.1| phosphoglucan water dikinase [Chlamydomonas reinhardtii]
 gb|EDP00354.1| phosphoglucan water dikinase [Chlamydomonas reinhardtii]
Length=978

 Score =   199 bits (507),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 99/211 (47%), Positives = 132/211 (63%), Gaps = 32/211 (15%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTH-RL  179
            FVRS  ++       W T GL+ + L LV+GD+ + +W +KL + + L+V++  +   RL
Sbjct  163  FVRSR-KKDERPAGTWRTEGLSGVALALVKGDEQAASWLKKLGLQKQLLVDSPPACRPRL  221

Query  180  EALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVI  359
            + L+Y  +Y  W+NTG + C E G H+RPN HA ++                        
Sbjct  222  DDLSYLYVYATWVNTGALACAESGSHYRPNHHANLA------------------------  257

Query  360  RKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVAT  539
                  L  F+ EF  S PLTRIRDIAHRNDIP +LK EIKHT+QNKLHR+AGPEDLVAT
Sbjct  258  ------LAMFRGEFRVSTPLTRIRDIAHRNDIPKELKDEIKHTLQNKLHRSAGPEDLVAT  311

Query  540  ELMLERITKNPGEYSEAFVEQFKIFHHELKD  632
            E+ML+R+T  PGEYSEAFVE+FKIF  EL++
Sbjct  312  EVMLQRVTARPGEYSEAFVEEFKIFTRELRE  342



>ref|XP_007511444.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17565.1| predicted protein [Bathycoccus prasinos]
Length=1340

 Score =   197 bits (502),  Expect = 4e-54, Method: Composition-based stats.
 Identities = 102/209 (49%), Positives = 140/209 (67%), Gaps = 8/209 (4%)
 Frame = +3

Query  18   DQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYS  197
            D+   ++NR WDTS L      LV  D+++ +W +KL+ V  L+ EN +     +AL YS
Sbjct  400  DRSSRDRNR-WDTSNLPSFAAALVSNDQSASSWRQKLQSVEKLLCEN-DGNDMEDALAYS  457

Query  198  AIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPC  377
             IYL WI+ G I C EDG H+RPN HA  +  +F ++E I G  +  +  +  IR++HP 
Sbjct  458  TIYLFWISVGAISCVEDGTHYRPNHHAGSAERMFGKIESIEGTDN--MSTLAAIRRLHPR  515

Query  378  LPSFKAEFTASVPLTRIRDIAHRNDIPH----DLKQEIKHTIQNKLHRNAGPEDLVATEL  545
            LP+F AEFT SVPLTRIRDIAH     H    +++QEIKHTIQNKLHR AGPEDLVA+E 
Sbjct  516  LPAFTAEFTQSVPLTRIRDIAHGKGDEHGKCREVRQEIKHTIQNKLHRCAGPEDLVASEK  575

Query  546  MLERITKNPGEYSEAFVEQFKIFHHELKD  632
            ML+++T    +Y +AFV++F+IF+ ELK+
Sbjct  576  MLQKLTAPGTDYPKAFVDEFEIFYRELKE  604



>gb|KJB71924.1| hypothetical protein B456_011G147600 [Gossypium raimondii]
Length=848

 Score =   195 bits (495),  Expect = 4e-54, Method: Composition-based stats.
 Identities = 89/96 (93%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = +3

Query  345  EILVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPE  524
            E+LVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPE
Sbjct  2    ELLVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPE  61

Query  525  DLVATELMLERITKNPGEYSEAFVEQFKIFHHELKD  632
            DLVATE ML RIT++PG+YSEAFVEQFKIFH ELKD
Sbjct  62   DLVATEAMLARITRDPGQYSEAFVEQFKIFHLELKD  97



>ref|XP_001417570.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO95863.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=997

 Score =   193 bits (490),  Expect = 7e-53, Method: Composition-based stats.
 Identities = 100/215 (47%), Positives = 140/215 (65%), Gaps = 16/215 (7%)
 Frame = +3

Query  27   GMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIY  206
            G E+N +W+T  LA+   ++VEGD++S +W +KL++V  LI ++      +++L Y+ +Y
Sbjct  52   GGERNLQWNTDNLADAARRIVEGDRDSSSWRQKLQMVEKLICDDGAD---VDSLAYATVY  108

Query  207  LKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERI--LGRKDATLQEIL-------VI  359
            L WI+ G I C EDG H+RPN HA  +  ++  +E         A+  +I        +I
Sbjct  109  LFWISVGAIACVEDGTHYRPNHHAGSAERMYGAIEAAERFANDVASGGDIYRARELRALI  168

Query  360  RKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPH----DLKQEIKHTIQNKLHRNAGPED  527
            R++HP LP+F AEFT SVPLTRIRDIAH     H    +++QEIKHTIQNKLHR AGPED
Sbjct  169  RRLHPRLPAFTAEFTQSVPLTRIRDIAHGKGDQHGKCREVRQEIKHTIQNKLHRCAGPED  228

Query  528  LVATELMLERITKNPGEYSEAFVEQFKIFHHELKD  632
            LVATE ML ++T    +Y E FV +FKIF+ ELK+
Sbjct  229  LVATESMLAKLTAPGTDYPEEFVNEFKIFYRELKE  263



>gb|KFG31055.1| pyruvate phosphate dikinase, pep/pyruvate binding domain-containing 
protein, partial [Toxoplasma gondii p89]
Length=441

 Score =   184 bits (466),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 128/198 (65%), Gaps = 15/198 (8%)
 Frame = +3

Query  81   KLVEGDKNSQNWWRKLEVVRDLIVENV----------ESTHRLEALTYSAIYLKWINTGQ  230
            +LVEG++ +++W  KLEVV++++   +          E+   +++L Y +IYL +++ G 
Sbjct  126  RLVEGEQTARSWREKLEVVKNVLAAALKEGKSRCNPQETVTLIDSLAYCSIYLHFVSQGD  185

Query  231  IPCFEDGGHHRPNRHAEISRLIFCELERIL----GRKDATLQEILVI-RKIHPCLPSFKA  395
            I C EDG H RPN HA +SR +   LE+I+    GR D       ++ R I P LPSF A
Sbjct  186  IVCTEDGRHFRPNHHASLSRELCIILEQIVQEMSGRDDIMADATRILARSIAPSLPSFGA  245

Query  396  EFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPG  575
             FTAS PLTRIRDIAHRNDIP DLK EIKHT+QNKLHR AGPEDLV  E +L R   NP 
Sbjct  246  PFTASQPLTRIRDIAHRNDIPSDLKNEIKHTLQNKLHRCAGPEDLVTAENLLRRFHTNPS  305

Query  576  EYSEAFVEQFKIFHHELK  629
             Y  AFV +F+ F+ EL+
Sbjct  306  AYPHAFVVEFERFYDELR  323



>ref|XP_003078935.1| chloroplast alpha-glucan water dikinase isoform 3 (ISS), partial 
[Ostreococcus tauri]
Length=969

 Score =   188 bits (478),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 99/212 (47%), Positives = 137/212 (65%), Gaps = 16/212 (8%)
 Frame = +3

Query  33   EKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLK  212
            ++N +W+T  LA+   ++VEGD++S +W +KL++V  ++ +N      +++L Y  +YL 
Sbjct  94   DRNLRWNTDNLADAARRIVEGDRDSSSWRQKLQMVEKVLCDNGAD---VDSLAYVTVYLF  150

Query  213  WINTGQIPCFEDGGHHRPNRHAEISRLIF--------CELERILGRKDATLQEI-LVIRK  365
            WI+ G I C EDG H+RPN HA  +  ++        C  E   G      +E+  +IR+
Sbjct  151  WISVGAIMCVEDGTHYRPNHHAGSAERMYGAIEAAERCAHEIANGGDHHRARELRALIRR  210

Query  366  IHPCLPSFKAEFTASVPLTRIRDIAH----RNDIPHDLKQEIKHTIQNKLHRNAGPEDLV  533
            +HP LP+F AEFT SVPLTRIRDIAH     N    D++QEIKHTIQNKLHR AGPEDLV
Sbjct  211  LHPRLPAFTAEFTQSVPLTRIRDIAHGKGDTNGKCRDVRQEIKHTIQNKLHRCAGPEDLV  270

Query  534  ATELMLERITKNPGEYSEAFVEQFKIFHHELK  629
            ATE ML ++T    +Y E FV +FKIF+ ELK
Sbjct  271  ATEAMLAKLTAPGTDYPEEFVNEFKIFYRELK  302



>emb|CEF97682.1| Pyruvate phosphate dikinase,PEP/pyruvate-binding, partial [Ostreococcus 
tauri]
Length=1107

 Score =   189 bits (480),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 99/213 (46%), Positives = 138/213 (65%), Gaps = 16/213 (8%)
 Frame = +3

Query  33   EKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLK  212
            ++N +W+T  LA+   ++VEGD++S +W +KL++V  ++ +N      +++L Y  +YL 
Sbjct  168  DRNLRWNTDNLADAARRIVEGDRDSSSWRQKLQMVEKVLCDNGAD---VDSLAYVTVYLF  224

Query  213  WINTGQIPCFEDGGHHRPNRHAEISRLIF--------CELERILGRKDATLQEI-LVIRK  365
            WI+ G I C EDG H+RPN HA  +  ++        C  E   G      +E+  +IR+
Sbjct  225  WISVGAIMCVEDGTHYRPNHHAGSAERMYGAIEAAERCAHEIANGGDHHRARELRALIRR  284

Query  366  IHPCLPSFKAEFTASVPLTRIRDIAH----RNDIPHDLKQEIKHTIQNKLHRNAGPEDLV  533
            +HP LP+F AEFT SVPLTRIRDIAH     N    D++QEIKHTIQNKLHR AGPEDLV
Sbjct  285  LHPRLPAFTAEFTQSVPLTRIRDIAHGKGDTNGKCRDVRQEIKHTIQNKLHRCAGPEDLV  344

Query  534  ATELMLERITKNPGEYSEAFVEQFKIFHHELKD  632
            ATE ML ++T    +Y E FV +FKIF+ ELK+
Sbjct  345  ATEAMLAKLTAPGTDYPEEFVNEFKIFYRELKE  377



>gb|KFG99968.1| pyruvate phosphate dikinase, pep/pyruvate binding domain-containing 
protein, partial [Toxoplasma gondii VAND]
Length=529

 Score =   183 bits (464),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 100/209 (48%), Positives = 134/209 (64%), Gaps = 16/209 (8%)
 Frame = +3

Query  51   DTSGLAEIPL-KLVEGDKNSQNWWRKLEVVRDLIVENV----------ESTHRLEALTYS  197
            +++ LA   L +LVEG++ +++W  KLEVV++++   +          E+   +++L Y 
Sbjct  203  ESATLASSALQRLVEGEQTARSWREKLEVVKNVLAAALKEGKSRCNPQETVTLIDSLAYC  262

Query  198  AIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERIL----GRKDATLQEILVI-R  362
            +IYL +++ G I C EDG H RPN HA +SR +   LE+I+    GR D       ++ R
Sbjct  263  SIYLHFVSQGDIVCTEDGRHFRPNHHASLSRELCIILEQIVQEMSGRDDIMADATRILAR  322

Query  363  KIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE  542
             I P LPSF A FTAS PLTRIRDIAHRNDIP DLK EIKHT+QNKLHR AGPEDLV  E
Sbjct  323  SIAPSLPSFGAPFTASQPLTRIRDIAHRNDIPSDLKNEIKHTLQNKLHRCAGPEDLVTAE  382

Query  543  LMLERITKNPGEYSEAFVEQFKIFHHELK  629
             +L R   NP  Y  AFV +F+ F+ EL+
Sbjct  383  NLLRRFHTNPSAYPHAFVVEFERFYDELR  411



>gb|KFH05191.1| pyruvate phosphate dikinase, pep/pyruvate binding domain-containing 
protein, partial [Toxoplasma gondii MAS]
Length=765

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 128/198 (65%), Gaps = 15/198 (8%)
 Frame = +3

Query  81   KLVEGDKNSQNWWRKLEVVRDLIVENV----------ESTHRLEALTYSAIYLKWINTGQ  230
            +LVEG++ +++W  KLEVV++++   +          E+   +++L Y +IYL +++ G 
Sbjct  126  RLVEGEQTARSWREKLEVVKNVLAAALKEGKSRCNPQETVTLIDSLAYCSIYLHFVSQGD  185

Query  231  IPCFEDGGHHRPNRHAEISRLIFCELERIL----GRKDATLQEILVI-RKIHPCLPSFKA  395
            I C EDG H RPN HA +SR +   LE+I+    GR D       ++ R I P LPSF A
Sbjct  186  IVCTEDGRHFRPNHHASLSRELCIILEQIVQEMSGRDDIMADATRILARSIAPSLPSFGA  245

Query  396  EFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPG  575
             FTAS PLTRIRDIAHRNDIP DLK EIKHT+QNKLHR AGPEDLV  E +L R   NP 
Sbjct  246  PFTASQPLTRIRDIAHRNDIPSDLKNEIKHTLQNKLHRCAGPEDLVTAENLLRRFHTNPS  305

Query  576  EYSEAFVEQFKIFHHELK  629
             Y  AFV +F+ F+ EL+
Sbjct  306  AYPHAFVVEFERFYDELR  323



>ref|XP_006421076.1| hypothetical protein CICLE_v10004968mg [Citrus clementina]
 gb|ESR34316.1| hypothetical protein CICLE_v10004968mg [Citrus clementina]
Length=356

 Score =   177 bits (448),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+R++D    E  RKWDTSGL  + LKLVEGD+ ++NWWRKLEVVR+LIVEN++S  RLE
Sbjct  227  FMRADDHWNREMERKWDTSGLQGLTLKLVEGDQRARNWWRKLEVVRELIVENLQSDERLE  286

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQ  344
            AL YSAIYLKWINTG+IPCFEDGGHHRPNRHAEISRLIF ELERI  RKDA+ Q
Sbjct  287  ALIYSAIYLKWINTGKIPCFEDGGHHRPNRHAEISRLIFRELERISCRKDASPQ  340



>gb|KFG42300.1| pyruvate phosphate dikinase, pep/pyruvate binding domain-containing 
protein, partial [Toxoplasma gondii GAB2-2007-GAL-DOM2]
Length=965

 Score =   184 bits (467),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 128/198 (65%), Gaps = 15/198 (8%)
 Frame = +3

Query  81   KLVEGDKNSQNWWRKLEVVRDLIVENV----------ESTHRLEALTYSAIYLKWINTGQ  230
            +LVEG++ +++W  KLEVV++++   +          E+   +++L Y +IYL +++ G 
Sbjct  214  RLVEGEQTARSWREKLEVVKNVLAAALKEGKSRCNPQETVTLIDSLAYCSIYLHFVSQGD  273

Query  231  IPCFEDGGHHRPNRHAEISRLIFCELERIL----GRKDATLQEILVI-RKIHPCLPSFKA  395
            I C EDG H RPN HA +SR +   LE+I+    GR D       ++ R I P LPSF A
Sbjct  274  IVCTEDGRHFRPNHHASLSRELCIILEQIVQEMSGRDDIMADATRILARSIAPSLPSFGA  333

Query  396  EFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPG  575
             FTAS PLTRIRDIAHRNDIP DLK EIKHT+QNKLHR AGPEDLV  E +L R   NP 
Sbjct  334  PFTASQPLTRIRDIAHRNDIPSDLKNEIKHTLQNKLHRCAGPEDLVTAENLLRRFHTNPS  393

Query  576  EYSEAFVEQFKIFHHELK  629
             Y  AFV +F+ F+ EL+
Sbjct  394  AYPHAFVVEFERFYDELR  411



>gb|ESS33912.1| pyruvate phosphate dikinase, pep/pyruvate binding domain-containing 
protein [Toxoplasma gondii VEG]
Length=1239

 Score =   184 bits (468),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 128/198 (65%), Gaps = 15/198 (8%)
 Frame = +3

Query  81   KLVEGDKNSQNWWRKLEVVRDLIVENV----------ESTHRLEALTYSAIYLKWINTGQ  230
            +LVEG++ +++W  KLEVV++++   +          E+   +++L Y +IYL +++ G 
Sbjct  214  RLVEGEQTARSWREKLEVVKNVLAAALKEGKSRCNPQETVTLIDSLAYCSIYLHFVSQGD  273

Query  231  IPCFEDGGHHRPNRHAEISRLIFCELERIL----GRKDATLQEILVI-RKIHPCLPSFKA  395
            I C EDG H RPN HA +SR +   LE+I+    GR D       ++ R I P LPSF A
Sbjct  274  IVCTEDGRHFRPNHHASLSRELCIILEQIVQEMSGRDDIMADATRILARSIAPSLPSFGA  333

Query  396  EFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPG  575
             FTAS PLTRIRDIAHRNDIP DLK EIKHT+QNKLHR AGPEDLV  E +L R   NP 
Sbjct  334  PFTASQPLTRIRDIAHRNDIPSDLKNEIKHTLQNKLHRCAGPEDLVTAENLLRRFHTNPS  393

Query  576  EYSEAFVEQFKIFHHELK  629
             Y  AFV +F+ F+ EL+
Sbjct  394  AYPHAFVVEFERFYDELR  411



>gb|KFG62834.1| pyruvate phosphate dikinase, pep/pyruvate binding domain-containing 
protein [Toxoplasma gondii RUB]
Length=1239

 Score =   184 bits (468),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 128/198 (65%), Gaps = 15/198 (8%)
 Frame = +3

Query  81   KLVEGDKNSQNWWRKLEVVRDLIVENV----------ESTHRLEALTYSAIYLKWINTGQ  230
            +LVEG++ +++W  KLEVV++++   +          E+   +++L Y +IYL +++ G 
Sbjct  214  RLVEGEQTARSWREKLEVVKNVLAAALKEGKSRCNPQETVTLIDSLAYCSIYLHFVSQGD  273

Query  231  IPCFEDGGHHRPNRHAEISRLIFCELERIL----GRKDATLQEILVI-RKIHPCLPSFKA  395
            I C EDG H RPN HA +SR +   LE+I+    GR D       ++ R I P LPSF A
Sbjct  274  IVCTEDGRHFRPNHHASLSRELCIILEQIVQEMSGRDDIMADATRILARSIAPSLPSFGA  333

Query  396  EFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPG  575
             FTAS PLTRIRDIAHRNDIP DLK EIKHT+QNKLHR AGPEDLV  E +L R   NP 
Sbjct  334  PFTASQPLTRIRDIAHRNDIPSDLKNEIKHTLQNKLHRCAGPEDLVTAENLLRRFHTNPS  393

Query  576  EYSEAFVEQFKIFHHELK  629
             Y  AFV +F+ F+ EL+
Sbjct  394  AYPHAFVVEFERFYDELR  411



>gb|EPR59823.1| pyruvate phosphate dikinase, pep/pyruvate binding domain-containing 
protein [Toxoplasma gondii GT1]
Length=1239

 Score =   184 bits (468),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 128/198 (65%), Gaps = 15/198 (8%)
 Frame = +3

Query  81   KLVEGDKNSQNWWRKLEVVRDLIVENV----------ESTHRLEALTYSAIYLKWINTGQ  230
            +LVEG++ +++W  KLEVV++++   +          E+   +++L Y +IYL +++ G 
Sbjct  214  RLVEGEQTARSWREKLEVVKNVLAAALKEGKSRCNPQETVTLIDSLAYCSIYLHFVSQGD  273

Query  231  IPCFEDGGHHRPNRHAEISRLIFCELERIL----GRKDATLQEILVI-RKIHPCLPSFKA  395
            I C EDG H RPN HA +SR +   LE+I+    GR D       ++ R I P LPSF A
Sbjct  274  IVCTEDGRHFRPNHHASLSRELCIILEQIVQEMSGRDDIMADATRILARSIAPSLPSFGA  333

Query  396  EFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPG  575
             FTAS PLTRIRDIAHRNDIP DLK EIKHT+QNKLHR AGPEDLV  E +L R   NP 
Sbjct  334  PFTASQPLTRIRDIAHRNDIPSDLKNEIKHTLQNKLHRCAGPEDLVTAENLLRRFHTNPS  393

Query  576  EYSEAFVEQFKIFHHELK  629
             Y  AFV +F+ F+ EL+
Sbjct  394  AYPHAFVVEFERFYDELR  411



>gb|EPT28056.1| pyruvate phosphate dikinase, pep/pyruvate binding domain-containing 
protein [Toxoplasma gondii ME49]
Length=1239

 Score =   184 bits (468),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 128/198 (65%), Gaps = 15/198 (8%)
 Frame = +3

Query  81   KLVEGDKNSQNWWRKLEVVRDLIVENV----------ESTHRLEALTYSAIYLKWINTGQ  230
            +LVEG++ +++W  KLEVV++++   +          E+   +++L Y +IYL +++ G 
Sbjct  214  RLVEGEQTARSWREKLEVVKNVLAAALKEGKSRCNPQETVTLIDSLAYCSIYLHFVSQGD  273

Query  231  IPCFEDGGHHRPNRHAEISRLIFCELERIL----GRKDATLQEILVI-RKIHPCLPSFKA  395
            I C EDG H RPN HA +SR +   LE+I+    GR D       ++ R I P LPSF A
Sbjct  274  IVCTEDGRHFRPNHHASLSRELCIILEQIVQEMSGRDDIMADATRILARSIAPSLPSFGA  333

Query  396  EFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPG  575
             FTAS PLTRIRDIAHRNDIP DLK EIKHT+QNKLHR AGPEDLV  E +L R   NP 
Sbjct  334  PFTASQPLTRIRDIAHRNDIPSDLKNEIKHTLQNKLHRCAGPEDLVTAENLLRRFHTNPS  393

Query  576  EYSEAFVEQFKIFHHELK  629
             Y  AFV +F+ F+ EL+
Sbjct  394  AYPHAFVVEFERFYDELR  411



>ref|XP_002368480.1| phosphoglucan, water dikinase protein, putative [Toxoplasma gondii 
ME49]
Length=1222

 Score =   184 bits (468),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 128/198 (65%), Gaps = 15/198 (8%)
 Frame = +3

Query  81   KLVEGDKNSQNWWRKLEVVRDLIVENV----------ESTHRLEALTYSAIYLKWINTGQ  230
            +LVEG++ +++W  KLEVV++++   +          E+   +++L Y +IYL +++ G 
Sbjct  197  RLVEGEQTARSWREKLEVVKNVLAAALKEGKSRCNPQETVTLIDSLAYCSIYLHFVSQGD  256

Query  231  IPCFEDGGHHRPNRHAEISRLIFCELERIL----GRKDATLQEILVI-RKIHPCLPSFKA  395
            I C EDG H RPN HA +SR +   LE+I+    GR D       ++ R I P LPSF A
Sbjct  257  IVCTEDGRHFRPNHHASLSRELCIILEQIVQEMSGRDDIMADATRILARSIAPSLPSFGA  316

Query  396  EFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPG  575
             FTAS PLTRIRDIAHRNDIP DLK EIKHT+QNKLHR AGPEDLV  E +L R   NP 
Sbjct  317  PFTASQPLTRIRDIAHRNDIPSDLKNEIKHTLQNKLHRCAGPEDLVTAENLLRRFHTNPS  376

Query  576  EYSEAFVEQFKIFHHELK  629
             Y  AFV +F+ F+ EL+
Sbjct  377  AYPHAFVVEFERFYDELR  394



>gb|KFG41384.1| pyruvate phosphate dikinase, pep/pyruvate binding domain-containing 
protein [Toxoplasma gondii FOU]
Length=535

 Score =   178 bits (452),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 95/194 (49%), Positives = 125/194 (64%), Gaps = 15/194 (8%)
 Frame = +3

Query  81   KLVEGDKNSQNWWRKLEVVRDLIVENV----------ESTHRLEALTYSAIYLKWINTGQ  230
            +LVEG++ +++W  KLEVV++++   +          E+   +++L Y +IYL +++ G 
Sbjct  214  RLVEGEQTARSWREKLEVVKNVLAAALKEGKSRCNPQETVTLIDSLAYCSIYLHFVSQGD  273

Query  231  IPCFEDGGHHRPNRHAEISRLIFCELERIL----GRKDATLQEILVI-RKIHPCLPSFKA  395
            I C EDG H RPN HA +SR +   LE+I+    GR D       ++ R I P LPSF A
Sbjct  274  IVCTEDGRHFRPNHHASLSRELCIILEQIVQEMSGRDDIMADATRILARSIAPSLPSFGA  333

Query  396  EFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPG  575
             FTAS PLTRIRDIAHRNDIP DLK EIKHT+QNKLHR AGPEDLV  E +L R   NP 
Sbjct  334  PFTASQPLTRIRDIAHRNDIPSDLKNEIKHTLQNKLHRCAGPEDLVTAENLLRRFHTNPS  393

Query  576  EYSEAFVEQFKIFH  617
             Y  AFV +F+ F+
Sbjct  394  AYPHAFVVEFERFY  407



>ref|XP_008889223.1| pyruvate phosphate dikinase, pep/pyruvate binding domain-containing 
protein [Hammondia hammondi]
 gb|KEP60361.1| pyruvate phosphate dikinase, pep/pyruvate binding domain-containing 
protein [Hammondia hammondi]
Length=1239

 Score =   181 bits (458),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 95/198 (48%), Positives = 127/198 (64%), Gaps = 15/198 (8%)
 Frame = +3

Query  81   KLVEGDKNSQNWWRKLEVVRDLIVENV----------ESTHRLEALTYSAIYLKWINTGQ  230
            +LVEG++ +++W  KLEVV++++   +          E+   +++L Y +IYL +++ G 
Sbjct  214  RLVEGEQTARSWREKLEVVKNVLAAALKEGKSRSSPQETVTLIDSLAYCSIYLHFVSQGN  273

Query  231  IPCFEDGGHHRPNRHAEISRLIFCELERIL----GRKDATLQEILVI-RKIHPCLPSFKA  395
            I C EDG H RPN HA +SR +   LE+I+     R D       ++ R I P LPSF A
Sbjct  274  IVCTEDGRHFRPNHHANLSRELCILLEQIVQEVSSRDDIMADATRILARSIAPSLPSFGA  333

Query  396  EFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPG  575
             FTAS PLTRIRDIAHRNDIP +LK EIKHT+QNKLHR AGPEDLV  E +L R   NP 
Sbjct  334  PFTASQPLTRIRDIAHRNDIPSNLKNEIKHTLQNKLHRCAGPEDLVTAENLLRRFHTNPS  393

Query  576  EYSEAFVEQFKIFHHELK  629
             Y  AFV +F+ F+ EL+
Sbjct  394  AYPHAFVVEFERFYDELR  411



>ref|XP_005716854.1| Phosphoglucan water dikinase, PWD [Chondrus crispus]
 emb|CDF37035.1| Phosphoglucan water dikinase, PWD [Chondrus crispus]
Length=1033

 Score =   174 bits (441),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 97/224 (43%), Positives = 130/224 (58%), Gaps = 23/224 (10%)
 Frame = +3

Query  18   DQRGMEKNRKWDTSGLA-----EIPLKL-------VEGDKNSQNWWRKLEVVRDLIVENV  161
            D     ++R W + G++     + P+ L       V      ++W ++L  VR L  E+ 
Sbjct  111  DPPSAPQSRPWASDGVSANGHSKFPVALDDLERAIVHLTNEKRSWRQRLSFVRSLFTEDS  170

Query  162  EST------HRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILG  323
             ++        ++ L   +++L ++ +GQ+ C EDGGHHRPN HA  +R +   L R+  
Sbjct  171  AASKNSFNPQNIDHLATVSVFLTFLASGQVRCEEDGGHHRPNHHANEARQLEAALARVAK  230

Query  324  ---RKDATLQEILVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQ  494
               RK        VIRKI P LPS+  +FTASVPLTRIRDIAHR DIPHD KQEIKHT+Q
Sbjct  231  SAPRKGTDSYTPYVIRKIFPQLPSYAPQFTASVPLTRIRDIAHRGDIPHDFKQEIKHTLQ  290

Query  495  NKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIFHHEL  626
            NKLHR AGPEDL  +  +LERI    G++S    EQF IFH EL
Sbjct  291  NKLHRCAGPEDLQTSARLLERIQH--GDFSGGLKEQFAIFHAEL  332



>emb|CDI76079.1| Carbohydrate-binding module family 20 protein, related [Eimeria 
acervulina]
Length=531

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/198 (46%), Positives = 122/198 (62%), Gaps = 18/198 (9%)
 Frame = +3

Query  84   LVEGDKNSQNWWRKLEVVRDLIVENVESTHRL------------EALTYSAIYLKWINTG  227
            +VEG+ ++ +W  KLE+V+  +V+N      L            +AL Y+ +Y   ++ G
Sbjct  246  IVEGNASAPSWGAKLELVKS-VVKNAGDGSSLAKASAEQLVVAIDALCYAGVYADLVSQG  304

Query  228  QIPCFEDGGHHRPNRHAEISRLIFCELERIL----GRKDATLQEI-LVIRKIHPCLPSFK  392
             + C EDG H RPNRHA ISR +   LE +L     R D     + LV R+I P LPSF 
Sbjct  305  ALRCSEDGRHLRPNRHANISREVSVHLELLLQAVASRTDDFASVLRLVARRILPSLPSFA  364

Query  393  AEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNP  572
            A F A+ PLTRIR+IAHR+DIP +LK EIKH IQNKLHR AGPEDL AT+ +L+R+    
Sbjct  365  AAFRAAQPLTRIRNIAHRDDIPMELKNEIKHKIQNKLHRCAGPEDLEATQQLLQRVHAAR  424

Query  573  GEYSEAFVEQFKIFHHEL  626
            G+YS  FV + + F+ EL
Sbjct  425  GQYSSGFVSELETFYKEL  442



>ref|XP_008662597.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Zea mays]
Length=287

 Score =   159 bits (401),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 88/114 (77%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+RSN+    E  RKWD +GL  + LKLVEGDK S+NWWRKLE+VR L+ E V+    LE
Sbjct  151  FMRSNEHHNTENCRKWDMTGLDAVSLKLVEGDKASRNWWRKLELVRVLLSEYVQDQSHLE  210

Query  183  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQ  344
            ALTYSAIYLKWI TGQIPCFEDGGHHRPN+HAEISR IF E+ERI   K+ + Q
Sbjct  211  ALTYSAIYLKWIYTGQIPCFEDGGHHRPNKHAEISRQIFGEIERIYYGKNTSSQ  264



>ref|XP_005827807.1| hypothetical protein GUITHDRAFT_164559 [Guillardia theta CCMP2712]
 gb|EKX40827.1| hypothetical protein GUITHDRAFT_164559 [Guillardia theta CCMP2712]
Length=1011

 Score =   166 bits (421),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 87/200 (44%), Positives = 125/200 (63%), Gaps = 23/200 (12%)
 Frame = +3

Query  84   LVEGDKNSQNWWRKLEVVRDLIVENVES-----------------THRLEALTYSAIYLK  212
            +V+ ++ + +W +KLE V+ L  +  +S                       L   AIYL 
Sbjct  121  IVKANQENGSWRQKLEFVKTLFYDKSDSDPCTPGDLATASGFNQQEPETSHLAMIAIYLH  180

Query  213  WINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFK  392
            +++TGQ+PC++ GGH+RPNRHA ++  I   L++I      T +   VIRKIHP LPS+ 
Sbjct  181  FLSTGQVPCYDVGGHNRPNRHAMLASAIDEALDKI----KKTPENAYVIRKIHPLLPSYS  236

Query  393  AEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNP  572
            + +TA VPLTRIRDIAHR+DIP ++K +IKH +QNKLHR AGPEDLV  E ++++     
Sbjct  237  SAYTAQVPLTRIRDIAHRSDIPKEMKDDIKHNLQNKLHRCAGPEDLVTAERIMKQ--AES  294

Query  573  GEYSEAFVEQFKIFHHELKD  632
            G YS AF+EQ +IF  EL++
Sbjct  295  GHYSAAFMEQMRIFMVELRE  314



>emb|CDJ47310.1| Carbohydrate-binding module family 20 protein, related [Eimeria 
brunetti]
Length=540

 Score =   154 bits (388),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 89/202 (44%), Positives = 120/202 (59%), Gaps = 22/202 (11%)
 Frame = +3

Query  84   LVEGDKNSQNWWRKLEVVRDLIVENVESTH-----------RLEALTYSAIYLKWINTGQ  230
            +VEG+  + +W  KLE+V+ +I +  + +             ++AL YS +YL++I  G 
Sbjct  255  IVEGNAAAASWGAKLEIVKKIIQKIGDGSSFSKAPAEKVVAAIDALCYSGVYLQFIKQGL  314

Query  231  IPCFEDGGHHRPNRHAEISRLIFCELERIL------GRKDATLQEILVIRKIHPCLPSFK  392
            I C EDG HHRPN HA ISR +   LE +L      G   A++ +I V R I  CLPSF 
Sbjct  315  ICCSEDGEHHRPNVHANISRELSIHLELLLQGVASRGDDFASVLQI-VARDIPSCLPSFA  373

Query  393  AEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERI----  560
            A +  S PLTRIR+IAHRNDIP +LK EIK  IQNK+HR AGPEDL AT L+L+R+    
Sbjct  374  AAYRVSEPLTRIRNIAHRNDIPLELKNEIKKKIQNKIHRCAGPEDLEATRLLLQRMHAAA  433

Query  561  TKNPGEYSEAFVEQFKIFHHEL  626
                  Y   F+ + + F+ EL
Sbjct  434  AAAAATYPPDFLSELETFYKEL  455



>gb|KEH44553.1| phosphoglucan, water dikinase, putative [Medicago truncatula]
Length=1226

 Score =   154 bits (388),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 87/142 (61%), Gaps = 42/142 (30%)
 Frame = +3

Query  207  LKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPS  386
             +WINTGQIPCFEDGGHHRPNRHAEISRLIF +LE+   RKD + Q              
Sbjct  377  FRWINTGQIPCFEDGGHHRPNRHAEISRLIFRKLEQHTSRKDISPQ--------------  422

Query  387  FKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITK  566
                                         +IKHTIQNKLHR AGPEDLVATE ML +ITK
Sbjct  423  ----------------------------TQIKHTIQNKLHRYAGPEDLVATEAMLAKITK  454

Query  567  NPGEYSEAFVEQFKIFHHELKD  632
            NPGEYSE FVEQFKIFH ELKD
Sbjct  455  NPGEYSETFVEQFKIFHRELKD  476



>gb|EJY83942.1| hypothetical protein OXYTRI_18322 [Oxytricha trifallax]
Length=1101

 Score =   144 bits (364),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 85/199 (43%), Positives = 116/199 (58%), Gaps = 7/199 (4%)
 Frame = +3

Query  39   NRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVE-STHRLEALTYSAIYLKW  215
            N+K   +   +I  +L   +     W +KLE+V  L+ +  E      E L   A YL +
Sbjct  185  NQKQSDTLAQDIISQLQSLNAEKGTWKQKLEIVAQLVEKYKEFKNFPTEGLAILAAYLYF  244

Query  216  INTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFKA  395
            +N+ QI C E+G H RPN HA I+     +L R L  +  T +   +IR +   LPSF  
Sbjct  245  VNSHQIKCAENGTHFRPNNHANIAY----DLYRTLDNELTTEENSFIIRSLKKNLPSFAD  300

Query  396  EFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPG  575
            +FT +VPLTRIRDIAHRNDIP DLK +IK+ +QNKLHR A P DL   E +++R+    G
Sbjct  301  QFTQTVPLTRIRDIAHRNDIPSDLKSDIKNRLQNKLHRCADPGDLKTCEELIQRVRN--G  358

Query  576  EYSEAFVEQFKIFHHELKD  632
             YS  F  QF+IF+ ELK+
Sbjct  359  NYSGDFKNQFEIFYEELKE  377



>emb|CDW77583.1| water chloroplastic-like [Stylonychia lemnae]
Length=991

 Score =   139 bits (349),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 105/174 (60%), Gaps = 15/174 (9%)
 Frame = +3

Query  114  WWRKLEVVRDLIVE-NVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISR  290
            W +KLE+V  L+ +    S    E L   + YL ++N+ QI C E+G H RPN HA I+ 
Sbjct  168  WKQKLEIVAQLVDKFKGYSNFPTEGLAILSAYLYFVNSHQIKCSENGTHFRPNNHANIAY  227

Query  291  LIFCELERILGRKDATLQEILVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLK  470
             ++  L+R L  ++ T             +PSF  ++T +VPLTRIRDIAHR DIP DLK
Sbjct  228  QLYQTLDRELTTEENTF------------IPSFADQYTQTVPLTRIRDIAHRGDIPQDLK  275

Query  471  QEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIFHHELKD  632
             +IKH +QNKLHR A P DL   E +++R+    G YS  F +QF++F+ ELK+
Sbjct  276  NDIKHRLQNKLHRCADPGDLKTCEELIQRV--RSGNYSGEFKQQFELFYEELKE  327



>ref|XP_011129379.1| putative phosphoglucan, water dikinase [Gregarina niphandrodes]
 gb|EZG78247.1| putative phosphoglucan, water dikinase [Gregarina niphandrodes]
Length=1159

 Score =   128 bits (322),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 73/188 (39%), Positives = 106/188 (56%), Gaps = 15/188 (8%)
 Frame = +3

Query  102  NSQNWWRKLEVVRDLIVEN-VESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHA  278
            N+++   +LE + +++      +   L  L   ++Y +W+ T  + C EDG H RPN  A
Sbjct  190  NTKSLRERLEFIANVVTSRPASAVEMLRTLALLSLYWEWVATRVLFCGEDGRHFRPNHVA  249

Query  279  EISRLIFCELERIL---GRKDATLQEI---------LVIRKIHPCLPSFKAEFTASVPLT  422
            + S+ IF  L   L   G+ DA   +          +V R++   LPSF A+FTA+VP+T
Sbjct  250  QSSKEIFDALVAYLDPAGKGDAHKGDTHSWALDVTEMVARRLMKLLPSFDAKFTATVPMT  309

Query  423  RIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQ  602
            RIRDIAHRNDIP D+K EIK T+QNKLHR A P+DLV    +L++        +  F+ +
Sbjct  310  RIRDIAHRNDIPSDVKTEIKTTLQNKLHRCASPQDLVTCRSLLDKYRAQ--NLNPDFLSE  367

Query  603  FKIFHHEL  626
            F  F  EL
Sbjct  368  FTAFESEL  375



>ref|XP_006421074.1| hypothetical protein CICLE_v10004968mg [Citrus clementina]
 gb|ESR34314.1| hypothetical protein CICLE_v10004968mg [Citrus clementina]
Length=353

 Score = 98.6 bits (244),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +3

Query  3    FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  182
            F+R++D    E  RKWDTSGL  + LKLVEGD+ ++NWWRKLEVVR+LIVEN++S  RLE
Sbjct  227  FMRADDHWNREMERKWDTSGLQGLTLKLVEGDQRARNWWRKLEVVRELIVENLQSDERLE  286

Query  183  ALTYSAIYLK  212
            AL YSAIYLK
Sbjct  287  ALIYSAIYLK  296


 Score = 50.1 bits (118),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +1

Query  235  LVLKMVVIIGQIDMLKFPGLYFVN*KESWAGKMQHFRKYL*SARSIHV  378
            + LK  VIIGQ  MLKF GLY  N  E  AGKM H RK+L   RS HV
Sbjct  293  IYLKTEVIIGQTGMLKFQGLYSANWNEFPAGKMLHLRKFLLFERSTHV  340



>ref|XP_002502953.1| carbohydrate-binding module family 20 protein [Micromonas sp. 
RCC299]
 gb|ACO64211.1| carbohydrate-binding module family 20 protein [Micromonas sp. 
RCC299]
Length=1625

 Score =   120 bits (300),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 69/190 (36%), Positives = 102/190 (54%), Gaps = 10/190 (5%)
 Frame = +3

Query  84   LVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHR  263
            L   D  +  W  KLE+V  +I    E T  ++ +    IY++W+    + C ED G   
Sbjct  672  LAVADDAASTWLEKLEIVSGMIGTGNEVT--VDKIAACCIYVRWLGNCDVDCGEDDGRRG  729

Query  264  PNRHAEISRLIFCELERILG---RKDATLQEI--LVIRKIHPCLPSFKAEFT-ASVPLTR  425
            P     ++R IF  LE   G   ++   + E+   ++R+I P LPSF  EF     P+ R
Sbjct  730  PAAACGVARDIFVNLETTAGELYKRGTRVGEVERALMRQIQPWLPSFADEFERGGAPMAR  789

Query  426  IRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKN--PGEYSEAFVE  599
            IR I    ++P  L++EI  +I+NKL RNAGP  L ATE ML+ I ++  PG+Y + FV+
Sbjct  790  IRGITSMPEVPQPLREEISKSIENKLARNAGPVALFATEAMLKTIKEDAYPGQYPQRFVD  849

Query  600  QFKIFHHELK  629
            +F  F  ELK
Sbjct  850  EFVAFTQELK  859



>ref|XP_003881249.1| phosphoenolpyruvate synthase, related [Neospora caninum Liverpool]
 emb|CBZ51216.1| phosphoenolpyruvate synthase, related [Neospora caninum Liverpool]
Length=1180

 Score =   111 bits (277),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 65/196 (33%), Positives = 102/196 (52%), Gaps = 52/196 (27%)
 Frame = +3

Query  75   PLKLV-EGDKNSQNWWRKLEVVRDLIVENV----------ESTHRLEALTYSAIYLKWIN  221
            PL+LV +G++ +++W  KLEVV+ ++   +          ++ + +++L Y +IYL++I+
Sbjct  195  PLRLVVDGERGAKSWREKLEVVKAVLTAALKDGKFRYNPQDTVNLIDSLAYCSIYLRFIS  254

Query  222  TGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFKAEF  401
             G I C EDG H RPN HA +SR +   LE+I+                           
Sbjct  255  QGDIVCTEDGRHFRPNHHANLSRELCVLLEQIM---------------------------  287

Query  402  TASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEY  581
                     ++ A R+D+      EIKH +QNKLHR AGPEDLV  E +L+R    PG Y
Sbjct  288  ---------QEAASRDDV-----MEIKHALQNKLHRCAGPEDLVTAEKLLQRFHSTPGRY  333

Query  582  SEAFVEQFKIFHHELK  629
               F+ +F+ F+ EL+
Sbjct  334  PHEFIVEFERFYDELR  349



>emb|CDJ67755.1| phosphoglucan, water dikinase protein, putative [Eimeria necatrix]
Length=1203

 Score =   110 bits (276),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 75/225 (33%), Positives = 111/225 (49%), Gaps = 44/225 (20%)
 Frame = +3

Query  84   LVEGDKNSQNWWRKLEVVRDLIVENVESTHR--------------------------LEA  185
            LVEGD  + +W  KLE+++ +++     +                            ++A
Sbjct  314  LVEGDAAAPSWGAKLELLKSVLLSAAPLSSSSSSSSSSSSSSSSSLSRAPAELLVSVIDA  373

Query  186  LTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERIL---GRKDATLQEILV  356
            + ++ IY + +    I C EDG H RPNRH+ ++R +   LE +L   G +   L  +L 
Sbjct  374  VCFAGIYSELLQQRIIICEEDGKHFRPNRHSNLAREVSVHLELLLHALGSRSDDLAAVLR  433

Query  357  IRKIHPCLPS--FKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL  530
            +           F A F A+ PLTRIR IAHRNDI  +LK+EIK+ IQNKLHR AGPEDL
Sbjct  434  LLLRLLLPSLPSFAAAFRAAQPLTRIRSIAHRNDISLELKKEIKNKIQNKLHRCAGPEDL  493

Query  531  VATELMLERI-------------TKNPGEYSEAFVEQFKIFHHEL  626
              T  +L+R+              +   + SE FV + ++F  EL
Sbjct  494  ETTRQLLQRVHQQQQQQQQQQQQQQQQQQVSEGFVRELELFFEEL  538



>ref|XP_007513823.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16348.1| predicted protein [Bathycoccus prasinos]
Length=1449

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 70/232 (30%), Positives = 110/232 (47%), Gaps = 33/232 (14%)
 Frame = +3

Query  30   MEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYL  209
            + + R  D S      +++   D  +  W  KLE V+ ++  NV      E L  +A YL
Sbjct  349  IRRKRIIDESKFTPSVVRVANVDTMNSKWHLKLESVKGIVGFNVPELDD-EKLATAATYL  407

Query  210  KWINTGQIPCF-----------EDGGHHRPNRHAEI-SRLIFCELERILGR-----KDAT  338
            +W++ G I C            E+   +   R A I +R IF  +E++ G      +  T
Sbjct  408  RWVSAGTIECTHPEGAIPRNETENAEEYNEKRRAAIEARSIFASVEKVEGETYQFGQKLT  467

Query  339  LQEILVIRKIHPCLPSFKAEFTASVPLTRIRDIA--------HRNDIPHDLKQEIKHTIQ  494
              E  ++R I+P LPSF A F    PLT+IRD+         H++ +P  LK E+KH+I+
Sbjct  468  TSEASLVRHINPWLPSFDARFAPMAPLTKIRDLCNAVENDDEHKDAVPEWLKTEVKHSIE  527

Query  495  NKLHRNAGPEDLVATELMLERITK--NPGEYSEA-----FVEQFKIFHHELK  629
              L +N   + L AT  +L+++ +  N  E  EA     FV+    F+ ELK
Sbjct  528  GNLLKNFDADALTATRRILDKVRRLNNTDENEEASINESFVDDLNAFYVELK  579



>ref|XP_006596061.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Glycine max]
Length=76

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +3

Query  546  MLERITKNPGEYSEAFVEQFKIFHHELKD  632
            ML +ITKNPGEYSE F+++FKIFH ELKD
Sbjct  1    MLAKITKNPGEYSEPFLKEFKIFHQELKD  29



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 906702465875