BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS082C06

Length=616
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAL91170.1|  phenylalanine ammonia-lyase 3                          180   3e-52   Cynara cardunculus var. scolymus [artichoke]
emb|CAA33500.1|  unnamed protein product                                175   5e-52   Petroselinum crispum
ref|XP_009759945.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     182   6e-50   Nicotiana sylvestris
gb|KGN48166.1|  hypothetical protein Csa_6G446280                       170   1e-49   Cucumis sativus [cucumbers]
ref|XP_009596642.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     181   2e-49   Nicotiana tomentosiformis
sp|P45728.1|PAL2_PETCR  RecName: Full=Phenylalanine ammonia-lyase 2     181   2e-49   Petroselinum crispum
gb|ACF94719.1|  phenylalanine ammonia lyase                             171   3e-49   Robinia pseudoacacia [black locust]
emb|CAL91169.1|  phenylalanine ammonia-lyase 3                          180   4e-49   Cynara cardunculus var. scolymus [artichoke]
ref|XP_011077338.1|  PREDICTED: phenylalanine ammonia-lyase             180   4e-49   Sesamum indicum [beniseed]
ref|XP_009794410.1|  PREDICTED: phenylalanine ammonia-lyase-like        179   6e-49   Nicotiana sylvestris
ref|XP_010262867.1|  PREDICTED: phenylalanine ammonia-lyase             179   6e-49   Nelumbo nucifera [Indian lotus]
sp|P24481.1|PAL1_PETCR  RecName: Full=Phenylalanine ammonia-lyase 1     178   1e-48   Petroselinum crispum
pdb|1W27|A  Chain A, Phenylalanine Ammonia-Lyase (Pal) From Petro...    178   2e-48   Petroselinum crispum
ref|XP_004239660.1|  PREDICTED: phenylalanine ammonia-lyase-like        178   2e-48   
emb|CDO99754.1|  unnamed protein product                                178   2e-48   Coffea canephora [robusta coffee]
gb|AAK15640.1|AF326116_1  phenylalanine ammonia-lyase                   178   2e-48   Agastache rugosa
sp|O23924.1|PALY_DIGLA  RecName: Full=Phenylalanine ammonia-lyase       178   2e-48   Digitalis lanata [Grecian foxglove]
gb|AEL21616.1|  phenylalanine ammonia lyase 1                           178   2e-48   Coffea arabica [arabica coffee]
gb|AFP49806.1|  phenylalanine ammonialyase 1                            178   2e-48   Coffea arabica [arabica coffee]
sp|O04058.2|PALY_HELAN  RecName: Full=Phenylalanine ammonia-lyase       177   3e-48   Helianthus annuus
gb|AJO53272.1|  phenylalanine ammonia-lyase                             177   3e-48   Pogostemon cablin
emb|CBJ23826.1|  phenylalanine ammonia-lyase                            177   3e-48   Melissa officinalis [sweet balm]
ref|XP_006424536.1|  hypothetical protein CICLE_v10029946mg             166   3e-48   
gb|AIB06732.1|  phenylalanine ammonia lyase                             177   5e-48   Mangifera indica
gb|AFZ94859.1|  phenylalanine ammonia-lyase                             177   5e-48   Plectranthus scutellarioides
gb|AAL55242.1|AF299330_1  phenylalanine ammonia-lyase                   177   6e-48   Lactuca sativa [cultivated lettuce]
gb|AHZ31605.1|  phenylalanine ammonia-lyase                             176   7e-48   Olea europaea
gb|ABD73282.1|  phenylalanine ammonia-lyase                             176   1e-47   Salvia miltiorrhiza [Chinese salvia]
ref|XP_006345786.1|  PREDICTED: phenylalanine ammonia-lyase-like        176   1e-47   Solanum tuberosum [potatoes]
gb|KJB16792.1|  hypothetical protein B456_002G248000                    176   1e-47   Gossypium raimondii
gb|AEW25915.1|  phenylalanine ammonia-lyase                             164   1e-47   Medicago falcata [sickle alfalfa]
gb|AER12109.1|  PAL                                                     176   1e-47   Gossypium hirsutum [American cotton]
gb|AAK84225.1|AF401636_1  phenylalanine ammonia-lyase                   176   1e-47   Rehmannia glutinosa [Chinese foxglove]
sp|P45732.1|PALY_STYHU  RecName: Full=Phenylalanine ammonia-lyase       176   1e-47   Stylosanthes humilis [alfafinha do nordeste]
gb|ACS71953.1|  phenylalanine ammonia-lyase                             176   1e-47   Euphorbia pulcherrima
gb|ACM44926.1|  phenylalanine ammonia-lyase                             176   2e-47   Euphorbia pulcherrima
ref|XP_011094662.1|  PREDICTED: phenylalanine ammonia-lyase             176   2e-47   Sesamum indicum [beniseed]
gb|ABR14606.1|  phenylalanine ammonia-lyase                             175   2e-47   Salvia miltiorrhiza [Chinese salvia]
gb|AAN32866.1|AF460203_1  phenylalanine ammonia-lyase 1                 175   2e-47   Coffea canephora [robusta coffee]
gb|ABL14040.1|  phenylalanine ammonia lyase                             168   2e-47   Astragalus mongholicus
gb|AFK43896.1|  unknown                                                 171   2e-47   Medicago truncatula
gb|AAV98199.1|  phenylalanine ammonialyase 1                            175   2e-47   Petunia x hybrida [garden petunia]
sp|Q01861.1|PAL1_PEA  RecName: Full=Phenylalanine ammonia-lyase 1       175   3e-47   Pisum sativum [garden pea]
prf||2001451A  Phe ammonia lyase                                        175   3e-47
gb|AEC11891.1|  PAL1                                                    175   3e-47   Petunia exserta
ref|XP_007009873.1|  Phenylalanine ammonia-lyase 2                      175   3e-47   
ref|XP_004173741.1|  PREDICTED: phenylalanine ammonia-lyase-like        163   3e-47   
gb|AAZ29733.1|  phenylalanine ammonia lyase                             175   3e-47   Trifolium pratense [peavine clover]
ref|XP_008449236.1|  PREDICTED: phenylalanine ammonia-lyase-like        175   3e-47   Cucumis melo [Oriental melon]
ref|XP_004173742.1|  PREDICTED: phenylalanine ammonia-lyase-like        163   3e-47   
dbj|BAE71252.1|  putative phenylalanine ammonia lyase                   174   3e-47   Trifolium pratense [peavine clover]
gb|ABL14039.1|  phenylalanine ammonia lyase                             167   3e-47   Astragalus mongholicus
gb|AGH13333.1|  phenylalanine ammonia-lyase                             174   4e-47   Rhus chinensis
gb|ACM62741.1|  phenylalanine ammonia-lyase                             174   4e-47   Garcinia mangostana [mangosteen]
gb|AEW25919.1|  phenylalanine ammonia-lyase                             162   4e-47   Medicago sativa subsp. caerulea
gb|AEM63671.1|  phenylalanine ammonia lyase 2                           174   4e-47   Platycodon grandiflorus [balloon-flower]
gb|ADN32768.1|  phenylalanine ammonia-lyase 2                           174   4e-47   Scutellaria baicalensis [Baikal skullcap]
gb|AAX84839.1|  phenylalanine ammonia-lyase                             174   4e-47   Astragalus mongholicus
gb|AEW25886.1|  phenylalanine ammonia-lyase                             162   4e-47   Medicago sativa subsp. x varia
gb|AEW25882.1|  phenylalanine ammonia-lyase                             162   5e-47   Medicago falcata [sickle alfalfa]
gb|AEW25889.1|  phenylalanine ammonia-lyase                             162   5e-47   Medicago sativa subsp. x varia
gb|AEW25884.1|  phenylalanine ammonia-lyase                             162   5e-47   Medicago sativa subsp. x varia
gb|AEW25883.1|  phenylalanine ammonia-lyase                             162   6e-47   Medicago sativa subsp. caerulea
ref|XP_009606373.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     174   6e-47   Nicotiana tomentosiformis
ref|XP_004246650.1|  PREDICTED: phenylalanine ammonia-lyase-like        174   6e-47   
gb|AEW25888.1|  phenylalanine ammonia-lyase                             162   6e-47   Medicago sativa subsp. caerulea
gb|AGW27206.1|  phenylalanine ammonia-lyase 3                           174   6e-47   Salvia miltiorrhiza [Chinese salvia]
sp|P26600.1|PAL5_SOLLC  RecName: Full=Phenylalanine ammonia-lyase...    174   6e-47   Solanum lycopersicum
ref|XP_004246649.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    174   6e-47   Solanum lycopersicum
gb|KHG04887.1|  Phenylalanine ammonia-lyase                             174   7e-47   Gossypium arboreum [tree cotton]
gb|AID51445.1|  phenylalanine ammonia-lyase 2                           174   8e-47   Astragalus membranaceus
gb|AJO53274.1|  phenylalanine ammonia-lyase                             174   8e-47   Pogostemon cablin
ref|XP_004246651.1|  PREDICTED: phenylalanine ammonia-lyase             173   8e-47   
ref|XP_003521397.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      173   9e-47   
gb|AEW25885.1|  phenylalanine ammonia-lyase                             161   1e-46   Medicago sativa subsp. caerulea
gb|KHG18863.1|  Phenylalanine ammonia-lyase                             173   1e-46   Gossypium arboreum [tree cotton]
ref|XP_010253912.1|  PREDICTED: phenylalanine ammonia-lyase             173   1e-46   Nelumbo nucifera [Indian lotus]
gb|AFP24940.1|  phenylalanine ammonia lyase                             173   1e-46   Prunus salicina [Japanese plum]
sp|O64963.1|PAL1_PRUAV  RecName: Full=Phenylalanine ammonia-lyase 1     173   1e-46   Prunus avium [gean]
ref|XP_010662173.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      163   1e-46   Vitis vinifera
gb|AIY26016.1|  PAL                                                     173   1e-46   Jasminum sambac [Arabian jasmine]
dbj|BAA95629.1|  phenylalanine ammonia lyase                            173   1e-46   Catharanthus roseus [chatas]
gb|KJB36583.1|  hypothetical protein B456_006G166000                    173   1e-46   Gossypium raimondii
sp|P27991.1|PAL1_SOYBN  RecName: Full=Phenylalanine ammonia-lyase 1     173   1e-46   Glycine max [soybeans]
ref|XP_004143259.1|  PREDICTED: phenylalanine ammonia-lyase-like        173   1e-46   
ref|XP_007162754.1|  hypothetical protein PHAVU_001G1777001g            169   1e-46   Phaseolus vulgaris [French bean]
gb|EYU38541.1|  hypothetical protein MIMGU_mgv1a001582mg                173   2e-46   Erythranthe guttata [common monkey flower]
ref|XP_004143258.1|  PREDICTED: phenylalanine ammonia-lyase-like        172   2e-46   Cucumis sativus [cucumbers]
ref|NP_001236956.1|  phenylalanine ammonia-lyase 2                      172   2e-46   
gb|ABI93975.1|  putative phenylalanine ammonia-lyase                    171   2e-46   Rhizophora mangle
gb|AAF40224.1|AF237955_1  phenylalanine ammonia-lyase 2                 172   2e-46   Rubus idaeus [European raspberry]
emb|CAA44817.1|  phenylalanine ammonia-lyase                            161   2e-46   Solanum tuberosum [potatoes]
sp|P45730.1|PALY_POPTR  RecName: Full=Phenylalanine ammonia-lyase       172   3e-46   Populus trichocarpa [western balsam poplar]
ref|XP_003521396.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      172   3e-46   
gb|ABQ63094.1|  phenylalanine ammonia-lyase                             172   3e-46   Astragalus membranaceus
gb|AFR41032.1|  phenylalanine ammonia-lyase                             160   3e-46   Populus alba [abele]
gb|AFR41033.1|  phenylalanine ammonia-lyase                             160   3e-46   Populus alba [abele]
gb|AHJ60264.1|  phenylalanine ammonia-lyase 1                           172   3e-46   Ipomoea purpurea
ref|XP_003554382.1|  PREDICTED: phenylalanine ammonia-lyase 1-lik...    172   4e-46   
ref|XP_007208432.1|  hypothetical protein PRUPE_ppa002099mg             172   4e-46   Prunus persica
gb|AFR41030.1|  phenylalanine ammonia-lyase                             160   4e-46   Populus alba [abele]
gb|ABD42947.1|  phenylalanine ammonia lyase                             172   4e-46   Acacia auriculiformis x Acacia mangium
emb|CBI31445.3|  unnamed protein product                                171   4e-46   Vitis vinifera
emb|CAA44609.1|  phenylalanine ammonia-lyase                            163   4e-46   Arabidopsis thaliana [mouse-ear cress]
gb|AFR41029.1|  phenylalanine ammonia-lyase                             160   4e-46   Populus alba [abele]
ref|XP_004497516.1|  PREDICTED: phenylalanine ammonia-lyase-like        171   4e-46   Cicer arietinum [garbanzo]
ref|XP_008243955.1|  PREDICTED: phenylalanine ammonia-lyase 1           171   5e-46   Prunus mume [ume]
gb|AEW25903.1|  phenylalanine ammonia-lyase                             159   5e-46   Medicago falcata [sickle alfalfa]
gb|AEW25890.1|  phenylalanine ammonia-lyase                             159   5e-46   Medicago sativa subsp. caerulea
ref|XP_003590471.1|  Phenylalanine ammonia-lyase                        171   5e-46   Medicago truncatula
ref|XP_003542541.1|  PREDICTED: phenylalanine ammonia-lyase class...    171   5e-46   
gb|AIL23235.1|  phenylalanine ammonia-lyase                             171   6e-46   Astragalus chrysochlorus
ref|XP_006407580.1|  hypothetical protein EUTSA_v10020168mg             171   6e-46   Eutrema salsugineum [saltwater cress]
ref|XP_006407581.1|  hypothetical protein EUTSA_v10020168mg             171   7e-46   Eutrema salsugineum [saltwater cress]
ref|XP_010658395.1|  PREDICTED: phenylalanine ammonia-lyase G1          171   7e-46   Vitis vinifera
gb|ACF94716.1|  phenylalanine ammonia lyase                             171   7e-46   Robinia pseudoacacia [black locust]
ref|XP_007027354.1|  PHE ammonia lyase 1                                171   8e-46   Theobroma cacao [chocolate]
gb|AEW25894.1|  phenylalanine ammonia-lyase                             159   8e-46   Medicago sativa subsp. x varia
gb|AAW51923.2|  phenylalanine ammonia-lyase 2                           171   8e-46   Rhizophora mangle
ref|XP_002322884.2|  phenylalanine ammonia-lyase family protein         171   8e-46   Populus trichocarpa [western balsam poplar]
ref|XP_008449238.1|  PREDICTED: phenylalanine ammonia-lyase             171   8e-46   Cucumis melo [Oriental melon]
gb|AEV53411.1|  phenylalanine ammonia-lyase 3                           171   9e-46   Populus tomentosa [Chinese white poplar]
ref|XP_009781653.1|  PREDICTED: phenylalanine ammonia-lyase             171   1e-45   Nicotiana sylvestris
sp|P45733.1|PAL3_TOBAC  RecName: Full=Phenylalanine ammonia-lyase       171   1e-45   Nicotiana tabacum [American tobacco]
dbj|BAC56977.1|  phenylalanine ammonia-lyase                            171   1e-45   Daucus carota [carrots]
emb|CDY13306.1|  BnaC06g14510D                                          161   1e-45   Brassica napus [oilseed rape]
gb|AEW25906.1|  phenylalanine ammonia-lyase                             159   1e-45   Medicago falcata [sickle alfalfa]
ref|XP_004304440.1|  PREDICTED: phenylalanine ammonia-lyase 1           170   1e-45   Fragaria vesca subsp. vesca
gb|AGT63063.1|  phenylalanine ammonia-lyase                             170   1e-45   Solanum tuberosum [potatoes]
gb|ABN79671.2|  phenylalanine ammonia-lyase                             170   1e-45   Rudbeckia hirta
ref|XP_010112228.1|  Phenylalanine ammonia-lyase                        170   1e-45   
gb|KDP44384.1|  hypothetical protein JCGZ_20064                         170   1e-45   Jatropha curcas
ref|XP_006354336.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    170   1e-45   
ref|XP_008449237.1|  PREDICTED: phenylalanine ammonia-lyase-like        170   2e-45   Cucumis melo [Oriental melon]
ref|XP_004143356.1|  PREDICTED: phenylalanine ammonia-lyase-like        170   2e-45   
ref|XP_006354337.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    170   2e-45   Solanum tuberosum [potatoes]
gb|KGN48164.1|  hypothetical protein Csa_6G445770                       170   2e-45   Cucumis sativus [cucumbers]
gb|ACT53399.1|  phenylalanine ammonia-lyase 2                           170   2e-45   Ageratina adenophora
ref|XP_004493977.1|  PREDICTED: phenylalanine ammonia-lyase-like        170   2e-45   Cicer arietinum [garbanzo]
gb|ACR56688.1|  phenylalanine ammonia-lyase                             169   2e-45   Scutellaria viscidula [zhan mao huang qin]
ref|XP_010325983.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    169   2e-45   
gb|ADN32767.1|  phenylalanine ammonia-lyase 1                           169   2e-45   Scutellaria baicalensis [Baikal skullcap]
gb|AAK60274.1|AF383151_1  phenylalanine ammonia-lyase 1                 169   2e-45   Manihot esculenta [manioc]
dbj|BAF36976.1|  phenylalanine ammonia-lyase                            169   2e-45   Lotus japonicus
dbj|BAO01110.1|  phenylalanine ammonia-lyase                            169   3e-45   Vigna radiata [mung bean]
gb|AIA66448.1|  PAL1                                                    169   3e-45   Capsicum annuum
gb|ACF17667.1|  putative phenylalanine ammonia-lyase                    169   3e-45   Capsicum annuum
ref|XP_009766905.1|  PREDICTED: phenylalanine ammonia-lyase             169   3e-45   Nicotiana sylvestris
gb|AAK62030.1|  phenylalanine ammonia-lyase 1                           169   3e-45   Manihot esculenta [manioc]
ref|XP_010543544.1|  PREDICTED: phenylalanine ammonia-lyase 4           169   3e-45   Tarenaya hassleriana [spider flower]
gb|AHZ30594.1|  phenylalanine ammonia lyase-2                           169   3e-45   Prunus domestica
ref|XP_004173912.1|  PREDICTED: phenylalanine ammonia-lyase-like        161   4e-45   
gb|AFR41018.1|  phenylalanine ammonia-lyase                             157   4e-45   Populus trichocarpa [western balsam poplar]
sp|P45729.1|PAL3_PETCR  RecName: Full=Phenylalanine ammonia-lyase 3     169   4e-45   Petroselinum crispum
gb|AEH02821.1|  phenylalanine ammonia lyase                             169   4e-45   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|KEH24018.1|  phenylalanine ammonia-lyase-like protein                169   4e-45   Medicago truncatula
sp|P35513.2|PAL2_TOBAC  RecName: Full=Phenylalanine ammonia-lyase       169   4e-45   Nicotiana tabacum [American tobacco]
gb|KJB46525.1|  hypothetical protein B456_007G373600                    169   5e-45   Gossypium raimondii
emb|CDY18463.1|  BnaA04g21240D                                          161   5e-45   Brassica napus [oilseed rape]
gb|AEJ88223.1|  phenylalanine ammonia lyase                             169   5e-45   Prunus persica
ref|XP_009146849.1|  PREDICTED: phenylalanine ammonia-lyase 4           168   5e-45   Brassica rapa
gb|ACT32033.1|  phenylalanine ammonia-lyase                             168   5e-45   Glycine soja [wild soybean]
ref|XP_009625397.1|  PREDICTED: phenylalanine ammonia-lyase             168   5e-45   Nicotiana tomentosiformis
gb|ABI33979.1|  phenylalanine ammonia lyase                             168   6e-45   Jatropha curcas
gb|KGN48161.1|  hypothetical protein Csa_6G445740                       167   6e-45   Cucumis sativus [cucumbers]
gb|KDP29132.1|  hypothetical protein JCGZ_16521                         168   6e-45   Jatropha curcas
dbj|BAG31930.1|  phenylalanine ammonia-lyase                            168   6e-45   Daucus carota [carrots]
gb|AAG49585.1|AF325496_1  phenylalanine ammonia-lyase                   168   6e-45   Ipomoea nil [qian niu]
gb|KGN48162.1|  hypothetical protein Csa_6G445750                       168   6e-45   Cucumis sativus [cucumbers]
ref|XP_011010447.1|  PREDICTED: phenylalanine ammonia-lyase             168   7e-45   Populus euphratica
ref|XP_008449239.1|  PREDICTED: phenylalanine ammonia-lyase-like        168   7e-45   Cucumis melo [Oriental melon]
emb|CDY08611.1|  BnaA05g28470D                                          168   7e-45   Brassica napus [oilseed rape]
dbj|BAJ17655.1|  phenylalanine ammonia lyase                            168   7e-45   Gynura bicolor
emb|CDY00922.1|  BnaC05g42780D                                          168   7e-45   
gb|KHG30005.1|  Phenylalanine ammonia-lyase                             168   8e-45   Gossypium arboreum [tree cotton]
gb|AFR41042.1|  phenylalanine ammonia-lyase                             157   8e-45   Populus fremontii
gb|ABG75910.1|  phenylalanine ammonia-lyase 1                           168   8e-45   Nicotiana attenuata
gb|KGN52975.1|  hypothetical protein Csa_4G008780                       167   8e-45   Cucumis sativus [cucumbers]
gb|ABG75911.1|  phenylalanine ammonia-lyase 2                           168   9e-45   Nicotiana attenuata
gb|KHG29664.1|  Phenylalanine ammonia-lyase                             168   9e-45   Gossypium arboreum [tree cotton]
ref|XP_007162756.1|  hypothetical protein PHAVU_001G177800g             167   1e-44   Phaseolus vulgaris [French bean]
gb|KEH24019.1|  phenylalanine ammonia-lyase-like protein                167   1e-44   Medicago truncatula
sp|P14166.1|PAL1_IPOBA  RecName: Full=Phenylalanine ammonia-lyase       167   1e-44   Ipomoea batatas [batate]
ref|XP_006354339.1|  PREDICTED: phenylalanine ammonia-lyase-like        167   1e-44   Solanum tuberosum [potatoes]
gb|AFF60415.1|  phenylalanine ammonia lyase                             167   1e-44   Pyrus pyrifolia [sha li]
gb|KHG26972.1|  Phenylalanine ammonia-lyase                             167   1e-44   Gossypium arboreum [tree cotton]
gb|ACA30407.1|  phenylalanine ammonia-lyase                             167   1e-44   Stylosanthes guianensis [stylo]
gb|KJB73539.1|  hypothetical protein B456_011G238400                    167   1e-44   Gossypium raimondii
gb|AGV54597.1|  phenylalanine ammonia-lyase                             167   1e-44   Phaseolus vulgaris [French bean]
gb|AHY94892.1|  phenylalanine ammonia lyase                             167   1e-44   Prunella vulgaris
gb|KGN52973.1|  hypothetical protein Csa_4G008760                       164   1e-44   Cucumis sativus [cucumbers]
ref|XP_006364021.1|  PREDICTED: phenylalanine ammonia-lyase-like        167   1e-44   Solanum tuberosum [potatoes]
ref|XP_004156293.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    167   1e-44   
ref|XP_004249558.1|  PREDICTED: phenylalanine ammonia-lyase             167   1e-44   Solanum lycopersicum
ref|XP_004143256.1|  PREDICTED: phenylalanine ammonia-lyase-like        167   1e-44   
prf||2006271A  Phe ammonia lyase                                        167   1e-44
sp|P45734.1|PALY_TRISU  RecName: Full=Phenylalanine ammonia-lyase       167   1e-44   Trifolium subterraneum
ref|XP_006424540.1|  hypothetical protein CICLE_v10027912mg             167   1e-44   Citrus clementina [clementine]
ref|XP_006424538.1|  hypothetical protein CICLE_v10027913mg             167   1e-44   Citrus clementina [clementine]
gb|AGL50914.1|  phenylalanine ammonia lyase                             167   2e-44   Pyrus communis
ref|XP_009342990.1|  PREDICTED: phenylalanine ammonia-lyase 1           167   2e-44   
ref|XP_002531677.1|  Phenylalanine ammonia-lyase, putative              167   2e-44   Ricinus communis
ref|XP_004246652.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    167   2e-44   
emb|CDY66761.1|  BnaCnng52250D                                          166   2e-44   Brassica napus [oilseed rape]
emb|CDX74991.1|  BnaA05g07370D                                          163   2e-44   
gb|AAZ29734.1|  phenylalanine ammonia lyase                             167   2e-44   Trifolium pratense [peavine clover]
sp|O23865.1|PAL1_DAUCA  RecName: Full=Phenylalanine ammonia-lyase 1     167   2e-44   Daucus carota [carrots]
gb|AFP49807.1|  phenylalanine ammonialyase 4                            167   2e-44   Coffea arabica [arabica coffee]
gb|AEO92029.1|  phenylalanine ammonia-lyase 3                           167   2e-44   Coffea canephora [robusta coffee]
gb|AFN85669.1|  phenylalanine ammonia-lyase                             167   2e-44   Hibiscus cannabinus [bimli-jute]
ref|XP_008387584.1|  PREDICTED: phenylalanine ammonia-lyase 1           167   2e-44   
gb|AFG30054.1|  phenylalanine ammonialyase                              167   2e-44   Malus hybrid cultivar
gb|ADO64252.1|  PAL                                                     166   2e-44   Epimedium sagittatum
gb|AFR41020.1|  phenylalanine ammonia-lyase                             155   2e-44   Populus trichocarpa [western balsam poplar]
gb|KJB62426.1|  hypothetical protein B456_009G416300                    167   2e-44   Gossypium raimondii
gb|AAQ74878.1|  phenylalanine ammonia lyase                             166   2e-44   Populus trichocarpa x Populus deltoides
gb|AAZ29732.1|  phenylalanine ammonia lyase                             166   3e-44   Trifolium pratense [peavine clover]
ref|XP_002315308.1|  phenylalanine ammonia-lyase family protein         166   3e-44   Populus trichocarpa [western balsam poplar]
gb|ACC63889.1|  phenylalanine ammonia-lyase                             166   3e-44   Populus trichocarpa [western balsam poplar]
emb|CDX91331.1|  BnaC04g08190D                                          162   3e-44   
ref|XP_004143257.1|  PREDICTED: phenylalanine ammonia-lyase-like        166   3e-44   
ref|XP_006354338.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    166   3e-44   Solanum tuberosum [potatoes]
gb|AJR20994.1|  phenylalanine ammonia-lyase                             166   3e-44   Populus szechuanica
gb|AIA24411.1|  phenylalanine ammonia-lyase                             166   3e-44   Sinopodophyllum hexandrum [Himalayan mayapple]
ref|XP_011041025.1|  PREDICTED: phenylalanine ammonia-lyase G2B         166   4e-44   Populus euphratica
ref|XP_008454137.1|  PREDICTED: phenylalanine ammonia-lyase-like        166   4e-44   Cucumis melo [Oriental melon]
ref|XP_007144370.1|  hypothetical protein PHAVU_007G150500g             166   4e-44   Phaseolus vulgaris [French bean]
sp|P45726.1|PALY_CAMSI  RecName: Full=Phenylalanine ammonia-lyase       166   4e-44   Camellia sinensis [black tea]
ref|XP_010553331.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      166   5e-44   Tarenaya hassleriana [spider flower]
gb|KFK38414.1|  hypothetical protein AALP_AA3G110100                    166   5e-44   Arabis alpina [alpine rockcress]
gb|AFR41056.1|  phenylalanine ammonia-lyase                             154   5e-44   Populus nigra [black poplar]
gb|KFK38413.1|  hypothetical protein AALP_AA3G110100                    166   5e-44   Arabis alpina [alpine rockcress]
dbj|BAA31258.1|  phenylalanine ammonia-lyase                            160   5e-44   Vitis vinifera
ref|XP_010482945.1|  PREDICTED: phenylalanine ammonia-lyase 4-like      166   5e-44   Camelina sativa [gold-of-pleasure]
ref|XP_009629066.1|  PREDICTED: phenylalanine ammonia-lyase             166   5e-44   Nicotiana tomentosiformis
gb|AAN52280.1|AF480620_1  phenylalanine ammonia-lyase                   166   5e-44   Populus tremuloides
gb|AAW78932.1|  phenylalanine-ammonia lyase                             166   5e-44   Rhodiola sachalinensis
ref|XP_006436446.1|  hypothetical protein CICLE_v10030821mg             166   5e-44   Citrus clementina [clementine]
ref|XP_008454139.1|  PREDICTED: phenylalanine ammonia-lyase-like        166   6e-44   Cucumis melo [Oriental melon]
sp|Q42667.1|PALY_CITLI  RecName: Full=Phenylalanine ammonia-lyase       166   6e-44   Citrus limon [lemon]
gb|AFZ78651.1|  phenylalanine ammonia-lyase                             165   6e-44   Populus tomentosa [Chinese white poplar]
ref|XP_010107520.1|  Phenylalanine ammonia-lyase                        166   6e-44   Morus notabilis
gb|AAO13347.1|  phenylalanine ammonia-lyase2                            165   6e-44   Lactuca sativa [cultivated lettuce]
gb|KGN52974.1|  hypothetical protein Csa_4G008770                       165   7e-44   Cucumis sativus [cucumbers]
dbj|BAL49995.1|  phenylalanine ammonia-lyase                            165   7e-44   Eucalyptus robusta [swamp messmate]
ref|XP_008449240.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      165   7e-44   Cucumis melo [Oriental melon]
gb|AAZ29735.1|  phenylalanine ammonia lyase                             165   7e-44   Trifolium pratense [peavine clover]
gb|KDO46246.1|  hypothetical protein CISIN_1g004955mg                   165   7e-44   Citrus sinensis [apfelsine]
gb|AEE81750.1|  phenylalanine ammonia lyase                             165   7e-44   Morus alba var. multicaulis
ref|XP_010528074.1|  PREDICTED: phenylalanine ammonia-lyase 1           165   7e-44   Tarenaya hassleriana [spider flower]
gb|AAU08174.1|  phenylalanine ammonia-lyase                             165   8e-44   Camellia sinensis [black tea]
ref|XP_008233304.1|  PREDICTED: phenylalanine ammonia-lyase 1           165   8e-44   Prunus mume [ume]
gb|ABF50788.1|  phenylalanine ammonia-lyase                             165   9e-44   Isatis tinctoria [woad]
ref|XP_008454138.1|  PREDICTED: phenylalanine ammonia-lyase-like        165   9e-44   Cucumis melo [Oriental melon]
gb|AID16077.1|  phenylalanine ammonium lyase                            165   9e-44   Morus alba
ref|XP_011041027.1|  PREDICTED: phenylalanine ammonia-lyase G2B-l...    165   1e-43   Populus euphratica
ref|XP_010107518.1|  Phenylalanine ammonia-lyase                        165   1e-43   
gb|AER58180.1|  phenylalanine ammonia lyase                             165   1e-43   Cucumis sativus [cucumbers]
emb|CAA59217.1|  phenylalanine ammonia-lyase                            154   1e-43   Arabidopsis thaliana [mouse-ear cress]
gb|AEZ67457.1|  phenylalanine ammonia-lyase                             165   1e-43   Perilla frutescens [beefsteak-mint]
ref|XP_004152155.1|  PREDICTED: phenylalanine ammonia-lyase-like        165   1e-43   
ref|XP_006364022.1|  PREDICTED: phenylalanine ammonia-lyase-like        165   1e-43   Solanum tuberosum [potatoes]
emb|CDX67566.1|  BnaA07g16060D                                          163   1e-43   
ref|XP_006410883.1|  hypothetical protein EUTSA_v10016314mg             165   1e-43   Eutrema salsugineum [saltwater cress]
sp|Q43052.1|PAL2_POPKI  RecName: Full=Phenylalanine ammonia-lyase...    164   1e-43   Populus sieboldii x Populus grandidentata
ref|XP_010662075.1|  PREDICTED: phenylalanine ammonia-lyase             164   1e-43   Vitis vinifera
gb|AID51446.1|  phenylalanine ammonia-lyase 3                           164   1e-43   Astragalus membranaceus
emb|CDX78161.1|  BnaA09g33560D                                          163   1e-43   
ref|XP_002281799.1|  PREDICTED: phenylalanine ammonia-lyase             164   1e-43   Vitis vinifera
emb|CDX76219.1|  BnaA04g04830D                                          163   1e-43   
ref|XP_006481493.1|  PREDICTED: phenylalanine ammonia-lyase-like        164   1e-43   Citrus sinensis [apfelsine]
gb|AEM63670.1|  phenylalanine ammonia lyase 1                           164   1e-43   Platycodon grandiflorus [balloon-flower]
ref|XP_010529727.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      164   2e-43   Tarenaya hassleriana [spider flower]
gb|ADY02661.1|  phenylalanine ammonia lyase                             164   2e-43   Parrya nudicaulis
sp|Q04593.1|PAL2_PEA  RecName: Full=Phenylalanine ammonia-lyase 2       164   2e-43   Pisum sativum [garden pea]
gb|AGU91428.1|  phenylalanine ammonia-lyase                             164   2e-43   Chrysanthemum boreale
gb|ADY02662.1|  phenylalanine ammonia lyase                             164   2e-43   Parrya nudicaulis
emb|CAN77065.1|  hypothetical protein VITISV_009233                     164   2e-43   Vitis vinifera
gb|AFZ78653.1|  phenylalanine ammonia-lyase                             164   2e-43   Populus tomentosa [Chinese white poplar]
gb|ADY02660.1|  phenylalanine ammonia lyase                             164   2e-43   
ref|XP_002267953.1|  PREDICTED: phenylalanine ammonia-lyase             164   2e-43   
ref|XP_011041026.1|  PREDICTED: phenylalanine ammonia-lyase G2B-l...    164   2e-43   
ref|XP_006428758.1|  hypothetical protein CICLE_v10011134mg             164   2e-43   
ref|XP_008785254.1|  PREDICTED: phenylalanine ammonia-lyase-like        164   2e-43   
ref|XP_003633985.1|  PREDICTED: phenylalanine ammonia-lyase-like        164   2e-43   
gb|KFK36594.1|  hypothetical protein AALP_AA4G144000                    164   2e-43   
gb|ADI40166.1|  phenylalanine ammonia-lyase                             164   2e-43   
gb|AFR41036.1|  phenylalanine ammonia-lyase                             153   2e-43   
ref|XP_009143533.1|  PREDICTED: phenylalanine ammonia-lyase 1           164   3e-43   
ref|XP_009384657.1|  PREDICTED: phenylalanine ammonia-lyase-like        164   3e-43   
ref|XP_004143255.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      164   3e-43   
gb|KHN09507.1|  Phenylalanine ammonia-lyase 1                           163   3e-43   
ref|NP_181241.1|  phenylalanine ammonia-lyase 1                         164   3e-43   
ref|XP_004156289.1|  PREDICTED: phenylalanine ammonia-lyase-like        164   3e-43   
gb|ADN32766.1|  phenylalanine ammonia-lyase                             163   3e-43   
gb|AAC18870.1|  phenylalanine ammonia lyase                             164   3e-43   
ref|XP_006488063.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      163   3e-43   
gb|AEZ01784.1|  phenylalanine ammonia-lyase                             163   3e-43   
gb|ACM61988.1|  phenylalanine ammonia-lyase                             163   3e-43   
ref|NP_187645.1|  phenylalanine ammonia-lyase 4                         163   3e-43   
emb|CDX73567.1|  BnaC08g24360D                                          162   3e-43   
sp|Q9M568.1|PAL1_RUBID  RecName: Full=Phenylalanine ammonia-lyase...    163   3e-43   
gb|ADF59062.1|  phenylalanine ammonia-lyase 2 precursor                 163   4e-43   
gb|ABB70117.2|  phenylalanine ammonia lyase                             163   4e-43   
ref|XP_008366650.1|  PREDICTED: phenylalanine ammonia-lyase 1           163   4e-43   
gb|AGL81344.1|  phenylalanine ammonia lyase                             163   4e-43   
gb|AGY49231.1|  phenylalanine ammonia lyase                             163   4e-43   
gb|AAX22053.1|  phenylalanine ammonia-lyase                             163   4e-43   
ref|XP_002881488.1|  hypothetical protein ARALYDRAFT_482690             163   5e-43   
emb|CBI26455.3|  unnamed protein product                                162   5e-43   
ref|XP_009103852.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      163   5e-43   
ref|XP_004143260.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    162   5e-43   
ref|XP_010509401.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      163   5e-43   
ref|XP_010516949.1|  PREDICTED: phenylalanine ammonia-lyase 1           163   5e-43   
gb|AFR41022.1|  phenylalanine ammonia-lyase                             152   5e-43   
ref|XP_004152158.1|  PREDICTED: phenylalanine ammonia-lyase-like        163   5e-43   
ref|XP_010505261.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      163   5e-43   
gb|ADA81868.1|  phenylalanine ammonia-lyase                             163   5e-43   
gb|AEX32784.1|  phenylalanine ammonia-lyase                             162   6e-43   
ref|XP_002312013.1|  phenylalanine ammonia-lyase family protein         162   6e-43   
ref|XP_008449235.1|  PREDICTED: phenylalanine ammonia-lyase-like        162   6e-43   
ref|XP_003635657.2|  PREDICTED: phenylalanine ammonia-lyase-like        162   6e-43   
gb|AFP86474.1|  phenylalanine ammonia-lyase                             163   6e-43   
gb|KGN48167.1|  hypothetical protein Csa_6G446290                       162   6e-43   
ref|XP_002268732.1|  PREDICTED: phenylalanine ammonia-lyase             162   7e-43   
gb|AFI71896.1|  phenylalanine ammonia-lyase                             162   7e-43   
ref|XP_003633987.1|  PREDICTED: phenylalanine ammonia-lyase-like        162   7e-43   
ref|XP_004234632.2|  PREDICTED: phenylalanine ammonia-lyase             162   7e-43   
gb|AEA72280.1|  phenylalanine ammonia-lyase                             162   7e-43   
gb|AHA42445.1|  phenylalanine ammonia lyase                             161   7e-43   
ref|XP_006403711.1|  hypothetical protein EUTSA_v10010153mg             162   8e-43   
ref|XP_004145752.1|  PREDICTED: phenylalanine ammonia-lyase-like        162   8e-43   
ref|XP_002268181.1|  PREDICTED: phenylalanine ammonia-lyase             162   9e-43   
ref|XP_002519521.1|  Phenylalanine ammonia-lyase, putative              162   9e-43   
ref|XP_009140249.1|  PREDICTED: phenylalanine ammonia-lyase 3           162   1e-42   
gb|AFR41048.1|  phenylalanine ammonia-lyase                             151   1e-42   
gb|AAX22055.1|  phenylalanine ammonia-lyase                             162   1e-42   
ref|XP_011031723.1|  PREDICTED: phenylalanine ammonia-lyase G4          162   1e-42   
emb|CDY15917.1|  BnaA04g11940D                                          162   1e-42   
ref|XP_002268256.1|  PREDICTED: phenylalanine ammonia-lyase             162   1e-42   
gb|ABM67591.1|  phenylalanin ammonia-lyase                              162   1e-42   
ref|XP_003633986.1|  PREDICTED: phenylalanine ammonia-lyase-like        162   1e-42   
gb|ADF59061.1|  phenylalanine ammonia-lyase 1 precursor                 162   1e-42   
emb|CAB42793.1|  phenylalanine-ammonia lyase                            162   1e-42   
gb|AEL21617.1|  phenylalanine ammonia lyase 2                           162   1e-42   
ref|XP_010032174.1|  PREDICTED: phenylalanine ammonia-lyase-like        162   1e-42   
ref|XP_002529414.1|  Phenylalanine ammonia-lyase, putative              162   1e-42   
sp|P19142.1|PAL2_PHAVU  RecName: Full=Phenylalanine ammonia-lyase...    161   2e-42   
gb|ADT63058.1|  phenylalanine ammonia-lyase                             161   2e-42   
gb|ABE03772.1|  phenylalanine ammonia-lyase                             161   2e-42   
ref|XP_011077265.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    161   2e-42   
gb|EYU39613.1|  hypothetical protein MIMGU_mgv1a019971mg                161   2e-42   
gb|AHA42443.1|  phenylalanine ammonia lyase                             161   2e-42   
sp|P31425.1|PAL1_SOLTU  RecName: Full=Phenylalanine ammonia-lyase 1     161   2e-42   
gb|AJO53273.1|  phenylalanine ammonia-lyase                             161   2e-42   
ref|XP_006293761.1|  hypothetical protein CARUB_v10022721mg             161   2e-42   
gb|ADL09136.1|  phenylanlanine ammonia-lyase                            161   2e-42   
dbj|BAF36967.1|  phenylalanine ammonia-lyase                            161   3e-42   
gb|ABY89691.1|  phenylalanine ammonialyase 2 protein                    161   3e-42   
dbj|BAF36971.1|  phenylalanine ammonia-lyase                            161   3e-42   
ref|XP_008355619.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    161   3e-42   
ref|XP_009141625.1|  PREDICTED: phenylalanine ammonia-lyase 1           161   3e-42   
ref|XP_008369679.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      161   3e-42   
gb|ABY89690.1|  phenylalanine ammonialyase 1 protein                    161   3e-42   
gb|ABC69916.1|  phenylalanine ammonia-lyase                             161   3e-42   
gb|AFZ78650.1|  phenylalanine ammonia-lyase                             160   3e-42   
ref|XP_006381441.1|  phenylalanine ammonia-lyase family protein         160   4e-42   
gb|ACE95170.1|  phenylalanine ammonia-lyase                             160   4e-42   
gb|EMT29667.1|  Phenylalanine ammonia-lyase                             154   4e-42   
gb|AFR41023.1|  phenylalanine ammonia-lyase                             149   4e-42   
ref|XP_003556238.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      160   4e-42   
sp|O49836.1|PAL2_LITER  RecName: Full=Phenylalanine ammonia-lyase...    160   5e-42   
ref|XP_006297083.1|  hypothetical protein CARUB_v10013086mg             160   5e-42   
ref|XP_002882662.1|  hypothetical protein ARALYDRAFT_897210             160   5e-42   
gb|ACT53398.1|  phenylalanine ammonia-lyase 1                           160   5e-42   
gb|ABC69917.1|  phenylalanine ammonia-lyase                             160   6e-42   
emb|CAA44818.1|  phenylalanine ammonia-lyase                            150   6e-42   
ref|XP_009116020.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    160   6e-42   
sp|P35511.1|PAL1_SOLLC  RecName: Full=Phenylalanine ammonia-lyase...    160   7e-42   
sp|P27990.1|PALY_MEDSA  RecName: Full=Phenylalanine ammonia-lyase       160   7e-42   
ref|XP_010515816.1|  PREDICTED: phenylalanine ammonia-lyase 2           159   8e-42   
ref|XP_011048535.1|  PREDICTED: phenylalanine ammonia-lyase-like        159   8e-42   
gb|AFR41049.1|  phenylalanine ammonia-lyase                             149   9e-42   
gb|AFU90757.1|  phenylalanine ammonia-lyase                             159   9e-42   
gb|AAK60275.1|AF383152_1  phenylalanine ammonia-lyase 2                 159   1e-41   
emb|CAL91037.1|  phenylalanine ammonia-lyase 1                          159   1e-41   
gb|AEO92028.1|  phenylalanine ammonia-lyase 2                           159   1e-41   
gb|AAR31107.1|  phenylalanine ammonia-lyase                             159   1e-41   
ref|XP_010067315.1|  PREDICTED: phenylalanine ammonia-lyase             159   1e-41   
gb|KCW65428.1|  hypothetical protein EUGRSUZ_G02848                     159   1e-41   
ref|XP_010684079.1|  PREDICTED: phenylalanine ammonia-lyase             159   1e-41   
gb|ACZ36441.1|  phenylalanine ammonialyase                              159   1e-41   
dbj|BAF36970.1|  phenylalanine ammonia-lyase                            159   1e-41   
ref|XP_006290660.1|  hypothetical protein CARUB_v10016752mg             159   2e-41   
gb|AAN52279.1|AF480619_1  phenylalanine ammonia-lyase                   159   2e-41   
ref|XP_002871081.1|  phenyl alanine ammonia-lyase 3                     158   2e-41   
ref|XP_002877909.1|  phenylalanine ammonia-lyase 2                      159   2e-41   
gb|AIC66437.1|  phenylalanine ammonia lyase                             159   2e-41   
gb|AEX32790.1|  phenylalanine ammonia-lyase                             158   2e-41   
gb|EYU34451.1|  hypothetical protein MIMGU_mgv1a002104mg                158   2e-41   
gb|ADD12041.1|  phenylalanine ammonia lyase                             158   2e-41   
gb|ADQ39192.1|  phenylalanine ammonia lyase 6                           158   2e-41   
ref|XP_009373523.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    158   2e-41   
gb|KFK34576.1|  hypothetical protein AALP_AA5G163700                    158   2e-41   
ref|XP_010106883.1|  Phenylalanine ammonia-lyase                        148   2e-41   
ref|XP_002285277.1|  PREDICTED: phenylalanine ammonia-lyase             158   2e-41   
ref|XP_010067316.1|  PREDICTED: phenylalanine ammonia-lyase             158   2e-41   
ref|XP_008463969.1|  PREDICTED: phenylalanine ammonia-lyase-like        158   2e-41   
ref|XP_010504083.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      158   2e-41   
ref|XP_010067317.1|  PREDICTED: phenylalanine ammonia-lyase-like        158   3e-41   
gb|AFR41047.1|  phenylalanine ammonia-lyase                             147   3e-41   
gb|ACR15762.1|  phenylalanine ammonia-lyase                             158   3e-41   
gb|AFR41050.1|  phenylalanine ammonia-lyase                             147   3e-41   
ref|XP_010935894.1|  PREDICTED: phenylalanine ammonia-lyase             158   3e-41   
gb|AEW10551.1|  phenylalanine ammonia lyase                             147   4e-41   
ref|XP_010067318.1|  PREDICTED: phenylalanine ammonia-lyase             157   4e-41   
ref|NP_190894.1|  phenylalanine ammonia-lyase 2                         157   4e-41   
gb|AAC18871.1|  phenylalanine ammonia lyase                             157   5e-41   
gb|KDO50673.1|  hypothetical protein CISIN_1g005031mg                   157   5e-41   
ref|XP_006428759.1|  hypothetical protein CICLE_v10011175mg             157   6e-41   
gb|AGE10590.1|  phenylalanine amononia-lyase                            157   7e-41   
ref|XP_004307376.1|  PREDICTED: phenylalanine ammonia-lyase 1           157   8e-41   
gb|AAA34179.2|  phenylalanine ammonia lyase                             157   8e-41   
dbj|BAA21643.1|  phenylalanine ammonia-lyase                            157   8e-41   
ref|XP_010426963.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      157   8e-41   
gb|ACG56648.1|  phenylalanine ammonia lyase                             156   1e-40   
dbj|BAG70992.1|  phenylalanine ammonia-lyase                            156   1e-40   
gb|ADC34597.1|  phenylalanine ammonia-lyase                             156   1e-40   
gb|ADQ28104.1|  phenylalanine ammonia-lyase                             156   1e-40   
gb|ACG56647.1|  phenylalanine ammonia lyase                             156   1e-40   
ref|XP_009392118.1|  PREDICTED: phenylalanine ammonia-lyase-like        156   1e-40   
gb|AFJ80777.1|  phenylalanine ammonia-lyase                             156   1e-40   
ref|XP_004248441.1|  PREDICTED: phenylalanine ammonia-lyase-like        145   1e-40   
gb|ACT21093.1|  phenylalanine ammonia-lyase                             155   2e-40   
gb|AFR41051.1|  phenylalanine ammonia-lyase                             145   2e-40   
gb|ACT68010.1|  phenylalanine ammonia-lyase                             155   3e-40   
ref|XP_010934327.1|  PREDICTED: phenylalanine ammonia-lyase-like        155   3e-40   
dbj|BAF36968.1|  phenylalanine ammonia-lyase                            155   3e-40   
sp|O49835.1|PAL1_LITER  RecName: Full=Phenylalanine ammonia-lyase...    155   3e-40   
gb|AAM12956.1|  phenylalanine ammonia-lyase                             155   4e-40   
ref|NP_196043.2|  phenylalanine ammonia-lyase 3                         155   4e-40   
ref|NP_001190223.1|  phenylalanine ammonia-lyase 3                      154   5e-40   
dbj|BAM28968.1|  phenylalanine ammonia lyase                            154   5e-40   
ref|XP_003591877.1|  Phenylalanine ammonia-lyase                        154   6e-40   
gb|ACZ44834.1|  phenylalanine ammonia-lyase                             154   7e-40   
ref|XP_006354305.1|  PREDICTED: phenylalanine ammonia-lyase-like        154   8e-40   
emb|CAA89007.1|  phenylalanine ammonia-lyase                            153   9e-40   
ref|XP_010067319.1|  PREDICTED: phenylalanine ammonia-lyase-like        154   1e-39   
gb|AHG06397.1|  phenylalanine ammonia lyase 62                          153   1e-39   
gb|EMT28134.1|  Phenylalanine ammonia-lyase                             153   1e-39   
gb|AHB18375.1|  phenylalanine ammonia-lyase 3                           152   2e-39   
emb|CAB42794.1|  phenylalanine-ammonia lyase                            153   2e-39   
gb|AGE10589.1|  phenylalanine amononia-lyase                            153   2e-39   
dbj|BAF36972.1|  phenylalanine ammonia-lyase                            152   2e-39   
gb|AAA69905.1|  phenylalanine ammonia-lyase                             152   3e-39   
dbj|BAJ88975.1|  predicted protein                                      152   3e-39   
gb|AFG26322.1|  phenylalanine ammonia-lyase                             152   4e-39   
ref|XP_004976241.1|  PREDICTED: phenylalanine ammonia-lyase-like        152   4e-39   
gb|AHG06396.1|  phenylalanine ammonia lyase 2                           152   4e-39   
gb|AGE10591.1|  phenylalanine amononia-lyase                            152   5e-39   
ref|XP_008805217.1|  PREDICTED: phenylalanine ammonia-lyase             152   5e-39   
ref|XP_007143727.1|  hypothetical protein PHAVU_007G096300g             151   7e-39   
ref|XP_010107517.1|  Phenylalanine ammonia-lyase 1                      145   8e-39   
gb|EMT28136.1|  Phenylalanine ammonia-lyase                             151   1e-38   
ref|XP_007220629.1|  hypothetical protein PRUPE_ppa002328mg             150   1e-38   
sp|P31426.1|PAL2_SOLTU  RecName: Full=Phenylalanine ammonia-lyase 2     150   1e-38   
ref|XP_004953157.1|  PREDICTED: phenylalanine ammonia-lyase-like        150   1e-38   
ref|XP_004953154.1|  PREDICTED: phenylalanine ammonia-lyase-like        150   1e-38   
ref|XP_007220630.1|  hypothetical protein PRUPE_ppa002328mg             150   1e-38   
ref|XP_010464706.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    150   1e-38   
ref|NP_001168086.1|  phenylalanine ammonia-lyase                        150   2e-38   
emb|CAN61378.1|  hypothetical protein VITISV_032212                     150   2e-38   
gb|EMT06206.1|  Phenylalanine ammonia-lyase                             150   2e-38   
ref|XP_007016787.1|  PHE ammonia lyase 1                                149   3e-38   
gb|ACZ44833.1|  phenylalanine ammonia-lyase                             149   4e-38   
ref|XP_006589419.1|  PREDICTED: phenylalanine ammonia-lyase 2-lik...    149   4e-38   
gb|AAP34199.1|  phenylalanine ammonia-lyase                             149   4e-38   
ref|NP_001266106.1|  phenylalanine ammonia-lyase 2                      149   5e-38   
gb|KJB62427.1|  hypothetical protein B456_009G416400                    148   6e-38   
ref|XP_010906526.1|  PREDICTED: phenylalanine ammonia-lyase-like        149   7e-38   
ref|XP_004248442.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      139   8e-38   
dbj|BAM28966.1|  phenylalanine ammonia lyase                            148   9e-38   
gb|ADA72014.1|  phenylalanine ammonia-lyase                             148   1e-37   
gb|AFR41017.1|  phenylalanine ammonia-lyase                             138   1e-37   
ref|NP_001047482.1|  Os02g0626400                                       148   1e-37   
ref|XP_008645952.1|  PREDICTED: phenylalanine ammonia-lyase             148   1e-37   
dbj|BAF36974.1|  phenylalanine ammonia-lyase                            148   1e-37   
ref|XP_009401948.1|  PREDICTED: phenylalanine ammonia-lyase-like        148   1e-37   
gb|ACZ51372.1|  phenylalanine ammonia-lyase                             147   2e-37   
gb|EMT07187.1|  Phenylalanine ammonia-lyase                             149   2e-37   
ref|NP_001055608.1|  Os05g0427400                                       147   2e-37   
ref|XP_006647543.1|  PREDICTED: phenylalanine ammonia-lyase-like        147   3e-37   
ref|XP_006652523.1|  PREDICTED: phenylalanine ammonia-lyase-like        147   3e-37   
ref|XP_002315309.2|  hypothetical protein POPTR_0010s23110g             147   3e-37   
ref|XP_002452479.1|  hypothetical protein SORBIDRAFT_04g026560          147   4e-37   
ref|XP_009413725.1|  PREDICTED: phenylalanine ammonia-lyase-like        146   5e-37   
gb|EPS61109.1|  phenylalanine ammonia-lyase                             146   5e-37   
ref|XP_002454200.1|  hypothetical protein SORBIDRAFT_04g026530          146   6e-37   
gb|EEC73636.1|  hypothetical protein OsI_08144                          146   7e-37   
ref|XP_002454199.1|  hypothetical protein SORBIDRAFT_04g026520          146   7e-37   



>emb|CAL91170.1| phenylalanine ammonia-lyase 3 [Cynara cardunculus var. scolymus]
Length=264

 Score =   180 bits (457),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 109/140 (78%), Gaps = 9/140 (6%)
 Frame = +1

Query  196  MENGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATV  375
            MEN NG + NG A  FC+ +        DPLNW  AAEA+ GSHLDEVKRMV E+RK  V
Sbjct  1    MENNNGHV-NGVATDFCINK--------DPLNWGVAAEAMTGSHLDEVKRMVAEFRKPVV  51

Query  376  KLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGF  555
            KLGGETLT++QVA +AA G +  VKVELSEAARAGVKASSDWVM  M  GTDSYGVTTGF
Sbjct  52   KLGGETLTVSQVAGIAAAGDSSVVKVELSEAARAGVKASSDWVMESMSKGTDSYGVTTGF  111

Query  556  GATSHRRTKQGAALQKELIR  615
            GATSHRRTKQG ALQKELIR
Sbjct  112  GATSHRRTKQGGALQKELIR  131



>emb|CAA33500.1| unnamed protein product [Petroselinum crispum]
Length=135

 Score =   175 bits (444),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 112/143 (78%), Gaps = 12/143 (8%)
 Frame = +1

Query  196  MENGNGIISNGHAHG----FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYR  363
            MENGNG  +NGH +G    FC++       + DPL W  AAEA+ GSHLDEVK+MV EYR
Sbjct  1    MENGNGATTNGHVNGNGMDFCMK-------TEDPLYWGIAAEAMTGSHLDEVKKMVAEYR  53

Query  364  KATVKLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGV  543
            K  VKLGGETLTI+QVAA++A+ G+  V VELSEAARAGVKASSDWVM  M  GTDSYGV
Sbjct  54   KPVVKLGGETLTISQVAAISARDGSG-VTVELSEAARAGVKASSDWVMDSMNKGTDSYGV  112

Query  544  TTGFGATSHRRTKQGAALQKELI  612
            TTGFGATSHRRTKQG ALQKELI
Sbjct  113  TTGFGATSHRRTKQGGALQKELI  135



>ref|XP_009759945.1| PREDICTED: phenylalanine ammonia-lyase G4-like [Nicotiana sylvestris]
Length=718

 Score =   182 bits (462),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 115/142 (81%), Gaps = 8/142 (6%)
 Frame = +1

Query  196  MENGNGIISNGH--AHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKA  369
            ME  NG   NGH  +  FC+    +     DPLNWN AA+ALKGSHLDEVK+MVEE+RK 
Sbjct  1    MEYANGN-CNGHNASQEFCI----KGHEQQDPLNWNMAADALKGSHLDEVKKMVEEFRKP  55

Query  370  TVKLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTT  549
             V+LGGETLTI QVAA+A + GT EV VEL+EAARAGVKASSDWV+ GM+NGTDSYGVTT
Sbjct  56   VVRLGGETLTIGQVAAIAGRSGT-EVMVELAEAARAGVKASSDWVIEGMKNGTDSYGVTT  114

Query  550  GFGATSHRRTKQGAALQKELIR  615
            GFGATSHRRTKQGAALQKELIR
Sbjct  115  GFGATSHRRTKQGAALQKELIR  136



>gb|KGN48166.1| hypothetical protein Csa_6G446280 [Cucumis sativus]
Length=166

 Score =   170 bits (431),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 100/116 (86%), Gaps = 2/116 (2%)
 Frame = +1

Query  268  SSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEV  447
            S +HDPLNW  AAE+LKGSHLDEVKRMVEEYR+  VKLGGETLTI+QVAA+A +    +V
Sbjct  10   SFTHDPLNWGVAAESLKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVAAIATRDF--DV  67

Query  448  KVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIR  615
             VELSE+ARAGVKASSDWVM  M+ GTDSYGVTTGFGATSHRRTK G ALQKELIR
Sbjct  68   TVELSESARAGVKASSDWVMESMKKGTDSYGVTTGFGATSHRRTKNGGALQKELIR  123



>ref|XP_009596642.1| PREDICTED: phenylalanine ammonia-lyase G4-like [Nicotiana tomentosiformis]
Length=719

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 116/143 (81%), Gaps = 9/143 (6%)
 Frame = +1

Query  196  MENGNGIISNGH---AHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRK  366
            ME  NG   NGH   +   C+    + +   DPLNWN AA+ALKGSHLDEVK+MVEE+RK
Sbjct  1    MEYANGN-CNGHNNASQELCI----KGNEQQDPLNWNMAADALKGSHLDEVKKMVEEFRK  55

Query  367  ATVKLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVT  546
              V+LGGETLTIAQVAA+A + GT EV VEL+EAARAGVKASSDWV+ GM+NGTDSYGVT
Sbjct  56   PVVQLGGETLTIAQVAAIAGRSGT-EVMVELAEAARAGVKASSDWVIEGMKNGTDSYGVT  114

Query  547  TGFGATSHRRTKQGAALQKELIR  615
            TGFGATSHRRTKQGAALQKELIR
Sbjct  115  TGFGATSHRRTKQGAALQKELIR  137



>sp|P45728.1|PAL2_PETCR RecName: Full=Phenylalanine ammonia-lyase 2 [Petroselinum crispum]
 emb|CAA57056.1| phenylalanine ammonia-lyase 2 [Petroselinum crispum]
Length=716

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 114/144 (79%), Gaps = 12/144 (8%)
 Frame = +1

Query  196  MENGNGIISNGHAHG----FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYR  363
            MENGNG I+NGH +G    FC++       + DPL W  AAEA+ GSHLDEVK+MV EYR
Sbjct  1    MENGNGAITNGHVNGNGMDFCMK-------TEDPLYWGIAAEAMTGSHLDEVKKMVAEYR  53

Query  364  KATVKLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGV  543
            K  VKLGGETLTI+QVAA++A+ G+  V VELSEAARAGVKASSDWVM  M  GTDSYGV
Sbjct  54   KPVVKLGGETLTISQVAAISARDGS-GVTVELSEAARAGVKASSDWVMDSMNKGTDSYGV  112

Query  544  TTGFGATSHRRTKQGAALQKELIR  615
            TTGFGATSHRRTKQG ALQKELIR
Sbjct  113  TTGFGATSHRRTKQGGALQKELIR  136



>gb|ACF94719.1| phenylalanine ammonia lyase [Robinia pseudoacacia]
Length=210

 Score =   171 bits (432),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 108/137 (79%), Gaps = 9/137 (7%)
 Frame = +1

Query  217  ISNGHAHG----FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLG  384
            +SNG+  G     C++     ++S DPLNW  AAE++KGSHLDEVKRMVEEYR   V++G
Sbjct  6    VSNGYHQGQNGSLCLKSN---NTSSDPLNWGVAAESMKGSHLDEVKRMVEEYRNPVVRIG  62

Query  385  GETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGAT  564
            GETLTI+QVAA+A +    +  +ELSE+ARAGVKASSDWVM  M NGTDSYGVTTGFGAT
Sbjct  63   GETLTISQVAAIATRDQ--DASLELSESARAGVKASSDWVMNSMNNGTDSYGVTTGFGAT  120

Query  565  SHRRTKQGAALQKELIR  615
            SHRRTKQG ALQKELIR
Sbjct  121  SHRRTKQGGALQKELIR  137



>emb|CAL91169.1| phenylalanine ammonia-lyase 3 [Cynara cardunculus var. scolymus]
Length=713

 Score =   180 bits (456),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 109/140 (78%), Gaps = 9/140 (6%)
 Frame = +1

Query  196  MENGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATV  375
            MEN NG + NG A  FC+ +        DPLNW  AAEA+ GSHLDEVKRMV E+RK  V
Sbjct  1    MENNNGHV-NGVATDFCINK--------DPLNWGVAAEAMTGSHLDEVKRMVAEFRKPVV  51

Query  376  KLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGF  555
            KLGGETLT++QVA +AA G +  VKVELSEAARAGVKASSDWVM  M  GTDSYGVTTGF
Sbjct  52   KLGGETLTVSQVAGIAAAGDSSVVKVELSEAARAGVKASSDWVMESMSKGTDSYGVTTGF  111

Query  556  GATSHRRTKQGAALQKELIR  615
            GATSHRRTKQG ALQKELIR
Sbjct  112  GATSHRRTKQGGALQKELIR  131



>ref|XP_011077338.1| PREDICTED: phenylalanine ammonia-lyase [Sesamum indicum]
Length=712

 Score =   180 bits (456),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 109/129 (84%), Gaps = 8/129 (6%)
 Frame = +1

Query  229  HAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaq  408
            H++GFCV++++      DPLNW AAAEALKGSHLDEVKRMVEE+RK  VKLGGETLTI+Q
Sbjct  10   HSNGFCVQKQK------DPLNWGAAAEALKGSHLDEVKRMVEEFRKPVVKLGGETLTISQ  63

Query  409  vaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQG  588
            VAA+A++     V VEL+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG
Sbjct  64   VAAIASRDNA--VAVELAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQG  121

Query  589  AALQKELIR  615
             ALQKELIR
Sbjct  122  GALQKELIR  130



>ref|XP_009794410.1| PREDICTED: phenylalanine ammonia-lyase-like [Nicotiana sylvestris]
Length=717

 Score =   179 bits (455),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 112/141 (79%), Gaps = 7/141 (5%)
 Frame = +1

Query  196  MENGNGIISNGHA-HGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKAT  372
            ME  NG   NGH+   FC+    +     DPLNWN AA AL GSHLDEVK+MVEE+RK  
Sbjct  1    MEYANGD-CNGHSSQEFCI----KGHQQEDPLNWNMAAAALSGSHLDEVKKMVEEFRKPA  55

Query  373  VKLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTG  552
            V+LGGETLT+AQVAA+A + GT EVKVELSE ARAGVKASSDWVM GM  GTDSYGVTTG
Sbjct  56   VRLGGETLTVAQVAAIAGRSGT-EVKVELSEGARAGVKASSDWVMEGMNKGTDSYGVTTG  114

Query  553  FGATSHRRTKQGAALQKELIR  615
            FGATSHRRTKQGAALQKELIR
Sbjct  115  FGATSHRRTKQGAALQKELIR  135



>ref|XP_010262867.1| PREDICTED: phenylalanine ammonia-lyase [Nelumbo nucifera]
Length=715

 Score =   179 bits (455),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 107/138 (78%), Gaps = 13/138 (9%)
 Frame = +1

Query  202  NGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKL  381
            NGNG   NG    FCV+Q        DPLNW  AAE+LKGSHLDEVKRMV+EYRK  VKL
Sbjct  9    NGNG---NGSIKSFCVQQ--------DPLNWQMAAESLKGSHLDEVKRMVQEYRKPVVKL  57

Query  382  GGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGA  561
            GGETLTI+QVAA+A       VKVEL+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGA
Sbjct  58   GGETLTISQVAAIATHDAG--VKVELAESARAGVKASSDWVMESMNKGTDSYGVTTGFGA  115

Query  562  TSHRRTKQGAALQKELIR  615
            TSHRRTKQG ALQKELIR
Sbjct  116  TSHRRTKQGGALQKELIR  133



>sp|P24481.1|PAL1_PETCR RecName: Full=Phenylalanine ammonia-lyase 1 [Petroselinum crispum]
 emb|CAA68938.1| PAL1 protein [Petroselinum crispum]
Length=716

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 113/144 (78%), Gaps = 12/144 (8%)
 Frame = +1

Query  196  MENGNGIISNGHAHG----FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYR  363
            MENGNG  +NGH +G    FC++       + DPL W  AAEA+ GSHLDEVK+MV EYR
Sbjct  1    MENGNGATTNGHVNGNGMDFCMK-------TEDPLYWGIAAEAMTGSHLDEVKKMVAEYR  53

Query  364  KATVKLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGV  543
            K  VKLGGETLTI+QVAA++A+ G+  V VELSEAARAGVKASSDWVM  M  GTDSYGV
Sbjct  54   KPVVKLGGETLTISQVAAISARDGS-GVTVELSEAARAGVKASSDWVMDSMNKGTDSYGV  112

Query  544  TTGFGATSHRRTKQGAALQKELIR  615
            TTGFGATSHRRTKQG ALQKELIR
Sbjct  113  TTGFGATSHRRTKQGGALQKELIR  136



>pdb|1W27|A Chain A, Phenylalanine Ammonia-Lyase (Pal) From Petroselinum 
Crispum
 pdb|1W27|B Chain B, Phenylalanine Ammonia-Lyase (Pal) From Petroselinum 
Crispum
Length=714

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 113/144 (78%), Gaps = 12/144 (8%)
 Frame = +1

Query  196  MENGNGIISNGHAHG----FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYR  363
            MENGNG  +NGH +G    FC++       + DPL W  AAEA+ GSHLDEVK+MV EYR
Sbjct  1    MENGNGATTNGHVNGNGMDFCMK-------TEDPLYWGIAAEAMTGSHLDEVKKMVAEYR  53

Query  364  KATVKLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGV  543
            K  VKLGGETLTI+QVAA++A+ G+  V VELSEAARAGVKASSDWVM  M  GTDSYGV
Sbjct  54   KPVVKLGGETLTISQVAAISARDGS-GVTVELSEAARAGVKASSDWVMDSMNKGTDSYGV  112

Query  544  TTGFGATSHRRTKQGAALQKELIR  615
            TTGFGATSHRRTKQG ALQKELIR
Sbjct  113  TTGFGATSHRRTKQGGALQKELIR  136



>ref|XP_004239660.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum lycopersicum]
Length=709

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 113/134 (84%), Gaps = 8/134 (6%)
 Frame = +1

Query  223  NGHAHG---FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  393
            NG+++G   FCV    +A    DPLNWN +A+ALKGSHLD VK+MVEEYRK  V+LGGET
Sbjct  5    NGNSNGDQVFCV----KAQQQQDPLNWNVSADALKGSHLDAVKKMVEEYRKPVVRLGGET  60

Query  394  LTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  573
            LT+AQVAA+AAQ G  +V V+LSEAARAGVKASSDWVM GM NGTDSYGVTTGFGATSHR
Sbjct  61   LTVAQVAAIAAQSGK-DVTVQLSEAARAGVKASSDWVMEGMRNGTDSYGVTTGFGATSHR  119

Query  574  RTKQGAALQKELIR  615
            RTKQGAALQKELIR
Sbjct  120  RTKQGAALQKELIR  133



>emb|CDO99754.1| unnamed protein product [Coffea canephora]
Length=660

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 110/138 (80%), Gaps = 7/138 (5%)
 Frame = +1

Query  202  NGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKL  381
            NGNG   N  A  FC +   RA  + DPLNWNAAAE+LKGSHLDEVKRMV+E+R+  V+L
Sbjct  5    NGNG---NDLAETFCTQ---RAGPAPDPLNWNAAAESLKGSHLDEVKRMVDEFRRPLVRL  58

Query  382  GGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGA  561
            GGETLTIAQVAA+AA      VKVELSE ARAGVKASSDWVM  M  GTDSYG+TTGFGA
Sbjct  59   GGETLTIAQVAAIAASSDA-AVKVELSEGARAGVKASSDWVMESMRKGTDSYGITTGFGA  117

Query  562  TSHRRTKQGAALQKELIR  615
            TSHRRTKQG ALQ+ELIR
Sbjct  118  TSHRRTKQGGALQEELIR  135



>gb|AAK15640.1|AF326116_1 phenylalanine ammonia-lyase [Agastache rugosa]
Length=716

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 111/135 (82%), Gaps = 12/135 (9%)
 Frame = +1

Query  220  SNGH---AHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGE  390
            SNGH   A+GFCV+Q       +DPLNW AAAE+LKGSHL+EVKRMVEE+RK  VKLGGE
Sbjct  9    SNGHNNGANGFCVKQ-------NDPLNWAAAAESLKGSHLEEVKRMVEEFRKPVVKLGGE  61

Query  391  TLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSH  570
            TLTI+QVAA+AA+     V VEL+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSH
Sbjct  62   TLTISQVAAIAAKDNA--VAVELAESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSH  119

Query  571  RRTKQGAALQKELIR  615
            RRTKQG ALQKELIR
Sbjct  120  RRTKQGGALQKELIR  134



>sp|O23924.1|PALY_DIGLA RecName: Full=Phenylalanine ammonia-lyase [Digitalis lanata]
 emb|CAA05251.1| phenylalanine ammonia lyase [Digitalis lanata]
Length=713

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 111/136 (82%), Gaps = 11/136 (8%)
 Frame = +1

Query  214  IISNGH--AHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGG  387
            ++ NGH   +GFCV+Q       +DPLNW AAAE LKGSHLDEVKRMVEE+RK  VKLGG
Sbjct  4    VVENGHHGNNGFCVKQ-------NDPLNWVAAAEELKGSHLDEVKRMVEEFRKTVVKLGG  56

Query  388  ETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATS  567
            ETLTI+QVAA+AA+    EV V+L+E++RAGVKASSDWVM  M  GTDSYGVTTGFGATS
Sbjct  57   ETLTISQVAAIAARDN--EVAVQLAESSRAGVKASSDWVMESMNKGTDSYGVTTGFGATS  114

Query  568  HRRTKQGAALQKELIR  615
            HRRTKQG ALQKELIR
Sbjct  115  HRRTKQGGALQKELIR  130



>gb|AEL21616.1| phenylalanine ammonia lyase 1 [Coffea arabica]
Length=717

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 110/138 (80%), Gaps = 7/138 (5%)
 Frame = +1

Query  202  NGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKL  381
            NGNG   N  A  FC +   RA  + DPLNWNAAAE+LKGSHLDEVKRMV+E+R+  V+L
Sbjct  5    NGNG---NDLAETFCTQ---RAGPAPDPLNWNAAAESLKGSHLDEVKRMVDEFRRPLVRL  58

Query  382  GGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGA  561
            GGETLTIAQVAA+AA      VKVELSE ARAGVKASSDWVM  M  GTDSYG+TTGFGA
Sbjct  59   GGETLTIAQVAAIAASSDA-AVKVELSEGARAGVKASSDWVMESMRKGTDSYGITTGFGA  117

Query  562  TSHRRTKQGAALQKELIR  615
            TSHRRTKQG ALQ+ELIR
Sbjct  118  TSHRRTKQGGALQEELIR  135



>gb|AFP49806.1| phenylalanine ammonialyase 1 [Coffea arabica]
Length=717

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 110/138 (80%), Gaps = 7/138 (5%)
 Frame = +1

Query  202  NGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKL  381
            NGNG   N  A  FC +   RA  + DPLNWNAAAE+LKGSHLDEVKRMV+E+R+  V+L
Sbjct  5    NGNG---NDLAETFCTQ---RAGPAPDPLNWNAAAESLKGSHLDEVKRMVDEFRRPLVRL  58

Query  382  GGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGA  561
            GGETLTIAQVAA+AA      VKVELSE ARAGVKASSDWVM  M  GTDSYG+TTGFGA
Sbjct  59   GGETLTIAQVAAIAASSDA-AVKVELSEGARAGVKASSDWVMESMRKGTDSYGITTGFGA  117

Query  562  TSHRRTKQGAALQKELIR  615
            TSHRRTKQG ALQ+ELIR
Sbjct  118  TSHRRTKQGGALQEELIR  135



>sp|O04058.2|PALY_HELAN RecName: Full=Phenylalanine ammonia-lyase [Helianthus annuus]
 emb|CAA73065.1| phenylalanine ammonia lyase [Helianthus annuus]
Length=667

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 108/140 (77%), Gaps = 11/140 (8%)
 Frame = +1

Query  196  MENGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATV  375
            MENG  +  NG A+GFC++         DPLNW  AAEAL GSHLDEVK+MV E+RK  V
Sbjct  1    MENGTHV--NGSANGFCIK---------DPLNWGVAAEALTGSHLDEVKKMVGEFRKPVV  49

Query  376  KLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGF  555
            KLGGETLT++QVA ++A G    VKVELSEAARAGVKASSDWVM  M  GTDSYGVTTGF
Sbjct  50   KLGGETLTVSQVAGISAAGDGNMVKVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGF  109

Query  556  GATSHRRTKQGAALQKELIR  615
            GATSHRRTK G ALQKELIR
Sbjct  110  GATSHRRTKNGGALQKELIR  129



>gb|AJO53272.1| phenylalanine ammonia-lyase [Pogostemon cablin]
Length=711

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 108/140 (77%), Gaps = 11/140 (8%)
 Frame = +1

Query  196  MENGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATV  375
            MENGN    NG   G CV+ +       DPLNWNAAAEAL+GSHLDEVKRMVEE+RK  V
Sbjct  1    MENGN----NGD--GLCVQSRNDVV---DPLNWNAAAEALRGSHLDEVKRMVEEFRKPVV  51

Query  376  KLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGF  555
            +LGGETLTI QVAAVA +     V VEL+E AR GVKASSDWVM  M NGTDSYGVTTGF
Sbjct  52   RLGGETLTIGQVAAVATREAA--VTVELTETAREGVKASSDWVMESMNNGTDSYGVTTGF  109

Query  556  GATSHRRTKQGAALQKELIR  615
            GATSHRRTKQG ALQKELIR
Sbjct  110  GATSHRRTKQGGALQKELIR  129



>emb|CBJ23826.1| phenylalanine ammonia-lyase [Melissa officinalis]
Length=709

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 110/133 (83%), Gaps = 11/133 (8%)
 Frame = +1

Query  223  NGH--AHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETL  396
            NGH  ++GFCV+Q       +DPLNW AAAE+LKGSHLDEVKRMVEE+RK  VKLGGETL
Sbjct  4    NGHHDSNGFCVKQ-------NDPLNWVAAAESLKGSHLDEVKRMVEEFRKPVVKLGGETL  56

Query  397  TIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRR  576
            TI+QVAA+AA+     V VEL+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRR
Sbjct  57   TISQVAAIAAKDNA--VAVELAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRR  114

Query  577  TKQGAALQKELIR  615
            TKQG ALQKELIR
Sbjct  115  TKQGGALQKELIR  127



>ref|XP_006424536.1| hypothetical protein CICLE_v10029946mg [Citrus clementina]
 gb|ESR37776.1| hypothetical protein CICLE_v10029946mg [Citrus clementina]
Length=132

 Score =   166 bits (419),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 98/112 (88%), Gaps = 2/112 (2%)
 Frame = +1

Query  280  DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVEL  459
            DPLNW +A+E+LKGSHLDEVKRMV EYRK  V+LGGETLTIAQVAAVA++     V VEL
Sbjct  23   DPLNWVSASESLKGSHLDEVKRMVSEYRKPVVRLGGETLTIAQVAAVASRDDG--VTVEL  80

Query  460  SEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIR  615
            +E ARAGVKASSDWVM  M NGTDSYGVTTGFGATSHRRTKQGAALQKELIR
Sbjct  81   NEEARAGVKASSDWVMESMNNGTDSYGVTTGFGATSHRRTKQGAALQKELIR  132



>gb|AIB06732.1| phenylalanine ammonia lyase [Mangifera indica]
Length=707

 Score =   177 bits (449),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 102/125 (82%), Gaps = 2/125 (2%)
 Frame = +1

Query  241  FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaav  420
            FC + +     + DPLNWN AAE+LKGSHLDEVKRMVEE+RK  VKLGGETLTI QV A+
Sbjct  3    FCHDNRNGGLCTSDPLNWNFAAESLKGSHLDEVKRMVEEFRKPVVKLGGETLTIGQVTAI  62

Query  421  aaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQ  600
            A+      V+VELSE ARAGV+ASSDWVM  M+NGTDSYGVTTGFGATSHRRTKQG ALQ
Sbjct  63   ASHDSG--VRVELSETARAGVQASSDWVMESMKNGTDSYGVTTGFGATSHRRTKQGGALQ  120

Query  601  KELIR  615
            KELIR
Sbjct  121  KELIR  125



>gb|AFZ94859.1| phenylalanine ammonia-lyase [Solenostemon scutellarioides]
Length=711

 Score =   177 bits (448),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 109/132 (83%), Gaps = 10/132 (8%)
 Frame = +1

Query  223  NGH-AHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLT  399
            NGH ++GFCV+Q       +DPLNW AAAEAL+GSHLDEVK+MVEE+RK  VKLGGETLT
Sbjct  7    NGHQSNGFCVKQ-------NDPLNWAAAAEALQGSHLDEVKKMVEEFRKPAVKLGGETLT  59

Query  400  IaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRT  579
            IAQVAA+AA+     V VELSEAARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRT
Sbjct  60   IAQVAAIAARDNA--VAVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRT  117

Query  580  KQGAALQKELIR  615
            KQG ALQ ELIR
Sbjct  118  KQGGALQTELIR  129



>gb|AAL55242.1|AF299330_1 phenylalanine ammonia-lyase [Lactuca sativa]
Length=711

 Score =   177 bits (448),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 107/140 (76%), Gaps = 11/140 (8%)
 Frame = +1

Query  196  MENGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATV  375
            MENGN +  NG  +  C++         DPLNW  AAEAL GSHLDEVK+MV E+RK  V
Sbjct  1    MENGNHV--NGVVNELCIK---------DPLNWGVAAEALTGSHLDEVKKMVAEFRKPVV  49

Query  376  KLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGF  555
            KLGGETLT++QVA +AA   +  VKVELSEAARAGVKASSDWVM  M  GTDSYGVTTGF
Sbjct  50   KLGGETLTVSQVAGIAAANDSDTVKVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGF  109

Query  556  GATSHRRTKQGAALQKELIR  615
            GATSHRRTKQG ALQKELIR
Sbjct  110  GATSHRRTKQGGALQKELIR  129



>gb|AHZ31605.1| phenylalanine ammonia-lyase [Olea europaea]
 gb|AHZ31606.1| phenylalanine ammonia-lyase [Olea europaea]
Length=713

 Score =   176 bits (447),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 108/137 (79%), Gaps = 15/137 (11%)
 Frame = +1

Query  217  ISNGHAHG----FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLG  384
            + NGH+ G    FC+E         DPLNW  AAE+LKGSHLDE+KRMVEE+RK  VKLG
Sbjct  6    VENGHSSGKLLNFCIE---------DPLNWGTAAESLKGSHLDELKRMVEEFRKPVVKLG  56

Query  385  GETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGAT  564
            GETLTI+QVAA+A++     VKVEL+EAARAGVKASSDWVM  M  GTDSYGVTTGFGAT
Sbjct  57   GETLTISQVAAIASRDNA--VKVELAEAARAGVKASSDWVMESMNKGTDSYGVTTGFGAT  114

Query  565  SHRRTKQGAALQKELIR  615
            SHRRTKQG ALQKELIR
Sbjct  115  SHRRTKQGGALQKELIR  131



>gb|ABD73282.1| phenylalanine ammonia-lyase [Salvia miltiorrhiza]
Length=711

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 110/134 (82%), Gaps = 12/134 (9%)
 Frame = +1

Query  223  NGH---AHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  393
            NGH   ++GFCV+Q       +DPLNW AAAE+LKGSHLDEVKRMVEE+RK  VKLGGET
Sbjct  5    NGHHEESNGFCVKQ-------NDPLNWVAAAESLKGSHLDEVKRMVEEFRKPVVKLGGET  57

Query  394  LTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  573
            LTI+QVAA+AA+     V VEL+E++RAGVKASSDWVM  M  GTDSYGVTTGFGATSHR
Sbjct  58   LTISQVAAIAAKDNA--VAVELAESSRAGVKASSDWVMESMSKGTDSYGVTTGFGATSHR  115

Query  574  RTKQGAALQKELIR  615
            RTKQG ALQKELIR
Sbjct  116  RTKQGGALQKELIR  129



>ref|XP_006345786.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=707

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 114/137 (83%), Gaps = 16/137 (12%)
 Frame = +1

Query  223  NGHAHG------FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLG  384
            NG+++G      FCV+         DPLNWN +A+AL+GSHLDEVK+MVEEYRK  V+LG
Sbjct  5    NGNSNGTHDDQVFCVK---------DPLNWNMSADALRGSHLDEVKKMVEEYRKPVVRLG  55

Query  385  GETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGAT  564
            GETLT+AQVAA+AAQ GT +V V+LSEAARAGVKASSDWVM GM NGTDSYGVTTGFGAT
Sbjct  56   GETLTVAQVAAIAAQSGT-DVTVQLSEAARAGVKASSDWVMEGMRNGTDSYGVTTGFGAT  114

Query  565  SHRRTKQGAALQKELIR  615
            SHRRTKQGAALQKELIR
Sbjct  115  SHRRTKQGAALQKELIR  131



>gb|KJB16792.1| hypothetical protein B456_002G248000 [Gossypium raimondii]
Length=721

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 103/132 (78%), Gaps = 2/132 (2%)
 Frame = +1

Query  220  SNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLT  399
            SNGH   FC           DPLNW  AAE+LKGSHLDEVKRMV E+RK  VKLGGETLT
Sbjct  10   SNGHLQSFCSTTNGGVGVLVDPLNWGVAAESLKGSHLDEVKRMVAEFRKPLVKLGGETLT  69

Query  400  IaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRT  579
            I+QVAA+A +     VKVELSE ARAGVKAS+DWV+ GM  GTDSYGVTTGFGATSHRRT
Sbjct  70   ISQVAAIATRDLG--VKVELSEDARAGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRT  127

Query  580  KQGAALQKELIR  615
            KQGAALQKELIR
Sbjct  128  KQGAALQKELIR  139



>gb|AEW25915.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
Length=125

 Score =   164 bits (415),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 101/129 (78%), Gaps = 8/129 (6%)
 Frame = +1

Query  217  ISNGHAHG-FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  393
            I+NGH    FC+ +K       DPLNW AAAE+L GSHLDEVKRMVEEYR   VK+GGET
Sbjct  4    ITNGHVEATFCLSKK-----GGDPLNWGAAAESLAGSHLDEVKRMVEEYRNPLVKIGGET  58

Query  394  LTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  573
            LTIAQVA +A+      V+VELSE+ARAGVKASSDWVM  M NGTDSYGVTTGFGATSHR
Sbjct  59   LTIAQVAGIASHDSG--VRVELSESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHR  116

Query  574  RTKQGAALQ  600
            RTKQG ALQ
Sbjct  117  RTKQGGALQ  125



>gb|AER12109.1| PAL [Gossypium hirsutum]
Length=721

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 103/132 (78%), Gaps = 2/132 (2%)
 Frame = +1

Query  220  SNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLT  399
            SNGH   FC           DPLNW  AAE+LKGSHLDEVKRMV E+RK  VKLGGETLT
Sbjct  10   SNGHLQSFCSTTNGGVGVLVDPLNWGVAAESLKGSHLDEVKRMVAEFRKPLVKLGGETLT  69

Query  400  IaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRT  579
            I+QVAA+A +     VKVELSE ARAGVKAS+DWV+ GM  GTDSYGVTTGFGATSHRRT
Sbjct  70   ISQVAAIATRDLG--VKVELSEDARAGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRT  127

Query  580  KQGAALQKELIR  615
            KQGAALQKELIR
Sbjct  128  KQGAALQKELIR  139



>gb|AAK84225.1|AF401636_1 phenylalanine ammonia-lyase [Rehmannia glutinosa]
Length=708

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 110/140 (79%), Gaps = 13/140 (9%)
 Frame = +1

Query  196  MENGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATV  375
            MENG+      H++G CVE  R      DPLNW AAAE+LKGSHLDEVKRMVEE+RK  V
Sbjct  1    MENGHH-----HSNGLCVETTR------DPLNWVAAAESLKGSHLDEVKRMVEEFRKPAV  49

Query  376  KLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGF  555
            KLGGE+LTIAQVAA+AA+     V VEL+E ARAGVKASSDWVM  M  GTDSYGVTTGF
Sbjct  50   KLGGESLTIAQVAAIAARDNA--VAVELAETARAGVKASSDWVMESMNKGTDSYGVTTGF  107

Query  556  GATSHRRTKQGAALQKELIR  615
            GATSHRRTKQG ALQKELIR
Sbjct  108  GATSHRRTKQGGALQKELIR  127



>sp|P45732.1|PALY_STYHU RecName: Full=Phenylalanine ammonia-lyase [Stylosanthes humilis]
 gb|AAA99500.1| phenylalanine ammonia lyase [Stylosanthes humilis]
Length=715

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 100/125 (80%), Gaps = 2/125 (2%)
 Frame = +1

Query  241  FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaav  420
            FC+         HDPLNW AAAEALKGSHLDEVKRMV EYRK  V LGG+TLTI+QVAA+
Sbjct  11   FCLTANNGQQPRHDPLNWAAAAEALKGSHLDEVKRMVSEYRKPLVNLGGQTLTISQVAAI  70

Query  421  aaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQ  600
            AA      V V+LSEA+RAGVKASSDWVM  M NGTDSYGVTTGFGATSHRRTKQG ALQ
Sbjct  71   AANDQG--VSVQLSEASRAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHRRTKQGGALQ  128

Query  601  KELIR  615
            KELIR
Sbjct  129  KELIR  133



>gb|ACS71953.1| phenylalanine ammonia-lyase [Euphorbia pulcherrima]
Length=721

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 108/131 (82%), Gaps = 2/131 (2%)
 Frame = +1

Query  223  NGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTI  402
            NG  +  C + +  +  SHDPL+W  AAE++KGSHLDEVKRMV E+RK  VKLGGETLT+
Sbjct  11   NGSLNSLCTDSE--SIRSHDPLSWGLAAESMKGSHLDEVKRMVAEFRKPVVKLGGETLTV  68

Query  403  aqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTK  582
            AQVAA+AA  G+  ++VEL+E+ARAGVKASSDWVM  M NGTDSYGVTTGFGATSHRRTK
Sbjct  69   AQVAAIAASNGSENIRVELAESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHRRTK  128

Query  583  QGAALQKELIR  615
            QG ALQKELIR
Sbjct  129  QGGALQKELIR  139



>gb|ACM44926.1| phenylalanine ammonia-lyase [Euphorbia pulcherrima]
Length=721

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 108/131 (82%), Gaps = 2/131 (2%)
 Frame = +1

Query  223  NGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTI  402
            NG  +  C + +  +  SHDPL+W  AAE++KGSHLDEVKRMV E+RK  VKLGGETLT+
Sbjct  11   NGSLNSLCTDSE--SIRSHDPLSWGLAAESMKGSHLDEVKRMVAEFRKPVVKLGGETLTV  68

Query  403  aqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTK  582
            AQVAA+AA  G+  ++VEL+E+ARAGVKASSDWVM  M NGTDSYGVTTGFGATSHRRTK
Sbjct  69   AQVAAIAASNGSENIRVELAESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHRRTK  128

Query  583  QGAALQKELIR  615
            QG ALQKELIR
Sbjct  129  QGGALQKELIR  139



>ref|XP_011094662.1| PREDICTED: phenylalanine ammonia-lyase [Sesamum indicum]
Length=711

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 105/129 (81%), Gaps = 9/129 (7%)
 Frame = +1

Query  229  HAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaq  408
            H++GFCV+QK       DPLNW  AAEALKGSHLDEVK+MV E+RK  VKLGGETLTI+Q
Sbjct  10   HSNGFCVQQK-------DPLNWGVAAEALKGSHLDEVKKMVAEFRKPVVKLGGETLTISQ  62

Query  409  vaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQG  588
            VAA+AA+     V VEL+EAAR GVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG
Sbjct  63   VAAIAARDNG--VAVELAEAARGGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQG  120

Query  589  AALQKELIR  615
             ALQKELIR
Sbjct  121  GALQKELIR  129



>gb|ABR14606.1| phenylalanine ammonia-lyase [Salvia miltiorrhiza]
Length=711

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 109/134 (81%), Gaps = 12/134 (9%)
 Frame = +1

Query  223  NGH---AHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  393
            NGH   ++GFCV+Q       +DPLNW AAAE+LKGSHLDEVKRMVEE+RK  VKLGGET
Sbjct  5    NGHHEESNGFCVKQ-------NDPLNWVAAAESLKGSHLDEVKRMVEEFRKPVVKLGGET  57

Query  394  LTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  573
            LTI+QVAA+AA+     V VEL E++RAGVKASSDWVM  M  GTDSYGVTTGFGATSHR
Sbjct  58   LTISQVAAIAAKDNA--VAVELVESSRAGVKASSDWVMESMSKGTDSYGVTTGFGATSHR  115

Query  574  RTKQGAALQKELIR  615
            RTKQG ALQKELIR
Sbjct  116  RTKQGGALQKELIR  129



>gb|AAN32866.1|AF460203_1 phenylalanine ammonia-lyase 1 [Coffea canephora]
 gb|AAZ04477.1| phenylalanine ammonia-lyase [Coffea canephora]
 gb|AEO92027.1| phenylalanine ammonia-lyase 1 [Coffea canephora]
Length=717

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 110/138 (80%), Gaps = 7/138 (5%)
 Frame = +1

Query  202  NGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKL  381
            NGNG   N  A  FC +   RA  + DPLNWNAAAE+LKGSHLDEVKRMV+E+R+  V+L
Sbjct  5    NGNG---NDLAETFCTQ---RAGPAPDPLNWNAAAESLKGSHLDEVKRMVDEFRRPLVRL  58

Query  382  GGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGA  561
            GGETLTIAQVAAVAA      VKVELSE ARAGVKASSDWVM  M  GTDSYG+TTGFGA
Sbjct  59   GGETLTIAQVAAVAASSDA-AVKVELSEGARAGVKASSDWVMESMRKGTDSYGITTGFGA  117

Query  562  TSHRRTKQGAALQKELIR  615
            TSHRRTKQG ALQ+ELIR
Sbjct  118  TSHRRTKQGGALQEELIR  135



>gb|ABL14040.1| phenylalanine ammonia lyase, partial [Astragalus mongholicus]
Length=274

 Score =   168 bits (425),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 99/125 (79%), Gaps = 7/125 (6%)
 Frame = +1

Query  241  FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaav  420
            FC+ + R      DP NW  AAEALKGSHLDEVKRMVEEYRK  V++GGETLTI+QVAA+
Sbjct  19   FCIRETR-----GDPFNWGVAAEALKGSHLDEVKRMVEEYRKPVVRIGGETLTISQVAAI  73

Query  421  aaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQ  600
            A       VKV+LSE+AR GVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG ALQ
Sbjct  74   AGHDQG--VKVDLSESARDGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQ  131

Query  601  KELIR  615
            KELIR
Sbjct  132  KELIR  136



>gb|AFK43896.1| unknown [Medicago truncatula]
Length=374

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 105/134 (78%), Gaps = 8/134 (6%)
 Frame = +1

Query  217  ISNGHAHG-FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  393
            I+NGH    FC+ +     +  DPLNW AAAE+L GSHLDEVKRMVEEYR   VK+GGET
Sbjct  4    ITNGHVEATFCLSK-----NGGDPLNWGAAAESLTGSHLDEVKRMVEEYRNPLVKIGGET  58

Query  394  LTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  573
            LTIAQVA +A+      V+VELSE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHR
Sbjct  59   LTIAQVAGIASHDSG--VRVELSESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHR  116

Query  574  RTKQGAALQKELIR  615
            RTKQG ALQKELIR
Sbjct  117  RTKQGGALQKELIR  130



>gb|AAV98199.1| phenylalanine ammonialyase 1 [Petunia x hybrida]
Length=718

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 111/132 (84%), Gaps = 5/132 (4%)
 Frame = +1

Query  223  NGHA-HGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLT  399
            NGHA    CV   +      DPLNWN AA+ALKGSHLDEVKRMV+E+RK  V+LGGETLT
Sbjct  9    NGHASQDICV---KGHDQQLDPLNWNMAADALKGSHLDEVKRMVKEFRKPVVRLGGETLT  65

Query  400  IaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRT  579
            +AQVAA+A+Q GT +V V+LSEA+RAGVKASSDWV+ GM NGTDSYGVTTGFGATSHRRT
Sbjct  66   VAQVAAIASQSGT-DVTVQLSEASRAGVKASSDWVLQGMINGTDSYGVTTGFGATSHRRT  124

Query  580  KQGAALQKELIR  615
            K+GAALQKELIR
Sbjct  125  KEGAALQKELIR  136



>sp|Q01861.1|PAL1_PEA RecName: Full=Phenylalanine ammonia-lyase 1 [Pisum sativum]
 dbj|BAA00885.1| phenylalanine ammonia-lyase [Pisum sativum]
 dbj|BAA00886.1| phenylalanine ammonia-lyase [Pisum sativum]
Length=723

 Score =   175 bits (443),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 106/137 (77%), Gaps = 5/137 (4%)
 Frame = +1

Query  214  IISNGHAHGFCVEQKRRAS---SSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLG  384
            I  N     FCV   +  +   +S DPLNW  AAEA+KGSHLDEVKRMVEEYRK  V+LG
Sbjct  8    ITKNNGYESFCVTNAKNNNMKVNSADPLNWGVAAEAMKGSHLDEVKRMVEEYRKPVVRLG  67

Query  385  GETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGAT  564
            GETLTI+QVAA+AA      VKVELSE+ARAGVKASSDWVM  M  GTDSYGVTTGFGAT
Sbjct  68   GETLTISQVAAIAAHDHG--VKVELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGAT  125

Query  565  SHRRTKQGAALQKELIR  615
            SHRRTKQG ALQKELIR
Sbjct  126  SHRRTKQGGALQKELIR  142



>prf||2001451A Phe ammonia lyase
Length=723

 Score =   175 bits (443),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 106/137 (77%), Gaps = 5/137 (4%)
 Frame = +1

Query  214  IISNGHAHGFCVEQKRRAS---SSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLG  384
            I  N     FCV   +  +   +S DPLNW  AAEA+KGSHLDEVKRMVEEYRK  V+LG
Sbjct  8    ITKNNGYESFCVTNAKNNNMKVNSADPLNWGVAAEAMKGSHLDEVKRMVEEYRKPVVRLG  67

Query  385  GETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGAT  564
            GETLTI+QVAA+AA      VKVELSE+ARAGVKASSDWVM  M  GTDSYGVTTGFGAT
Sbjct  68   GETLTISQVAAIAAHDHG--VKVELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGAT  125

Query  565  SHRRTKQGAALQKELIR  615
            SHRRTKQG ALQKELIR
Sbjct  126  SHRRTKQGGALQKELIR  142



>gb|AEC11891.1| PAL1 [Petunia exserta]
 gb|AEC11892.1| PAL1 [Petunia axillaris]
Length=718

 Score =   175 bits (443),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 111/132 (84%), Gaps = 5/132 (4%)
 Frame = +1

Query  223  NGHA-HGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLT  399
            NGHA    CV   +      DPLNWN AA+ALKGSHLDEVKRMV+E+RK  V+LGGETLT
Sbjct  9    NGHASQDICV---KGHDQQLDPLNWNMAADALKGSHLDEVKRMVKEFRKPVVRLGGETLT  65

Query  400  IaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRT  579
            +AQVAA+A+Q GT +V V+LSEA+RAGVKASSDWV+ GM NGTDSYGVTTGFGATSHRRT
Sbjct  66   VAQVAAIASQSGT-DVTVQLSEASRAGVKASSDWVLQGMINGTDSYGVTTGFGATSHRRT  124

Query  580  KQGAALQKELIR  615
            K+GAALQKELIR
Sbjct  125  KEGAALQKELIR  136



>ref|XP_007009873.1| Phenylalanine ammonia-lyase 2 [Theobroma cacao]
 gb|EOY18683.1| Phenylalanine ammonia-lyase 2 [Theobroma cacao]
Length=713

 Score =   175 bits (443),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 107/138 (78%), Gaps = 17/138 (12%)
 Frame = +1

Query  202  NGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKL  381
            NGNG      + GFC+          DPLNW A+AE+LKGSHLDEVKRMVEE+RK  V+L
Sbjct  11   NGNG------SPGFCIT---------DPLNWGASAESLKGSHLDEVKRMVEEFRKPVVRL  55

Query  382  GGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGA  561
            GGETLTIAQVAA+A +     VKVELSEAAR  VKASSDWVM GM  GTDSYGVTTGFGA
Sbjct  56   GGETLTIAQVAAIANRDAG--VKVELSEAARPAVKASSDWVMEGMNRGTDSYGVTTGFGA  113

Query  562  TSHRRTKQGAALQKELIR  615
            TSHRRTKQGAALQKELIR
Sbjct  114  TSHRRTKQGAALQKELIR  131



>ref|XP_004173741.1| PREDICTED: phenylalanine ammonia-lyase-like, partial [Cucumis 
sativus]
Length=141

 Score =   163 bits (413),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 101/131 (77%), Gaps = 9/131 (7%)
 Frame = +1

Query  223  NGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTI  402
            NG     C       ++  DPLNW  AAE++KGSHLDEVKRMVEEYR+  VKLGGETLTI
Sbjct  10   NGSVETLC-------NTHQDPLNWGLAAESMKGSHLDEVKRMVEEYRRPLVKLGGETLTI  62

Query  403  aqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTK  582
            +QVAA+A +    +V VEL+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRT 
Sbjct  63   SQVAAIATRDN--DVLVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTN  120

Query  583  QGAALQKELIR  615
            QG ALQKELIR
Sbjct  121  QGGALQKELIR  131



>gb|AAZ29733.1| phenylalanine ammonia lyase [Trifolium pratense]
Length=712

 Score =   175 bits (443),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 106/134 (79%), Gaps = 8/134 (6%)
 Frame = +1

Query  217  ISNGHAHG-FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  393
            I+NGHA   FCV +     S  DPLNW AAAE+L GSHLDEVKRMVEEYR   VK+GG T
Sbjct  4    ITNGHAEATFCVTK-----SVGDPLNWGAAAESLTGSHLDEVKRMVEEYRNPLVKIGGAT  58

Query  394  LTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  573
            LTIAQVA +A+      V+VELSE+ARAGVKASSDWVM  M NGTDSYGVTTGFGATSHR
Sbjct  59   LTIAQVAGIASHDSG--VRVELSESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHR  116

Query  574  RTKQGAALQKELIR  615
            RTKQG ALQKELIR
Sbjct  117  RTKQGGALQKELIR  130



>ref|XP_008449236.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=705

 Score =   175 bits (443),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 100/116 (86%), Gaps = 2/116 (2%)
 Frame = +1

Query  268  SSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEV  447
            S +HDPLNW  AAE+LKGSHLDEVKRMVEEYR+  VKLGGETLTI+QVAA+A +    +V
Sbjct  10   SFTHDPLNWGVAAESLKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVAAIATRDI--DV  67

Query  448  KVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIR  615
             VELSE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG ALQKELIR
Sbjct  68   TVELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIR  123



>ref|XP_004173742.1| PREDICTED: phenylalanine ammonia-lyase-like, partial [Cucumis 
sativus]
Length=144

 Score =   163 bits (413),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 101/131 (77%), Gaps = 9/131 (7%)
 Frame = +1

Query  223  NGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTI  402
            NG     C++         DPLNW  AAE++KGSHLDEVKRMVEEYR+  VKLGGETLTI
Sbjct  5    NGSLESLCMK-------GQDPLNWGLAAESMKGSHLDEVKRMVEEYRRPLVKLGGETLTI  57

Query  403  aqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTK  582
            +QVAA+A +    +V VEL+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRT 
Sbjct  58   SQVAAIATRDN--DVLVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTN  115

Query  583  QGAALQKELIR  615
            QG ALQKELIR
Sbjct  116  QGGALQKELIR  126



>dbj|BAE71252.1| putative phenylalanine ammonia lyase [Trifolium pratense]
Length=712

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 106/134 (79%), Gaps = 8/134 (6%)
 Frame = +1

Query  217  ISNGHAHG-FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  393
            I+NGHA   FCV +     S  DPLNW AAAE+L GSHLDEVKRMVEEYR   VK+GG T
Sbjct  4    ITNGHAEATFCVTK-----SVGDPLNWGAAAESLTGSHLDEVKRMVEEYRNPLVKIGGAT  58

Query  394  LTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  573
            LTIAQVA +A+      V+VELSE+ARAGVKASSDWVM  M NGTDSYGVTTGFGATSHR
Sbjct  59   LTIAQVAGIASHDSG--VRVELSESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHR  116

Query  574  RTKQGAALQKELIR  615
            RTKQG ALQKELIR
Sbjct  117  RTKQGGALQKELIR  130



>gb|ABL14039.1| phenylalanine ammonia lyase, partial [Astragalus mongholicus]
Length=274

 Score =   167 bits (423),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 104/133 (78%), Gaps = 3/133 (2%)
 Frame = +1

Query  220  SNGHAHGFCVEQKRRAS-SSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETL  396
            +NGHA     E +   S +  DPLNW  AAEALKGS LDEVKRMVEEYR   VK+GGETL
Sbjct  6    ANGHASSTANEAELCISKAGGDPLNWAVAAEALKGSLLDEVKRMVEEYRNPVVKIGGETL  65

Query  397  TIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRR  576
            TI+QVA +A+  G   VKVELSE+ARAGVKASSDWVM  M NGTDSYGVTTGFGATSHRR
Sbjct  66   TISQVAGIASHDGG--VKVELSESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRR  123

Query  577  TKQGAALQKELIR  615
            TKQG ALQKE IR
Sbjct  124  TKQGGALQKEFIR  136



>gb|AGH13333.1| phenylalanine ammonia-lyase [Rhus chinensis]
Length=707

 Score =   174 bits (442),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 99/125 (79%), Gaps = 2/125 (2%)
 Frame = +1

Query  241  FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaav  420
            FC E +     + DPLNWN AAE+LKGSHLDEVKRMVEE RK  VKLGGETLTI QV A+
Sbjct  3    FCHENRNGGLCTSDPLNWNFAAESLKGSHLDEVKRMVEESRKPVVKLGGETLTIGQVTAI  62

Query  421  aaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQ  600
            A       ++VELSEAAR GV+ASSDWVM  M NGTDSYGVTTGFGATSHRRTKQG ALQ
Sbjct  63   ANHDSG--LRVELSEAARPGVQASSDWVMESMNNGTDSYGVTTGFGATSHRRTKQGGALQ  120

Query  601  KELIR  615
            KELIR
Sbjct  121  KELIR  125



>gb|ACM62741.1| phenylalanine ammonia-lyase [Garcinia mangostana]
Length=718

 Score =   174 bits (442),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 107/135 (79%), Gaps = 4/135 (3%)
 Frame = +1

Query  214  IISNGH-AHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGE  390
            I  NGH  +G C+      +S  DPLNW   AE+LKGSHL+EVKRMVEEYRK  VKLGGE
Sbjct  5    ITQNGHHMNGLCMNGSAHVNS--DPLNWGYLAESLKGSHLEEVKRMVEEYRKPLVKLGGE  62

Query  391  TLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSH  570
            TLTIAQVAAVA       VKVEL+E+ARAGVKASSDWVM  M NGTDSYGVTTGFGATSH
Sbjct  63   TLTIAQVAAVAGGFEA-GVKVELAESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSH  121

Query  571  RRTKQGAALQKELIR  615
            RRTKQGAALQKELIR
Sbjct  122  RRTKQGAALQKELIR  136



>gb|AEW25919.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
Length=125

 Score =   162 bits (411),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 100/129 (78%), Gaps = 8/129 (6%)
 Frame = +1

Query  217  ISNGHAHG-FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  393
            I+NGH    FC+ +     +  DPLNW AAAE+L GSHLDEVKRMVEEYR   VK+GGET
Sbjct  4    ITNGHVEATFCLSK-----NGGDPLNWGAAAESLXGSHLDEVKRMVEEYRNPLVKIGGET  58

Query  394  LTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  573
            LTIAQVA +A       V+VELSE+ARAGVKASSDWVM  M NGTDSYGVTTGFGATSHR
Sbjct  59   LTIAQVAGIAXHDSG--VRVELSESARAGVKASSDWVMXSMNNGTDSYGVTTGFGATSHR  116

Query  574  RTKQGAALQ  600
            RTKQG ALQ
Sbjct  117  RTKQGGALQ  125



>gb|AEM63671.1| phenylalanine ammonia lyase 2 [Platycodon grandiflorus]
Length=708

 Score =   174 bits (442),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 106/134 (79%), Gaps = 13/134 (10%)
 Frame = +1

Query  220  SNGHAH--GFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  393
            SNGH+   GFCVE         DPLNW  AAE LKGSHLDEVK+MVEE+RK  V+LGG+T
Sbjct  4    SNGHSKNGGFCVE---------DPLNWGKAAEGLKGSHLDEVKKMVEEFRKPVVQLGGKT  54

Query  394  LTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  573
            LTIAQVAA+A       VKVELSE+ARAGVKASSDWVM  M NGTDSYGVTTGFGATSHR
Sbjct  55   LTIAQVAAIATHDSG--VKVELSESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHR  112

Query  574  RTKQGAALQKELIR  615
            RTK+G ALQKELIR
Sbjct  113  RTKEGGALQKELIR  126



>gb|ADN32768.1| phenylalanine ammonia-lyase 2 [Scutellaria baicalensis]
Length=708

 Score =   174 bits (442),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 108/135 (80%), Gaps = 11/135 (8%)
 Frame = +1

Query  217  ISNGH--AHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGE  390
            + NGH   +GFCV+Q       +DPLNW AAAEAL+GSHLDEVKRMV E+RK  VKLGGE
Sbjct  1    MENGHKNGNGFCVKQ-------NDPLNWGAAAEALQGSHLDEVKRMVAEFRKPVVKLGGE  53

Query  391  TLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSH  570
            TLTI+QVAA+AA+     V VEL+EAAR GVKASSDWVM  M  GTDSYGVTTGFGATSH
Sbjct  54   TLTISQVAAIAARDNG--VVVELAEAARPGVKASSDWVMESMNKGTDSYGVTTGFGATSH  111

Query  571  RRTKQGAALQKELIR  615
            RRTKQG ALQKELIR
Sbjct  112  RRTKQGGALQKELIR  126



>gb|AAX84839.1| phenylalanine ammonia-lyase [Astragalus mongholicus]
Length=718

 Score =   174 bits (442),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 109/140 (78%), Gaps = 8/140 (6%)
 Frame = +1

Query  199  ENGNGIISNGHAHG-FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATV  375
            E  NG +SN      FC+ +     +  DPLNW AAAEALKGSHLDEVKRMVEEYR   V
Sbjct  4    EGANGHVSNHATEAEFCISK-----TGGDPLNWGAAAEALKGSHLDEVKRMVEEYRNPVV  58

Query  376  KLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGF  555
            K+GGETLTIAQVA +A+  G   VKVELSE+ARAGVKASSDWVM  M NGTDSYGVTTGF
Sbjct  59   KIGGETLTIAQVAGIASHDGG--VKVELSESARAGVKASSDWVMNSMNNGTDSYGVTTGF  116

Query  556  GATSHRRTKQGAALQKELIR  615
            GATSHRRT+QG ALQKELIR
Sbjct  117  GATSHRRTRQGGALQKELIR  136



>gb|AEW25886.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
x varia]
 gb|AEW25891.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
x varia]
 gb|AEW25892.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25896.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25898.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25901.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25911.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25918.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25927.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25928.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25930.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25937.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
Length=125

 Score =   162 bits (410),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 101/129 (78%), Gaps = 8/129 (6%)
 Frame = +1

Query  217  ISNGHAHG-FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  393
            I+NGH    FC+ +     +  DPLNW AAAE+L GSHLDEVKRMVEEYR   VK+GGET
Sbjct  4    ITNGHVEATFCLSK-----NGGDPLNWGAAAESLXGSHLDEVKRMVEEYRNPLVKIGGET  58

Query  394  LTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  573
            LTIAQVA +A+      V+VELSE+ARAGVKASSDWVM  M NGTDSYGVTTGFGATSHR
Sbjct  59   LTIAQVAGIASHDSG--VRVELSESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHR  116

Query  574  RTKQGAALQ  600
            RTKQG ALQ
Sbjct  117  RTKQGGALQ  125



>gb|AEW25882.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25893.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25899.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25902.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25904.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25905.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25913.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25916.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25917.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25920.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25925.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25926.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25929.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25931.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25932.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25933.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25936.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25944.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25948.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
Length=125

 Score =   162 bits (410),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 101/129 (78%), Gaps = 8/129 (6%)
 Frame = +1

Query  217  ISNGHAHG-FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  393
            I+NGH    FC+ +     +  DPLNW AAAE+L GSHLDEVKRMVEEYR   VK+GGET
Sbjct  4    ITNGHVEATFCLSK-----NGGDPLNWGAAAESLTGSHLDEVKRMVEEYRNPLVKIGGET  58

Query  394  LTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  573
            LTIAQVA +A+      V+VELSE+ARAGVKASSDWVM  M NGTDSYGVTTGFGATSHR
Sbjct  59   LTIAQVAGIASHDSG--VRVELSESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHR  116

Query  574  RTKQGAALQ  600
            RTKQG ALQ
Sbjct  117  RTKQGGALQ  125



>gb|AEW25889.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
x varia]
 gb|AEW25914.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25943.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
Length=125

 Score =   162 bits (410),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 101/129 (78%), Gaps = 8/129 (6%)
 Frame = +1

Query  217  ISNGHAHG-FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  393
            I+NGH    FC+ +     +  DPLNW AAAE+L GSHLDEVKRMVEEYR   VK+GGET
Sbjct  4    ITNGHVEATFCLXK-----NGGDPLNWGAAAESLXGSHLDEVKRMVEEYRNPLVKIGGET  58

Query  394  LTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  573
            LTIAQVA +A+      V+VELSE+ARAGVKASSDWVM  M NGTDSYGVTTGFGATSHR
Sbjct  59   LTIAQVAGIASHDSG--VRVELSESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHR  116

Query  574  RTKQGAALQ  600
            RTKQG ALQ
Sbjct  117  RTKQGGALQ  125



>gb|AEW25884.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
x varia]
Length=125

 Score =   162 bits (410),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 101/129 (78%), Gaps = 8/129 (6%)
 Frame = +1

Query  217  ISNGHAHG-FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  393
            I+NGH    FC+ +     +  DPLNW AAAE+L GSHLDEVKRMVEEYR   VK+GGET
Sbjct  4    ITNGHVEAXFCLSK-----NGGDPLNWGAAAESLAGSHLDEVKRMVEEYRNPLVKIGGET  58

Query  394  LTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  573
            LTIAQVA +A+      V+VELSE+ARAGVKASSDWVM  M NGTDSYGVTTGFGATSHR
Sbjct  59   LTIAQVAGIASHDSG--VRVELSESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHR  116

Query  574  RTKQGAALQ  600
            RTKQG ALQ
Sbjct  117  RTKQGGALQ  125



>gb|AEW25883.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25887.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
x varia]
 gb|AEW25895.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25900.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25910.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25934.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25935.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
 gb|AEW25939.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25942.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
x varia]
 gb|AEW25945.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25946.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
Length=125

 Score =   162 bits (410),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 101/129 (78%), Gaps = 8/129 (6%)
 Frame = +1

Query  217  ISNGHAHG-FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  393
            I+NGH    FC+ +     +  DPLNW AAAE+L GSHLDEVKRMVEEYR   VK+GGET
Sbjct  4    ITNGHVEATFCLSK-----NGGDPLNWGAAAESLAGSHLDEVKRMVEEYRNPLVKIGGET  58

Query  394  LTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  573
            LTIAQVA +A+      V+VELSE+ARAGVKASSDWVM  M NGTDSYGVTTGFGATSHR
Sbjct  59   LTIAQVAGIASHDSG--VRVELSESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHR  116

Query  574  RTKQGAALQ  600
            RTKQG ALQ
Sbjct  117  RTKQGGALQ  125



>ref|XP_009606373.1| PREDICTED: phenylalanine ammonia-lyase G4-like [Nicotiana tomentosiformis]
Length=717

 Score =   174 bits (441),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 110/141 (78%), Gaps = 7/141 (5%)
 Frame = +1

Query  196  MENGNGIISNGHA-HGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKAT  372
            ME  NG   NGH+    C+    +     DPLNWN AA AL GSHLDEVK+MVEE+RK  
Sbjct  1    MEYTNGD-CNGHSDQELCI----KGHQQEDPLNWNMAAAALSGSHLDEVKKMVEEFRKPA  55

Query  373  VKLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTG  552
            V+LGGETLT+AQVAA+A + GT EV VELSE ARAGVKASSDWVM GM  GTDSYGVTTG
Sbjct  56   VRLGGETLTVAQVAAIAGRSGT-EVTVELSEGARAGVKASSDWVMEGMNKGTDSYGVTTG  114

Query  553  FGATSHRRTKQGAALQKELIR  615
            FGATSHRRTKQGAALQKELIR
Sbjct  115  FGATSHRRTKQGAALQKELIR  135



>ref|XP_004246650.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum lycopersicum]
Length=721

 Score =   174 bits (440),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 109/135 (81%), Gaps = 1/135 (1%)
 Frame = +1

Query  214  IISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  393
            I+ NGH +G  ++  +++ + +DPLNW  AAE+L+GSHLDEVK+MV+E+RK  VKLGGET
Sbjct  5    IVQNGHVNGEAMDLCKKSINVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLGGET  64

Query  394  LTIaqvaavaaqggTPE-VKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSH  570
            LT+AQVA++A        VKVELSE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSH
Sbjct  65   LTVAQVASIANVDNKSNGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSH  124

Query  571  RRTKQGAALQKELIR  615
            RRTK G ALQKELIR
Sbjct  125  RRTKNGGALQKELIR  139



>gb|AEW25888.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25908.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25909.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25912.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
x varia]
 gb|AEW25921.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25922.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25938.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25941.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
x varia]
Length=125

 Score =   162 bits (409),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 101/129 (78%), Gaps = 8/129 (6%)
 Frame = +1

Query  217  ISNGHAHG-FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  393
            I+NGH    FC+ +     +  DPLNW AAAE+L GSHLDEVKRMVEEYR   VK+GGET
Sbjct  4    ITNGHVEATFCLXK-----NGGDPLNWGAAAESLAGSHLDEVKRMVEEYRNPLVKIGGET  58

Query  394  LTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  573
            LTIAQVA +A+      V+VELSE+ARAGVKASSDWVM  M NGTDSYGVTTGFGATSHR
Sbjct  59   LTIAQVAGIASHDSG--VRVELSESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHR  116

Query  574  RTKQGAALQ  600
            RTKQG ALQ
Sbjct  117  RTKQGGALQ  125



>gb|AGW27206.1| phenylalanine ammonia-lyase 3 [Salvia miltiorrhiza]
Length=760

 Score =   174 bits (441),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 108/132 (82%), Gaps = 10/132 (8%)
 Frame = +1

Query  223  NGHA-HGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLT  399
            NGH+ +GFCV+Q        DPLNW AAAEAL+GSHLD VKRMVEE+RK  VKLGGETLT
Sbjct  56   NGHSENGFCVKQS-------DPLNWAAAAEALQGSHLDAVKRMVEEFRKPAVKLGGETLT  108

Query  400  IaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRT  579
            IAQVAA+A++     V VEL+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRT
Sbjct  109  IAQVAAIASRDNA--VAVELAESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRT  166

Query  580  KQGAALQKELIR  615
            KQG ALQKELIR
Sbjct  167  KQGGALQKELIR  178



>sp|P26600.1|PAL5_SOLLC RecName: Full=Phenylalanine ammonia-lyase; Short=PAL [Solanum 
lycopersicum]
 gb|AAA34176.1| phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=721

 Score =   174 bits (440),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 109/135 (81%), Gaps = 1/135 (1%)
 Frame = +1

Query  214  IISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  393
            I+ NGH +G  ++  +++ + +DPLNW  AAE+L+GSHLDEVK+MV+E+RK  VKLGGET
Sbjct  5    IVQNGHVNGEAMDLCKKSINVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLGGET  64

Query  394  LTIaqvaavaaqggTPE-VKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSH  570
            LT+AQVA++A        VKVELSE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSH
Sbjct  65   LTVAQVASIANVDNKSNGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSH  124

Query  571  RRTKQGAALQKELIR  615
            RRTK G ALQKELIR
Sbjct  125  RRTKNGGALQKELIR  139



>ref|XP_004246649.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X1 [Solanum 
lycopersicum]
Length=721

 Score =   174 bits (440),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 109/135 (81%), Gaps = 1/135 (1%)
 Frame = +1

Query  214  IISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  393
            I+ NGH +G  ++  +++ + +DPLNW  AAE+L+GSHLDEVK+MV+E+RK  VKLGGET
Sbjct  5    IVQNGHVNGEAMDLCKKSINVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLGGET  64

Query  394  LTIaqvaavaaqggTPE-VKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSH  570
            LT+AQVA++A        VKVELSE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSH
Sbjct  65   LTVAQVASIANVDNKSNGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSH  124

Query  571  RRTKQGAALQKELIR  615
            RRTK G ALQKELIR
Sbjct  125  RRTKNGGALQKELIR  139



>gb|KHG04887.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=728

 Score =   174 bits (440),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 106/143 (74%), Gaps = 6/143 (4%)
 Frame = +1

Query  199  ENGNGII----SNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRK  366
            +NG  I     SNGH   FC           DPLNW  AAE+LKGSHLDEVKRMV E+RK
Sbjct  6    QNGTSITQNGTSNGHLQSFCSATNGGVGVVVDPLNWGVAAESLKGSHLDEVKRMVAEFRK  65

Query  367  ATVKLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVT  546
              VKLGGETLTI+QVAA+A +     VKVELSE A AGVKAS+DWV+ GM  GTDSYGVT
Sbjct  66   PLVKLGGETLTISQVAAIATRDLG--VKVELSEDAMAGVKASADWVLDGMNKGTDSYGVT  123

Query  547  TGFGATSHRRTKQGAALQKELIR  615
            TGFGATSHRRTKQGAALQKELIR
Sbjct  124  TGFGATSHRRTKQGAALQKELIR  146



>gb|AID51445.1| phenylalanine ammonia-lyase 2 [Astragalus membranaceus]
Length=718

 Score =   174 bits (440),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 106/134 (79%), Gaps = 3/134 (2%)
 Frame = +1

Query  214  IISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  393
            I +N +   FC+  K    ++ DPLNW  AAE++KGSHLDEVKRMVEEYR   V+LGGET
Sbjct  6    ITNNFNGGSFCL--KNSTINASDPLNWGVAAESMKGSHLDEVKRMVEEYRTPVVRLGGET  63

Query  394  LTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  573
            LTI+QVAA+A       V+VELSE+ARAGVKASSDWVM  M NGTDSYGVTTGFGATSHR
Sbjct  64   LTISQVAAIAGAYDD-GVRVELSESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR  122

Query  574  RTKQGAALQKELIR  615
            RTKQG ALQKELIR
Sbjct  123  RTKQGGALQKELIR  136



>gb|AJO53274.1| phenylalanine ammonia-lyase [Pogostemon cablin]
Length=715

 Score =   174 bits (440),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 110/139 (79%), Gaps = 11/139 (8%)
 Frame = +1

Query  199  ENGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVK  378
            ENG+    NG  +GFCV+      +  DPLNW AAAEALKGSHL+EVKRMVEE+RK  VK
Sbjct  6    ENGH---RNGAVNGFCVK------AQGDPLNWGAAAEALKGSHLEEVKRMVEEFRKPVVK  56

Query  379  LGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFG  558
            LGGE+LTI+QVAA+AA+     V VEL+E ARAGVKASSDWVM  M  GTDSYGVTTGFG
Sbjct  57   LGGESLTISQVAAIAARDNA--VAVELAEPARAGVKASSDWVMESMNKGTDSYGVTTGFG  114

Query  559  ATSHRRTKQGAALQKELIR  615
            ATSHRRTKQG ALQKELIR
Sbjct  115  ATSHRRTKQGGALQKELIR  133



>ref|XP_004246651.1| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=721

 Score =   173 bits (439),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 109/135 (81%), Gaps = 1/135 (1%)
 Frame = +1

Query  214  IISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  393
            I+ NGH +G  ++  +++ + +DPLNW  AAE+L+GSHLDEVK+MV+E+RK  VKLGGET
Sbjct  5    IVQNGHVNGEAMDLCKKSINVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLGGET  64

Query  394  LTIaqvaavaaqggTPE-VKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSH  570
            LT+AQVA++A        VKVELSE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSH
Sbjct  65   LTVAQVASIANVDNKSNGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSH  124

Query  571  RRTKQGAALQKELIR  615
            RRTK G ALQKELIR
Sbjct  125  RRTKNGGALQKELIR  139



>ref|XP_003521397.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Glycine max]
Length=713

 Score =   173 bits (439),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 106/133 (80%), Gaps = 6/133 (5%)
 Frame = +1

Query  220  SNGHAHG-FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETL  396
            +NGH +G FC+     A  S DPLNW AAAEA+KGSHLDEVKRMV EYRK  V+LGGETL
Sbjct  4    TNGHQNGSFCLST---AKGSSDPLNWGAAAEAMKGSHLDEVKRMVAEYRKPVVRLGGETL  60

Query  397  TIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRR  576
            TIAQVAAVA       V VELSE+AR GVKASS+WVM  M NGTDSYGVTTGFGATSHRR
Sbjct  61   TIAQVAAVAGHDHG--VAVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSHRR  118

Query  577  TKQGAALQKELIR  615
            TKQG ALQKELIR
Sbjct  119  TKQGGALQKELIR  131



>gb|AEW25885.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25897.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25907.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25923.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25940.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW25947.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
Length=125

 Score =   161 bits (408),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 100/129 (78%), Gaps = 8/129 (6%)
 Frame = +1

Query  217  ISNGHAHG-FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  393
            I+NGH    FC+       +  DPLNW AAAE+L GSHLDEVKRMVEEYR   VK+GGET
Sbjct  4    ITNGHVEATFCL-----GKNGGDPLNWGAAAESLAGSHLDEVKRMVEEYRNPLVKIGGET  58

Query  394  LTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  573
            LTIAQVA +A+      V+VELSE+ARAGVKASSDWVM  M NGTDSYGVTTGFGATSHR
Sbjct  59   LTIAQVAGIASHDSG--VRVELSESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHR  116

Query  574  RTKQGAALQ  600
            RTKQG ALQ
Sbjct  117  RTKQGGALQ  125



>gb|KHG18863.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=720

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 106/138 (77%), Gaps = 7/138 (5%)
 Frame = +1

Query  214  IISNGHAHG----FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKL  381
            I  NGH  G    FC   K  A  + DPLNW  AAE+LKGSHLDEVKRMV EYR   VKL
Sbjct  4    ITQNGHHKGSLESFCTASKG-AGGAIDPLNWGVAAESLKGSHLDEVKRMVAEYRNPLVKL  62

Query  382  GGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGA  561
            GGETLTI+QVAA+A +     VKVELSE ARAGVKAS+DWV+ GM  GTDSYGVTTGFGA
Sbjct  63   GGETLTISQVAAIATRDLG--VKVELSEDARAGVKASADWVLDGMNKGTDSYGVTTGFGA  120

Query  562  TSHRRTKQGAALQKELIR  615
            TSHRRTKQGAALQKELIR
Sbjct  121  TSHRRTKQGAALQKELIR  138



>ref|XP_010253912.1| PREDICTED: phenylalanine ammonia-lyase [Nelumbo nucifera]
Length=713

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 106/139 (76%), Gaps = 13/139 (9%)
 Frame = +1

Query  199  ENGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVK  378
            EN NG   NG    FC++Q        DPLNW  AAE+LKGSHLDEVKRMV+E+RK  V+
Sbjct  6    ENCNG---NGSLKSFCIQQ--------DPLNWEKAAESLKGSHLDEVKRMVQEFRKPVVR  54

Query  379  LGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFG  558
            LGG+TLTI+QVAA+A       VKV LSE+ARAGVKASSDWVM  M  GTDSYGVTTGFG
Sbjct  55   LGGQTLTISQVAAIATHDAG--VKVVLSESARAGVKASSDWVMESMNKGTDSYGVTTGFG  112

Query  559  ATSHRRTKQGAALQKELIR  615
            ATSHRRTKQG ALQKELIR
Sbjct  113  ATSHRRTKQGGALQKELIR  131



>gb|AFP24940.1| phenylalanine ammonia lyase [Prunus salicina]
Length=717

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 106/142 (75%), Gaps = 16/142 (11%)
 Frame = +1

Query  208  NGIISNGHAHG------FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKA  369
            N I  NGH +G       C+++        DPLNW  AAE LKGSHLDEVKRMV EYRK 
Sbjct  4    NSIKQNGHQNGSLESSELCIKK--------DPLNWGVAAETLKGSHLDEVKRMVAEYRKP  55

Query  370  TVKLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTT  549
             VKLGGE+LTI+QVAA+A       VKVELSE+ARAGVKASSDWVM  M  GTDSYGVTT
Sbjct  56   VVKLGGESLTISQVAAIATHDSG--VKVELSESARAGVKASSDWVMDSMSKGTDSYGVTT  113

Query  550  GFGATSHRRTKQGAALQKELIR  615
            GFGATSHRRTKQGAALQKELIR
Sbjct  114  GFGATSHRRTKQGAALQKELIR  135



>sp|O64963.1|PAL1_PRUAV RecName: Full=Phenylalanine ammonia-lyase 1 [Prunus avium]
 gb|AAC78457.1| phenylalanine ammonia-lyase [Prunus avium]
Length=717

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 106/142 (75%), Gaps = 16/142 (11%)
 Frame = +1

Query  208  NGIISNGHAHG------FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKA  369
            N I  NGH +G       C+++        DPLNW  AAE LKGSHLDEVKRMV EYRK 
Sbjct  4    NSIKQNGHKNGSVELPELCIKK--------DPLNWGVAAETLKGSHLDEVKRMVAEYRKP  55

Query  370  TVKLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTT  549
             VKLGGE+LTI+QVAA+A       VKVELSE+ARAGVKASSDWVM  M  GTDSYGVTT
Sbjct  56   VVKLGGESLTISQVAAIATHDSG--VKVELSESARAGVKASSDWVMDSMSKGTDSYGVTT  113

Query  550  GFGATSHRRTKQGAALQKELIR  615
            GFGATSHRRTKQGAALQKELIR
Sbjct  114  GFGATSHRRTKQGAALQKELIR  135



>ref|XP_010662173.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Vitis vinifera]
Length=178

 Score =   163 bits (412),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 97/125 (78%), Gaps = 11/125 (9%)
 Frame = +1

Query  241  FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaav  420
            FCV          DPLNW  AAE LKGSHLDEVKRMV EYRK  V+LGGETLTI+QVAA+
Sbjct  15   FCVS---------DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAI  65

Query  421  aaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQ  600
            A + G  +V VELSE ARAGV ASS+WVM  M  GTDSYGVTTGFGATSHRRTKQG ALQ
Sbjct  66   AGREG--DVNVELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQ  123

Query  601  KELIR  615
            KELIR
Sbjct  124  KELIR  128



>gb|AIY26016.1| PAL [Jasminum sambac]
Length=712

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 103/132 (78%), Gaps = 11/132 (8%)
 Frame = +1

Query  220  SNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLT  399
            SNG +  FCV+         DPLNW  AAEALKGSHLDEVKRMVEE+RK  VKLGGETLT
Sbjct  10   SNGKSMDFCVK---------DPLNWGMAAEALKGSHLDEVKRMVEEFRKPVVKLGGETLT  60

Query  400  IaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRT  579
            ++QVAA+AA+     V VELSE AR GVKASSDWVM  M  GTDSYGVTTGFGATSHRRT
Sbjct  61   VSQVAAIAARDNA--VTVELSETARGGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRT  118

Query  580  KQGAALQKELIR  615
            KQG ALQKELIR
Sbjct  119  KQGGALQKELIR  130



>dbj|BAA95629.1| phenylalanine ammonia lyase [Catharanthus roseus]
Length=716

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 106/136 (78%), Gaps = 10/136 (7%)
 Frame = +1

Query  208  NGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGG  387
            NG I+NG    FC++         DPLNW  AA++LKGSHLDEVKRMV E+RK  VKLGG
Sbjct  9    NGHINNGEVLDFCLK---------DPLNWGMAADSLKGSHLDEVKRMVAEFRKPVVKLGG  59

Query  388  ETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATS  567
            ETLTI+QVAA+AA+     VKVELSE ARAGVKASSDWVM  M  GTDSYGVTTGFGATS
Sbjct  60   ETLTISQVAAIAARDYN-AVKVELSEDARAGVKASSDWVMESMNKGTDSYGVTTGFGATS  118

Query  568  HRRTKQGAALQKELIR  615
            HRRTKQG ALQKELIR
Sbjct  119  HRRTKQGGALQKELIR  134



>gb|KJB36583.1| hypothetical protein B456_006G166000 [Gossypium raimondii]
Length=720

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 106/138 (77%), Gaps = 7/138 (5%)
 Frame = +1

Query  214  IISNGHAHG----FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKL  381
            I  NGH  G    FC   K  A  + DPLNW  AAE+LKGSHLDEVKRMV EYR   VKL
Sbjct  4    ITQNGHHKGSLESFCTASKG-AGGAVDPLNWGVAAESLKGSHLDEVKRMVAEYRNPLVKL  62

Query  382  GGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGA  561
            GGETLTI+QVAA+A +     VKVELSE ARAGVKAS+DWV+ GM  GTDSYGVTTGFGA
Sbjct  63   GGETLTISQVAAIATRDLG--VKVELSEDARAGVKASADWVLDGMNKGTDSYGVTTGFGA  120

Query  562  TSHRRTKQGAALQKELIR  615
            TSHRRTKQGAALQKELIR
Sbjct  121  TSHRRTKQGAALQKELIR  138



>sp|P27991.1|PAL1_SOYBN RecName: Full=Phenylalanine ammonia-lyase 1 [Glycine max]
 emb|CAA37129.1| phenylalanine ammonia-lyase [Glycine max]
Length=713

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 107/133 (80%), Gaps = 6/133 (5%)
 Frame = +1

Query  220  SNGHAHG-FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETL  396
            +NGH +G FC+     A  ++DPLNW AAAEA+KGSHLDEVKRMV EYRK  V+LGGETL
Sbjct  4    TNGHQNGSFCLST---AKGNNDPLNWGAAAEAMKGSHLDEVKRMVAEYRKPVVRLGGETL  60

Query  397  TIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRR  576
            TIAQVAAVA       V VELSE+AR GVKASS+WVM  M NGTDSYGVTTGFGATSHRR
Sbjct  61   TIAQVAAVAGHDHG--VAVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSHRR  118

Query  577  TKQGAALQKELIR  615
            TKQG ALQKELIR
Sbjct  119  TKQGGALQKELIR  131



>ref|XP_004143259.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
 ref|XP_004156290.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
Length=705

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 100/116 (86%), Gaps = 2/116 (2%)
 Frame = +1

Query  268  SSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEV  447
            S +HDPLNW  AAE+LKGSHLDEVKRMVEEYR+  VKLGGETLTI+QVAA+A +    +V
Sbjct  10   SFTHDPLNWGVAAESLKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVAAIATRDF--DV  67

Query  448  KVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIR  615
             VELSE+ARAGVKASSDWVM  M+ GTDSYGVTTGFGATSHRRTK G ALQKELIR
Sbjct  68   TVELSESARAGVKASSDWVMESMKKGTDSYGVTTGFGATSHRRTKNGGALQKELIR  123



>ref|XP_007162754.1| hypothetical protein PHAVU_001G1777001g, partial [Phaseolus vulgaris]
 gb|ESW34748.1| hypothetical protein PHAVU_001G1777001g, partial [Phaseolus vulgaris]
Length=411

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 105/134 (78%), Gaps = 7/134 (5%)
 Frame = +1

Query  217  ISNGHAH-GFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  393
            ++N H +  FC+   +    + DPLNW  AAEALKGSHLDEVKRMV EYR+  V+LGGET
Sbjct  6    LTNAHQNCSFCLPSAK----TTDPLNWGTAAEALKGSHLDEVKRMVAEYRQPLVRLGGET  61

Query  394  LTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  573
            LTIAQVAAV+       V+VELSE+AR GVKASSDWVM  M NGTDSYGVTTGFGATSHR
Sbjct  62   LTIAQVAAVSGHDQG--VRVELSESAREGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR  119

Query  574  RTKQGAALQKELIR  615
            RTKQG ALQKELIR
Sbjct  120  RTKQGGALQKELIR  133



>gb|EYU38541.1| hypothetical protein MIMGU_mgv1a001582mg [Erythranthe guttata]
Length=790

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 107/134 (80%), Gaps = 12/134 (9%)
 Frame = +1

Query  223  NGH---AHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  393
            NGH    +GFCV+Q       +DPLNW  AAE+LKGSHLDEVKRMV E+RK  VKLGGET
Sbjct  85   NGHHAAGNGFCVQQ-------NDPLNWGMAAESLKGSHLDEVKRMVAEFRKPVVKLGGET  137

Query  394  LTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  573
            LTI+QVAA+AA+     V VEL+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHR
Sbjct  138  LTISQVAAIAARDNA--VAVELNESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHR  195

Query  574  RTKQGAALQKELIR  615
            RTKQG ALQKELIR
Sbjct  196  RTKQGGALQKELIR  209



>ref|XP_004143258.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
 ref|XP_004156291.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
 gb|KGN48163.1| hypothetical protein Csa_6G445760 [Cucumis sativus]
Length=713

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 103/131 (79%), Gaps = 9/131 (7%)
 Frame = +1

Query  223  NGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTI  402
            NG     C+        S+DPLNW  AAE+LKGSHLDEVKRMVEEYR+  VKLGGETLTI
Sbjct  10   NGSVESLCI-------GSNDPLNWGVAAESLKGSHLDEVKRMVEEYRRPLVKLGGETLTI  62

Query  403  aqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTK  582
            +QVAA+A +    +V VELSE++RAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTK
Sbjct  63   SQVAAIATRDT--DVIVELSESSRAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTK  120

Query  583  QGAALQKELIR  615
            QG ALQKELIR
Sbjct  121  QGGALQKELIR  131



>ref|NP_001236956.1| phenylalanine ammonia-lyase 2 [Glycine max]
 gb|ACS88364.1| phenylalanine ammonia-lyase 2 [Glycine max]
 gb|ACU30058.1| phenylalanine ammonia-lyase 2 [Glycine max]
Length=717

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 106/133 (80%), Gaps = 3/133 (2%)
 Frame = +1

Query  220  SNGHAHGFCVEQKRRAS-SSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETL  396
            +N     FCV        S++DPLNW AAAEA+ GSHLDEVKRM+EEYR+  VKLGGETL
Sbjct  5    ANAANTNFCVNVSNNGYISANDPLNWGAAAEAMAGSHLDEVKRMLEEYRRPVVKLGGETL  64

Query  397  TIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRR  576
            TI+QVAA+AA      VKVEL+E++RAGVKASSDWVM  M  GTDSYGVTTGFGATSHRR
Sbjct  65   TISQVAAIAAHDQG--VKVELAESSRAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRR  122

Query  577  TKQGAALQKELIR  615
            TKQGAALQKELIR
Sbjct  123  TKQGAALQKELIR  135



>gb|ABI93975.1| putative phenylalanine ammonia-lyase, partial [Rhizophora mangle]
Length=579

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 103/131 (79%), Gaps = 5/131 (4%)
 Frame = +1

Query  223  NGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTI  402
            NG     C  +  R    HDPLNW  AAE+LKGSHLDEVKRMV EYRK  VKLGGETLTI
Sbjct  11   NGSLDSLCTTKPPR----HDPLNWGVAAESLKGSHLDEVKRMVAEYRKHVVKLGGETLTI  66

Query  403  aqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTK  582
            AQVAA++    +  + VEL+E+ARAGVKASSDWVM GM  GTDSYGVTTGFGATSHRRTK
Sbjct  67   AQVAAISRGVDS-GITVELAESARAGVKASSDWVMDGMTKGTDSYGVTTGFGATSHRRTK  125

Query  583  QGAALQKELIR  615
            QG+ALQ+ELIR
Sbjct  126  QGSALQRELIR  136



>gb|AAF40224.1|AF237955_1 phenylalanine ammonia-lyase 2 [Rubus idaeus]
Length=730

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 106/138 (77%), Gaps = 4/138 (3%)
 Frame = +1

Query  208  NGIISNGHAHGFCV--EQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKL  381
            NGI +     G C+  E  +   S  DPLNW AAAE++ GSHLDEV+RMV EYRK  VKL
Sbjct  13   NGIQNGSLDDGLCIKTESIKTGYSVSDPLNWGAAAESMTGSHLDEVRRMVAEYRKPVVKL  72

Query  382  GGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGA  561
            GGETLTI+QVAA+A       VKVEL+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGA
Sbjct  73   GGETLTISQVAAIANHDSG--VKVELAESARAGVKASSDWVMDSMNKGTDSYGVTTGFGA  130

Query  562  TSHRRTKQGAALQKELIR  615
            TSHRRTKQGAALQKELIR
Sbjct  131  TSHRRTKQGAALQKELIR  148



>emb|CAA44817.1| phenylalanine ammonia-lyase [Solanum tuberosum]
Length=138

 Score =   161 bits (407),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 102/135 (76%), Gaps = 2/135 (1%)
 Frame = +1

Query  214  IISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  393
            I  NGH +G  VE+     S HDPLNW  A ++L+GSHLDEVK+MV+E+RK  VKL GET
Sbjct  5    IAQNGHVNGE-VEEVLWKKSIHDPLNWEMAVDSLRGSHLDEVKKMVDEFRKPIVKLWGET  63

Query  394  LTIaqvaa-vaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSH  570
            LT+AQVA+   A   T   KVELSE+ARAGVKASSDWVM  M  GTDSYGVTTGF ATSH
Sbjct  64   LTVAQVASIANADNKTSGFKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFCATSH  123

Query  571  RRTKQGAALQKELIR  615
            RRTK G ALQKELI+
Sbjct  124  RRTKNGGALQKELIK  138



>sp|P45730.1|PALY_POPTR RecName: Full=Phenylalanine ammonia-lyase [Populus trichocarpa]
 pir||JQ2265 phenylalanine ammonia-lyase (EC 4.3.1.5) - western balsam poplar 
x cottonwood
 gb|AAA33805.1| phenylalanine ammonia lyase [Populus trichocarpa x Populus deltoides]
Length=715

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 103/131 (79%), Gaps = 8/131 (6%)
 Frame = +1

Query  223  NGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTI  402
            NG     CV Q+       DPL+W  AAEA+KGSHLDEVKRMV +YRK  VKLGGETLTI
Sbjct  11   NGSLESLCVNQR-------DPLSWGVAAEAMKGSHLDEVKRMVADYRKPVVKLGGETLTI  63

Query  403  aqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTK  582
            AQVA++A    T +VKVELSE+AR GVKASSDWVM  M+ GTDSYGVTTGFGATSHRRTK
Sbjct  64   AQVASIAGHD-TGDVKVELSESARPGVKASSDWVMDSMDKGTDSYGVTTGFGATSHRRTK  122

Query  583  QGAALQKELIR  615
            QG ALQKELIR
Sbjct  123  QGGALQKELIR  133



>ref|XP_003521396.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Glycine max]
Length=716

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 107/134 (80%), Gaps = 6/134 (4%)
 Frame = +1

Query  217  ISNGHAHG-FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  393
            I+NG  +G FC+   + +S   DPLNW AAAEA+KGSHLDEVKRMV EYRK  V+LGGET
Sbjct  6    ITNGSQNGSFCLSTTKGSS---DPLNWGAAAEAMKGSHLDEVKRMVAEYRKPVVRLGGET  62

Query  394  LTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  573
            LTIAQVAAVA       V VELSE+AR GVKASS+WVM  M NGTDSYGVTTGFGATSHR
Sbjct  63   LTIAQVAAVAGHDLG--VAVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSHR  120

Query  574  RTKQGAALQKELIR  615
            RTKQG ALQKELIR
Sbjct  121  RTKQGGALQKELIR  134



>gb|ABQ63094.1| phenylalanine ammonia-lyase [Astragalus membranaceus]
Length=718

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 105/133 (79%), Gaps = 3/133 (2%)
 Frame = +1

Query  220  SNGHAHGFCVEQKRRASSSH-DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETL  396
            +NGH      E +   S +  DPLNW  AAEALKGSHLDEVKRMVEEYR   VK+GGETL
Sbjct  6    ANGHVSNHVTEAEYCISKAGGDPLNWGVAAEALKGSHLDEVKRMVEEYRNPVVKIGGETL  65

Query  397  TIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRR  576
            TIAQVA +A+  G   VKVELSE+ARAGVKASSDWVM  M NGTDSYGVTTGFGATSHRR
Sbjct  66   TIAQVAGIASHDGG--VKVELSESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRR  123

Query  577  TKQGAALQKELIR  615
            TKQG ALQKELIR
Sbjct  124  TKQGGALQKELIR  136



>gb|AFR41032.1| phenylalanine ammonia-lyase, partial [Populus alba]
 gb|AFR41034.1| phenylalanine ammonia-lyase, partial [Populus alba]
Length=127

 Score =   160 bits (405),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 95/122 (78%), Gaps = 2/122 (2%)
 Frame = +1

Query  244  CVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaava  423
            C        + +DPLNW+ AAE+LKGSHLDEVKRM++EYRK  VKLGGETLTI QV A+A
Sbjct  8    CTGNGSLGFNPNDPLNWSMAAESLKGSHLDEVKRMIDEYRKPVVKLGGETLTIGQVTAIA  67

Query  424  aqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQK  603
            ++     VKVELSE AR GVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG  LQK
Sbjct  68   SRDVG--VKVELSEEARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGELQK  125

Query  604  EL  609
            EL
Sbjct  126  EL  127



>gb|AFR41033.1| phenylalanine ammonia-lyase, partial [Populus alba]
Length=127

 Score =   160 bits (405),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 94/122 (77%), Gaps = 2/122 (2%)
 Frame = +1

Query  244  CVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaava  423
            C        + +DPLNW  AAE+LKGSHLDEVKRM++EYRK  VKLGGETLTI QV A+A
Sbjct  8    CTGNGSLGFNPNDPLNWGMAAESLKGSHLDEVKRMIDEYRKPVVKLGGETLTIGQVTAIA  67

Query  424  aqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQK  603
            ++     VKVELSE AR GVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG  LQK
Sbjct  68   SRDVG--VKVELSEXARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGELQK  125

Query  604  EL  609
            EL
Sbjct  126  EL  127



>gb|AHJ60264.1| phenylalanine ammonia-lyase 1 [Ipomoea purpurea]
Length=707

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 106/135 (79%), Gaps = 10/135 (7%)
 Frame = +1

Query  211  GIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGE  390
            G I NGH + FC++         DPLNW  AA++LKGSHLDEVKRMV E+R   VK+GG+
Sbjct  3    GAIENGHTNDFCIKV--------DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQ  54

Query  391  TLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSH  570
            TLT+AQVAA+AA+     VKVELSEAARAGVKASSDWVM  M NGTDSYGVTTGFGATSH
Sbjct  55   TLTVAQVAAIAARDNA--VKVELSEAARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  112

Query  571  RRTKQGAALQKELIR  615
            RRTK G ALQ+ELIR
Sbjct  113  RRTKNGHALQQELIR  127



>ref|XP_003554382.1| PREDICTED: phenylalanine ammonia-lyase 1-like isoform 1 [Glycine 
max]
Length=712

 Score =   172 bits (435),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 106/133 (80%), Gaps = 7/133 (5%)
 Frame = +1

Query  220  SNGHAHG-FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETL  396
            +NGH +G FC+     ++   DPLNW AAAEA+KGSHLDEVKRMV EYRK  V+LGGETL
Sbjct  4    TNGHQNGSFCLS----STKGSDPLNWGAAAEAMKGSHLDEVKRMVSEYRKPVVRLGGETL  59

Query  397  TIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRR  576
            TIAQVAAVA       V VELSE+AR GVKASS+WVM  M NGTDSYGVTTGFGATSHRR
Sbjct  60   TIAQVAAVAGHDHG--VTVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSHRR  117

Query  577  TKQGAALQKELIR  615
            TKQG ALQKELIR
Sbjct  118  TKQGGALQKELIR  130



>ref|XP_007208432.1| hypothetical protein PRUPE_ppa002099mg [Prunus persica]
 gb|EMJ09631.1| hypothetical protein PRUPE_ppa002099mg [Prunus persica]
Length=717

 Score =   172 bits (435),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 104/141 (74%), Gaps = 14/141 (10%)
 Frame = +1

Query  208  NGIISNGHAHGFCVEQKRRASSSH-----DPLNWNAAAEALKGSHLDEVKRMVEEYRKAT  372
            N I  NGH       Q R   SS      DPLNW  AAE LKGSHLDEVKRMV EYRK  
Sbjct  4    NSIKQNGH-------QNRSLESSELCIKKDPLNWGVAAETLKGSHLDEVKRMVAEYRKPV  56

Query  373  VKLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTG  552
            VKLGGE+LTI+QVAA+A       VKVELSE+ARAGVKASSDWVM  M  GTDSYGVTTG
Sbjct  57   VKLGGESLTISQVAAIATHDSG--VKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTG  114

Query  553  FGATSHRRTKQGAALQKELIR  615
            FGATSHRRTKQGAALQKELIR
Sbjct  115  FGATSHRRTKQGAALQKELIR  135



>gb|AFR41030.1| phenylalanine ammonia-lyase, partial [Populus alba]
Length=127

 Score =   160 bits (404),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 94/122 (77%), Gaps = 2/122 (2%)
 Frame = +1

Query  244  CVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaava  423
            C        + +DPLNW  AAE+LKGSHLDEVKRM++EYRK  VKLGGETLTI QV A+A
Sbjct  8    CTGNGSLGFNPNDPLNWGMAAESLKGSHLDEVKRMIDEYRKPVVKLGGETLTIGQVTAIA  67

Query  424  aqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQK  603
            ++     VKVELSE AR GVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG  LQK
Sbjct  68   SRDVG--VKVELSEEARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGELQK  125

Query  604  EL  609
            EL
Sbjct  126  EL  127



>gb|ABD42947.1| phenylalanine ammonia lyase [Acacia auriculiformis x Acacia mangium]
Length=714

 Score =   172 bits (435),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 104/128 (81%), Gaps = 5/128 (4%)
 Frame = +1

Query  232  AHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqv  411
            A  FC+     A+   DPLNW  AAE+LKGSHLDEVKRMVEE+RK  V+LGGETLTI+QV
Sbjct  11   ADSFCLSGGVAAA---DPLNWGVAAESLKGSHLDEVKRMVEEFRKPVVRLGGETLTISQV  67

Query  412  aavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGA  591
            AA+AA      VKVELSE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQGA
Sbjct  68   AAIAAHDQG--VKVELSESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGA  125

Query  592  ALQKELIR  615
            ALQKELIR
Sbjct  126  ALQKELIR  133



>emb|CBI31445.3| unnamed protein product [Vitis vinifera]
Length=578

 Score =   171 bits (432),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 110/142 (77%), Gaps = 5/142 (4%)
 Frame = +1

Query  196  MENGNGIISNGHA--HGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKA  369
            + NGN   +NG A    FC+      +++ DPLNWN AAE+LKGSHLDEVKRMVEEYR+ 
Sbjct  3    LSNGNHCHTNGKASIESFCMGDTGTKAAA-DPLNWNMAAESLKGSHLDEVKRMVEEYRRQ  61

Query  370  TVKLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTT  549
             V+LGGETLTI+QVAAVA++     V VELSE AR GVKASSDWVM  M NGTDSYGVTT
Sbjct  62   VVQLGGETLTISQVAAVASRDTG--VTVELSEEAREGVKASSDWVMDSMNNGTDSYGVTT  119

Query  550  GFGATSHRRTKQGAALQKELIR  615
            GFGATSHRRTKQG ALQ ELIR
Sbjct  120  GFGATSHRRTKQGGALQMELIR  141



>emb|CAA44609.1| phenylalanine ammonia-lyase [Arabidopsis thaliana]
Length=240

 Score =   163 bits (413),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 97/123 (79%), Gaps = 2/123 (2%)
 Frame = +1

Query  247  VEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaa  426
            ++ K    ++ DPLNW AAAE +KGSHLDEVKRMV E+RK  V LGGETLTI QVAA++ 
Sbjct  23   IKTKNMVINAEDPLNWGAAAEQMKGSHLDEVKRMVAEFRKPVVNLGGETLTIGQVAAIST  82

Query  427  qggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKE  606
             G +  VKVELSE ARAGV ASSDWVM  M  GTDSYGVTTGFGATSHRRTK G ALQKE
Sbjct  83   IGNS--VKVELSETARAGVNASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGVALQKE  140

Query  607  LIR  615
            LIR
Sbjct  141  LIR  143



>gb|AFR41029.1| phenylalanine ammonia-lyase, partial [Populus alba]
 gb|AFR41031.1| phenylalanine ammonia-lyase, partial [Populus alba]
 gb|AFR41035.1| phenylalanine ammonia-lyase, partial [Populus alba]
Length=127

 Score =   160 bits (404),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 94/122 (77%), Gaps = 2/122 (2%)
 Frame = +1

Query  244  CVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaava  423
            C        + +DPLNW  AAE+LKGSHLDEVKRM++EYRK  VKLGGETLTI QV A+A
Sbjct  8    CTGNGSLGFNPNDPLNWXMAAESLKGSHLDEVKRMIDEYRKPVVKLGGETLTIGQVTAIA  67

Query  424  aqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQK  603
            ++     VKVELSE AR GVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG  LQK
Sbjct  68   SRDVG--VKVELSEEARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGELQK  125

Query  604  EL  609
            EL
Sbjct  126  EL  127



>ref|XP_004497516.1| PREDICTED: phenylalanine ammonia-lyase-like [Cicer arietinum]
Length=715

 Score =   171 bits (434),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 107/136 (79%), Gaps = 8/136 (6%)
 Frame = +1

Query  211  GIISNGHAHG-FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGG  387
            G +SNGHA   FC+ +     +  DPLNW  AA+++KGSHLDEVKRMVEEYR   V++GG
Sbjct  5    GALSNGHAQPTFCLTK-----TLPDPLNWGVAADSMKGSHLDEVKRMVEEYRNPIVRIGG  59

Query  388  ETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATS  567
            ETLTIAQVA +A+      V+VELSE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATS
Sbjct  60   ETLTIAQVAGIASHDSG--VRVELSESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATS  117

Query  568  HRRTKQGAALQKELIR  615
            HRRTKQG ALQKELIR
Sbjct  118  HRRTKQGGALQKELIR  133



>ref|XP_008243955.1| PREDICTED: phenylalanine ammonia-lyase 1 [Prunus mume]
Length=717

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 106/142 (75%), Gaps = 16/142 (11%)
 Frame = +1

Query  208  NGIISNGHAHG------FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKA  369
            N I  NGH +G       C+++        DPLNW  AAE LKGSHLDEVKRMV EYRK 
Sbjct  4    NSIKQNGHQNGSLESSELCIKK--------DPLNWGVAAETLKGSHLDEVKRMVAEYRKP  55

Query  370  TVKLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTT  549
             VKLGGE+LTI+QVAA+A       VKVELSE+A+AGVKASSDWVM  M  GTDSYGVTT
Sbjct  56   VVKLGGESLTISQVAAIATHDSG--VKVELSESAQAGVKASSDWVMDSMSKGTDSYGVTT  113

Query  550  GFGATSHRRTKQGAALQKELIR  615
            GFGATSHRRTKQGAALQKELIR
Sbjct  114  GFGATSHRRTKQGAALQKELIR  135



>gb|AEW25903.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
Length=125

 Score =   159 bits (403),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 100/129 (78%), Gaps = 8/129 (6%)
 Frame = +1

Query  217  ISNGHAHG-FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  393
            I+NGH    FC+ +     +  DPLNW AAAE+L GSHLDEVKRMVEEYR   VK+GGET
Sbjct  4    ITNGHVEATFCLSK-----NGGDPLNWGAAAESLTGSHLDEVKRMVEEYRNPLVKIGGET  58

Query  394  LTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  573
            LTIAQVA +A+      V+VELSE+ARA VKASSDWVM  M NGTDSYGVTTGFGATSHR
Sbjct  59   LTIAQVAGIASHDSG--VRVELSESARAXVKASSDWVMDSMNNGTDSYGVTTGFGATSHR  116

Query  574  RTKQGAALQ  600
            RTKQG ALQ
Sbjct  117  RTKQGGALQ  125



>gb|AEW25890.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
Length=125

 Score =   159 bits (403),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 100/129 (78%), Gaps = 8/129 (6%)
 Frame = +1

Query  217  ISNGHAHG-FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  393
            I+NGH    FC+ +     +  DPLNW AAAE+L GSHLDEVK MVEEYR   VK+GGET
Sbjct  4    ITNGHVEATFCLXK-----NGGDPLNWGAAAESLXGSHLDEVKXMVEEYRNPLVKIGGET  58

Query  394  LTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  573
            LTIAQVA +A+      V+VELSE+ARAGVKASSDWVM  M NGTDSYGVTTGFGATSHR
Sbjct  59   LTIAQVAGIASHDSG--VRVELSESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHR  116

Query  574  RTKQGAALQ  600
            RTKQG ALQ
Sbjct  117  RTKQGGALQ  125



>ref|XP_003590471.1| Phenylalanine ammonia-lyase [Medicago truncatula]
 gb|AES60722.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=712

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 105/134 (78%), Gaps = 8/134 (6%)
 Frame = +1

Query  217  ISNGHAHG-FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  393
            I+NGH    FC+ +     +  DPLNW AAAE+L GSHLDEVKRMVEEYR   VK+GGET
Sbjct  4    ITNGHVEATFCLSK-----NGGDPLNWGAAAESLTGSHLDEVKRMVEEYRNPLVKIGGET  58

Query  394  LTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  573
            LTIAQVA +A+      V+VELSE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHR
Sbjct  59   LTIAQVAGIASHDSG--VRVELSESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHR  116

Query  574  RTKQGAALQKELIR  615
            RTKQG ALQKELIR
Sbjct  117  RTKQGGALQKELIR  130



>ref|XP_003542541.1| PREDICTED: phenylalanine ammonia-lyase class 2-like [Glycine 
max]
Length=716

 Score =   171 bits (433),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 108/132 (82%), Gaps = 4/132 (3%)
 Frame = +1

Query  223  NGHAHGFCVEQKRRAS-SSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLT  399
            NG+ + FC+        S++DPLNW AAAEA+ GSHLDEVKRMVEEYR+  VKLGGETLT
Sbjct  6    NGNTN-FCMSVNNNGYISANDPLNWGAAAEAMAGSHLDEVKRMVEEYRRPVVKLGGETLT  64

Query  400  IaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRT  579
            I+QVAA+AA      VKVEL+E++RAGVKASSDWVM  M+ GTDSYGVTTGFGATSHRRT
Sbjct  65   ISQVAAIAAHDQG--VKVELAESSRAGVKASSDWVMESMDKGTDSYGVTTGFGATSHRRT  122

Query  580  KQGAALQKELIR  615
            KQG ALQKELIR
Sbjct  123  KQGGALQKELIR  134



>gb|AIL23235.1| phenylalanine ammonia-lyase [Astragalus chrysochlorus]
Length=719

 Score =   171 bits (433),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 108/140 (77%), Gaps = 8/140 (6%)
 Frame = +1

Query  199  ENGNGIISNGHAHG-FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATV  375
            E  NG +SN      FC+ +     +  DPLNW  AAEA+KGSHLDEVKRMVE+YR   V
Sbjct  4    EGANGHVSNNVTEAEFCITK-----TGGDPLNWGVAAEAMKGSHLDEVKRMVEQYRNPVV  58

Query  376  KLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGF  555
            K+GGETLT+AQVA +A+  G   VKVELSE+ARAGVKASSDWVM  M NGTDSYGVTTGF
Sbjct  59   KIGGETLTVAQVAGIASHDGG--VKVELSESARAGVKASSDWVMNSMNNGTDSYGVTTGF  116

Query  556  GATSHRRTKQGAALQKELIR  615
            GATSHRRTKQG ALQKELIR
Sbjct  117  GATSHRRTKQGGALQKELIR  136



>ref|XP_006407580.1| hypothetical protein EUTSA_v10020168mg [Eutrema salsugineum]
 gb|ESQ49033.1| hypothetical protein EUTSA_v10020168mg [Eutrema salsugineum]
Length=708

 Score =   171 bits (433),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 101/117 (86%), Gaps = 4/117 (3%)
 Frame = +1

Query  265  ASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPE  444
            A+ S DPLNWN+AAEALKGSHL+EVKRMVEEYRK TVKLGGETLTI QVAAVA+ G T  
Sbjct  12   AAVSDDPLNWNSAAEALKGSHLEEVKRMVEEYRKGTVKLGGETLTIGQVAAVASGGVT--  69

Query  445  VKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIR  615
              VEL+E ARAGVKASS+WVM  M  GTDSYGVTTGFGATSHRRTKQG ALQKELIR
Sbjct  70   --VELAEEARAGVKASSEWVMESMNRGTDSYGVTTGFGATSHRRTKQGGALQKELIR  124



>ref|XP_006407581.1| hypothetical protein EUTSA_v10020168mg [Eutrema salsugineum]
 gb|ESQ49034.1| hypothetical protein EUTSA_v10020168mg [Eutrema salsugineum]
Length=706

 Score =   171 bits (433),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 101/117 (86%), Gaps = 4/117 (3%)
 Frame = +1

Query  265  ASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPE  444
            A+ S DPLNWN+AAEALKGSHL+EVKRMVEEYRK TVKLGGETLTI QVAAVA+ G T  
Sbjct  12   AAVSDDPLNWNSAAEALKGSHLEEVKRMVEEYRKGTVKLGGETLTIGQVAAVASGGVT--  69

Query  445  VKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIR  615
              VEL+E ARAGVKASS+WVM  M  GTDSYGVTTGFGATSHRRTKQG ALQKELIR
Sbjct  70   --VELAEEARAGVKASSEWVMESMNRGTDSYGVTTGFGATSHRRTKQGGALQKELIR  124



>ref|XP_010658395.1| PREDICTED: phenylalanine ammonia-lyase G1 [Vitis vinifera]
Length=723

 Score =   171 bits (433),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 110/142 (77%), Gaps = 5/142 (4%)
 Frame = +1

Query  196  MENGNGIISNGHA--HGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKA  369
            + NGN   +NG A    FC+      +++ DPLNWN AAE+LKGSHLDEVKRMVEEYR+ 
Sbjct  3    LSNGNHCHTNGKASIESFCMGDTGTKAAA-DPLNWNMAAESLKGSHLDEVKRMVEEYRRQ  61

Query  370  TVKLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTT  549
             V+LGGETLTI+QVAAVA++     V VELSE AR GVKASSDWVM  M NGTDSYGVTT
Sbjct  62   VVQLGGETLTISQVAAVASRDTG--VTVELSEEAREGVKASSDWVMDSMNNGTDSYGVTT  119

Query  550  GFGATSHRRTKQGAALQKELIR  615
            GFGATSHRRTKQG ALQ ELIR
Sbjct  120  GFGATSHRRTKQGGALQMELIR  141



>gb|ACF94716.1| phenylalanine ammonia lyase [Robinia pseudoacacia]
Length=719

 Score =   171 bits (433),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 108/137 (79%), Gaps = 9/137 (7%)
 Frame = +1

Query  217  ISNGHAHG----FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLG  384
            +SNG+        C++     ++S DPLNW  AAE++KGSHLDEVKRMVEEYR   V++G
Sbjct  6    VSNGYHQSQNGSLCLKSN---NTSSDPLNWGVAAESMKGSHLDEVKRMVEEYRNPVVRIG  62

Query  385  GETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGAT  564
            GETLTI+QVAA+A +    +V +ELSE+ARAGVKASSDWVM  M NGTDSYGVTTGFGAT
Sbjct  63   GETLTISQVAAIATRDQ--DVSLELSESARAGVKASSDWVMNSMNNGTDSYGVTTGFGAT  120

Query  565  SHRRTKQGAALQKELIR  615
            SHRRTKQG ALQKELIR
Sbjct  121  SHRRTKQGGALQKELIR  137



>ref|XP_007027354.1| PHE ammonia lyase 1 [Theobroma cacao]
 gb|EOY07856.1| PHE ammonia lyase 1 [Theobroma cacao]
Length=722

 Score =   171 bits (433),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 103/132 (78%), Gaps = 3/132 (2%)
 Frame = +1

Query  223  NGHAHGFCVEQKRRASSSH-DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLT  399
            NG    FC         +  DPLNW A AE+LKGSHLDEVKRMV EYRK +VKLGGETLT
Sbjct  11   NGSLESFCTTASTATKGAVVDPLNWGATAESLKGSHLDEVKRMVAEYRKPSVKLGGETLT  70

Query  400  IaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRT  579
            I+QVAA+A +     VKVELSE ARAGVKAS+DWV+ GM  GTDSYGVTTGFGATSHRRT
Sbjct  71   ISQVAAIATRDLG--VKVELSEDARAGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRT  128

Query  580  KQGAALQKELIR  615
            KQGAALQKELIR
Sbjct  129  KQGAALQKELIR  140



>gb|AEW25894.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
x varia]
 gb|AEW25924.1| phenylalanine ammonia-lyase, partial [Medicago sativa subsp. 
caerulea]
Length=125

 Score =   159 bits (402),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 100/129 (78%), Gaps = 8/129 (6%)
 Frame = +1

Query  217  ISNGHAHG-FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  393
            I+NG     FC+ +     +  DPLNW AAAE+L GSHLDEVKRMVEEYR   VK+GGET
Sbjct  4    ITNGXVEATFCLSK-----NGGDPLNWGAAAESLAGSHLDEVKRMVEEYRNPLVKIGGET  58

Query  394  LTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  573
            LTIAQVA +A+      V+VELSE+ARAGVKASSDWVM  M NGTDSYGVTTGFGATSHR
Sbjct  59   LTIAQVAGIASHDSG--VRVELSESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHR  116

Query  574  RTKQGAALQ  600
            RTKQG ALQ
Sbjct  117  RTKQGGALQ  125



>gb|AAW51923.2| phenylalanine ammonia-lyase 2 [Rhizophora mangle]
Length=723

 Score =   171 bits (432),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 103/131 (79%), Gaps = 5/131 (4%)
 Frame = +1

Query  223  NGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTI  402
            NG     C  +  R    HDPLNW  AAE+LKGSHLDEVKRMV EYRK  VKLGGETLTI
Sbjct  11   NGSLDSLCTTKPPR----HDPLNWGVAAESLKGSHLDEVKRMVAEYRKHVVKLGGETLTI  66

Query  403  aqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTK  582
            AQVAA++    +  + VEL+E+ARAGVKASSDWVM GM  GTDSYGVTTGFGATSHRRTK
Sbjct  67   AQVAAISRGVDS-GITVELAESARAGVKASSDWVMDGMTKGTDSYGVTTGFGATSHRRTK  125

Query  583  QGAALQKELIR  615
            QG+ALQ+ELIR
Sbjct  126  QGSALQRELIR  136



>ref|XP_002322884.2| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63887.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEF04645.2| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=715

 Score =   171 bits (432),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 102/131 (78%), Gaps = 8/131 (6%)
 Frame = +1

Query  223  NGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTI  402
            NG     CV Q        DPL+W  AAEA+KGSHLDEVKRMV +YRK  VKLGGETLTI
Sbjct  11   NGSLESLCVNQL-------DPLSWGVAAEAMKGSHLDEVKRMVADYRKPVVKLGGETLTI  63

Query  403  aqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTK  582
            AQVA++A    T +VKVELSE+AR GVKASSDWVM  M+ GTDSYGVTTGFGATSHRRTK
Sbjct  64   AQVASIAGHD-TGDVKVELSESARPGVKASSDWVMDSMDKGTDSYGVTTGFGATSHRRTK  122

Query  583  QGAALQKELIR  615
            QG ALQKELIR
Sbjct  123  QGGALQKELIR  133



>ref|XP_008449238.1| PREDICTED: phenylalanine ammonia-lyase [Cucumis melo]
Length=708

 Score =   171 bits (432),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 97/112 (87%), Gaps = 2/112 (2%)
 Frame = +1

Query  280  DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVEL  459
            DPLNW  AAEALKGSHLDEVKRMVEEYR+  VKLGGETLTI+QVAA+A +    +V VEL
Sbjct  17   DPLNWGVAAEALKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVAAIATRDT--DVIVEL  74

Query  460  SEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIR  615
            SE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG ALQKELIR
Sbjct  75   SESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIR  126



>gb|AEV53411.1| phenylalanine ammonia-lyase 3 [Populus tomentosa]
 gb|AFZ78652.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=715

 Score =   171 bits (432),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 106/138 (77%), Gaps = 12/138 (9%)
 Frame = +1

Query  214  IISNGHAHG----FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKL  381
            +  NGH +G     C+ Q        DPL+W  AAEA+KGSHLDEVKRMV +YRK  VKL
Sbjct  4    VTKNGHQNGSLESLCINQL-------DPLSWGVAAEAMKGSHLDEVKRMVADYRKPVVKL  56

Query  382  GGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGA  561
            GGETLTIAQVA++A    T +VKVELSE+AR GVKASSDWVM  M+ GTDSYGVTTGFGA
Sbjct  57   GGETLTIAQVASIAGHD-TGDVKVELSESARPGVKASSDWVMDSMDKGTDSYGVTTGFGA  115

Query  562  TSHRRTKQGAALQKELIR  615
            TSHRRTKQG ALQ+ELIR
Sbjct  116  TSHRRTKQGGALQRELIR  133



>ref|XP_009781653.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana sylvestris]
Length=712

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 104/136 (76%), Gaps = 9/136 (7%)
 Frame = +1

Query  211  GIISNGHAH-GFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGG  387
            G+  NGH    FCV+         DPLNW  AA++LKGSHLDEVK+MV E+RK  VKLGG
Sbjct  3    GVAQNGHQEMDFCVKV--------DPLNWEMAADSLKGSHLDEVKKMVAEFRKPVVKLGG  54

Query  388  ETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATS  567
            ETLT+AQVAA+AA+     VKVELSE ARAGVKASSDWVM  M  GTDSYGVTTGFGATS
Sbjct  55   ETLTVAQVAAIAAKDNAKTVKVELSEGARAGVKASSDWVMDSMSKGTDSYGVTTGFGATS  114

Query  568  HRRTKQGAALQKELIR  615
            HRRTK G ALQKELIR
Sbjct  115  HRRTKNGGALQKELIR  130



>sp|P45733.1|PAL3_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 emb|CAA55075.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=712

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 104/136 (76%), Gaps = 9/136 (7%)
 Frame = +1

Query  211  GIISNGHAH-GFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGG  387
            G+  NGH    FCV+         DPLNW  AA++LKGSHLDEVK+MV E+RK  VKLGG
Sbjct  3    GVAQNGHQEMDFCVKV--------DPLNWEMAADSLKGSHLDEVKKMVAEFRKPVVKLGG  54

Query  388  ETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATS  567
            ETLT+AQVAA+AA+     VKVELSE ARAGVKASSDWVM  M  GTDSYGVTTGFGATS
Sbjct  55   ETLTVAQVAAIAAKDNAKTVKVELSEGARAGVKASSDWVMDSMSKGTDSYGVTTGFGATS  114

Query  568  HRRTKQGAALQKELIR  615
            HRRTK G ALQKELIR
Sbjct  115  HRRTKNGGALQKELIR  130



>dbj|BAC56977.1| phenylalanine ammonia-lyase [Daucus carota]
Length=715

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 109/139 (78%), Gaps = 15/139 (11%)
 Frame = +1

Query  199  ENGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVK  378
            ENGNG+         C++++       DPL+W  AAEALKGSHL+EVKRMV EYRK  VK
Sbjct  9    ENGNGV-------DLCMKKE-------DPLSWGVAAEALKGSHLEEVKRMVAEYRKPVVK  54

Query  379  LGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFG  558
            LGGETLTI+QVAA++A+  +  VKVELSEAARAGVKASSDWVM  M  GTDSYGVTTGFG
Sbjct  55   LGGETLTISQVAAISARDDS-GVKVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGFG  113

Query  559  ATSHRRTKQGAALQKELIR  615
            ATSHRRTKQG ALQKELIR
Sbjct  114  ATSHRRTKQGGALQKELIR  132



>emb|CDY13306.1| BnaC06g14510D [Brassica napus]
Length=210

 Score =   161 bits (408),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 97/121 (80%), Gaps = 2/121 (2%)
 Frame = +1

Query  253  QKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqg  432
            +K   + + DPLNW AAAE +KGSHLDEVKRMVEEYR+  V LGGETLTI QVAA++  G
Sbjct  18   EKTNVAVAADPLNWGAAAEQMKGSHLDEVKRMVEEYRRPVVNLGGETLTIGQVAAISTVG  77

Query  433  gTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELI  612
                VKVEL+EA+R GVKASSDWVM  M  GTDSYGVTTGFGATSHRRTK GAALQ ELI
Sbjct  78   NG--VKVELAEASRDGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGAALQTELI  135

Query  613  R  615
            R
Sbjct  136  R  136



>gb|AEW25906.1| phenylalanine ammonia-lyase, partial [Medicago falcata]
Length=125

 Score =   159 bits (401),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 97/128 (76%), Gaps = 6/128 (5%)
 Frame = +1

Query  217  ISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETL  396
            I+NGH        K       DPLNW AAAE+L GSHLDEVKRMVEEYR   VK+GGETL
Sbjct  4    ITNGHVEATXCLSKNGG----DPLNWGAAAESLTGSHLDEVKRMVEEYRNPLVKIGGETL  59

Query  397  TIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRR  576
            TIAQVA +A+      V+VELSE+ARAGVKASSDWVM  M NGTDSYGVTTGFGATSHRR
Sbjct  60   TIAQVAGIASHDSG--VRVELSESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHRR  117

Query  577  TKQGAALQ  600
            TKQG ALQ
Sbjct  118  TKQGGALQ  125



>ref|XP_004304440.1| PREDICTED: phenylalanine ammonia-lyase 1 [Fragaria vesca subsp. 
vesca]
Length=724

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 104/133 (78%), Gaps = 3/133 (2%)
 Frame = +1

Query  217  ISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETL  396
            I NG     CV+ +   + S DPLNW AAAE++ GSHLDEVKRMV EYRK  VKLGG+TL
Sbjct  14   IQNGSLDILCVKTESLKAVS-DPLNWGAAAESMTGSHLDEVKRMVAEYRKPVVKLGGKTL  72

Query  397  TIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRR  576
            TIAQVAA+A       VKVEL E+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRR
Sbjct  73   TIAQVAAIANHDSG--VKVELDESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRR  130

Query  577  TKQGAALQKELIR  615
            TKQGAALQKELIR
Sbjct  131  TKQGAALQKELIR  143



>gb|AGT63063.1| phenylalanine ammonia-lyase [Solanum tuberosum]
Length=722

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 107/137 (78%), Gaps = 3/137 (2%)
 Frame = +1

Query  214  IISNGHAHGFCV--EQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGG  387
            I  NGH +G  V  E  +++ +  DPLNW  AAE+L+GSHLDEVK+MV+E+RK  VKLGG
Sbjct  4    IAQNGHVNGEVVAMELCKKSINVDDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLGG  63

Query  388  ETLTIaqvaavaaqggTPE-VKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGAT  564
            ETLT+AQVA++A        VKVELSE+ARAGVKASSDWVM  M  GTDSYGVTTGFGAT
Sbjct  64   ETLTVAQVASIANADNKSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGAT  123

Query  565  SHRRTKQGAALQKELIR  615
            SHRRTK G ALQKELIR
Sbjct  124  SHRRTKNGGALQKELIR  140



>gb|ABN79671.2| phenylalanine ammonia-lyase [Rudbeckia hirta]
Length=720

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 106/140 (76%), Gaps = 11/140 (8%)
 Frame = +1

Query  202  NGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKL  381
            NGN +  NG A  FC++         DPLNW AAAEAL GSHLDEVK+MV E+RK  VKL
Sbjct  8    NGNHVNGNGAAAEFCIK---------DPLNWGAAAEALTGSHLDEVKKMVAEFRKPVVKL  58

Query  382  GGETLTIaqvaavaaqggTPE--VKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGF  555
            GGETLT++QVA +AA GG     V VELSEAARAGVKASSDWVM  M  GTDSYGVTTGF
Sbjct  59   GGETLTVSQVAGIAAAGGGGGGTVTVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGF  118

Query  556  GATSHRRTKQGAALQKELIR  615
            GATSHRRTK G ALQKELIR
Sbjct  119  GATSHRRTKNGGALQKELIR  138



>ref|XP_010112228.1| Phenylalanine ammonia-lyase [Morus notabilis]
 gb|EXC32937.1| Phenylalanine ammonia-lyase [Morus notabilis]
Length=696

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 100/142 (70%), Gaps = 22/142 (15%)
 Frame = +1

Query  199  ENGNGIISNGHAHGFCVE---QKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKA  369
            EN N  I NG    FC+          +  DPLNW AAAE+LKGSHLDEVKRMV EYRKA
Sbjct  6    ENSN--IGNG---SFCISGSTTNNHGGNHADPLNWGAAAESLKGSHLDEVKRMVNEYRKA  60

Query  370  TVKLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTT  549
             V+LGGETLTI+              +VEL+E ARAGVKASSDWVM  M NGTDSYGVTT
Sbjct  61   VVRLGGETLTIS--------------QVELAEVARAGVKASSDWVMESMNNGTDSYGVTT  106

Query  550  GFGATSHRRTKQGAALQKELIR  615
            GFGATSHRRTKQG ALQKELIR
Sbjct  107  GFGATSHRRTKQGGALQKELIR  128



>gb|KDP44384.1| hypothetical protein JCGZ_20064 [Jatropha curcas]
Length=712

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 100/130 (77%), Gaps = 7/130 (5%)
 Frame = +1

Query  241  FCVEQKRRASSS-----HDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIa  405
            FC +     + S      DPLNW A AE+LKGSHLDEVKRM+ EYRK  VKLGGETLTIA
Sbjct  3    FCQQTPNNGNGSPGFNVSDPLNWGAVAESLKGSHLDEVKRMINEYRKPVVKLGGETLTIA  62

Query  406  qvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQ  585
            QV A+A +     VKVELSEAARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQ
Sbjct  63   QVTAIANRDAG--VKVELSEAARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQ  120

Query  586  GAALQKELIR  615
            G ALQ+ELIR
Sbjct  121  GGALQRELIR  130



>ref|XP_006354336.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X1 [Solanum 
tuberosum]
Length=719

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 107/134 (80%), Gaps = 3/134 (2%)
 Frame = +1

Query  223  NGHAHGFCV--EQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETL  396
            NGH +G  V  E  +++ + HDPLNW  AA++L+GSHLDEVK+MV+E+RK  VKLGGETL
Sbjct  4    NGHINGEVVAMELCKKSINVHDPLNWEMAADSLRGSHLDEVKKMVDEFRKPIVKLGGETL  63

Query  397  TIaqvaavaaqggTPE-VKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  573
            T+AQVA++A        VKVELSE++RAGVKASSDWVM  M  GTDSYGVTTGFGATSHR
Sbjct  64   TVAQVASIANADNKSNGVKVELSESSRAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHR  123

Query  574  RTKQGAALQKELIR  615
            RTK G ALQKELIR
Sbjct  124  RTKNGGALQKELIR  137



>ref|XP_008449237.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=717

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 104/133 (78%), Gaps = 12/133 (9%)
 Frame = +1

Query  223  NGHAHGFCVEQKRRASSSH--DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETL  396
            NG    FC        +SH  DPLNW  AAEALKGSHLDEVKRMV+EYR+  VKLGGETL
Sbjct  13   NGSMESFC--------TSHVVDPLNWGVAAEALKGSHLDEVKRMVDEYRRPVVKLGGETL  64

Query  397  TIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRR  576
            TI+QVAA+A +    +V V+L+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRR
Sbjct  65   TISQVAAIATRDS--DVVVKLAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRR  122

Query  577  TKQGAALQKELIR  615
            TKQG ALQKELIR
Sbjct  123  TKQGGALQKELIR  135



>ref|XP_004143356.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
 ref|XP_004156338.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
Length=717

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 104/133 (78%), Gaps = 12/133 (9%)
 Frame = +1

Query  223  NGHAHGFCVEQKRRASSSH--DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETL  396
            NG    FC        +SH  DPLNW  AAEALKGSHLDEVKRMV+EYR+  VKLGGETL
Sbjct  13   NGSMESFC--------TSHVVDPLNWGVAAEALKGSHLDEVKRMVDEYRRPVVKLGGETL  64

Query  397  TIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRR  576
            TI+QVAA+A +    +V V+L+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRR
Sbjct  65   TISQVAAIATRDN--DVVVKLAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRR  122

Query  577  TKQGAALQKELIR  615
            TKQG ALQKELIR
Sbjct  123  TKQGGALQKELIR  135



>ref|XP_006354337.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X2 [Solanum 
tuberosum]
Length=719

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 107/134 (80%), Gaps = 3/134 (2%)
 Frame = +1

Query  223  NGHAHGFCV--EQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETL  396
            NGH +G  V  E  +++ + HDPLNW  AA++L+GSHLDEVK+MV+E+RK  VKLGGETL
Sbjct  4    NGHINGEVVAMELCKKSINVHDPLNWEMAADSLRGSHLDEVKKMVDEFRKPIVKLGGETL  63

Query  397  TIaqvaavaaqggTPE-VKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  573
            T+AQVA++A        VKVELSE++RAGVKASSDWVM  M  GTDSYGVTTGFGATSHR
Sbjct  64   TVAQVASIANADNKSNGVKVELSESSRAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHR  123

Query  574  RTKQGAALQKELIR  615
            RTK G ALQKELIR
Sbjct  124  RTKNGGALQKELIR  137



>gb|KGN48164.1| hypothetical protein Csa_6G445770 [Cucumis sativus]
Length=717

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 104/133 (78%), Gaps = 12/133 (9%)
 Frame = +1

Query  223  NGHAHGFCVEQKRRASSSH--DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETL  396
            NG    FC        +SH  DPLNW  AAEALKGSHLDEVKRMV+EYR+  VKLGGETL
Sbjct  13   NGSMESFC--------TSHVVDPLNWGVAAEALKGSHLDEVKRMVDEYRRPVVKLGGETL  64

Query  397  TIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRR  576
            TI+QVAA+A +    +V V+L+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRR
Sbjct  65   TISQVAAIATRDN--DVVVKLAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRR  122

Query  577  TKQGAALQKELIR  615
            TKQG ALQKELIR
Sbjct  123  TKQGGALQKELIR  135



>gb|ACT53399.1| phenylalanine ammonia-lyase 2 [Ageratina adenophora]
Length=720

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 108/147 (73%), Gaps = 16/147 (11%)
 Frame = +1

Query  196  MENGNGI--ISNGHAHG-----FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVE  354
            MENGN +   +NG  +G     FC++         DPLNW AAA  L GSHLDEVK+MV 
Sbjct  1    MENGNHVNGFTNGVVNGVVNDPFCIK---------DPLNWGAAAAELTGSHLDEVKKMVA  51

Query  355  EYRKATVKLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDS  534
            E+RK  VKLGGETLT+AQVA +AA  G   VKVELSEAARAGV ASSDWVM  M  GTDS
Sbjct  52   EFRKPVVKLGGETLTVAQVAGIAAADGGSAVKVELSEAARAGVAASSDWVMESMNKGTDS  111

Query  535  YGVTTGFGATSHRRTKQGAALQKELIR  615
            YGVTTGFGATSHRRTKQG ALQKELIR
Sbjct  112  YGVTTGFGATSHRRTKQGGALQKELIR  138



>ref|XP_004493977.1| PREDICTED: phenylalanine ammonia-lyase-like [Cicer arietinum]
Length=723

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 100/128 (78%), Gaps = 5/128 (4%)
 Frame = +1

Query  241  FCV---EQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqv  411
            FC+       +  +  DPLNW  AAEA+KGSHLDEVKRMVEEYRK  V+LGGETLTI+QV
Sbjct  16   FCLIKNANNMKVINGGDPLNWGVAAEAMKGSHLDEVKRMVEEYRKPVVRLGGETLTISQV  75

Query  412  aavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGA  591
            AA+A       V VELSE++R GVKASSDWVM  M NGTDSYGVTTGFGATSHRRTKQG 
Sbjct  76   AAIATHDHG--VTVELSESSRPGVKASSDWVMESMNNGTDSYGVTTGFGATSHRRTKQGG  133

Query  592  ALQKELIR  615
            ALQKELIR
Sbjct  134  ALQKELIR  141



>gb|ACR56688.1| phenylalanine ammonia-lyase [Scutellaria viscidula]
Length=711

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 103/128 (80%), Gaps = 9/128 (7%)
 Frame = +1

Query  232  AHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqv  411
            ++GFCV+         DPLNW AAAEALKGSHLDEVKRMVEE+R   VK+GGE LTIAQV
Sbjct  11   SNGFCVQLS-------DPLNWGAAAEALKGSHLDEVKRMVEEFRNPVVKIGGENLTIAQV  63

Query  412  aavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGA  591
            AA+A++     V VEL+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG 
Sbjct  64   AAIASRDNA--VAVELAESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGG  121

Query  592  ALQKELIR  615
            ALQKELIR
Sbjct  122  ALQKELIR  129



>ref|XP_010325983.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X3 [Solanum 
lycopersicum]
Length=718

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 108/135 (80%), Gaps = 1/135 (1%)
 Frame = +1

Query  214  IISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  393
            I+ NGH +G  ++  +++ + +DPLNW  AAE+L+GSHLDEVK+MV+E+RK  VKLGGET
Sbjct  5    IVQNGHVNGEAMDLCKKSINVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLGGET  64

Query  394  LTIaqvaavaaqggTPE-VKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSH  570
            LTIAQVA++A        VKVELSE++RAGVKASSDWVM  M  GTDSYGVTTGFG TSH
Sbjct  65   LTIAQVASIANVDNKSNGVKVELSESSRAGVKASSDWVMDSMSKGTDSYGVTTGFGDTSH  124

Query  571  RRTKQGAALQKELIR  615
            RRT  G+ALQK+LIR
Sbjct  125  RRTTNGSALQKDLIR  139



>gb|ADN32767.1| phenylalanine ammonia-lyase 1 [Scutellaria baicalensis]
Length=711

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 103/128 (80%), Gaps = 9/128 (7%)
 Frame = +1

Query  232  AHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqv  411
            ++GFCV+         DPLNW AAAEALKGSHLDEVKRMVEE+R   VK+GGE LTIAQV
Sbjct  11   SNGFCVQLS-------DPLNWGAAAEALKGSHLDEVKRMVEEFRNPVVKIGGENLTIAQV  63

Query  412  aavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGA  591
            AA+A++     V VEL+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG 
Sbjct  64   AAIASRDNA--VAVELAESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGG  121

Query  592  ALQKELIR  615
            ALQKELIR
Sbjct  122  ALQKELIR  129



>gb|AAK60274.1|AF383151_1 phenylalanine ammonia-lyase 1 [Manihot esculenta]
Length=687

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 100/128 (78%), Gaps = 5/128 (4%)
 Frame = +1

Query  241  FCVEQKRRAS---SSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqv  411
            FC      AS   SS DPLNW  AAE+LKGSHLDEVKRMV+EYRK  V+LGGETLTIAQV
Sbjct  3    FCEAHNVTASPGFSSADPLNWGMAAESLKGSHLDEVKRMVDEYRKPVVRLGGETLTIAQV  62

Query  412  aavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGA  591
             A+A       VKVELSE ARAGVKASSDWV+  M  GTDSYGVTTGFGATSHRRTKQG 
Sbjct  63   TAIANHDSG--VKVELSEEARAGVKASSDWVLDSMNKGTDSYGVTTGFGATSHRRTKQGG  120

Query  592  ALQKELIR  615
            ALQ+ELIR
Sbjct  121  ALQRELIR  128



>dbj|BAF36976.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=732

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 108/145 (74%), Gaps = 12/145 (8%)
 Frame = +1

Query  214  IISNGHAHG------FCVEQKR-----RASSSHDPLNWNAAAEALKGSHLDEVKRMVEEY  360
            II+NG+ HG      FCV           +  HDPLNW AAAEA+KGSHLDEVKRMVEEY
Sbjct  7    IITNGNGHGHHDDAAFCVNNGVGLGVGPTTPHHDPLNWGAAAEAMKGSHLDEVKRMVEEY  66

Query  361  RKATVKLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYG  540
            RK  V+LGGETLTIAQVAAVAA      V VELSE++RAGV+AS +WV   M  GTDSYG
Sbjct  67   RKPVVRLGGETLTIAQVAAVAAHDQG-AVTVELSESSRAGVEASRNWVRDSMNKGTDSYG  125

Query  541  VTTGFGATSHRRTKQGAALQKELIR  615
            VTTGFGATSHRRTKQG ALQKELIR
Sbjct  126  VTTGFGATSHRRTKQGGALQKELIR  150



>dbj|BAO01110.1| phenylalanine ammonia-lyase [Vigna radiata]
Length=715

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 107/134 (80%), Gaps = 7/134 (5%)
 Frame = +1

Query  217  ISNGHAHG-FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  393
            ++NG+ +G FC      ++ + DPLNW  AAEALKGSHLDEVKRMV EYR+  V+LGGET
Sbjct  6    LTNGNQNGSFCF----TSTKTSDPLNWGTAAEALKGSHLDEVKRMVAEYRQPLVRLGGET  61

Query  394  LTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  573
            LTIAQVA V+A      V+VELSE+AR GVKASS+WVM  M NGTDSYGVTTGFGATSHR
Sbjct  62   LTIAQVAGVSAHDQG--VRVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSHR  119

Query  574  RTKQGAALQKELIR  615
            RTKQG ALQKELIR
Sbjct  120  RTKQGGALQKELIR  133



>gb|AIA66448.1| PAL1 [Capsicum annuum]
Length=717

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 98/116 (84%), Gaps = 1/116 (1%)
 Frame = +1

Query  271  SSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaq-ggTPEV  447
            S HDPLNW  AAE+LKGSHLDEVK+MV+E+RK  VKLGGETLT+AQVA++A     T  V
Sbjct  20   SIHDPLNWEMAAESLKGSHLDEVKKMVDEFRKPIVKLGGETLTVAQVASIANADNKTCGV  79

Query  448  KVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIR  615
            KVELSE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTK G ALQKELIR
Sbjct  80   KVELSESARAGVKASSDWVMDSMCKGTDSYGVTTGFGATSHRRTKNGGALQKELIR  135



>gb|ACF17667.1| putative phenylalanine ammonia-lyase [Capsicum annuum]
Length=717

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 98/116 (84%), Gaps = 1/116 (1%)
 Frame = +1

Query  271  SSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaq-ggTPEV  447
            S HDPLNW  AAE+LKGSHLDEVK+MV+E+RK  VKLGGETLT+AQVA++A     T  V
Sbjct  20   SIHDPLNWEMAAESLKGSHLDEVKKMVDEFRKPIVKLGGETLTVAQVASIANADNKTCGV  79

Query  448  KVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIR  615
            KVELSE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTK G ALQKELIR
Sbjct  80   KVELSESARAGVKASSDWVMDSMCKGTDSYGVTTGFGATSHRRTKNGGALQKELIR  135



>ref|XP_009766905.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana sylvestris]
 gb|ACJ66297.1| phenylalanine ammonia-lyase 4 [Nicotiana tabacum]
 gb|ACJ66298.1| phenylalanine ammonia-lyase 4 [Nicotiana tabacum]
Length=717

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 106/133 (80%), Gaps = 1/133 (1%)
 Frame = +1

Query  220  SNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLT  399
            SNGH +G    +  + SS+ DPLNW  AAE+L+GSHLDEVK+MV E+RK  VKLGGETLT
Sbjct  3    SNGHVNGGENFELCKKSSATDPLNWEMAAESLRGSHLDEVKKMVSEFRKPMVKLGGETLT  62

Query  400  IaqvaavaaqggTPE-VKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRR  576
            +AQVAA+A +  +   VKVELSE ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRR
Sbjct  63   VAQVAAIAVRDKSANGVKVELSEEARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRR  122

Query  577  TKQGAALQKELIR  615
            TK G ALQKELIR
Sbjct  123  TKNGGALQKELIR  135



>gb|AAK62030.1| phenylalanine ammonia-lyase 1 [Manihot esculenta]
Length=710

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 100/128 (78%), Gaps = 5/128 (4%)
 Frame = +1

Query  241  FCVEQKRRAS---SSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqv  411
            FC      AS   SS DPLNW  AAE+LKGSHLDEVKRMV+EYRK  V+LGGETLTIAQV
Sbjct  3    FCEAHNVTASPGFSSADPLNWGMAAESLKGSHLDEVKRMVDEYRKPVVRLGGETLTIAQV  62

Query  412  aavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGA  591
             A+A       VKVELSE ARAGVKASSDWV+  M  GTDSYGVTTGFGATSHRRTKQG 
Sbjct  63   TAIANHDSG--VKVELSEEARAGVKASSDWVLDSMNKGTDSYGVTTGFGATSHRRTKQGG  120

Query  592  ALQKELIR  615
            ALQ+ELIR
Sbjct  121  ALQRELIR  128



>ref|XP_010543544.1| PREDICTED: phenylalanine ammonia-lyase 4 [Tarenaya hassleriana]
Length=718

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 101/115 (88%), Gaps = 1/115 (1%)
 Frame = +1

Query  274  SHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEV-K  450
            S DPLNWNAAAEA+KGSH++EVKRMVE+YR+ TVKLGGETLTI QVAAV+  GG+    K
Sbjct  21   SGDPLNWNAAAEAMKGSHVEEVKRMVEDYRRKTVKLGGETLTIGQVAAVSGFGGSAAAAK  80

Query  451  VELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIR  615
            VELSEAARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRT+QG ALQKELIR
Sbjct  81   VELSEAARAGVKASSDWVMESMNRGTDSYGVTTGFGATSHRRTRQGGALQKELIR  135



>gb|AHZ30594.1| phenylalanine ammonia lyase-2, partial [Prunus domestica]
Length=701

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 95/112 (85%), Gaps = 2/112 (2%)
 Frame = +1

Query  280  DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVEL  459
            DPLNW  AAE LKGSHLDEVKRMV EYRK  VKLGGE+LTI+QVAA+A       VKVEL
Sbjct  13   DPLNWGVAAETLKGSHLDEVKRMVAEYRKPVVKLGGESLTISQVAAIATHDSG--VKVEL  70

Query  460  SEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIR  615
            SE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQGAALQKELIR
Sbjct  71   SESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGAALQKELIR  122



>ref|XP_004173912.1| PREDICTED: phenylalanine ammonia-lyase-like, partial [Cucumis 
sativus]
Length=244

 Score =   161 bits (407),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 96/116 (83%), Gaps = 2/116 (2%)
 Frame = +1

Query  268  SSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEV  447
            SS HDPLNW  AA++LKGSH DEVKRMVEEY++  VKL GETLT++QVAA+A +    +V
Sbjct  10   SSIHDPLNWGVAADSLKGSHFDEVKRMVEEYQRTLVKLDGETLTVSQVAAIATRNS--DV  67

Query  448  KVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIR  615
             VELSE+ R GVKASSDW+M  +  GTDSYG+TTGFGATSHRRTKQG ALQKELIR
Sbjct  68   IVELSESTRVGVKASSDWIMESLNKGTDSYGITTGFGATSHRRTKQGGALQKELIR  123



>gb|AFR41018.1| phenylalanine ammonia-lyase, partial [Populus trichocarpa]
 gb|AFR41019.1| phenylalanine ammonia-lyase, partial [Populus trichocarpa]
 gb|AFR41021.1| phenylalanine ammonia-lyase, partial [Populus trichocarpa]
 gb|AFR41025.1| phenylalanine ammonia-lyase, partial [Populus trichocarpa]
 gb|AFR41026.1| phenylalanine ammonia-lyase, partial [Populus trichocarpa]
 gb|AFR41027.1| phenylalanine ammonia-lyase, partial [Populus trichocarpa]
 gb|AFR41037.1| phenylalanine ammonia-lyase, partial [Populus fremontii]
 gb|AFR41038.1| phenylalanine ammonia-lyase, partial [Populus fremontii]
 gb|AFR41039.1| phenylalanine ammonia-lyase, partial [Populus fremontii]
 gb|AFR41040.1| phenylalanine ammonia-lyase, partial [Populus fremontii]
 gb|AFR41041.1| phenylalanine ammonia-lyase, partial [Populus fremontii]
 gb|AFR41043.1| phenylalanine ammonia-lyase, partial [Populus fremontii]
 gb|AFR41044.1| phenylalanine ammonia-lyase, partial [Populus fremontii]
 gb|AFR41045.1| phenylalanine ammonia-lyase, partial [Populus fremontii]
Length=127

 Score =   157 bits (398),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 93/122 (76%), Gaps = 2/122 (2%)
 Frame = +1

Query  244  CVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaava  423
            C        + +DPLNW   AE+LKGSHLDEVKRM++EYRK  VKLGGE+LTI QV A+A
Sbjct  8    CTGNGSLGFNPNDPLNWGMVAESLKGSHLDEVKRMIDEYRKPVVKLGGESLTIGQVTAIA  67

Query  424  aqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQK  603
            ++     VKVELSE AR GVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG  LQK
Sbjct  68   SRDVG--VKVELSEEARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGELQK  125

Query  604  EL  609
            EL
Sbjct  126  EL  127



>sp|P45729.1|PAL3_PETCR RecName: Full=Phenylalanine ammonia-lyase 3 [Petroselinum crispum]
 emb|CAA57057.1| phenylalanine ammonia-lyase 3 [Petroselinum crispum]
Length=718

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 107/136 (79%), Gaps = 12/136 (9%)
 Frame = +1

Query  220  SNGHAHG----FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGG  387
            +NGHA+G     C++++       DPLNW  AAEAL GSHLDEVKRMV EYRK  VKL G
Sbjct  8    TNGHANGNGLDLCMKKE-------DPLNWGVAAEALTGSHLDEVKRMVAEYRKPVVKLEG  60

Query  388  ETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATS  567
            ETLTI+QVAA++A+  +  VKVELSE ARAGVKASSDWVM  M  GTDSYGVTTGFGATS
Sbjct  61   ETLTISQVAAISARDDS-GVKVELSEEARAGVKASSDWVMDSMNKGTDSYGVTTGFGATS  119

Query  568  HRRTKQGAALQKELIR  615
            HRRTKQG ALQKELIR
Sbjct  120  HRRTKQGGALQKELIR  135



>gb|AEH02821.1| phenylalanine ammonia lyase [Chrysanthemum x morifolium]
Length=717

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 108/145 (74%), Gaps = 15/145 (10%)
 Frame = +1

Query  196  MENGNGIISNG-----HAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEY  360
            MENGNG+ +NG     H +  C++         DPLNW  AAEAL GSHL+EVK+MV+E+
Sbjct  1    MENGNGVYANGTNGNGHINDLCIK---------DPLNWGVAAEALTGSHLNEVKKMVKEF  51

Query  361  RKATVKLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYG  540
            +   VK+GGETLT++QVA +AA      VKVELSE+ARAGVKASSDWVM  M  GTDSYG
Sbjct  52   KNPIVKIGGETLTVSQVAGIAASDNA-SVKVELSESARAGVKASSDWVMESMGKGTDSYG  110

Query  541  VTTGFGATSHRRTKQGAALQKELIR  615
            VTTGFGATSHRRTK G ALQKELIR
Sbjct  111  VTTGFGATSHRRTKNGGALQKELIR  135



>gb|KEH24018.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=724

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 105/137 (77%), Gaps = 5/137 (4%)
 Frame = +1

Query  214  IISNGHAHGFCVEQKRRAS---SSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLG  384
            I  N     FC+   +  +   +  DPLNW  AAEA+KGSHLDEVKRMVEEYRK  V+LG
Sbjct  8    ITKNSANESFCLIHAKNNNMKVNEADPLNWGVAAEAMKGSHLDEVKRMVEEYRKPVVRLG  67

Query  385  GETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGAT  564
            GETLTI+QVAA+AA      V+VELSE+ARAGV+ASSDWVM  M  GTDSYGVTTGFGAT
Sbjct  68   GETLTISQVAAIAAHDHG--VQVELSESARAGVEASSDWVMESMNKGTDSYGVTTGFGAT  125

Query  565  SHRRTKQGAALQKELIR  615
            SHRRTKQG ALQKELIR
Sbjct  126  SHRRTKQGGALQKELIR  142



>sp|P35513.2|PAL2_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 dbj|BAA22947.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
 dbj|BAA22963.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=712

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 104/136 (76%), Gaps = 9/136 (7%)
 Frame = +1

Query  211  GIISNGHAH-GFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGG  387
            G+  NGH    FC++         DPLNW  AA++LKGSHLDEVK+MV E+RK  VKLGG
Sbjct  3    GVAQNGHQEMDFCMKV--------DPLNWEMAADSLKGSHLDEVKKMVAEFRKPVVKLGG  54

Query  388  ETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATS  567
            ETLT+AQVAA+AA+     VKVELSE ARAGVKASSDWVM  M  GTDSYGVTTGFGATS
Sbjct  55   ETLTVAQVAAIAAKDNVKTVKVELSEGARAGVKASSDWVMDSMGKGTDSYGVTTGFGATS  114

Query  568  HRRTKQGAALQKELIR  615
            HRRTK G ALQKELIR
Sbjct  115  HRRTKNGGALQKELIR  130



>gb|KJB46525.1| hypothetical protein B456_007G373600 [Gossypium raimondii]
Length=718

 Score =   169 bits (427),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 104/135 (77%), Gaps = 3/135 (2%)
 Frame = +1

Query  214  IISNGHAHGFCVEQKRRASS-SHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGE  390
            I  NG    FC      +++ + DPLNW   AE+LKGSHLDEVKRMV EYRK  VKLGGE
Sbjct  4    ITQNGSLDSFCTTTANGSTAFAADPLNWGVVAESLKGSHLDEVKRMVMEYRKPLVKLGGE  63

Query  391  TLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSH  570
            TLTI+QVAA+AA      VKVELS+ ARA VKAS+DWV+ GM  GTDSYGVTTGFGATSH
Sbjct  64   TLTISQVAAIAAHDSG--VKVELSDDARAAVKASADWVLDGMNKGTDSYGVTTGFGATSH  121

Query  571  RRTKQGAALQKELIR  615
            RRTKQGAALQKELIR
Sbjct  122  RRTKQGAALQKELIR  136



>emb|CDY18463.1| BnaA04g21240D [Brassica napus]
Length=263

 Score =   161 bits (408),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 104/139 (75%), Gaps = 10/139 (7%)
 Frame = +1

Query  223  NGHAHG------FCV-EQKRRASS-SHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVK  378
            NG +HG       C  E K+ A+    DPLNW AAAE +KGSHLDEVKRMV+E+R+  V 
Sbjct  4    NGLSHGGEVDAMLCGGEIKKNATVVGADPLNWGAAAEQMKGSHLDEVKRMVKEFRRPVVN  63

Query  379  LGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFG  558
            LGGETLTI QVAA++  G    VKVELSE ARAGVKASSDWVM  M  GTDSYGVTTGFG
Sbjct  64   LGGETLTIGQVAAISTLGNG--VKVELSETARAGVKASSDWVMESMGKGTDSYGVTTGFG  121

Query  559  ATSHRRTKQGAALQKELIR  615
            ATSHRRTK G ALQKELIR
Sbjct  122  ATSHRRTKNGVALQKELIR  140



>gb|AEJ88223.1| phenylalanine ammonia lyase [Prunus persica]
Length=719

 Score =   169 bits (427),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 105/139 (76%), Gaps = 9/139 (6%)
 Frame = +1

Query  199  ENGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVK  378
            +NGNG+ S      FCV   +    + DPLNW  AAE+LKGSHLDEVKRMV EYRK  V+
Sbjct  8    QNGNGMES------FCVGHDQ-LHGTQDPLNWGMAAESLKGSHLDEVKRMVNEYRKPVVR  60

Query  379  LGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFG  558
            LGGETLTIAQVAA+A       V VELSE ARAGVKASSDWVM  M  GTDSYGVTTGFG
Sbjct  61   LGGETLTIAQVAAIANHDSG--VHVELSEDARAGVKASSDWVMDSMSKGTDSYGVTTGFG  118

Query  559  ATSHRRTKQGAALQKELIR  615
            ATSHRRTKQG ALQ+ELIR
Sbjct  119  ATSHRRTKQGGALQRELIR  137



>ref|XP_009146849.1| PREDICTED: phenylalanine ammonia-lyase 4 [Brassica rapa]
Length=706

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 98/114 (86%), Gaps = 4/114 (4%)
 Frame = +1

Query  274  SHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKV  453
            S DPLNWNAAAEALKGSHL+EVKRMVE+YRK  V+LGGETLTI QVAAVA+ G T    V
Sbjct  15   SADPLNWNAAAEALKGSHLEEVKRMVEDYRKGAVRLGGETLTIGQVAAVASGGVT----V  70

Query  454  ELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIR  615
            EL+E ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG ALQKELIR
Sbjct  71   ELAEEARAGVKASSDWVMESMNRGTDSYGVTTGFGATSHRRTKQGGALQKELIR  124



>gb|ACT32033.1| phenylalanine ammonia-lyase [Glycine soja]
Length=712

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 105/133 (79%), Gaps = 7/133 (5%)
 Frame = +1

Query  220  SNGHAHG-FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETL  396
            +NGH +G FC+     ++   DPLNW AAAEA+KGSHLDEVKRMV EYRK  V+LGGETL
Sbjct  4    TNGHQNGSFCLS----STKGSDPLNWGAAAEAMKGSHLDEVKRMVSEYRKPVVRLGGETL  59

Query  397  TIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRR  576
            TIAQVAAVA       V VELSE+AR GVKASS+WVM  M N TDSYGVTTGFGATSHRR
Sbjct  60   TIAQVAAVAGHDHG--VTVELSESAREGVKASSEWVMNSMNNRTDSYGVTTGFGATSHRR  117

Query  577  TKQGAALQKELIR  615
            TKQG ALQKELIR
Sbjct  118  TKQGGALQKELIR  130



>ref|XP_009625397.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana tomentosiformis]
Length=712

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 104/136 (76%), Gaps = 9/136 (7%)
 Frame = +1

Query  211  GIISNGHAH-GFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGG  387
            G+  NGH    FC++         DPLNW  AA++LKGSHLDEVK+MV E+RK  VKLGG
Sbjct  3    GVAQNGHQEMDFCMKV--------DPLNWEMAADSLKGSHLDEVKKMVAEFRKPVVKLGG  54

Query  388  ETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATS  567
            ETLT+AQVAA+AA+     VKVELSE ARAGVKASSDWVM  M  GTDSYGVTTGFGATS
Sbjct  55   ETLTVAQVAAIAAKDNVKTVKVELSEGARAGVKASSDWVMDSMGKGTDSYGVTTGFGATS  114

Query  568  HRRTKQGAALQKELIR  615
            HRRTK G ALQKELIR
Sbjct  115  HRRTKNGGALQKELIR  130



>gb|ABI33979.1| phenylalanine ammonia lyase [Jatropha curcas]
Length=713

 Score =   168 bits (426),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 107/138 (78%), Gaps = 14/138 (10%)
 Frame = +1

Query  214  IISNGHAHG----FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKL  381
            II NGH +G     C+        + DPL+W  AAE++KGSHLDEVK+MV EYRK  VKL
Sbjct  4    IIGNGHQNGSLEGLCI--------TRDPLSWGVAAESMKGSHLDEVKKMVSEYRKPLVKL  55

Query  382  GGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGA  561
            GGETLT+AQVAA+A+      VKVEL+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGA
Sbjct  56   GGETLTVAQVAAIASHDAG--VKVELAESARAGVKASSDWVMDSMNKGTDSYGVTTGFGA  113

Query  562  TSHRRTKQGAALQKELIR  615
            TSHRRTKQGAALQ+ELIR
Sbjct  114  TSHRRTKQGAALQRELIR  131



>gb|KGN48161.1| hypothetical protein Csa_6G445740 [Cucumis sativus]
Length=544

 Score =   167 bits (423),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 101/125 (81%), Gaps = 7/125 (6%)
 Frame = +1

Query  241  FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaav  420
            FC       ++  DPLNW  AA++LKGSHLDEVKRMV+EYR+  VKLGGETLTI+QVAA+
Sbjct  13   FCTN-----TTHPDPLNWGLAADSLKGSHLDEVKRMVQEYRRPLVKLGGETLTISQVAAI  67

Query  421  aaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQ  600
            A +    +V VELSE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG ALQ
Sbjct  68   ATRDT--DVIVELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQ  125

Query  601  KELIR  615
            KELIR
Sbjct  126  KELIR  130



>gb|KDP29132.1| hypothetical protein JCGZ_16521 [Jatropha curcas]
Length=713

 Score =   168 bits (426),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 107/138 (78%), Gaps = 14/138 (10%)
 Frame = +1

Query  214  IISNGHAHG----FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKL  381
            II NGH +G     C+        + DPL+W  AAE++KGSHLDEVK+MV EYRK  VKL
Sbjct  4    IIGNGHQNGSLEGLCI--------TRDPLSWGVAAESMKGSHLDEVKKMVSEYRKPLVKL  55

Query  382  GGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGA  561
            GGETLT+AQVAA+A+      VKVEL+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGA
Sbjct  56   GGETLTVAQVAAIASHDAG--VKVELAESARAGVKASSDWVMDSMNKGTDSYGVTTGFGA  113

Query  562  TSHRRTKQGAALQKELIR  615
            TSHRRTKQGAALQ+ELIR
Sbjct  114  TSHRRTKQGAALQRELIR  131



>dbj|BAG31930.1| phenylalanine ammonia-lyase [Daucus carota]
Length=715

 Score =   168 bits (426),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 108/139 (78%), Gaps = 15/139 (11%)
 Frame = +1

Query  199  ENGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVK  378
            ENGNG+         C++++       DPL+W  AAEAL GSHL+EVKRMV EYRK  VK
Sbjct  9    ENGNGV-------DLCMKKE-------DPLSWGVAAEALTGSHLEEVKRMVAEYRKPVVK  54

Query  379  LGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFG  558
            LGGETLTI+QVAA++A+  +  VKVELSEAARAGVKASSDWVM  M  GTDSYGVTTGFG
Sbjct  55   LGGETLTISQVAAISARDDS-GVKVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGFG  113

Query  559  ATSHRRTKQGAALQKELIR  615
            ATSHRRTKQG ALQKELIR
Sbjct  114  ATSHRRTKQGGALQKELIR  132



>gb|AAG49585.1|AF325496_1 phenylalanine ammonia-lyase [Ipomoea nil]
Length=711

 Score =   168 bits (426),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 104/132 (79%), Gaps = 10/132 (8%)
 Frame = +1

Query  220  SNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLT  399
            +NGH +GFCV+         DPLNW  AA++L+GSHLDEVK MV E+RK  VKLGGETLT
Sbjct  8    NNGHQNGFCVKV--------DPLNWEVAADSLRGSHLDEVKVMVAEFRKPAVKLGGETLT  59

Query  400  IaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRT  579
            +AQVAA+A++     V VELSE +RAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRT
Sbjct  60   VAQVAAIASRDNA--VTVELSEESRAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRT  117

Query  580  KQGAALQKELIR  615
            KQG ALQKELIR
Sbjct  118  KQGGALQKELIR  129



>gb|KGN48162.1| hypothetical protein Csa_6G445750 [Cucumis sativus]
Length=708

 Score =   168 bits (426),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 96/112 (86%), Gaps = 2/112 (2%)
 Frame = +1

Query  280  DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVEL  459
            DPLNW  AAE+LKGSHLDEVKRMVEEYR+  VKLGGETLTI+QVAA+A +    +V VEL
Sbjct  17   DPLNWGVAAESLKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVAAIATRDS--DVIVEL  74

Query  460  SEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIR  615
            SE+AR GVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG ALQKELIR
Sbjct  75   SESARVGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIR  126



>ref|XP_011010447.1| PREDICTED: phenylalanine ammonia-lyase [Populus euphratica]
Length=715

 Score =   168 bits (426),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 107/134 (80%), Gaps = 4/134 (3%)
 Frame = +1

Query  214  IISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  393
            +  NG+ +G     +   S+  DPL+W  AAEA+KGSHLDEVKRMV +YRK+ VKLGGET
Sbjct  4    VTKNGYQNG---SLESLCSNQLDPLSWGVAAEAMKGSHLDEVKRMVADYRKSVVKLGGET  60

Query  394  LTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  573
            LTIAQVA++A    T +VKVELSE+AR GVKASSDWVM  M+ GTDSYGVTTGFGATSHR
Sbjct  61   LTIAQVASIAGHD-TGDVKVELSESARPGVKASSDWVMDSMDKGTDSYGVTTGFGATSHR  119

Query  574  RTKQGAALQKELIR  615
            RTKQG ALQ+ELIR
Sbjct  120  RTKQGGALQRELIR  133



>ref|XP_008449239.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=711

 Score =   168 bits (425),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 97/112 (87%), Gaps = 2/112 (2%)
 Frame = +1

Query  280  DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVEL  459
            DPLNW  AA++LKGSHLDEVKRMVEEYR+  VKLGGETLTI+QVAA+A +    +V VEL
Sbjct  20   DPLNWGLAADSLKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVAAIATRDT--DVIVEL  77

Query  460  SEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIR  615
            SE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG ALQKELIR
Sbjct  78   SESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIR  129



>emb|CDY08611.1| BnaA05g28470D [Brassica napus]
Length=706

 Score =   168 bits (425),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 98/114 (86%), Gaps = 4/114 (4%)
 Frame = +1

Query  274  SHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKV  453
            S DPLNWNAAAEALKGSHL+EVKRMVE+YRK  V+LGGETLTI QVAAVA+ G T    V
Sbjct  15   SADPLNWNAAAEALKGSHLEEVKRMVEDYRKGAVRLGGETLTIGQVAAVASGGVT----V  70

Query  454  ELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIR  615
            EL+E ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG ALQKELIR
Sbjct  71   ELAEEARAGVKASSDWVMESMNRGTDSYGVTTGFGATSHRRTKQGGALQKELIR  124



>dbj|BAJ17655.1| phenylalanine ammonia lyase [Gynura bicolor]
Length=726

 Score =   168 bits (426),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 99/129 (77%), Gaps = 9/129 (7%)
 Frame = +1

Query  229  HAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaq  408
            H H  C++         D LNW  AAEAL GSHLDEVK+MV E+R   VK+GGETLT++Q
Sbjct  25   HVHDLCIK---------DTLNWGVAAEALTGSHLDEVKKMVAEFRNPVVKIGGETLTVSQ  75

Query  409  vaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQG  588
            VA +AA   +  VKVELSEAARAGVKASSDWVM  M+ GTDSYGVTTGFGATSHRRTKQG
Sbjct  76   VAGIAAASDSSTVKVELSEAARAGVKASSDWVMESMDKGTDSYGVTTGFGATSHRRTKQG  135

Query  589  AALQKELIR  615
             ALQKELIR
Sbjct  136  GALQKELIR  144



>emb|CDY00922.1| BnaC05g42780D [Brassica napus]
Length=706

 Score =   168 bits (425),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 98/114 (86%), Gaps = 4/114 (4%)
 Frame = +1

Query  274  SHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKV  453
            S DPLNWNAAAEALKGSHL+EVKRMVE+YRK  V+LGGETLTI QVAAVA+ G    V V
Sbjct  15   SADPLNWNAAAEALKGSHLEEVKRMVEDYRKGAVRLGGETLTIGQVAAVASGG----VMV  70

Query  454  ELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIR  615
            EL+E ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG ALQKELIR
Sbjct  71   ELAEEARAGVKASSDWVMESMNRGTDSYGVTTGFGATSHRRTKQGGALQKELIR  124



>gb|KHG30005.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=718

 Score =   168 bits (425),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 104/135 (77%), Gaps = 3/135 (2%)
 Frame = +1

Query  214  IISNGHAHGFCVEQKRRASS-SHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGE  390
            I  NG    FC      +++ + DPLNW   AE+LKGSHLDEVKRMV EYRK  VKLGGE
Sbjct  4    ITQNGSFDSFCTTTANGSTAFAADPLNWGIVAESLKGSHLDEVKRMVMEYRKPLVKLGGE  63

Query  391  TLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSH  570
            TLTI+QVAA+AA      VKVELS+ ARA VKAS+DWV+ GM  GTDSYGVTTGFGATSH
Sbjct  64   TLTISQVAAIAAHDSG--VKVELSDDARAAVKASADWVLDGMNKGTDSYGVTTGFGATSH  121

Query  571  RRTKQGAALQKELIR  615
            RRTKQGAALQKELIR
Sbjct  122  RRTKQGAALQKELIR  136



>gb|AFR41042.1| phenylalanine ammonia-lyase, partial [Populus fremontii]
 gb|AFR41053.1| phenylalanine ammonia-lyase, partial [Populus nigra]
Length=127

 Score =   157 bits (396),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 92/122 (75%), Gaps = 2/122 (2%)
 Frame = +1

Query  244  CVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaava  423
            C        +  DPLNW   AE+LKGSHLDEVKRM++EYRK  VKLGGE+LTI QV A+A
Sbjct  8    CTGNGSLGFNPKDPLNWGMVAESLKGSHLDEVKRMIDEYRKPVVKLGGESLTIGQVTAIA  67

Query  424  aqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQK  603
            ++     VKVELSE AR GVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG  LQK
Sbjct  68   SRDVG--VKVELSEEARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGELQK  125

Query  604  EL  609
            EL
Sbjct  126  EL  127



>gb|ABG75910.1| phenylalanine ammonia-lyase 1 [Nicotiana attenuata]
Length=712

 Score =   168 bits (425),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 102/136 (75%), Gaps = 9/136 (7%)
 Frame = +1

Query  211  GIISNGHAH-GFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGG  387
            G+  NGH    FCV+         DPLNW  AA++LKGSHLDEVK MV EYRK  VKLGG
Sbjct  3    GVAQNGHQEMDFCVKV--------DPLNWEMAADSLKGSHLDEVKIMVAEYRKPVVKLGG  54

Query  388  ETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATS  567
            ETLT+AQVAA+AA+     V VELSE ARAGVKASSDWVM  M  GTDSYGVTTGFGATS
Sbjct  55   ETLTVAQVAAIAAKDNAKTVTVELSEGARAGVKASSDWVMDSMSKGTDSYGVTTGFGATS  114

Query  568  HRRTKQGAALQKELIR  615
            HRRTK G ALQKELIR
Sbjct  115  HRRTKNGGALQKELIR  130



>gb|KGN52975.1| hypothetical protein Csa_4G008780 [Cucumis sativus]
Length=646

 Score =   167 bits (424),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 102/131 (78%), Gaps = 9/131 (7%)
 Frame = +1

Query  223  NGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTI  402
            NG    FC       SS  DPLNW  AA+++KGSHLDEVKRMVEEYR+  VKLGG+TLTI
Sbjct  10   NGSMESFC-------SSHQDPLNWGLAADSMKGSHLDEVKRMVEEYRRPLVKLGGQTLTI  62

Query  403  aqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTK  582
            +QVAA+A +    +V VEL+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRT 
Sbjct  63   SQVAAIATRDN--DVLVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTN  120

Query  583  QGAALQKELIR  615
            QG ALQKELIR
Sbjct  121  QGGALQKELIR  131



>gb|ABG75911.1| phenylalanine ammonia-lyase 2 [Nicotiana attenuata]
Length=717

 Score =   168 bits (425),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 106/133 (80%), Gaps = 1/133 (1%)
 Frame = +1

Query  220  SNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLT  399
            SNGH +G    +  + SS+ DPLNW  A+E+L+GSHLDEVK+MV E+RK  VKLGGETLT
Sbjct  3    SNGHVNGGEDFELCKKSSATDPLNWEMASESLRGSHLDEVKKMVSEFRKPMVKLGGETLT  62

Query  400  IaqvaavaaqggTPE-VKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRR  576
            +AQVAA+A +  +   VKVELSE ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRR
Sbjct  63   VAQVAAIAVRDKSANGVKVELSEDARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRR  122

Query  577  TKQGAALQKELIR  615
            TK G ALQKELIR
Sbjct  123  TKNGGALQKELIR  135



>gb|KHG29664.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=721

 Score =   168 bits (425),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 99/125 (79%), Gaps = 2/125 (2%)
 Frame = +1

Query  241  FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaav  420
            FC           DPLNW  AAE+L+GSHLDEVKRMV EYR+  VKLGGETLTI+QVAA+
Sbjct  17   FCTTTTAAKGGVVDPLNWGVAAESLQGSHLDEVKRMVAEYRRPLVKLGGETLTISQVAAI  76

Query  421  aaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQ  600
            A +     VKVELSE ARAGVKAS+DWV+ GM  GTDSYGVTTGFGATSHRRTKQGAALQ
Sbjct  77   ATRDLG--VKVELSEDARAGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRTKQGAALQ  134

Query  601  KELIR  615
            KELIR
Sbjct  135  KELIR  139



>ref|XP_007162756.1| hypothetical protein PHAVU_001G177800g [Phaseolus vulgaris]
 gb|ESW34750.1| hypothetical protein PHAVU_001G177800g [Phaseolus vulgaris]
Length=714

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 104/133 (78%), Gaps = 6/133 (5%)
 Frame = +1

Query  217  ISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETL  396
            ++N     FC+     ++ + DPLNW  AAEALKGSHLDEVKRMV EYR+  V+LGGETL
Sbjct  6    LTNAQNGSFCLP----SAKTTDPLNWGTAAEALKGSHLDEVKRMVAEYRQPLVRLGGETL  61

Query  397  TIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRR  576
            TIAQVAAV+       V+VELSE+AR GVKASS+WVM  M NGTDSYGVTTGFGATSHRR
Sbjct  62   TIAQVAAVSGHDQG--VRVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSHRR  119

Query  577  TKQGAALQKELIR  615
            TKQG ALQKELIR
Sbjct  120  TKQGGALQKELIR  132



>gb|KEH24019.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=724

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 105/137 (77%), Gaps = 5/137 (4%)
 Frame = +1

Query  214  IISNGHAHGFCVEQKRRAS---SSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLG  384
            I  N     FC+   +  +   +  DPLNW  AAEA+KGSH+DEVKRMVEEYRK  V+LG
Sbjct  8    ITKNSANESFCLIHAKNNNMKVNEADPLNWGVAAEAMKGSHIDEVKRMVEEYRKPVVRLG  67

Query  385  GETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGAT  564
            GETLTI+QVAA+AA      V+VELSE+ARAGV+ASSDWVM  M  GTDSYGVTTGFGAT
Sbjct  68   GETLTISQVAAIAAHDHG--VQVELSESARAGVEASSDWVMESMNKGTDSYGVTTGFGAT  125

Query  565  SHRRTKQGAALQKELIR  615
            SHRRTKQG ALQKELIR
Sbjct  126  SHRRTKQGGALQKELIR  142



>sp|P14166.1|PAL1_IPOBA RecName: Full=Phenylalanine ammonia-lyase [Ipomoea batatas]
 gb|AAA33389.1| phenylalanine ammonia-lyase [Ipomoea batatas]
Length=707

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 103/127 (81%), Gaps = 7/127 (6%)
 Frame = +1

Query  235  HGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqva  414
            +GFC+++++      DPLNW  AAE+L+GSHLDEVKRMV E+RK  VKLGGETLT+AQVA
Sbjct  5    NGFCIKKQQV-----DPLNWEMAAESLRGSHLDEVKRMVAEFRKPAVKLGGETLTVAQVA  59

Query  415  avaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAA  594
             +A++     V VELSE ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG A
Sbjct  60   RIASRDNA--VAVELSEEARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGA  117

Query  595  LQKELIR  615
            LQKELIR
Sbjct  118  LQKELIR  124



>ref|XP_006354339.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=722

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 106/137 (77%), Gaps = 3/137 (2%)
 Frame = +1

Query  214  IISNGHAHGFCV--EQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGG  387
            I  NGH +G  V  E  +++ +  DPLNW  AA++L+GSHLDEVK+MV E+RK  VKLGG
Sbjct  4    IAQNGHVNGEVVAMELCKKSINVDDPLNWEMAADSLRGSHLDEVKKMVAEFRKPIVKLGG  63

Query  388  ETLTIaqvaavaaqggTPE-VKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGAT  564
            ETLT+AQVA++A        VKVELSE+ARAGVKASSDWVM  M  GTDSYGVTTGFGAT
Sbjct  64   ETLTVAQVASIANADNKSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGAT  123

Query  565  SHRRTKQGAALQKELIR  615
            SHRRTK G ALQKELIR
Sbjct  124  SHRRTKNGGALQKELIR  140



>gb|AFF60415.1| phenylalanine ammonia lyase, partial [Pyrus pyrifolia]
Length=639

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 96/112 (86%), Gaps = 2/112 (2%)
 Frame = +1

Query  280  DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVEL  459
            DPLNW  AA++LKGSHLDEVKRMV EYRK  VKLGGE+LTI+QVAA+A       VKVEL
Sbjct  9    DPLNWGLAADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTISQVAAIATHDTG--VKVEL  66

Query  460  SEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIR  615
            SE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQGAALQKELIR
Sbjct  67   SESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTKQGAALQKELIR  118



>gb|KHG26972.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=710

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 100/125 (80%), Gaps = 4/125 (3%)
 Frame = +1

Query  241  FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaav  420
            FC       SS  DPLNW A+A+++KGSHLDEVKRMVEEY+K  V+LGGETLTIAQV A+
Sbjct  8    FC--NGGNGSSLADPLNWAASAQSMKGSHLDEVKRMVEEYKKPVVRLGGETLTIAQVTAI  65

Query  421  aaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQ  600
            A +     V+VELSEAAR  VKASSDWVM GM  GTDSYGVTTGFGATSHRRTKQG ALQ
Sbjct  66   ANRDVA--VQVELSEAARPAVKASSDWVMEGMNRGTDSYGVTTGFGATSHRRTKQGGALQ  123

Query  601  KELIR  615
            KELIR
Sbjct  124  KELIR  128



>gb|ACA30407.1| phenylalanine ammonia-lyase [Stylosanthes guianensis]
Length=717

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 99/125 (79%), Gaps = 3/125 (2%)
 Frame = +1

Query  241  FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaav  420
            FC+         HDPLNW  AA+ALKGSHLDEVK+MV EYRK  V LGGETLTI+QVAA+
Sbjct  11   FCL-TATNGQPRHDPLNWGVAADALKGSHLDEVKKMVSEYRKPFVNLGGETLTISQVAAI  69

Query  421  aaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQ  600
            AA      V V+LS+A+R+GVKASSDWVM  M NGTDSYGVTTGFGATSHRRTKQG ALQ
Sbjct  70   AANDQG--VSVQLSQASRSGVKASSDWVMDSMNNGTDSYGVTTGFGATSHRRTKQGGALQ  127

Query  601  KELIR  615
            KELIR
Sbjct  128  KELIR  132



>gb|KJB73539.1| hypothetical protein B456_011G238400 [Gossypium raimondii]
Length=710

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 100/125 (80%), Gaps = 4/125 (3%)
 Frame = +1

Query  241  FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaav  420
            FC       SS  DPLNW A+A+++KGSHLDEVKRMVEEY+K  V+LGGETLTIAQV A+
Sbjct  8    FC--NGGNGSSLADPLNWAASAQSMKGSHLDEVKRMVEEYKKPVVRLGGETLTIAQVTAI  65

Query  421  aaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQ  600
            A +     V+VELSEAAR  VKASSDWVM GM  GTDSYGVTTGFGATSHRRTKQG ALQ
Sbjct  66   ANRDVA--VQVELSEAARPAVKASSDWVMEGMNRGTDSYGVTTGFGATSHRRTKQGGALQ  123

Query  601  KELIR  615
            KELIR
Sbjct  124  KELIR  128



>gb|AGV54597.1| phenylalanine ammonia-lyase [Phaseolus vulgaris]
Length=714

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 104/133 (78%), Gaps = 6/133 (5%)
 Frame = +1

Query  217  ISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETL  396
            ++N     FC+     ++ + DPLNW  AAEALKGSHLDEVKRMV EYR+  V+LGGETL
Sbjct  6    LTNAQNGSFCLP----SAKTTDPLNWGTAAEALKGSHLDEVKRMVAEYRQPLVRLGGETL  61

Query  397  TIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRR  576
            TIAQVAAV+       V+VELSE+AR GVKASS+WVM  M NGTDSYGVTTGFGATSHRR
Sbjct  62   TIAQVAAVSGHDQG--VRVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSHRR  119

Query  577  TKQGAALQKELIR  615
            TKQG ALQKELIR
Sbjct  120  TKQGGALQKELIR  132



>gb|AHY94892.1| phenylalanine ammonia lyase [Prunella vulgaris]
Length=710

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 106/133 (80%), Gaps = 11/133 (8%)
 Frame = +1

Query  223  NGH--AHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETL  396
            NGH  ++GFCV+Q        DPLNW AAAE++ GSHL EVKRMVEE+RK  V+LGGETL
Sbjct  5    NGHHASNGFCVKQS-------DPLNWGAAAESMSGSHLQEVKRMVEEFRKPVVRLGGETL  57

Query  397  TIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRR  576
            TI+QVAA+AA+     V VEL+E+ARAGVKASSDWVM  M  GT SYGVTTGFGATSHRR
Sbjct  58   TISQVAAIAAKDNA--VAVELAESARAGVKASSDWVMDSMSKGTVSYGVTTGFGATSHRR  115

Query  577  TKQGAALQKELIR  615
            TKQG ALQKELIR
Sbjct  116  TKQGGALQKELIR  128



>gb|KGN52973.1| hypothetical protein Csa_4G008760 [Cucumis sativus]
Length=438

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 101/131 (77%), Gaps = 9/131 (7%)
 Frame = +1

Query  223  NGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTI  402
            NG     C       ++  DPLNW  AAE++KGSHLDEVKRMVEEYR+  VKLGGETLTI
Sbjct  10   NGSVETLC-------NTHQDPLNWGLAAESMKGSHLDEVKRMVEEYRRPLVKLGGETLTI  62

Query  403  aqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTK  582
            +QVAA+A +    +V VEL+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRT 
Sbjct  63   SQVAAIATRDN--DVLVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTN  120

Query  583  QGAALQKELIR  615
            QG ALQKELIR
Sbjct  121  QGGALQKELIR  131



>ref|XP_006364021.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=723

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 105/137 (77%), Gaps = 3/137 (2%)
 Frame = +1

Query  214  IISNGHAHGFC--VEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGG  387
            I  NGH +G    V       S++DPLNW  AA++L+GSHLDEVK+MV+E+RK  VKLGG
Sbjct  5    IAQNGHINGEVEEVAMDLCKKSNYDPLNWEMAADSLRGSHLDEVKKMVDEFRKPIVKLGG  64

Query  388  ETLTIaqvaavaaqggTPE-VKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGAT  564
            ETLT+AQVA++A        VKVELSE+ARAGVKASSDWVM  M  GTDSYGVTTGFGAT
Sbjct  65   ETLTVAQVASIANVDNKSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGAT  124

Query  565  SHRRTKQGAALQKELIR  615
            SHRRTK G ALQKELIR
Sbjct  125  SHRRTKNGGALQKELIR  141



>ref|XP_004156293.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase-like 
[Cucumis sativus]
Length=712

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 101/125 (81%), Gaps = 7/125 (6%)
 Frame = +1

Query  241  FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaav  420
            FC       ++  DPLNW  AA++LKGSHLDEVKRMV+EYR+  VKLGGETLTI+QVAA+
Sbjct  13   FCTN-----TTHPDPLNWGLAADSLKGSHLDEVKRMVQEYRRPLVKLGGETLTISQVAAI  67

Query  421  aaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQ  600
            A +    +V VELSE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG ALQ
Sbjct  68   ATRDT--DVIVELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQ  125

Query  601  KELIR  615
            KELIR
Sbjct  126  KELIR  130



>ref|XP_004249558.1| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=711

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 102/135 (76%), Gaps = 8/135 (6%)
 Frame = +1

Query  211  GIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGE  390
            G+I+      FC++         DPLNW  AAE+L+GSHLDEVK+MV E+RK  VKLGGE
Sbjct  3    GVINGQQDLDFCIKV--------DPLNWEMAAESLRGSHLDEVKKMVAEFRKPVVKLGGE  54

Query  391  TLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSH  570
            TLT+AQVA+VAA+     VKVEL E ARAGVKASSDWVM  M  GTDSYGVTTGFGATSH
Sbjct  55   TLTVAQVASVAAKVNVENVKVELCEDARAGVKASSDWVMESMSKGTDSYGVTTGFGATSH  114

Query  571  RRTKQGAALQKELIR  615
            RRTK G ALQKELIR
Sbjct  115  RRTKNGGALQKELIR  129



>ref|XP_004143256.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
Length=712

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 101/125 (81%), Gaps = 7/125 (6%)
 Frame = +1

Query  241  FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaav  420
            FC       ++  DPLNW  AA++LKGSHLDEVKRMV+EYR+  VKLGGETLTI+QVAA+
Sbjct  13   FCTN-----TTHPDPLNWGLAADSLKGSHLDEVKRMVQEYRRPLVKLGGETLTISQVAAI  67

Query  421  aaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQ  600
            A +    +V VELSE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG ALQ
Sbjct  68   ATRDT--DVIVELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQ  125

Query  601  KELIR  615
            KELIR
Sbjct  126  KELIR  130



>prf||2006271A Phe ammonia lyase
Length=725

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 102/128 (80%), Gaps = 6/128 (5%)
 Frame = +1

Query  241  FCVEQKRRAS---SSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqv  411
            FC+      +   ++ DPLNW  AAEA+KGSHLDEVKRMVEEYRK  V+LGGETLTI+QV
Sbjct  19   FCLTHANANNMKVNAADPLNWGVAAEAMKGSHLDEVKRMVEEYRKPVVRLGGETLTISQV  78

Query  412  aavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGA  591
            AA+AA  G     VELSE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG 
Sbjct  79   AAIAAHDGA---TVELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGG  135

Query  592  ALQKELIR  615
            ALQKELIR
Sbjct  136  ALQKELIR  143



>sp|P45734.1|PALY_TRISU RecName: Full=Phenylalanine ammonia-lyase [Trifolium subterraneum]
 gb|AAA17993.1| phenylalanine ammonia-lyase [Trifolium subterraneum]
Length=725

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 102/128 (80%), Gaps = 6/128 (5%)
 Frame = +1

Query  241  FCVEQKRRAS---SSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqv  411
            FC+      +   ++ DPLNW  AAEA+KGSHLDEVKRMVEEYRK  V+LGGETLTI+QV
Sbjct  19   FCLTHANANNMKVNAADPLNWGVAAEAMKGSHLDEVKRMVEEYRKPVVRLGGETLTISQV  78

Query  412  aavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGA  591
            AA+AA  G     VELSE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG 
Sbjct  79   AAIAAHDGA---TVELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGG  135

Query  592  ALQKELIR  615
            ALQKELIR
Sbjct  136  ALQKELIR  143



>ref|XP_006424540.1| hypothetical protein CICLE_v10027912mg [Citrus clementina]
 gb|ESR37780.1| hypothetical protein CICLE_v10027912mg [Citrus clementina]
Length=714

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 101/118 (86%), Gaps = 2/118 (2%)
 Frame = +1

Query  262  RASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTP  441
            +  ++ DPLNW +A+E+LKGSHLDEVKRMV EYRK  V+LGGETLTIAQVAAVA++    
Sbjct  17   KLCTNIDPLNWVSASESLKGSHLDEVKRMVSEYRKPVVRLGGETLTIAQVAAVASRDDG-  75

Query  442  EVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIR  615
             V VEL+E ARAGVKASSDWVM  M NGTDSYGVTTGFGATSHRRTKQGAALQKELIR
Sbjct  76   -VTVELNEEARAGVKASSDWVMESMNNGTDSYGVTTGFGATSHRRTKQGAALQKELIR  132



>ref|XP_006424538.1| hypothetical protein CICLE_v10027913mg [Citrus clementina]
 gb|ESR37778.1| hypothetical protein CICLE_v10027913mg [Citrus clementina]
Length=714

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 101/118 (86%), Gaps = 2/118 (2%)
 Frame = +1

Query  262  RASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTP  441
            +  ++ DPLNW +A+E+LKGSHLDEVKRMV EYRK  V+LGGETLTIAQVAAVA++    
Sbjct  17   KLCTNIDPLNWVSASESLKGSHLDEVKRMVSEYRKPVVRLGGETLTIAQVAAVASRDDG-  75

Query  442  EVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIR  615
             V VEL+E ARAGVKASSDWVM  M NGTDSYGVTTGFGATSHRRTKQGAALQKELIR
Sbjct  76   -VTVELNEEARAGVKASSDWVMESMNNGTDSYGVTTGFGATSHRRTKQGAALQKELIR  132



>gb|AGL50914.1| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 101/131 (77%), Gaps = 4/131 (3%)
 Frame = +1

Query  223  NGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTI  402
            NGH     VE         DPLNW  AA++LKGSHLDEVKRMV EYRK  VKLGGE+LTI
Sbjct  12   NGHHQNGAVESP--LCIKKDPLNWGLAADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTI  69

Query  403  aqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTK  582
            +QVAA+A       VKVELSE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTK
Sbjct  70   SQVAAIATHDTG--VKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTK  127

Query  583  QGAALQKELIR  615
            QGAALQKELIR
Sbjct  128  QGAALQKELIR  138



>ref|XP_009342990.1| PREDICTED: phenylalanine ammonia-lyase 1 [Pyrus x bretschneideri]
Length=720

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 101/131 (77%), Gaps = 4/131 (3%)
 Frame = +1

Query  223  NGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTI  402
            NGH     VE         DPLNW  AA++LKGSHLDEVKRMV EYRK  VKLGGE+LTI
Sbjct  12   NGHHQNGAVESP--LCIKKDPLNWGLAADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTI  69

Query  403  aqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTK  582
            +QVAA+A       VKVELSE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTK
Sbjct  70   SQVAAIATHDTG--VKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTK  127

Query  583  QGAALQKELIR  615
            QGAALQKELIR
Sbjct  128  QGAALQKELIR  138



>ref|XP_002531677.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
 gb|EEF30696.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
Length=719

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 104/132 (79%), Gaps = 3/132 (2%)
 Frame = +1

Query  223  NGHAHGFCVEQKRRASSSH-DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLT  399
            N + HG  +E    A++ H DPLNW   A++LKGSHLDEVKRMV+EYR+  V+LGGETLT
Sbjct  8    NNNNHGSSLESFCTATAGHHDPLNWGMLADSLKGSHLDEVKRMVDEYRRPVVRLGGETLT  67

Query  400  IaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRT  579
            IAQV A+A +     +KVELSE ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRT
Sbjct  68   IAQVTAIANRDAG--IKVELSEDARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRT  125

Query  580  KQGAALQKELIR  615
            KQG ALQ+ELIR
Sbjct  126  KQGGALQRELIR  137



>ref|XP_004246652.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X2 [Solanum 
lycopersicum]
Length=719

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 107/137 (78%), Gaps = 3/137 (2%)
 Frame = +1

Query  214  IISNGHAHGFCVEQK--RRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGG  387
            I+ NGHA+G  V     +++   +DPLNW  AAE+L+GSHLDEVK+MV+E+RK  VKLGG
Sbjct  4    IVPNGHANGKVVAMDLCKKSIIVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLGG  63

Query  388  ETLTIaqvaavaaqggTPE-VKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGAT  564
            ETLTIAQVA++A        VKVELSE++RAGVKASSDWVM  M  GTDSYGVTTGFG T
Sbjct  64   ETLTIAQVASIANVDNKSNGVKVELSESSRAGVKASSDWVMDSMSKGTDSYGVTTGFGDT  123

Query  565  SHRRTKQGAALQKELIR  615
            SHRRT  G+ALQK+LIR
Sbjct  124  SHRRTTNGSALQKDLIR  140



>emb|CDY66761.1| BnaCnng52250D [Brassica napus]
Length=519

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 102/126 (81%), Gaps = 3/126 (2%)
 Frame = +1

Query  241  FC-VEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaa  417
             C V +K + + + DPLNW AAAE +KGSHLDEVKRMVE+YRK  V LGGETLTI QVAA
Sbjct  19   LCGVVEKTKVTVAADPLNWGAAAEQMKGSHLDEVKRMVEDYRKPVVNLGGETLTIGQVAA  78

Query  418  vaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAAL  597
            ++  GG   VKVEL+EA+RAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTK GAAL
Sbjct  79   ISNVGGG--VKVELAEASRAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGAAL  136

Query  598  QKELIR  615
            Q ELIR
Sbjct  137  QTELIR  142



>emb|CDX74991.1| BnaA05g07370D [Brassica napus]
Length=380

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 101/136 (74%), Gaps = 7/136 (5%)
 Frame = +1

Query  223  NGHAHG----FC-VEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGG  387
            NG +H      C  E K    ++ DPLNW AAAE +KGSHLDEVKRMV E+RK  V LGG
Sbjct  4    NGSSHKVDAMLCGAEIKNVTVAAADPLNWGAAAEQMKGSHLDEVKRMVMEFRKPVVNLGG  63

Query  388  ETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATS  567
            ETLTI QVAA++  G    VKVELSE ARAGVKASSDWVM  M  GTDSYGVTTGFGATS
Sbjct  64   ETLTIGQVAAISTVGNG--VKVELSETARAGVKASSDWVMESMGKGTDSYGVTTGFGATS  121

Query  568  HRRTKQGAALQKELIR  615
            HRRTK G ALQKELIR
Sbjct  122  HRRTKNGVALQKELIR  137



>gb|AAZ29734.1| phenylalanine ammonia lyase [Trifolium pratense]
Length=725

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 96/112 (86%), Gaps = 3/112 (3%)
 Frame = +1

Query  280  DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVEL  459
            DPLNW  AAEA+KGSHLDEVKRMVEEYRK  V+LGGETLTI+QVAA+AA  G     VEL
Sbjct  35   DPLNWGVAAEAMKGSHLDEVKRMVEEYRKPVVRLGGETLTISQVAAIAAHDGA---TVEL  91

Query  460  SEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIR  615
            SE+ARAGVKASSDW+M  M  GTDSYGVTTGFGATSHRRTKQG ALQKELIR
Sbjct  92   SESARAGVKASSDWIMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIR  143



>sp|O23865.1|PAL1_DAUCA RecName: Full=Phenylalanine ammonia-lyase 1 [Daucus carota]
 dbj|BAA23367.1| phenylalanine ammonia-lyase [Daucus carota]
Length=708

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 106/139 (76%), Gaps = 16/139 (12%)
 Frame = +1

Query  199  ENGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVK  378
            EN N ++ NG     C+++        DPLNW  AAEAL GSHLDEVKRMV E+RK  V+
Sbjct  4    ENKNVVLGNG----LCMQK--------DPLNWGMAAEALTGSHLDEVKRMVAEFRKPMVQ  51

Query  379  LGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFG  558
            LGGETLT++QVAA+AA      VKVEL+E+ARAGVKASSDWVM  M  GTDSYGVTTGFG
Sbjct  52   LGGETLTVSQVAAIAAGS----VKVELAESARAGVKASSDWVMESMNKGTDSYGVTTGFG  107

Query  559  ATSHRRTKQGAALQKELIR  615
            ATSHRRTKQG ALQKELIR
Sbjct  108  ATSHRRTKQGGALQKELIR  126



>gb|AFP49807.1| phenylalanine ammonialyase 4 [Coffea arabica]
Length=713

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 106/139 (76%), Gaps = 12/139 (9%)
 Frame = +1

Query  199  ENGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVK  378
            ENGN      H++ FCV+         DPLNWNAAAE+LKGSHLDEVK+MV EYRK  VK
Sbjct  6    ENGNV----HHSNRFCVQD--------DPLNWNAAAESLKGSHLDEVKKMVREYRKPLVK  53

Query  379  LGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFG  558
            LGGETLT+AQVAAVAA        VEL E+A+AGVKASS+WV+  M NGTDSYGVTTGFG
Sbjct  54   LGGETLTVAQVAAVAAVHAGGGTVVELCESAKAGVKASSEWVVESMNNGTDSYGVTTGFG  113

Query  559  ATSHRRTKQGAALQKELIR  615
            ATSHRRTKQG ALQ ELIR
Sbjct  114  ATSHRRTKQGTALQTELIR  132



>gb|AEO92029.1| phenylalanine ammonia-lyase 3 [Coffea canephora]
 gb|AEO94541.1| phenylalanine ammonia-lyase 3 [Coffea canephora]
Length=713

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 106/139 (76%), Gaps = 12/139 (9%)
 Frame = +1

Query  199  ENGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVK  378
            ENGN      H++ FCV+         DPLNWNAAAE+LKGSHLDEVK+MV EYRK  VK
Sbjct  6    ENGNV----HHSNRFCVQD--------DPLNWNAAAESLKGSHLDEVKKMVREYRKPLVK  53

Query  379  LGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFG  558
            LGGETLT+AQVAAVAA        VEL E+A+AGVKASS+WV+  M NGTDSYGVTTGFG
Sbjct  54   LGGETLTVAQVAAVAAVHAGGGTVVELCESAKAGVKASSEWVVESMNNGTDSYGVTTGFG  113

Query  559  ATSHRRTKQGAALQKELIR  615
            ATSHRRTKQG ALQ ELIR
Sbjct  114  ATSHRRTKQGTALQTELIR  132



>gb|AFN85669.1| phenylalanine ammonia-lyase [Hibiscus cannabinus]
Length=715

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 99/125 (79%), Gaps = 6/125 (5%)
 Frame = +1

Query  241  FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaav  420
            FC    R      DPLNW  AAE+LKGSHLDEVKRMV EYR+  VKLGGETLTI+QVAA+
Sbjct  15   FC----RTKGGGVDPLNWGVAAESLKGSHLDEVKRMVAEYRRPLVKLGGETLTISQVAAI  70

Query  421  aaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQ  600
            A +     VKVELSE ARAGVKAS+DWV+ GM  GTDSYGVTTGFGATSHRRT QGAALQ
Sbjct  71   ATRDLG--VKVELSEDARAGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRTNQGAALQ  128

Query  601  KELIR  615
            KELIR
Sbjct  129  KELIR  133



>ref|XP_008387584.1| PREDICTED: phenylalanine ammonia-lyase 1 [Malus domestica]
Length=720

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 96/112 (86%), Gaps = 2/112 (2%)
 Frame = +1

Query  280  DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVEL  459
            DPLNW  AA++LKGSHLDEVKRMV EYRK  VKLGGE+LTI+QVAA+A       VKVEL
Sbjct  29   DPLNWGLAADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTISQVAAIATHDTG--VKVEL  86

Query  460  SEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIR  615
            SE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQGAALQKELIR
Sbjct  87   SESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTKQGAALQKELIR  138



>gb|AFG30054.1| phenylalanine ammonialyase [Malus hybrid cultivar]
Length=720

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 96/112 (86%), Gaps = 2/112 (2%)
 Frame = +1

Query  280  DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVEL  459
            DPLNW  AA++LKGSHLDEVKRMV EYRK  VKLGGE+LTI+QVAA+A       VKVEL
Sbjct  29   DPLNWGLAADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTISQVAAIATHDTG--VKVEL  86

Query  460  SEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIR  615
            SE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQGAALQKELIR
Sbjct  87   SESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTKQGAALQKELIR  138



>gb|ADO64252.1| PAL [Epimedium sagittatum]
Length=708

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 97/112 (87%), Gaps = 2/112 (2%)
 Frame = +1

Query  280  DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVEL  459
            DPLNWN AAE++KGSHLDEVKRMVEEYRK  V+LGGE+LTI+QVAA+A+      V VEL
Sbjct  17   DPLNWNMAAESMKGSHLDEVKRMVEEYRKGVVRLGGESLTISQVAAIASHDQG--VMVEL  74

Query  460  SEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIR  615
            +E++RAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG ALQKELIR
Sbjct  75   NESSRAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIR  126



>gb|AFR41020.1| phenylalanine ammonia-lyase, partial [Populus trichocarpa]
Length=126

 Score =   155 bits (392),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 92/121 (76%), Gaps = 2/121 (2%)
 Frame = +1

Query  244  CVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaava  423
            C        + +DPLNW   AE+LKGSHLDEVKRM++EYRK  VKLGGE+LTI QV A+A
Sbjct  8    CTGNGSLGFNPNDPLNWGMVAESLKGSHLDEVKRMIDEYRKPVVKLGGESLTIGQVTAIA  67

Query  424  aqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQK  603
            ++     VKVELSE AR GVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG  LQK
Sbjct  68   SRDVG--VKVELSEEARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGELQK  125

Query  604  E  606
            E
Sbjct  126  E  126



>gb|KJB62426.1| hypothetical protein B456_009G416300 [Gossypium raimondii]
Length=721

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 100/125 (80%), Gaps = 2/125 (2%)
 Frame = +1

Query  241  FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaav  420
            FC           DPLNW  AA++L+GSHLDEVKRMV EYR++ VKLGGETLTI+QVAA+
Sbjct  17   FCTTTTTAKGGVVDPLNWGVAAKSLQGSHLDEVKRMVAEYRRSLVKLGGETLTISQVAAI  76

Query  421  aaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQ  600
            A +     VKVELSE ARAGVKAS+DWV+ GM  GTDSYGVTTGFGATSHRRTKQGAALQ
Sbjct  77   ATRDLG--VKVELSEDARAGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRTKQGAALQ  134

Query  601  KELIR  615
            KELIR
Sbjct  135  KELIR  139



>gb|AAQ74878.1| phenylalanine ammonia lyase [Populus trichocarpa x Populus deltoides]
Length=711

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 100/129 (78%), Gaps = 6/129 (5%)
 Frame = +1

Query  241  FCVEQKRRASS----SHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaq  408
            FC + +    S    ++DPLNW  AAE+LKGSHLDEVKRM+EEYRK  VKLGGETLTI Q
Sbjct  3    FCQDSRNGNGSLGFNTNDPLNWGMAAESLKGSHLDEVKRMIEEYRKPVVKLGGETLTIGQ  62

Query  409  vaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQG  588
            V A+A++     V VELSE ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG
Sbjct  63   VTAIASRDVG--VMVELSEEARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQG  120

Query  589  AALQKELIR  615
              LQKELIR
Sbjct  121  GELQKELIR  129



>gb|AAZ29732.1| phenylalanine ammonia lyase [Trifolium pratense]
Length=724

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 96/112 (86%), Gaps = 3/112 (3%)
 Frame = +1

Query  280  DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVEL  459
            DPLNW  AAEA+KGSHLDEVKRMVEEYRK  V+LGGETLTI+QVAA+AA  G     VEL
Sbjct  34   DPLNWGVAAEAMKGSHLDEVKRMVEEYRKPVVRLGGETLTISQVAAIAAHDGA---TVEL  90

Query  460  SEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIR  615
            SE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG ALQKELIR
Sbjct  91   SESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIR  142



>ref|XP_002315308.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63891.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEF01479.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=711

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 100/129 (78%), Gaps = 6/129 (5%)
 Frame = +1

Query  241  FCVEQKRRASS----SHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaq  408
            FC + +    S    ++DPLNW  AAE+LKGSHLDEVKRM+EEYRK  VKLGGETLTI Q
Sbjct  3    FCQDSRNGNGSLGFNTNDPLNWGMAAESLKGSHLDEVKRMIEEYRKPVVKLGGETLTIGQ  62

Query  409  vaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQG  588
            V A+A++     V VELSE ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG
Sbjct  63   VTAIASRDVG--VMVELSEEARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQG  120

Query  589  AALQKELIR  615
              LQKELIR
Sbjct  121  GELQKELIR  129



>gb|ACC63889.1| phenylalanine ammonia-lyase [Populus trichocarpa]
Length=711

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 100/129 (78%), Gaps = 6/129 (5%)
 Frame = +1

Query  241  FCVEQKRRASS----SHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaq  408
            FC + +    S    ++DPLNW  AAE+LKGSHLDEVKRM+EEYRK  VKLGGETLTI Q
Sbjct  3    FCQDSRNGNGSLGFNTNDPLNWGMAAESLKGSHLDEVKRMIEEYRKPVVKLGGETLTIGQ  62

Query  409  vaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQG  588
            V A+A++     V VELSE ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG
Sbjct  63   VTAIASRDVG--VMVELSEEARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQG  120

Query  589  AALQKELIR  615
              LQKELIR
Sbjct  121  GELQKELIR  129



>emb|CDX91331.1| BnaC04g08190D [Brassica napus]
Length=380

 Score =   162 bits (411),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 96/122 (79%), Gaps = 2/122 (2%)
 Frame = +1

Query  250  EQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaq  429
            E K    ++ DPLNW AAAE +KGSHLDEVKRMV E+RK  V LGGETLTI QVAA++  
Sbjct  18   EIKNVTVAAADPLNWGAAAEQMKGSHLDEVKRMVMEFRKPVVNLGGETLTIGQVAAISTV  77

Query  430  ggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKEL  609
            G    VKVELSE ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTK G ALQKEL
Sbjct  78   GNG--VKVELSETARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGVALQKEL  135

Query  610  IR  615
            IR
Sbjct  136  IR  137



>ref|XP_004143257.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
 ref|XP_004156292.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
Length=710

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 103/133 (77%), Gaps = 8/133 (6%)
 Frame = +1

Query  217  ISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETL  396
            ++NGH       +     +  DPLNW  AAE+LKGSHLDEVKRMVEEYR+  VKLGGETL
Sbjct  4    MTNGHI------EDNLCHTHSDPLNWGVAAESLKGSHLDEVKRMVEEYRRPLVKLGGETL  57

Query  397  TIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRR  576
            TI+QVAA+A +    +V VELSE+AR GVKASSDWVM  M  GTDSYGVTTGFGATSHRR
Sbjct  58   TISQVAAIATRDS--DVIVELSESARVGVKASSDWVMESMNKGTDSYGVTTGFGATSHRR  115

Query  577  TKQGAALQKELIR  615
            TK+G ALQKELIR
Sbjct  116  TKEGGALQKELIR  128



>ref|XP_006354338.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X3 [Solanum 
tuberosum]
Length=723

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 106/137 (77%), Gaps = 3/137 (2%)
 Frame = +1

Query  214  IISNGHAHGFCV--EQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGG  387
            I  NGH +G  V  E  +++ + HDPLNW  AAE+L+GSHLDEVK+MV+E+RK  VKL G
Sbjct  5    IAQNGHVNGEVVAMELCKKSINVHDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLEG  64

Query  388  ETLTIaqvaavaaqggTPE-VKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGAT  564
            ETLT+AQVA++A        VKVELSE+ARAGVKASSDWVM  M  GTDSYGVTTGFG T
Sbjct  65   ETLTVAQVASIANADNKSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGDT  124

Query  565  SHRRTKQGAALQKELIR  615
            SHRRTK G ALQK+LIR
Sbjct  125  SHRRTKNGNALQKDLIR  141



>gb|AJR20994.1| phenylalanine ammonia-lyase [Populus szechuanica]
Length=711

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 100/129 (78%), Gaps = 6/129 (5%)
 Frame = +1

Query  241  FCVEQKRRASS----SHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaq  408
            FC + +    S    ++DPLNW  AAE+LKGSHLDEVKRM+EEYRK  VKLGGETLTI Q
Sbjct  3    FCQDSRNGNGSLGFNTNDPLNWGMAAESLKGSHLDEVKRMIEEYRKPVVKLGGETLTIGQ  62

Query  409  vaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQG  588
            V A+A++     V VELSE ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG
Sbjct  63   VTAIASRDVG--VMVELSEEARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQG  120

Query  589  AALQKELIR  615
              LQKELIR
Sbjct  121  GELQKELIR  129



>gb|AIA24411.1| phenylalanine ammonia-lyase [Sinopodophyllum hexandrum]
Length=709

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 107/139 (77%), Gaps = 16/139 (12%)
 Frame = +1

Query  199  ENGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVK  378
            EN N + S      FC+++        DPLNW  AA+ALKGSHLDEVK+MV+EYR+  V+
Sbjct  7    ENTNSVAS------FCIKE--------DPLNWGMAADALKGSHLDEVKKMVKEYRQGVVR  52

Query  379  LGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFG  558
            LGGETLTI+QVAAVA+      VKVEL+E+ARAGVKASSDWVM  M  GTDSYGVTTGFG
Sbjct  53   LGGETLTISQVAAVASHDQG--VKVELNESARAGVKASSDWVMESMNKGTDSYGVTTGFG  110

Query  559  ATSHRRTKQGAALQKELIR  615
            ATSHRRTKQG ALQKELIR
Sbjct  111  ATSHRRTKQGGALQKELIR  129



>ref|XP_011041025.1| PREDICTED: phenylalanine ammonia-lyase G2B [Populus euphratica]
Length=711

 Score =   166 bits (420),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 100/129 (78%), Gaps = 6/129 (5%)
 Frame = +1

Query  241  FCVEQKRRASS----SHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaq  408
            FC + +    S    ++DPLNW  AAE+LKGSHLDEVKRM+EEYRK  VKLGGETLTI Q
Sbjct  3    FCQDSRNGNGSLGFNTNDPLNWGMAAESLKGSHLDEVKRMIEEYRKPVVKLGGETLTIGQ  62

Query  409  vaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQG  588
            V A+A++     V VELSE ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG
Sbjct  63   VTAIASRDVG--VVVELSEEARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQG  120

Query  589  AALQKELIR  615
              LQKELIR
Sbjct  121  GELQKELIR  129



>ref|XP_008454137.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=713

 Score =   166 bits (420),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 101/131 (77%), Gaps = 9/131 (7%)
 Frame = +1

Query  223  NGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTI  402
            NG     C       SS  DPLNW  AA+++KGSHLDEVKRMVEEYR+  VKLGGETLTI
Sbjct  10   NGSTESLC-------SSHQDPLNWGLAADSMKGSHLDEVKRMVEEYRRPLVKLGGETLTI  62

Query  403  aqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTK  582
            +QVAA+A +    +V VEL+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRT 
Sbjct  63   SQVAAIATRDN--DVVVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTN  120

Query  583  QGAALQKELIR  615
            QG ALQKELIR
Sbjct  121  QGGALQKELIR  131



>ref|XP_007144370.1| hypothetical protein PHAVU_007G150500g [Phaseolus vulgaris]
 gb|ESW16364.1| hypothetical protein PHAVU_007G150500g [Phaseolus vulgaris]
Length=712

 Score =   166 bits (420),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 102/125 (82%), Gaps = 5/125 (4%)
 Frame = +1

Query  241  FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaav  420
            FCV     A+++ DPLNW AAAEAL GSHLDEVKRMV EYRK  V+LGG+TLTIAQVAA 
Sbjct  11   FCVTA---ANAAGDPLNWAAAAEALSGSHLDEVKRMVAEYRKPAVRLGGQTLTIAQVAAT  67

Query  421  aaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQ  600
            AA      +KVEL+E+ARA VKASSDWVM  M+ GTDSYGVTTGFGATSHRRTKQG ALQ
Sbjct  68   AAHDQG--LKVELAESARACVKASSDWVMESMDKGTDSYGVTTGFGATSHRRTKQGGALQ  125

Query  601  KELIR  615
            KELIR
Sbjct  126  KELIR  130



>sp|P45726.1|PALY_CAMSI RecName: Full=Phenylalanine ammonia-lyase [Camellia sinensis]
 dbj|BAA05643.1| phenylalanine ammonia-lyase [Camellia sinensis]
Length=714

 Score =   166 bits (420),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 108/137 (79%), Gaps = 12/137 (9%)
 Frame = +1

Query  205  GNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLG  384
            GNG+ S G + GFC++         DPLNW  AAEA+KGSHL+EVK MVEE+RK  V+LG
Sbjct  8    GNGVGSGG-SPGFCLK---------DPLNWGVAAEAMKGSHLEEVKGMVEEFRKPVVRLG  57

Query  385  GETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGAT  564
            GETLTI+QVAA+A +G   EV VELSE+AR GVKASSDWVM  M  GTDSYGVTTGFGAT
Sbjct  58   GETLTISQVAAIAVRGS--EVAVELSESAREGVKASSDWVMESMNKGTDSYGVTTGFGAT  115

Query  565  SHRRTKQGAALQKELIR  615
            SHRRTK+G ALQKELIR
Sbjct  116  SHRRTKEGGALQKELIR  132



>ref|XP_010553331.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Tarenaya hassleriana]
Length=725

 Score =   166 bits (420),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 98/121 (81%), Gaps = 2/121 (2%)
 Frame = +1

Query  253  QKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqg  432
            +K   S + DPLNW  AAE +KGSHLDEVKRMVEE+R+  V+LGGETLTI QVAA+A+  
Sbjct  25   EKLCESPTADPLNWGVAAEQMKGSHLDEVKRMVEEHRRPVVRLGGETLTIGQVAAIASAV  84

Query  433  gTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELI  612
                VKVELSEAARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTK G ALQKELI
Sbjct  85   DG--VKVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGVALQKELI  142

Query  613  R  615
            R
Sbjct  143  R  143



>gb|KFK38414.1| hypothetical protein AALP_AA3G110100 [Arabis alpina]
Length=706

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 97/117 (83%), Gaps = 4/117 (3%)
 Frame = +1

Query  265  ASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPE  444
            A  S DPLNWN AAE+L+GSHL+EVKRMVE+YRK  VKLGGETLTI QVAAVA  G T  
Sbjct  12   AVVSDDPLNWNMAAESLRGSHLEEVKRMVEDYRKGAVKLGGETLTIGQVAAVANGGVT--  69

Query  445  VKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIR  615
              VEL+E ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG ALQKELIR
Sbjct  70   --VELAEEARAGVKASSDWVMESMNRGTDSYGVTTGFGATSHRRTKQGGALQKELIR  124



>gb|AFR41056.1| phenylalanine ammonia-lyase, partial [Populus nigra]
Length=126

 Score =   154 bits (390),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 91/121 (75%), Gaps = 2/121 (2%)
 Frame = +1

Query  244  CVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaava  423
            C        +  DPLNW   AE+LKGSHLDEVKRM++EYRK  VKLGGE+LTI QV A+A
Sbjct  8    CTGNGSLGFNPKDPLNWGMVAESLKGSHLDEVKRMIDEYRKPVVKLGGESLTIGQVTAIA  67

Query  424  aqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQK  603
            ++     VKVELSE AR GVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG  LQK
Sbjct  68   SRDVG--VKVELSEEARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGELQK  125

Query  604  E  606
            E
Sbjct  126  E  126



>gb|KFK38413.1| hypothetical protein AALP_AA3G110100 [Arabis alpina]
Length=708

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 97/117 (83%), Gaps = 4/117 (3%)
 Frame = +1

Query  265  ASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPE  444
            A  S DPLNWN AAE+L+GSHL+EVKRMVE+YRK  VKLGGETLTI QVAAVA  G T  
Sbjct  12   AVVSDDPLNWNMAAESLRGSHLEEVKRMVEDYRKGAVKLGGETLTIGQVAAVANGGVT--  69

Query  445  VKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIR  615
              VEL+E ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG ALQKELIR
Sbjct  70   --VELAEEARAGVKASSDWVMESMNRGTDSYGVTTGFGATSHRRTKQGGALQKELIR  124



>dbj|BAA31258.1| phenylalanine ammonia-lyase [Vitis vinifera]
Length=319

 Score =   160 bits (405),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 97/125 (78%), Gaps = 11/125 (9%)
 Frame = +1

Query  241  FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaav  420
            FCV          DPLNW  AAE LKGSHLDEVKRMV EYRK  V+LGGETLTI+QVAA+
Sbjct  15   FCVS---------DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAI  65

Query  421  aaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQ  600
            A + G  +V VELSE ARAGV ASS+WVM  M  GTDSYGVTTGFGATSHRRTKQG ALQ
Sbjct  66   AGREG--DVGVELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQ  123

Query  601  KELIR  615
            KELI+
Sbjct  124  KELIK  128



>ref|XP_010482945.1| PREDICTED: phenylalanine ammonia-lyase 4-like [Camelina sativa]
Length=706

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +1

Query  280  DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVEL  459
            DPLNWNAAAEALKGSHL+EVKRMVE+YR+  VKLGGETLTI QVAAVA         VEL
Sbjct  13   DPLNWNAAAEALKGSHLEEVKRMVEDYREGVVKLGGETLTIGQVAAVARGASGGGATVEL  72

Query  460  SEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIR  615
            +E ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG ALQ ELIR
Sbjct  73   AEEARAGVKASSDWVMESMNRGTDSYGVTTGFGATSHRRTKQGGALQNELIR  124



>ref|XP_009629066.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana tomentosiformis]
 sp|P25872.1|PAL1_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 gb|AAA34122.1| phenylalanine ammonia lyase [Nicotiana tabacum]
 dbj|BAA22948.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=715

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 103/133 (77%), Gaps = 3/133 (2%)
 Frame = +1

Query  220  SNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLT  399
            SNGH +G   E       S DPLNW  AAE+L+GSHLDEVK+MV E+RK  VKLGGE+LT
Sbjct  3    SNGHVNGG--ENFELCKKSADPLNWEMAAESLRGSHLDEVKKMVSEFRKPMVKLGGESLT  60

Query  400  IaqvaavaaqggTPE-VKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRR  576
            +AQVAA+A +  +   VKVELSE ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRR
Sbjct  61   VAQVAAIAVRDKSANGVKVELSEEARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRR  120

Query  577  TKQGAALQKELIR  615
            TK G ALQKELIR
Sbjct  121  TKNGGALQKELIR  133



>gb|AAN52280.1|AF480620_1 phenylalanine ammonia-lyase [Populus tremuloides]
Length=711

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 96/124 (77%), Gaps = 2/124 (2%)
 Frame = +1

Query  244  CVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaava  423
            C        + +DPLNW  AAE+LKGSHLDEVKRM++EYRK  VKLGGETLTI QV A+A
Sbjct  8    CTGNGSLGFNPNDPLNWGMAAESLKGSHLDEVKRMIDEYRKPVVKLGGETLTIGQVTAIA  67

Query  424  aqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQK  603
            ++     VKVELSE AR GVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG  LQK
Sbjct  68   SRDIG--VKVELSEEARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGELQK  125

Query  604  ELIR  615
            ELIR
Sbjct  126  ELIR  129



>gb|AAW78932.1| phenylalanine-ammonia lyase [Rhodiola sachalinensis]
Length=710

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 98/112 (88%), Gaps = 2/112 (2%)
 Frame = +1

Query  280  DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVEL  459
            DPL+W  AAEA+KGSHLDEVKRMVEEYRK  VKLGGETLTIAQVAA+A +G   +V+VEL
Sbjct  19   DPLSWGLAAEAMKGSHLDEVKRMVEEYRKPAVKLGGETLTIAQVAAIAGRGS--DVRVEL  76

Query  460  SEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIR  615
            SE+AR GVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG ALQKELIR
Sbjct  77   SESAREGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKQGGALQKELIR  128



>ref|XP_006436446.1| hypothetical protein CICLE_v10030821mg [Citrus clementina]
 ref|XP_006485648.1| PREDICTED: phenylalanine ammonia-lyase-like [Citrus sinensis]
 gb|ESR49686.1| hypothetical protein CICLE_v10030821mg [Citrus clementina]
Length=722

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 95/112 (85%), Gaps = 2/112 (2%)
 Frame = +1

Query  280  DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVEL  459
            DPLNW  AA++LKGSHLDEVKRMV+EYR+  VKLGGE+LTI QV A+AA      VKVEL
Sbjct  29   DPLNWTVAADSLKGSHLDEVKRMVDEYRRPVVKLGGESLTIGQVTAIAAHDSG--VKVEL  86

Query  460  SEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIR  615
            +EAARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG ALQKELIR
Sbjct  87   AEAARAGVKASSDWVMDSMMKGTDSYGVTTGFGATSHRRTKQGGALQKELIR  138



>ref|XP_008454139.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=708

 Score =   166 bits (419),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 102/131 (78%), Gaps = 9/131 (7%)
 Frame = +1

Query  223  NGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTI  402
            NG +   C+       +  DPLNW  AAE++KGSHLDEVKRMVEEYR+  VKLGGETLTI
Sbjct  5    NGSSESLCM-------NGQDPLNWGLAAESMKGSHLDEVKRMVEEYRRPLVKLGGETLTI  57

Query  403  aqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTK  582
            +QVAA+A +    +V VEL+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRT 
Sbjct  58   SQVAAIATRDN--DVVVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTN  115

Query  583  QGAALQKELIR  615
            QG ALQKELIR
Sbjct  116  QGGALQKELIR  126



>sp|Q42667.1|PALY_CITLI RecName: Full=Phenylalanine ammonia-lyase [Citrus limon]
 gb|AAB67733.1| phenylalanine ammonia-lyase [Citrus limon]
Length=722

 Score =   166 bits (419),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 95/112 (85%), Gaps = 2/112 (2%)
 Frame = +1

Query  280  DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVEL  459
            DPLNW  AA++LKGSHLDEVKRM++EYR+  VKLGGE+LTI QV A+AA      VKVEL
Sbjct  29   DPLNWTVAADSLKGSHLDEVKRMIDEYRRPVVKLGGESLTIGQVTAIAAHDSG--VKVEL  86

Query  460  SEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIR  615
            +EAARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG ALQKELIR
Sbjct  87   AEAARAGVKASSDWVMDSMMKGTDSYGVTTGFGATSHRRTKQGGALQKELIR  138



>gb|AFZ78651.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=711

 Score =   165 bits (418),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 95/124 (77%), Gaps = 2/124 (2%)
 Frame = +1

Query  244  CVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaava  423
            C        S  DPLNW  AAE+LKGSHLDEVKRM++EYRK  +KLGGETLTI QV A+A
Sbjct  8    CTGNGSLGFSPSDPLNWGMAAESLKGSHLDEVKRMIDEYRKPVIKLGGETLTIGQVTAIA  67

Query  424  aqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQK  603
            ++     VKVELSE AR GVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG  LQK
Sbjct  68   SRDVG--VKVELSEEARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGELQK  125

Query  604  ELIR  615
            ELIR
Sbjct  126  ELIR  129



>ref|XP_010107520.1| Phenylalanine ammonia-lyase [Morus notabilis]
 gb|EXC16202.1| Phenylalanine ammonia-lyase [Morus notabilis]
Length=725

 Score =   166 bits (419),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 104/138 (75%), Gaps = 4/138 (3%)
 Frame = +1

Query  208  NGIISNGHA-HGFCVEQKRRASS-SHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKL  381
            NG + NG +  G C          S D LNW AAAEA+KGSHL+EVKRMVEEYRK  V L
Sbjct  9    NGHVQNGVSLEGICTSNGNNGGVVSGDALNWGAAAEAMKGSHLEEVKRMVEEYRKPAVNL  68

Query  382  GGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGA  561
            GGETLTI+QVAA+A+      VKVELSEAAR GVKASSDWVM  M  GTDSYGVTTGFGA
Sbjct  69   GGETLTISQVAAIASHDCG--VKVELSEAAREGVKASSDWVMESMSKGTDSYGVTTGFGA  126

Query  562  TSHRRTKQGAALQKELIR  615
            TSHRRTKQG ALQKELIR
Sbjct  127  TSHRRTKQGGALQKELIR  144



>gb|AAO13347.1| phenylalanine ammonia-lyase2 [Lactuca sativa]
Length=713

 Score =   165 bits (418),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 101/131 (77%), Gaps = 9/131 (7%)
 Frame = +1

Query  223  NGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTI  402
            NG    FCV+         DPLNW  AAE+LKGSHLDEVKRMV E+RK  V+LGGETLT+
Sbjct  13   NGERAEFCVKG--------DPLNWGMAAESLKGSHLDEVKRMVAEFRKPVVRLGGETLTV  64

Query  403  aqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTK  582
            +QVAA+AA      VKVELSE ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTK
Sbjct  65   SQVAAIAASDNA-GVKVELSETARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTK  123

Query  583  QGAALQKELIR  615
            +G ALQKELIR
Sbjct  124  EGGALQKELIR  134



>gb|KGN52974.1| hypothetical protein Csa_4G008770 [Cucumis sativus]
Length=592

 Score =   165 bits (417),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 101/131 (77%), Gaps = 9/131 (7%)
 Frame = +1

Query  223  NGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTI  402
            NG     C       SS  DPLNW  AA+++KGSHLDEVKRMVEEYR+  VKLGG+TLTI
Sbjct  10   NGSMESLC-------SSHQDPLNWGLAADSMKGSHLDEVKRMVEEYRRPLVKLGGQTLTI  62

Query  403  aqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTK  582
            +QVAA+A +    +V VEL+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRT 
Sbjct  63   SQVAAIATRDN--DVLVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTN  120

Query  583  QGAALQKELIR  615
            QG ALQKELIR
Sbjct  121  QGGALQKELIR  131



>dbj|BAL49995.1| phenylalanine ammonia-lyase [Eucalyptus robusta]
 dbj|BAL63070.1| phenylalanine ammonia-lyase [Eucalyptus robusta]
Length=715

 Score =   165 bits (418),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 104/137 (76%), Gaps = 13/137 (9%)
 Frame = +1

Query  205  GNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLG  384
            GNG+      HG C    R A    DPLNW AAA AL GSHLDEVKRMVEEYR+  V+LG
Sbjct  10   GNGL------HGLCATGSRHA----DPLNWGAAAAALTGSHLDEVKRMVEEYRRPAVRLG  59

Query  385  GETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGAT  564
            GE+LTIAQVAAVA+Q G   V VELSEAAR  VKASSDWVM  M  GTDSYGVTTGFGAT
Sbjct  60   GESLTIAQVAAVASQEG---VGVELSEAARPRVKASSDWVMESMNKGTDSYGVTTGFGAT  116

Query  565  SHRRTKQGAALQKELIR  615
            SHRRTKQG ALQKELIR
Sbjct  117  SHRRTKQGGALQKELIR  133



>ref|XP_008449240.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Cucumis melo]
Length=714

 Score =   165 bits (418),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 110/133 (83%), Gaps = 6/133 (5%)
 Frame = +1

Query  223  NGHAHG--FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETL  396
            +G+ +G  FC+    R++S++DPLNW AAAE+LKGSHL+EVKRMVEEYR+  VKLGGETL
Sbjct  4    SGYQNGVEFCI--GARSNSNNDPLNWGAAAESLKGSHLEEVKRMVEEYRRPVVKLGGETL  61

Query  397  TIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRR  576
            TI+QVAA+A++     V VELSE+AR GV+ASS WVM  M  GTDSYGVTTGFGATSHRR
Sbjct  62   TISQVAAIASRDSG--VVVELSESARGGVEASSKWVMDSMNQGTDSYGVTTGFGATSHRR  119

Query  577  TKQGAALQKELIR  615
            TK+G ALQ+ELIR
Sbjct  120  TKEGGALQRELIR  132



>gb|AAZ29735.1| phenylalanine ammonia lyase [Trifolium pratense]
Length=725

 Score =   165 bits (418),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 96/112 (86%), Gaps = 3/112 (3%)
 Frame = +1

Query  280  DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVEL  459
            DPLNW  AAEA+KGSHLDEVKRMVEEYRK  V+LGG+TLTI+QVAA+AA  G     VEL
Sbjct  35   DPLNWGVAAEAMKGSHLDEVKRMVEEYRKPVVRLGGKTLTISQVAAIAAHDGA---TVEL  91

Query  460  SEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIR  615
            SE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG ALQKELIR
Sbjct  92   SESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIR  143



>gb|KDO46246.1| hypothetical protein CISIN_1g004955mg [Citrus sinensis]
Length=722

 Score =   165 bits (418),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 95/112 (85%), Gaps = 2/112 (2%)
 Frame = +1

Query  280  DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVEL  459
            DPLNW  AA++LKGSHLDEVKRM++EYR+  VKLGGE+LTI QV A+AA      VKVEL
Sbjct  29   DPLNWTVAADSLKGSHLDEVKRMIDEYRRPVVKLGGESLTIGQVTAIAAHDSG--VKVEL  86

Query  460  SEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIR  615
            +EAARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG ALQKELIR
Sbjct  87   AEAARAGVKASSDWVMDSMMKGTDSYGVTTGFGATSHRRTKQGGALQKELIR  138



>gb|AEE81750.1| phenylalanine ammonia lyase [Morus alba var. multicaulis]
Length=726

 Score =   165 bits (418),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 106/138 (77%), Gaps = 4/138 (3%)
 Frame = +1

Query  208  NGIISNGHA-HGFCVEQKRRAS-SSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKL  381
            NG + NG +  G C          S D LNW AAAEA+KGSHL+EVK+MVEEYRK  V L
Sbjct  9    NGHVKNGVSLEGICTSNGSNGGIVSGDALNWGAAAEAMKGSHLEEVKKMVEEYRKPAVNL  68

Query  382  GGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGA  561
            GGETLTI+QVAA+A+Q     VKVELSEAAR GVKASSDWVM  M+ GTDSYGVTTGFGA
Sbjct  69   GGETLTISQVAAIASQDSG--VKVELSEAAREGVKASSDWVMESMDKGTDSYGVTTGFGA  126

Query  562  TSHRRTKQGAALQKELIR  615
            TSHRRTKQG ALQKELIR
Sbjct  127  TSHRRTKQGGALQKELIR  144



>ref|XP_010528074.1| PREDICTED: phenylalanine ammonia-lyase 1 [Tarenaya hassleriana]
Length=720

 Score =   165 bits (418),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 99/117 (85%), Gaps = 1/117 (1%)
 Frame = +1

Query  265  ASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPE  444
            A+S+ DPLNW AAAE +KGSHL+EVKRMVEE+R+  V+LGGETLTI QVAA++A G    
Sbjct  23   AASAEDPLNWGAAAEEMKGSHLEEVKRMVEEFRRPVVRLGGETLTIGQVAAISAAGND-G  81

Query  445  VKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIR  615
             KVELSEAARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTK G ALQKELIR
Sbjct  82   AKVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGVALQKELIR  138



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090