BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS082B11

Length=564
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007039329.1|  Subtilase family protein                           174   6e-48   
ref|XP_010529680.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    175   1e-47   Tarenaya hassleriana [spider flower]
ref|XP_010529681.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    175   1e-47   Tarenaya hassleriana [spider flower]
ref|XP_010529679.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    175   1e-47   Tarenaya hassleriana [spider flower]
ref|XP_009350314.1|  PREDICTED: subtilisin-like protease SBT5.3         172   1e-46   
ref|XP_006306822.1|  hypothetical protein CARUB_v10008364mg             172   2e-46   Capsella rubella
ref|XP_007210725.1|  hypothetical protein PRUPE_ppa022363mg             171   4e-46   Prunus persica
ref|XP_010436465.1|  PREDICTED: subtilisin-like protease SBT3.5         171   4e-46   
ref|XP_011081356.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    171   5e-46   Sesamum indicum [beniseed]
ref|XP_011081355.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    171   6e-46   Sesamum indicum [beniseed]
ref|XP_009344070.1|  PREDICTED: subtilisin-like protease SBT5.3         170   9e-46   Pyrus x bretschneideri [bai li]
ref|XP_008392653.1|  PREDICTED: subtilisin-like protease                167   2e-45   
ref|XP_009348696.1|  PREDICTED: subtilisin-like protease SBT5.4         169   2e-45   
emb|CDX94251.1|  BnaC02g29110D                                          169   2e-45   
gb|EYU19440.1|  hypothetical protein MIMGU_mgv1a001654mg                169   3e-45   Erythranthe guttata [common monkey flower]
ref|XP_010421966.1|  PREDICTED: subtilisin-like protease SBT3.3         169   3e-45   Camelina sativa [gold-of-pleasure]
emb|CDX93808.1|  BnaA09g24080D                                          169   3e-45   
ref|XP_009114847.1|  PREDICTED: subtilisin-like protease SBT5.3         169   4e-45   Brassica rapa
ref|XP_010445236.1|  PREDICTED: subtilisin-like protease SBT3.5         169   5e-45   
gb|KFK45042.1|  hypothetical protein AALP_AA1G336600                    168   5e-45   Arabis alpina [alpine rockcress]
ref|XP_009114844.1|  PREDICTED: subtilisin-like protease SBT5.3         168   5e-45   Brassica rapa
ref|XP_002298974.2|  hypothetical protein POPTR_0001s45470g             167   7e-45   
gb|AAF31277.1|AC006424_6  Second of four adjacent putative subtil...    167   7e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006415136.1|  hypothetical protein EUTSA_v10006855mg             168   7e-45   Eutrema salsugineum [saltwater cress]
ref|XP_009128706.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    167   8e-45   Brassica rapa
ref|NP_564413.2|  subtilase family protein                              167   8e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009128705.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    167   1e-44   
ref|XP_009128704.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    167   1e-44   Brassica rapa
ref|XP_010449086.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    167   1e-44   Camelina sativa [gold-of-pleasure]
ref|XP_002891020.1|  subtilase family protein                           167   2e-44   
ref|XP_011075896.1|  PREDICTED: subtilisin-like protease SBT3.5         167   2e-44   Sesamum indicum [beniseed]
ref|XP_006397048.1|  hypothetical protein EUTSA_v10028454mg             166   3e-44   Eutrema salsugineum [saltwater cress]
ref|NP_564412.1|  Subtilase 3.5                                         166   4e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002891021.1|  predicted protein                                  166   5e-44   Arabidopsis lyrata subsp. lyrata
ref|XP_010437012.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    164   6e-44   Camelina sativa [gold-of-pleasure]
ref|XP_006397045.1|  hypothetical protein EUTSA_v10028448mg             165   7e-44   Eutrema salsugineum [saltwater cress]
ref|XP_002891022.1|  subtilase family protein                           165   7e-44   Arabidopsis lyrata subsp. lyrata
ref|XP_002518937.1|  Cucumisin precursor, putative                      165   9e-44   Ricinus communis
ref|XP_010437005.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    165   9e-44   Camelina sativa [gold-of-pleasure]
ref|XP_006413792.1|  hypothetical protein EUTSA_v10024501mg             164   9e-44   Eutrema salsugineum [saltwater cress]
ref|XP_002317663.1|  subtilase family protein                           165   9e-44   Populus trichocarpa [western balsam poplar]
ref|XP_006287107.1|  hypothetical protein CARUB_v10000269mg             165   1e-43   
gb|AGN12874.1|  putative transcription factor DYSFUNCTIONAL TAPET...    164   2e-43   Sisymbrium irio
ref|XP_011040610.1|  PREDICTED: subtilisin-like protease SBT3.3         164   2e-43   Populus euphratica
gb|KJB74658.1|  hypothetical protein B456_012G000900                    164   2e-43   Gossypium raimondii
ref|XP_010455451.1|  PREDICTED: subtilisin-like protease SBT3.5         166   2e-43   
ref|XP_006306827.1|  hypothetical protein CARUB_v10008369mg             163   3e-43   
ref|XP_010099424.1|  Subtilisin-like protease                           159   3e-43   
ref|XP_002867837.1|  subtilase family protein                           162   4e-43   
ref|XP_010542106.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    162   5e-43   Tarenaya hassleriana [spider flower]
ref|XP_010529677.1|  PREDICTED: subtilisin-like protease SBT3.3         163   5e-43   Tarenaya hassleriana [spider flower]
ref|XP_010542096.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    163   5e-43   
gb|KFK45040.1|  hypothetical protein AALP_AA1G336300                    162   6e-43   Arabis alpina [alpine rockcress]
gb|KFK28745.1|  hypothetical protein AALP_AA7G041500                    162   7e-43   Arabis alpina [alpine rockcress]
ref|XP_002872522.1|  subtilase family protein                           162   8e-43   
gb|AAD03431.1|  similar to the subtilase family of serine proteas...    162   8e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009348701.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    156   9e-43   Pyrus x bretschneideri [bai li]
ref|NP_001078370.1|  subtilisin-like protease                           161   1e-42   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE98849.1|  subtilisin-like protease -like protein                 161   1e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010529409.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    162   1e-42   Tarenaya hassleriana [spider flower]
ref|XP_010529408.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    162   1e-42   Tarenaya hassleriana [spider flower]
emb|CDX84657.1|  BnaA03g15730D                                          161   1e-42   
ref|XP_010318062.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    161   1e-42   Solanum lycopersicum
ref|XP_011470880.1|  PREDICTED: subtilisin-like protease SBT3.3         162   1e-42   Fragaria vesca subsp. vesca
ref|XP_010318060.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    162   1e-42   Solanum lycopersicum
emb|CAB40021.1|  subtilisin-like protease-like protein                  162   1e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010318061.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    161   1e-42   Solanum lycopersicum
ref|XP_009132975.1|  PREDICTED: subtilisin-like protease SBT5.3         161   1e-42   Brassica rapa
ref|NP_567362.1|  subtilisin-like protease                              161   1e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867836.1|  subtilase family protein                           161   1e-42   
ref|NP_001190697.1|  subtilisin-like protease                           162   2e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010421968.1|  PREDICTED: subtilisin-like protease SBT3.3         160   2e-42   Camelina sativa [gold-of-pleasure]
ref|NP_564414.2|  Subtilase family protein SBT3.3                       161   2e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009344068.1|  PREDICTED: subtilisin-like protease SBT5.3         160   3e-42   
ref|XP_010470055.1|  PREDICTED: subtilisin-like protease SBT3.3         160   3e-42   
gb|KJB52411.1|  hypothetical protein B456_008G260500                    161   3e-42   Gossypium raimondii
emb|CDX91186.1|  BnaC02g04110D                                          160   4e-42   
ref|XP_009128710.1|  PREDICTED: subtilisin-like protease SBT5.3         160   4e-42   Brassica rapa
emb|CDY54842.1|  BnaC05g51310D                                          162   4e-42   Brassica napus [oilseed rape]
ref|NP_567358.1|  Subtilase family protein                              160   4e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287119.1|  hypothetical protein CARUB_v10000289mg             160   4e-42   
gb|AAD03438.1|  similar to the subtilase family of serine proteas...    160   4e-42   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567360.1|  Subtilase family protein                              160   4e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009137200.1|  PREDICTED: subtilisin-like protease SBT5.3         160   5e-42   Brassica rapa
ref|NP_567359.1|  Subtilase family protein                              160   5e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002874634.1|  subtilase family protein                           160   5e-42   
ref|XP_006391365.1|  hypothetical protein EUTSA_v10018142mg             160   7e-42   
ref|XP_009105192.1|  PREDICTED: subtilisin-like protease SBT5.3         159   7e-42   Brassica rapa
emb|CDY07491.1|  BnaA07g25700D                                          159   7e-42   Brassica napus [oilseed rape]
gb|AAD03430.1|  similar to the subtilase family of serine proteas...    159   7e-42   Arabidopsis thaliana [mouse-ear cress]
emb|CDX79081.1|  BnaA01g11480D                                          159   8e-42   
ref|XP_010661922.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    161   1e-41   
ref|XP_009135013.1|  PREDICTED: subtilisin-like protease SBT5.3         159   1e-41   Brassica rapa
ref|XP_002872521.1|  predicted protein                                  159   1e-41   Arabidopsis lyrata subsp. lyrata
ref|XP_010449026.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    156   2e-41   
ref|XP_008239249.1|  PREDICTED: subtilisin-like protease                159   2e-41   Prunus mume [ume]
ref|XP_002867838.1|  subtilase family protein                           157   2e-41   
ref|XP_007210025.1|  hypothetical protein PRUPE_ppa018629mg             158   2e-41   Prunus persica
ref|NP_567361.1|  Subtilase family protein                              158   2e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011038011.1|  PREDICTED: subtilisin-like protease SBT3.5         158   2e-41   Populus euphratica
ref|XP_010436981.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    157   3e-41   
ref|XP_010104913.1|  Subtilisin-like protease                           158   3e-41   
ref|XP_006397047.1|  hypothetical protein EUTSA_v10028468mg             157   3e-41   
emb|CDX82843.1|  BnaC01g12930D                                          157   4e-41   
ref|XP_002874635.1|  subtilase family protein                           157   4e-41   
ref|XP_010554964.1|  PREDICTED: subtilisin-like protease SBT3.3         157   4e-41   
ref|XP_010436973.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    157   4e-41   Camelina sativa [gold-of-pleasure]
emb|CDY65868.1|  BnaAnng21170D                                          156   5e-41   Brassica napus [oilseed rape]
gb|KHN39834.1|  Cucumisin                                               157   6e-41   Glycine soja [wild soybean]
ref|XP_010437025.1|  PREDICTED: subtilisin-like protease SBT3.5         157   6e-41   Camelina sativa [gold-of-pleasure]
ref|XP_003537841.1|  PREDICTED: cucumisin-like                          157   6e-41   Glycine max [soybeans]
ref|XP_010434151.1|  PREDICTED: subtilisin-like protease SBT3.3         153   7e-41   
ref|XP_002298973.2|  subtilase family protein                           157   8e-41   
ref|XP_006301525.1|  hypothetical protein CARUB_v10021953mg             156   1e-40   Capsella rubella
ref|XP_010449025.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    156   1e-40   
ref|XP_006286458.1|  hypothetical protein CARUB_v10000288mg             156   1e-40   Capsella rubella
ref|XP_009125836.1|  PREDICTED: subtilisin-like protease SBT5.4         156   1e-40   Brassica rapa
ref|XP_006377885.1|  hypothetical protein POPTR_0011s15430g             155   1e-40   
emb|CDX94043.1|  BnaC07g36770D                                          156   1e-40   
ref|XP_009114845.1|  PREDICTED: subtilisin-like protease SBT5.3         156   1e-40   Brassica rapa
ref|XP_010434150.1|  PREDICTED: subtilisin-like protease SBT3.3         149   1e-40   Camelina sativa [gold-of-pleasure]
ref|XP_007039203.1|  Subtilase family protein, putative                 156   2e-40   
ref|XP_009137202.1|  PREDICTED: subtilisin-like protease SBT5.3         156   2e-40   Brassica rapa
gb|KFK41050.1|  hypothetical protein AALP_AA2G078900                    155   2e-40   Arabis alpina [alpine rockcress]
ref|XP_010461117.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    155   2e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010461118.1|  PREDICTED: subtilisin-like protease SBT3.5         155   2e-40   Camelina sativa [gold-of-pleasure]
emb|CBI23066.3|  unnamed protein product                                154   2e-40   Vitis vinifera
ref|XP_002273195.2|  PREDICTED: subtilisin-like protease SBT3.5         155   4e-40   Vitis vinifera
ref|XP_010513580.1|  PREDICTED: subtilisin-like protease SBT3.3         154   4e-40   
gb|KFK31853.1|  hypothetical protein AALP_AA6G166900                    155   4e-40   Arabis alpina [alpine rockcress]
emb|CDY61569.1|  BnaCnng38020D                                          156   5e-40   Brassica napus [oilseed rape]
ref|XP_002893749.1|  hypothetical protein ARALYDRAFT_473479             154   5e-40   
ref|XP_006413751.1|  hypothetical protein EUTSA_v10024480mg             154   1e-39   Eutrema salsugineum [saltwater cress]
emb|CAB36809.1|  subtilisin proteinase-like                             153   1e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010445228.1|  PREDICTED: subtilisin-like protease SBT3.3         154   1e-39   
gb|AAL24366.1|  subtilisin proteinase-like                              152   1e-39   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567632.1|  Subtilase family protein                              153   2e-39   
ref|NP_567633.2|  Subtilase family protein                              153   2e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010421967.1|  PREDICTED: subtilisin-like protease SBT3.3         153   2e-39   Camelina sativa [gold-of-pleasure]
ref|XP_006306820.1|  hypothetical protein CARUB_v10008362mg             153   2e-39   Capsella rubella
emb|CDY67954.1|  BnaAnng25710D                                          152   2e-39   Brassica napus [oilseed rape]
ref|XP_010499844.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    152   3e-39   
ref|XP_010478713.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    151   3e-39   Camelina sativa [gold-of-pleasure]
gb|AID21654.1|  At4g21323p-like protein                                 152   3e-39   Arabidopsis lyrata [lyrate rockcress]
ref|NP_193895.2|  Subtilase family protein                              152   3e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010474133.1|  PREDICTED: subtilisin-like protease SBT3.3         152   3e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010528996.1|  PREDICTED: subtilisin-like protease SBT3.5         152   3e-39   
gb|KFK41045.1|  hypothetical protein AALP_AA2G078300                    152   4e-39   Arabis alpina [alpine rockcress]
ref|XP_011470878.1|  PREDICTED: uncharacterized protein LOC101314621    154   4e-39   Fragaria vesca subsp. vesca
ref|XP_010478712.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    152   4e-39   Camelina sativa [gold-of-pleasure]
ref|XP_011038010.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    151   5e-39   Populus euphratica
emb|CDX98693.1|  BnaA03g44780D                                          152   5e-39   
emb|CDX94044.1|  BnaC07g36780D                                          151   6e-39   
ref|XP_006286454.1|  hypothetical protein CARUB_v10000290mg             151   6e-39   Capsella rubella
emb|CAB36808.1|  subtilisin-like protease                               151   8e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011038008.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    151   9e-39   Populus euphratica
ref|NP_564869.1|  Subtilase-like protein                                150   1e-38   Arabidopsis thaliana [mouse-ear cress]
ref|NP_174573.1|  Subtilisin-like serine endopeptidase family pro...    150   1e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010455450.1|  PREDICTED: subtilisin-like protease SBT3.3         150   1e-38   Camelina sativa [gold-of-pleasure]
gb|AID21679.1|  At4g21323p-like protein                                 150   2e-38   Arabidopsis lyrata [lyrate rockcress]
gb|AID21582.1|  AT4G21323p                                              150   2e-38   Arabidopsis halleri
gb|AID21686.1|  At4g21323p-like protein                                 150   2e-38   Arabidopsis lyrata [lyrate rockcress]
ref|XP_010463200.1|  PREDICTED: subtilisin-like protease SBT3.5         150   2e-38   
ref|XP_010511550.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    148   3e-38   
emb|CCI61493.1|  unnamed protein product                                149   4e-38   Arabidopsis halleri
gb|ACN35690.1|  unknown                                                 143   4e-38   Zea mays [maize]
gb|AID21628.1|  At4g21326p-like protein                                 149   4e-38   Arabidopsis lyrata [lyrate rockcress]
ref|XP_010480961.1|  PREDICTED: subtilisin-like protease SBT3.5         149   4e-38   
gb|AID21678.1|  At4g21326p-like protein                                 149   5e-38   Arabidopsis lyrata [lyrate rockcress]
gb|AID21602.1|  At4g21323p-like protein                                 149   5e-38   Arabidopsis halleri
ref|XP_003634153.1|  PREDICTED: subtilisin-like protease SBT3.5         149   5e-38   Vitis vinifera
ref|XP_010511549.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    149   5e-38   Camelina sativa [gold-of-pleasure]
ref|XP_003634152.2|  PREDICTED: subtilisin-like protease SBT3.5         149   5e-38   Vitis vinifera
ref|XP_010419003.1|  PREDICTED: subtilisin-like protease SBT3.3         148   6e-38   
gb|AID21619.1|  At4g21323p-like protein                                 149   7e-38   Arabidopsis halleri
ref|XP_006304869.1|  hypothetical protein CARUB_v10012621mg             148   7e-38   
emb|CBI23086.3|  unnamed protein product                                149   8e-38   Vitis vinifera
gb|AID21627.1|  At4g21323p-like protein                                 149   9e-38   Arabidopsis lyrata [lyrate rockcress]
ref|XP_007131764.1|  hypothetical protein PHAVU_011G039900g             148   9e-38   Phaseolus vulgaris [French bean]
gb|KHN12354.1|  Subtilisin-like protease                                138   1e-37   Glycine soja [wild soybean]
emb|CDX93811.1|  BnaA09g24110D                                          148   1e-37   
ref|XP_002888489.1|  subtilase family protein                           148   1e-37   
emb|CDX98690.1|  BnaA03g44750D                                          147   1e-37   
gb|ADQ37345.1|  unknown                                                 147   1e-37   Arabidopsis lyrata [lyrate rockcress]
ref|XP_006399712.1|  hypothetical protein EUTSA_v10012766mg             147   2e-37   Eutrema salsugineum [saltwater cress]
ref|XP_010538146.1|  PREDICTED: subtilisin-like protease SBT3.5         147   2e-37   Tarenaya hassleriana [spider flower]
emb|CBI23085.3|  unnamed protein product                                149   2e-37   Vitis vinifera
emb|CDX86874.1|  BnaA09g22640D                                          147   2e-37   
dbj|BAD94221.1|  subtilisin proteinase like protein                     137   3e-37   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567625.4|  subtilase 3.12                                        147   3e-37   
gb|ABV21208.1|  At4g21326                                               146   3e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010449088.1|  PREDICTED: subtilisin-like protease SBT3.5         147   3e-37   Camelina sativa [gold-of-pleasure]
emb|CAB87667.1|  subtilisin-like protease-like protein                  146   4e-37   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568255.1|  Subtilase family protein                              146   4e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006391366.1|  hypothetical protein EUTSA_v10018188mg             146   4e-37   
gb|AID21685.1|  At4g21326p-like protein                                 146   5e-37   Arabidopsis lyrata [lyrate rockcress]
gb|ADQ37356.1|  unknown                                                 145   6e-37   Arabidopsis lyrata [lyrate rockcress]
emb|CDX99526.1|  BnaC09g24660D                                          146   6e-37   
gb|AAG51763.1|AC066691_3  hypothetical protein; 8963-6048               145   7e-37   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564868.2|  Subtilisin-like serine endopeptidase family pro...    145   8e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002869894.1|  hypothetical protein ARALYDRAFT_329472             147   9e-37   
emb|CAA20197.1|  putative protein                                       147   1e-36   Arabidopsis thaliana [mouse-ear cress]
gb|AJP61136.1|  At4g21326p-like protein                                 145   1e-36   Arabidopsis halleri
gb|AID21653.1|  At4g21326p-like protein                                 145   1e-36   Arabidopsis lyrata [lyrate rockcress]
gb|AJP61138.1|  At4g21323p-like protein                                 145   1e-36   Arabidopsis halleri
ref|XP_010470496.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    144   2e-36   Camelina sativa [gold-of-pleasure]
emb|CDY25259.1|  BnaA02g21970D                                          144   2e-36   Brassica napus [oilseed rape]
ref|XP_006283139.1|  hypothetical protein CARUB_v10004165mg             145   2e-36   Capsella rubella
gb|ADQ37388.1|  unknown                                                 144   2e-36   Capsella rubella
gb|AID21581.1|  AT4G21326p                                              144   2e-36   Arabidopsis halleri
ref|XP_002871506.1|  subtilase family protein                           144   2e-36   Arabidopsis lyrata subsp. lyrata
ref|XP_010470495.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    144   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_006283179.1|  hypothetical protein CARUB_v10004209mg             144   3e-36   Capsella rubella
ref|XP_006829608.1|  hypothetical protein AMTR_s00122p00022570          135   4e-36   
gb|AID21603.1|  At4g21326p-like protein                                 144   4e-36   Arabidopsis halleri
ref|XP_004957446.1|  PREDICTED: subtilisin-like protease SDD1-like      144   4e-36   Setaria italica
gb|AJP61119.1|  At4g21326p-like protein                                 143   4e-36   Arabidopsis halleri
emb|CCI61494.1|  unnamed protein product                                143   5e-36   Arabidopsis halleri
gb|ADQ37368.1|  unknown                                                 142   6e-36   Arabidopsis lyrata [lyrate rockcress]
ref|XP_010919043.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    143   7e-36   
ref|XP_008778788.1|  PREDICTED: subtilisin-like protease SBT5.4         140   8e-36   
ref|XP_010919042.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    143   9e-36   Elaeis guineensis
ref|XP_009407970.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    142   1e-35   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY70485.1|  BnaA03g58450D                                          142   2e-35   Brassica napus [oilseed rape]
ref|XP_009137186.1|  PREDICTED: subtilisin-like protease SBT5.3         142   2e-35   Brassica rapa
gb|KFK31852.1|  hypothetical protein AALP_AA6G166800                    143   2e-35   Arabis alpina [alpine rockcress]
ref|NP_001159267.1|  uncharacterized protein LOC100304357 precursor     141   2e-35   Zea mays [maize]
ref|XP_010538683.1|  PREDICTED: subtilisin-like protease SBT3.5         141   2e-35   Tarenaya hassleriana [spider flower]
ref|XP_006370728.1|  hypothetical protein POPTR_0001s45460g             137   3e-35   
ref|XP_010109770.1|  hypothetical protein L484_008446                   141   4e-35   
ref|XP_007201744.1|  hypothetical protein PRUPE_ppa001956mg             140   5e-35   
ref|XP_009351288.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    140   5e-35   Pyrus x bretschneideri [bai li]
ref|XP_009351289.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    140   5e-35   Pyrus x bretschneideri [bai li]
gb|EAZ09847.1|  hypothetical protein OsI_32138                          140   6e-35   Oryza sativa Indica Group [Indian rice]
ref|XP_006423460.1|  hypothetical protein CICLE_v10027857mg             138   1e-34   
gb|KDO40058.1|  hypothetical protein CISIN_1g006582mg                   138   1e-34   Citrus sinensis [apfelsine]
ref|XP_010271498.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    139   1e-34   Nelumbo nucifera [Indian lotus]
ref|XP_010271499.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    139   1e-34   Nelumbo nucifera [Indian lotus]
ref|XP_008236858.1|  PREDICTED: subtilisin-like protease                139   1e-34   Prunus mume [ume]
ref|XP_006487362.1|  PREDICTED: subtilisin-like protease SDD1-lik...    138   2e-34   Citrus sinensis [apfelsine]
ref|XP_007042043.1|  Subtilase family protein, putative isoform 2       137   3e-34   
ref|XP_006487361.1|  PREDICTED: subtilisin-like protease SDD1-lik...    139   3e-34   Citrus sinensis [apfelsine]
gb|EMT21161.1|  Cucumisin                                               138   3e-34   
ref|XP_006423459.1|  hypothetical protein CICLE_v10027857mg             139   3e-34   Citrus clementina [clementine]
ref|XP_008342302.1|  PREDICTED: subtilisin-like protease                138   3e-34   Malus domestica [apple tree]
ref|XP_002460565.1|  hypothetical protein SORBIDRAFT_02g030760          138   4e-34   Sorghum bicolor [broomcorn]
ref|XP_011458289.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    137   4e-34   Fragaria vesca subsp. vesca
emb|CDY49641.1|  BnaCnng17930D                                          138   4e-34   Brassica napus [oilseed rape]
ref|XP_007042042.1|  Subtilase family protein, putative isoform 1       138   5e-34   
ref|XP_007042044.1|  Subtilase family protein, putative isoform 3       138   5e-34   
ref|XP_011458288.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    137   7e-34   Fragaria vesca subsp. vesca
ref|XP_011458287.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    137   7e-34   Fragaria vesca subsp. vesca
emb|CDX93810.1|  BnaA09g24100D                                          137   8e-34   
gb|AFK45690.1|  unknown                                                 128   1e-33   Lotus japonicus
ref|XP_010263869.1|  PREDICTED: subtilisin-like protease SBT3.5         137   1e-33   Nelumbo nucifera [Indian lotus]
gb|KCW55411.1|  hypothetical protein EUGRSUZ_I01318                     136   2e-33   Eucalyptus grandis [rose gum]
gb|KDP41723.1|  hypothetical protein JCGZ_26741                         136   2e-33   Jatropha curcas
ref|XP_010028643.1|  PREDICTED: subtilisin-like protease SBT5.3         136   2e-33   Eucalyptus grandis [rose gum]
ref|XP_006829160.1|  hypothetical protein AMTR_s00001p00269990          136   2e-33   
gb|AES91027.2|  subtilisin-like serine protease                         136   3e-33   Medicago truncatula
ref|XP_002305456.2|  hypothetical protein POPTR_0004s16850g             136   3e-33   Populus trichocarpa [western balsam poplar]
ref|XP_006580143.1|  PREDICTED: subtilisin-like protease SDD1-lik...    135   3e-33   Glycine max [soybeans]
emb|CDX94032.1|  BnaC07g36660D                                          135   3e-33   
dbj|BAK05842.1|  predicted protein                                      135   4e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006580142.1|  PREDICTED: subtilisin-like protease SDD1-lik...    134   4e-33   Glycine max [soybeans]
ref|XP_008775642.1|  PREDICTED: subtilisin-like protease SBT5.3         135   4e-33   
ref|XP_006415135.1|  hypothetical protein EUTSA_v10006863mg             135   4e-33   Eutrema salsugineum [saltwater cress]
ref|XP_006580141.1|  PREDICTED: subtilisin-like protease SDD1-lik...    135   4e-33   Glycine max [soybeans]
ref|XP_006829610.1|  hypothetical protein AMTR_s00122p00026080          135   4e-33   
ref|XP_010499843.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    136   4e-33   
ref|XP_003524182.2|  PREDICTED: subtilisin-like protease SDD1-lik...    135   4e-33   Glycine max [soybeans]
ref|XP_009137185.1|  PREDICTED: subtilisin-like protease SBT5.4         135   6e-33   Brassica rapa
ref|XP_006358675.1|  PREDICTED: xylem serine proteinase 1-like          135   7e-33   
emb|CDY58475.1|  BnaA03g58460D                                          134   7e-33   Brassica napus [oilseed rape]
ref|XP_003608830.1|  Subtilisin-like serine protease                    136   7e-33   
emb|CDX94033.1|  BnaC07g36670D                                          135   7e-33   
ref|NP_567624.1|  Subtilase family protein                              134   1e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010689355.1|  PREDICTED: subtilisin-like protease SBT5.3         134   1e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011037192.1|  PREDICTED: subtilisin-like protease SBT3.5         133   2e-32   Populus euphratica
ref|XP_007039328.1|  Subtilase family protein, putative isoform 2       133   2e-32   
ref|NP_001169390.1|  putative subtilase family protein precursor        132   3e-32   
ref|XP_002512984.1|  Xylem serine proteinase 1 precursor, putative      132   3e-32   
ref|XP_006413795.1|  hypothetical protein EUTSA_v10024459mg             132   4e-32   
ref|XP_007039327.1|  Subtilase family protein, putative isoform 1       133   4e-32   
ref|XP_003614591.1|  Subtilisin-like protease                           132   4e-32   
ref|XP_010436935.1|  PREDICTED: subtilisin-like protease SBT3.3         132   4e-32   
gb|AES91025.2|  subtilisin-like serine protease                         132   5e-32   
ref|XP_003608828.1|  Subtilisin-like serine protease                    132   6e-32   
emb|CAN80173.1|  hypothetical protein VITISV_018392                     132   8e-32   
ref|XP_011079238.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    131   1e-31   
ref|XP_011038012.1|  PREDICTED: subtilisin-like protease SBT3.5         131   1e-31   
ref|XP_011012404.1|  PREDICTED: subtilisin-like protease SBT3.5         131   1e-31   
ref|XP_007131421.1|  hypothetical protein PHAVU_011G012100g             131   1e-31   
ref|XP_003608829.1|  Subtilisin-like serine protease                    130   2e-31   
gb|AES91026.2|  subtilisin-like serine protease                         130   2e-31   
ref|XP_002887016.1|  subtilase family protein                           130   2e-31   
ref|XP_002317660.2|  hypothetical protein POPTR_0011s15400g             130   3e-31   
ref|XP_006351094.1|  PREDICTED: cucumisin-like                          129   5e-31   
ref|XP_006357625.1|  PREDICTED: subtilisin-like protease-like           127   6e-31   
gb|AAO61749.1|AF366558_1  subtilisin-like seed-specific protein         123   7e-31   
ref|XP_007039330.1|  Subtilase family protein, putative                 129   1e-30   
ref|XP_002278450.2|  PREDICTED: subtilisin-like protease SBT3.3         129   1e-30   
ref|XP_002298975.2|  hypothetical protein POPTR_0001s45490g             129   1e-30   
emb|CBI34615.3|  unnamed protein product                                128   1e-30   
emb|CDY07492.1|  BnaA07g25710D                                          128   1e-30   
ref|XP_009105193.1|  PREDICTED: subtilisin-like protease SBT5.3         128   1e-30   
gb|AET04097.2|  subtilisin-like serine protease                         128   1e-30   
ref|XP_003629621.1|  Subtilisin-like protease                           128   1e-30   
ref|NP_001063751.1|  Os09g0530800                                       128   2e-30   
ref|XP_006387513.1|  hypothetical protein POPTR_0909s00200g             123   2e-30   
ref|XP_010551747.1|  PREDICTED: subtilisin-like protease SBT3.5         127   2e-30   
ref|XP_003578494.1|  PREDICTED: subtilisin-like protease SBT3.5         127   3e-30   
ref|XP_010056037.1|  PREDICTED: subtilisin-like protease SBT5.3         127   3e-30   
ref|XP_006660880.1|  PREDICTED: subtilisin-like protease-like           127   4e-30   
ref|XP_010495162.1|  PREDICTED: subtilisin-like protease SBT3.3         122   4e-30   
ref|XP_011040612.1|  PREDICTED: subtilisin-like protease SBT3.5         127   4e-30   
ref|XP_007153620.1|  hypothetical protein PHAVU_003G050900g             126   5e-30   
ref|XP_008452040.1|  PREDICTED: subtilisin-like protease                126   5e-30   
ref|XP_006387236.1|  hypothetical protein POPTR_1449s00200g             119   6e-30   
gb|KEH35215.1|  subtilisin-like serine protease                         125   1e-29   
gb|KEH35216.1|  subtilisin-like serine protease                         125   1e-29   
gb|KJB22186.1|  hypothetical protein B456_004G034100                    125   1e-29   
ref|XP_002967355.1|  hypothetical protein SELMODRAFT_439868             125   1e-29   
ref|XP_003601486.1|  Subtilisin-like protease                           125   1e-29   
ref|XP_006289915.1|  hypothetical protein CARUB_v10003531mg             125   2e-29   
ref|XP_007210133.1|  hypothetical protein PRUPE_ppa022964mg             124   2e-29   
ref|XP_006289363.1|  hypothetical protein CARUB_v10002849mg             124   3e-29   
ref|XP_002518939.1|  Cucumisin precursor, putative                      124   3e-29   
ref|XP_002525017.1|  Xylem serine proteinase 1 precursor, putative      124   3e-29   
ref|XP_002960360.1|  hypothetical protein SELMODRAFT_402550             124   3e-29   
ref|XP_002306266.2|  hypothetical protein POPTR_0005s06820g             124   3e-29   
ref|XP_004146562.1|  PREDICTED: subtilisin-like protease-like           124   5e-29   
gb|KGN55997.1|  hypothetical protein Csa_3G045110                       122   7e-29   
emb|CDY49640.1|  BnaCnng17920D                                          123   7e-29   
ref|XP_010067650.1|  PREDICTED: subtilisin-like protease                123   8e-29   
gb|KCW88587.1|  hypothetical protein EUGRSUZ_A00964                     120   9e-29   
emb|CBI34614.3|  unnamed protein product                                124   1e-28   
ref|XP_006377331.1|  hypothetical protein POPTR_0011s04970g             122   1e-28   
ref|XP_008344750.1|  PREDICTED: subtilisin-like protease                121   2e-28   
ref|XP_009339280.1|  PREDICTED: subtilisin-like protease SBT5.4         122   2e-28   
ref|XP_010691741.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    120   2e-28   
gb|KDP35557.1|  hypothetical protein JCGZ_08995                         122   2e-28   
ref|XP_008449186.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    123   2e-28   
dbj|BAJ34472.1|  unnamed protein product                                119   2e-28   
ref|XP_008353281.1|  PREDICTED: subtilisin-like protease                122   2e-28   
ref|XP_003608826.1|  Subtilisin-like protease                           122   2e-28   
emb|CDP06171.1|  unnamed protein product                                121   3e-28   
ref|NP_001267495.1|  SUB1 homolog precursor                             121   3e-28   
ref|XP_006377332.1|  hypothetical protein POPTR_0011s04980g             121   3e-28   
ref|XP_006287131.1|  hypothetical protein CARUB_v10000302mg             121   4e-28   
emb|CDY65695.1|  BnaA02g06820D                                          119   4e-28   
ref|XP_010100157.1|  Subtilisin-like protease SDD1                      121   4e-28   
ref|XP_008384613.1|  PREDICTED: subtilisin-like protease                121   4e-28   
ref|XP_010056036.1|  PREDICTED: subtilisin-like protease SBT5.3         121   4e-28   
gb|KCW72614.1|  hypothetical protein EUGRSUZ_E01074                     120   5e-28   
ref|XP_004502100.1|  PREDICTED: subtilisin-like protease-like           120   6e-28   
ref|XP_010439493.1|  PREDICTED: subtilisin-like protease SBT3.5         120   6e-28   
ref|XP_010456502.1|  PREDICTED: subtilisin-like protease SBT3.3         120   7e-28   
ref|XP_006286616.1|  hypothetical protein CARUB_v10002407mg             120   7e-28   
ref|XP_008794749.1|  PREDICTED: subtilisin-like protease SBT5.3         120   7e-28   
ref|XP_003524185.1|  PREDICTED: subtilisin-like protease-like           120   9e-28   
gb|KFK31799.1|  hypothetical protein AALP_AA6G160400                    120   1e-27   
ref|XP_004515894.1|  PREDICTED: subtilisin-like protease-like           120   1e-27   
ref|XP_008218932.1|  PREDICTED: subtilisin-like protease                120   1e-27   
emb|CDY65693.1|  BnaA02g06800D                                          119   1e-27   
ref|XP_010067699.1|  PREDICTED: subtilisin-like protease SBT5.3         120   1e-27   
emb|CDY15084.1|  BnaC03g44450D                                          119   1e-27   
ref|XP_009136129.1|  PREDICTED: subtilisin-like protease SBT5.3         119   2e-27   
emb|CDY65487.1|  BnaA03g57660D                                          119   2e-27   
ref|XP_010092450.1|  Subtilisin-like protease                           115   2e-27   
ref|XP_010676145.1|  PREDICTED: subtilisin-like protease SBT5.4         115   2e-27   
gb|KCW88582.1|  hypothetical protein EUGRSUZ_A00959                     119   2e-27   
ref|XP_010045213.1|  PREDICTED: subtilisin-like protease SBT5.3         119   2e-27   
ref|XP_009394691.1|  PREDICTED: subtilisin-like protease SBT5.3         119   2e-27   
gb|AFV08661.1|  subtilisin-like protease                                119   3e-27   
emb|CAN62337.1|  hypothetical protein VITISV_004299                     117   3e-27   
ref|XP_006418604.1|  hypothetical protein EUTSA_v10002408mg             119   3e-27   
ref|XP_010657502.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    117   4e-27   
gb|KEH31721.1|  subtilisin-like serine protease                         117   4e-27   
ref|XP_011013808.1|  PREDICTED: subtilisin-like protease SBT5.3         118   5e-27   
ref|XP_010434193.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    118   5e-27   
gb|KCW89054.1|  hypothetical protein EUGRSUZ_A01380                     118   5e-27   
ref|XP_010087081.1|  Subtilisin-like protease SDD1                      116   5e-27   
ref|XP_011013366.1|  PREDICTED: subtilisin-like protease SBT5.3         118   5e-27   
ref|XP_010048355.1|  PREDICTED: subtilisin-like protease SBT5.3         118   5e-27   
ref|XP_002266728.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    118   6e-27   
ref|XP_010434192.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    118   6e-27   
ref|XP_010256205.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    118   6e-27   
ref|XP_006439186.1|  hypothetical protein CICLE_v10018942mg             117   6e-27   
ref|XP_009126659.1|  PREDICTED: subtilisin-like protease SBT5.4 i...    117   7e-27   
ref|XP_007207992.1|  hypothetical protein PRUPE_ppa015005mg             117   8e-27   
gb|AAK74005.1|  At2g04160/T16B23.1                                      115   8e-27   
ref|XP_002971639.1|  hypothetical protein SELMODRAFT_412127             117   8e-27   
ref|XP_002965691.1|  hypothetical protein SELMODRAFT_407291             117   9e-27   
gb|AES70685.2|  subtilisin-like serine protease                         117   9e-27   
ref|XP_009126658.1|  PREDICTED: subtilisin-like protease SBT5.4 i...    117   9e-27   
ref|XP_003600434.1|  Subtilisin-like protease                           117   1e-26   
ref|XP_002873539.1|  hypothetical protein ARALYDRAFT_909167             115   1e-26   
ref|XP_010542042.1|  PREDICTED: subtilisin-like protease SBT5.3         117   1e-26   
ref|XP_010539197.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    117   1e-26   
gb|KJB18900.1|  hypothetical protein B456_003G074100                    117   1e-26   
ref|XP_006476262.1|  PREDICTED: subtilisin-like protease SDD1-like      117   1e-26   
ref|XP_011082896.1|  PREDICTED: subtilisin-like protease SBT5.3         116   2e-26   
ref|XP_002525023.1|  Xylem serine proteinase 1 precursor, putative      116   2e-26   
gb|ACP18876.1|  subtilisin-like serine protease                         116   2e-26   
ref|XP_010942942.1|  PREDICTED: subtilisin-like protease SBT5.4         116   2e-26   
ref|XP_011013813.1|  PREDICTED: subtilisin-like protease SBT5.3         116   2e-26   
ref|XP_009394968.1|  PREDICTED: subtilisin-like protease SBT5.3         116   2e-26   
gb|ACN25158.1|  unknown                                                 111   2e-26   
gb|KHN40543.1|  Subtilisin-like protease                                115   3e-26   
emb|CBI38458.3|  unnamed protein product                                115   3e-26   
gb|KJB79073.1|  hypothetical protein B456_013G033000                    115   3e-26   
gb|KJB42692.1|  hypothetical protein B456_007G164000                    115   3e-26   
ref|XP_010647022.1|  PREDICTED: subtilisin-like protease SBT5.3         115   3e-26   
gb|KJB79074.1|  hypothetical protein B456_013G033000                    115   3e-26   
gb|KJB79072.1|  hypothetical protein B456_013G033000                    115   3e-26   
gb|KJB79075.1|  hypothetical protein B456_013G033000                    115   3e-26   
sp|I1N462.3|SBT1_SOYBN  RecName: Full=Subtilisin-like protease Gl...    115   3e-26   
gb|KJB79071.1|  hypothetical protein B456_013G033000                    115   4e-26   
ref|XP_010048342.1|  PREDICTED: subtilisin-like protease SBT5.3         115   4e-26   
gb|KJB79077.1|  hypothetical protein B456_013G033000                    115   4e-26   
ref|XP_006475104.1|  PREDICTED: subtilisin-like protease-like           115   4e-26   
gb|AAM15440.1|  subtilisin-like serine protease AIR3                    114   4e-26   
ref|XP_010096499.1|  Subtilisin-like protease                           115   4e-26   
ref|XP_002299063.2|  hypothetical protein POPTR_0001s47290g             115   5e-26   
ref|XP_009794911.1|  PREDICTED: subtilisin-like protease SBT5.3         112   6e-26   
ref|XP_006452710.1|  hypothetical protein CICLE_v10010380mg             115   6e-26   
ref|XP_011461611.1|  PREDICTED: subtilisin-like protease SBT5.4         115   6e-26   
gb|EYU34388.1|  hypothetical protein MIMGU_mgv1a001745mg                115   7e-26   
ref|XP_008794759.1|  PREDICTED: subtilisin-like protease SBT5.3         115   7e-26   
ref|XP_011039898.1|  PREDICTED: subtilisin-like protease SBT5.4         114   8e-26   
ref|XP_010647672.1|  PREDICTED: subtilisin-like protease SBT3.5         114   8e-26   
gb|ACN36540.1|  unknown                                                 111   9e-26   
gb|KDP29034.1|  hypothetical protein JCGZ_16423                         114   9e-26   
emb|CBI38006.3|  unnamed protein product                                114   1e-25   
ref|NP_565309.2|  subtilisin-like serine endopeptidase family pro...    114   1e-25   
gb|KHN40545.1|  Subtilisin-like protease                                114   1e-25   
ref|XP_009591665.1|  PREDICTED: subtilisin-like protease SBT5.3         115   1e-25   
ref|XP_009391852.1|  PREDICTED: subtilisin-like protease SBT5.3         114   1e-25   
tpg|DAA54194.1|  TPA: putative subtilase family protein                 111   1e-25   
ref|XP_008245809.1|  PREDICTED: subtilisin-like protease SDD1           114   1e-25   
ref|XP_008218944.1|  PREDICTED: subtilisin-like protease                114   1e-25   
emb|CDX94252.1|  BnaC02g29120D                                          113   2e-25   
gb|KHG28029.1|  Subtilisin-like protease SDD1                           114   2e-25   
emb|CDP06146.1|  unnamed protein product                                114   2e-25   
ref|XP_009348700.1|  PREDICTED: subtilisin-like protease SBT5.3         114   2e-25   
ref|XP_011022895.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    114   2e-25   
ref|XP_011022894.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    114   2e-25   
ref|XP_010514315.1|  PREDICTED: subtilisin-like protease SBT5.3         113   2e-25   
ref|XP_004294696.1|  PREDICTED: subtilisin-like protease SBT5.3         113   2e-25   
ref|XP_004172461.1|  PREDICTED: subtilisin-like protease-like           107   2e-25   
ref|XP_006297035.1|  hypothetical protein CARUB_v10013025mg             113   2e-25   
ref|XP_002885743.1|  hypothetical protein ARALYDRAFT_899224             113   2e-25   
gb|KJB63096.1|  hypothetical protein B456_009G453100                    113   2e-25   
ref|XP_006602868.1|  PREDICTED: subtilisin-like protease-like           113   2e-25   
ref|XP_011012624.1|  PREDICTED: subtilisin-like protease SBT5.3         113   3e-25   
ref|XP_004504376.1|  PREDICTED: subtilisin-like protease SDD1-lik...    113   3e-25   
gb|AIC80773.1|  subtilase                                               112   3e-25   
ref|XP_002320540.2|  subtilisin-like protease family protein            113   3e-25   
ref|XP_006380388.1|  hypothetical protein POPTR_0007s04520g             113   4e-25   
ref|XP_010942943.1|  PREDICTED: subtilisin-like protease SBT5.4         112   4e-25   
ref|XP_008392654.1|  PREDICTED: subtilisin-like protease SDD1           112   4e-25   
ref|NP_001052081.1|  Os04g0127200                                       112   4e-25   
ref|XP_002524587.1|  Xylem serine proteinase 1 precursor, putative      112   4e-25   
ref|NP_174574.2|  Subtilisin-like serine endopeptidase family pro...    107   4e-25   
ref|XP_010443761.1|  PREDICTED: subtilisin-like protease SBT5.4         112   4e-25   
gb|KHN40542.1|  Xylem serine proteinase 1                               108   4e-25   
ref|XP_004515813.1|  PREDICTED: subtilisin-like protease-like           112   5e-25   
emb|CAE76061.1|  B1248C03.20                                            112   5e-25   
ref|XP_006602865.1|  PREDICTED: subtilisin-like protease-like           112   5e-25   
gb|KHN40540.1|  Subtilisin-like protease                                112   6e-25   
ref|XP_010644656.1|  PREDICTED: subtilisin-like protease SBT5.4         112   6e-25   
ref|XP_008462020.1|  PREDICTED: subtilisin-like protease isoform X2     111   7e-25   
emb|CBI39824.3|  unnamed protein product                                112   7e-25   
ref|XP_008462019.1|  PREDICTED: subtilisin-like protease isoform X1     112   7e-25   
gb|EMT21267.1|  Subtilisin-like protease                                111   8e-25   
ref|XP_002530614.1|  Cucumisin precursor, putative                      112   8e-25   
ref|XP_010488664.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    112   8e-25   
ref|XP_007206786.1|  hypothetical protein PRUPE_ppa025514mg             111   9e-25   
emb|CBI31596.3|  unnamed protein product                                111   9e-25   
ref|XP_010257694.1|  PREDICTED: subtilisin-like protease SBT3.5         111   1e-24   
ref|XP_009408716.1|  PREDICTED: subtilisin-like protease SBT5.3         111   1e-24   
gb|EYU19955.1|  hypothetical protein MIMGU_mgv1a023738mg                111   1e-24   
ref|XP_009361505.1|  PREDICTED: subtilisin-like protease SBT5.3         111   1e-24   
ref|XP_006586369.1|  PREDICTED: subtilisin-like protease-like           104   1e-24   
ref|XP_007209077.1|  hypothetical protein PRUPE_ppa001674mg             111   1e-24   
ref|XP_010251263.1|  PREDICTED: subtilisin-like protease SBT5.4         111   1e-24   
gb|EEE60418.1|  hypothetical protein OsJ_13612                          110   1e-24   
gb|KCW75459.1|  hypothetical protein EUGRSUZ_E04225                     110   2e-24   
ref|XP_010107369.1|  Subtilisin-like protease                           110   2e-24   
ref|XP_010525170.1|  PREDICTED: cucumisin                               105   2e-24   
ref|XP_010252985.1|  PREDICTED: subtilisin-like protease SBT5.4         110   2e-24   
ref|XP_008357992.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    110   2e-24   
ref|XP_010059708.1|  PREDICTED: subtilisin-like protease SBT5.4         110   2e-24   
ref|XP_010488663.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    110   2e-24   
ref|XP_011462195.1|  PREDICTED: subtilisin-like protease SBT5.4         110   2e-24   
ref|XP_003567246.1|  PREDICTED: CO(2)-response secreted protease-...    110   2e-24   
ref|NP_001052069.1|  Os04g0120100                                       105   2e-24   
ref|XP_002966095.1|  hypothetical protein SELMODRAFT_439471             110   2e-24   
ref|XP_008342263.1|  PREDICTED: subtilisin-like protease                110   3e-24   



>ref|XP_007039329.1| Subtilase family protein [Theobroma cacao]
 gb|EOY23830.1| Subtilase family protein [Theobroma cacao]
Length=512

 Score =   174 bits (441),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 105/144 (73%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRP  388
            KPGLVYDM T DYV+ LCA+GY++ AIS + GQ  +C     S+LDVN PSITIP+L+  
Sbjct  360  KPGLVYDMDTDDYVHYLCAVGYNNSAISKLVGQGIACPSAKPSVLDVNVPSITIPNLRNS  419

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
             TLTR VTNVGP NSTYK +VEPP GI V V P+ L F    ++IS+ V +ST H  NTG
Sbjct  420  ATLTRRVTNVGPPNSTYKALVEPPFGITVTVTPNILVFHSTAQEISYQVRVSTSHQVNTG  479

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            +YFGSL W DGVHNV IPIS +T+
Sbjct  480  YYFGSLTWTDGVHNVAIPISARTQ  503



>ref|XP_010529680.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Tarenaya 
hassleriana]
Length=707

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 108/144 (75%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
             PGLVYDM T+DY++ +C++GY   +IS++ G+ T C H   S+LD+N PSITIPDL   
Sbjct  555  DPGLVYDMGTSDYIHYMCSVGYKDPSISLVVGKATICPHPNPSVLDLNLPSITIPDLSGE  614

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +T+TRTVTNVGP NS YKV+++PP G+ + V P TL F+P  +++SF V +ST H  NTG
Sbjct  615  VTITRTVTNVGPRNSVYKVVIDPPSGVHMDVNPKTLVFNPKTERVSFTVRVSTSHKVNTG  674

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            FYFGSL W D VHNV IP+SV+T+
Sbjct  675  FYFGSLTWTDSVHNVAIPVSVRTQ  698



>ref|XP_010529681.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X3 [Tarenaya 
hassleriana]
Length=704

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 108/144 (75%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
             PGLVYDM T+DY++ +C++GY   +IS++ G+ T C H   S+LD+N PSITIPDL   
Sbjct  552  DPGLVYDMGTSDYIHYMCSVGYKDPSISLVVGKATICPHPNPSVLDLNLPSITIPDLSGE  611

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +T+TRTVTNVGP NS YKV+++PP G+ + V P TL F+P  +++SF V +ST H  NTG
Sbjct  612  VTITRTVTNVGPRNSVYKVVIDPPSGVHMDVNPKTLVFNPKTERVSFTVRVSTSHKVNTG  671

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            FYFGSL W D VHNV IP+SV+T+
Sbjct  672  FYFGSLTWTDSVHNVAIPVSVRTQ  695



>ref|XP_010529679.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Tarenaya 
hassleriana]
Length=717

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 108/144 (75%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
             PGLVYDM T+DY++ +C++GY   +IS++ G+ T C H   S+LD+N PSITIPDL   
Sbjct  565  DPGLVYDMGTSDYIHYMCSVGYKDPSISLVVGKATICPHPNPSVLDLNLPSITIPDLSGE  624

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +T+TRTVTNVGP NS YKV+++PP G+ + V P TL F+P  +++SF V +ST H  NTG
Sbjct  625  VTITRTVTNVGPRNSVYKVVIDPPSGVHMDVNPKTLVFNPKTERVSFTVRVSTSHKVNTG  684

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            FYFGSL W D VHNV IP+SV+T+
Sbjct  685  FYFGSLTWTDSVHNVAIPVSVRTQ  708



>ref|XP_009350314.1| PREDICTED: subtilisin-like protease SBT5.3 [Pyrus x bretschneideri]
Length=718

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 107/147 (73%), Gaps = 1/147 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHK-GFSILDVNFPSITIPDLKRPI  385
            PGL+YDM T DY+N LCA GY++ AIS++  Q TSC     SILDVN PSITIP+L+ P+
Sbjct  567  PGLIYDMGTNDYINYLCAFGYNTSAISLLVKQATSCPVIKPSILDVNLPSITIPNLRNPV  626

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            TLTRTVTNVGP  STYK  +EPP GI VVVKP  L F+  VK +SF V +ST +  NT +
Sbjct  627  TLTRTVTNVGPVISTYKTQIEPPLGINVVVKPEALVFNSTVKALSFTVAVSTTYQVNTAY  686

Query  204  YFGSLIWNDGVHNVRIPISVKTKY*ES  124
            +FGSL W DGVH V  PISV+T+  +S
Sbjct  687  FFGSLTWTDGVHAVSSPISVRTQIIQS  713



>ref|XP_006306822.1| hypothetical protein CARUB_v10008364mg [Capsella rubella]
 gb|EOA39720.1| hypothetical protein CARUB_v10008364mg [Capsella rubella]
Length=770

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 108/144 (75%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            +PGL+YDM + DY+  LC+ GY+  +IS + G+ T C +   S+LDVN PSITIP+LK  
Sbjct  618  EPGLIYDMGSEDYILYLCSAGYNDSSISQLVGKVTVCSNPKPSVLDVNLPSITIPNLKDE  677

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            + LTRTVTNVGP +S YKV+VEPP G+IVVVKP TL F+   K++SF V +ST H  NTG
Sbjct  678  VNLTRTVTNVGPVDSIYKVVVEPPLGVIVVVKPETLVFNSKFKRVSFTVRVSTTHKTNTG  737

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            FYFGSL W D VHNV IP+SV+T+
Sbjct  738  FYFGSLTWTDSVHNVIIPVSVRTQ  761



>ref|XP_007210725.1| hypothetical protein PRUPE_ppa022363mg [Prunus persica]
 gb|EMJ11924.1| hypothetical protein PRUPE_ppa022363mg [Prunus persica]
Length=783

 Score =   171 bits (434),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 105/143 (73%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHK-GFSILDVNFPSITIPDLKRPI  385
            PGL+YDM T DY+  LCA+GY++ AIS + GQTT+C     S+LDVN PSITIP+L+  I
Sbjct  632  PGLIYDMGTEDYIKYLCAVGYNTSAISQLVGQTTACSMVKPSVLDVNLPSITIPNLRENI  691

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            TLTR+VTNVGP NS YK  ++PP GI V V+P TL F+  +K ISF V +ST H  NTG+
Sbjct  692  TLTRSVTNVGPVNSVYKANIDPPPGISVAVRPETLVFNSTIKTISFTVAVSTTHQVNTGY  751

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
            YFGSL W DG H V  PISV+T+
Sbjct  752  YFGSLTWTDGEHLVTSPISVRTQ  774



>ref|XP_010436465.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=629

 Score =   171 bits (432),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 105/143 (73%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYDM+  DY++  CA GY+  AI+I+ G+ T C     SILD N+P+ITIPDL+  +
Sbjct  483  PGLVYDMNVDDYIHFFCASGYNETAITILVGKPTRCSSPLPSILDFNYPAITIPDLEEEV  542

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            TLTRTVTNVGP +S Y+ +VEPP+G+ +VV+P TL FS N KK+ F V +S+ H  NTG+
Sbjct  543  TLTRTVTNVGPVDSVYRAVVEPPQGVKIVVEPETLVFSSNTKKLGFKVRVSSSHKSNTGY  602

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
            +FGS  W DG  NV IP+SV+T+
Sbjct  603  FFGSFTWTDGTRNVTIPLSVRTR  625



>ref|XP_011081356.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Sesamum 
indicum]
Length=782

 Score =   171 bits (433),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 103/141 (73%), Gaps = 0/141 (0%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGFSILDVNFPSITIPDLKRPIT  382
            PGLVYDM  +DY+N LC+M Y++ AIS + G+  +C K  S+LDVN PSITIP L    T
Sbjct  632  PGLVYDMDESDYINYLCSMEYNNSAISRLTGKPVTCPKTVSLLDVNLPSITIPYLGNSTT  691

Query  381  LTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFY  202
            LTRTVTNVG  NS Y V+VEPP G IV+V P  L F+   KKISF VT+S+ H  + G+Y
Sbjct  692  LTRTVTNVGATNSIYHVIVEPPTGTIVLVNPPILIFNSMTKKISFTVTVSSMHQLSAGYY  751

Query  201  FGSLIWNDGVHNVRIPISVKT  139
            FGSLIW DGVH+VR PISV+T
Sbjct  752  FGSLIWTDGVHDVRSPISVRT  772



>ref|XP_011081355.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Sesamum 
indicum]
Length=805

 Score =   171 bits (433),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 103/141 (73%), Gaps = 0/141 (0%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGFSILDVNFPSITIPDLKRPIT  382
            PGLVYDM  +DY+N LC+M Y++ AIS + G+  +C K  S+LDVN PSITIP L    T
Sbjct  655  PGLVYDMDESDYINYLCSMEYNNSAISRLTGKPVTCPKTVSLLDVNLPSITIPYLGNSTT  714

Query  381  LTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFY  202
            LTRTVTNVG  NS Y V+VEPP G IV+V P  L F+   KKISF VT+S+ H  + G+Y
Sbjct  715  LTRTVTNVGATNSIYHVIVEPPTGTIVLVNPPILIFNSMTKKISFTVTVSSMHQLSAGYY  774

Query  201  FGSLIWNDGVHNVRIPISVKT  139
            FGSLIW DGVH+VR PISV+T
Sbjct  775  FGSLIWTDGVHDVRSPISVRT  795



>ref|XP_009344070.1| PREDICTED: subtilisin-like protease SBT5.3 [Pyrus x bretschneideri]
Length=699

 Score =   170 bits (430),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 104/144 (72%), Gaps = 1/144 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRPI  385
            PGLVYDM   DY+  LCA GY++ AIS + G+ T+C  K  SILDVN PS+TIP L+ PI
Sbjct  547  PGLVYDMGAADYMEYLCARGYNNSAISRLTGKNTTCPVKKPSILDVNLPSVTIPSLRNPI  606

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+ RTVTNVG   S YK  +EPP G IV V P+ L F+  V+K++F +TIS  H  NTG+
Sbjct  607  TVKRTVTNVGAPESIYKATIEPPFGTIVYVNPTALVFNSTVEKLTFTITISAIHEMNTGY  666

Query  204  YFGSLIWNDGVHNVRIPISVKTKY  133
            YFGSL W DGVH VRIP+SVKT++
Sbjct  667  YFGSLTWVDGVHAVRIPLSVKTEF  690



>ref|XP_008392653.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=499

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 104/145 (72%), Gaps = 1/145 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRP  388
            +PGLVYDM   DY+  LCA  Y++ AIS + G+ T+C  K  SILDVN PS+TIP L+ P
Sbjct  344  EPGLVYDMGAADYMEYLCARAYNNSAISRLTGKKTTCPVKKPSILDVNLPSVTIPSLRNP  403

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +T+ RTVTNVG   S YK  +EPP G IV V P+ L F+  V+K++F +TIS  H  NTG
Sbjct  404  VTVKRTVTNVGAPESIYKATIEPPFGTIVYVNPTALVFNSTVEKLTFTITISAIHEMNTG  463

Query  207  FYFGSLIWNDGVHNVRIPISVKTKY  133
            +YFGSL W DGVH VRIP+SV+T++
Sbjct  464  YYFGSLTWVDGVHAVRIPLSVRTEF  488



>ref|XP_009348696.1| PREDICTED: subtilisin-like protease SBT5.4 [Pyrus x bretschneideri]
Length=759

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 106/143 (74%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRPI  385
            PGL+YDM+T DY+N LCA GY +  ++ +    TSC  +  SILDVN PSITIP+++ PI
Sbjct  608  PGLIYDMATNDYINYLCAFGYDTLTVTQLVEHATSCPVQKPSILDVNLPSITIPNIRNPI  667

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            TLTRTVTN+GP +STYK  +EPP GI VVV+P TL F+  VKKISF V +ST +  NT +
Sbjct  668  TLTRTVTNIGPVSSTYKAQIEPPPGINVVVRPETLVFNSTVKKISFTVEVSTTYRVNTAY  727

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
            +FGSL W DGVH V  P+SV+T+
Sbjct  728  FFGSLTWTDGVHAVTSPMSVRTQ  750



>emb|CDX94251.1| BnaC02g29110D [Brassica napus]
Length=761

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 104/144 (72%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRP  388
            KPGLVYD+   DYV  +CA+GY+  +IS + G+ T+C     S+LD+N PSITIPDLK  
Sbjct  609  KPGLVYDLGLQDYVLYMCAVGYNDSSISQLVGERTTCSNPRPSVLDLNLPSITIPDLKEE  668

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +TLTRTVTNVGP NS YKV VEPP GI V V P  L F+   K +S+ V +ST H  NTG
Sbjct  669  VTLTRTVTNVGPLNSVYKVKVEPPLGIQVTVVPKKLVFNSKTKTLSYQVRVSTRHKINTG  728

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            FYFGSL W+D VHNV IP+SV+T+
Sbjct  729  FYFGSLTWSDSVHNVIIPLSVRTQ  752



>gb|EYU19440.1| hypothetical protein MIMGU_mgv1a001654mg [Erythranthe guttata]
Length=778

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 105/142 (74%), Gaps = 1/142 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPI  385
            PGL+YDM TTDY+N LCAM Y+S AIS + GQ   C +K F ILDVN PSITIP L+   
Sbjct  630  PGLIYDMDTTDYINYLCAMEYNSSAISRLTGQPIMCPNKTFPILDVNLPSITIPYLRNST  689

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
             L+RTVTNVGP NS Y+V+VEPP G +V V P  L F+ ++KKI++ VT+ + H    G+
Sbjct  690  VLSRTVTNVGPTNSIYRVVVEPPTGTLVFVTPPILIFNSHIKKITYQVTVISVHPLIGGY  749

Query  204  YFGSLIWNDGVHNVRIPISVKT  139
            YFGSLIW DGVH+VR PI+V++
Sbjct  750  YFGSLIWTDGVHDVRSPIAVRS  771



>ref|XP_010421966.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=762

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 108/147 (73%), Gaps = 1/147 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            +PGL+YD++T DYV  LC+  Y+  +IS + G+ T C +   S+LD+N PSITIP+LK  
Sbjct  610  RPGLIYDINTNDYVLYLCSTDYNDTSISQVVGKKTECPNPKPSVLDLNLPSITIPNLKDK  669

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +TLTRTVTNVGP NS YKV++ PP G+ + VKP+ L F+P  KK+SF VT+ST H  NTG
Sbjct  670  VTLTRTVTNVGPPNSIYKVLINPPSGVRMTVKPNMLRFNPRTKKVSFTVTVSTTHKVNTG  729

Query  207  FYFGSLIWNDGVHNVRIPISVKTKY*E  127
            +YFGSL W D VH V IP+SV+T+  E
Sbjct  730  YYFGSLTWTDNVHRVVIPVSVRTQILE  756



>emb|CDX93808.1| BnaA09g24080D [Brassica napus]
Length=748

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 105/144 (73%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            +PGL+YDM   DY+  LC+ GY+  +IS + G+ T C +   S+LD+N PSITIP+LK  
Sbjct  596  EPGLIYDMGPKDYILYLCSAGYNDSSISQLVGKVTVCSNPKPSVLDMNLPSITIPNLKEK  655

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +TLTRTVTNVGP NS YKV+VEPP G+ VVV P  L F+   K++SF V  ST H  NTG
Sbjct  656  VTLTRTVTNVGPVNSVYKVVVEPPLGVRVVVTPKKLVFNSKTKRVSFKVRASTTHKINTG  715

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            +YFGSLIW D VHNV IP+SV+T+
Sbjct  716  YYFGSLIWTDNVHNVTIPVSVRTQ  739



>ref|XP_009114847.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=774

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 103/143 (72%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPI  385
            PGL+YDM   DY+  LC+ GY+  +IS + GQ T C +   S+LDVN PS+TIP+LK  +
Sbjct  623  PGLIYDMGPKDYILYLCSAGYNDSSISQLVGQVTVCSNPKPSVLDVNLPSLTIPNLKEEV  682

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
             LTRTVTNVGP NS YKV+VEPP G+ VVV P  L F+   K +SF V +ST H  NTGF
Sbjct  683  NLTRTVTNVGPVNSVYKVVVEPPLGVRVVVTPKKLVFNSKTKSLSFMVRVSTIHKINTGF  742

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
            YFGSLIW D VHNV IP+SV+T+
Sbjct  743  YFGSLIWRDSVHNVTIPVSVRTQ  765



>ref|XP_010445236.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=856

 Score =   169 bits (428),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 104/143 (73%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYDM+  DY++  CA GY+  AI+I+ G+ T C     SILD N+P+ITIPDL+  +
Sbjct  710  PGLVYDMNVDDYIHFFCASGYNETAITILVGKPTRCSSPLPSILDFNYPAITIPDLEEEV  769

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+TRTVTNVGP +S Y+ +VEPP+G+ +VV+P TL F  N KK+ F V +S+ H  NTG+
Sbjct  770  TITRTVTNVGPVDSVYRAVVEPPQGVKIVVEPETLVFEQNTKKLGFKVRVSSSHKSNTGY  829

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
            +FGS  W DG  NV IP+SV+T+
Sbjct  830  FFGSFTWTDGTRNVTIPLSVRTR  852



>gb|KFK45042.1| hypothetical protein AALP_AA1G336600 [Arabis alpina]
Length=741

 Score =   168 bits (425),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 105/144 (73%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            +PGL+YDM + DY+  LC+ GY+  +IS + G+ T C +   S+LDVN PSITIP+LK  
Sbjct  589  EPGLIYDMGSEDYIIYLCSAGYNDSSISQLVGRVTVCSNPKPSVLDVNLPSITIPNLKDE  648

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            + LTRTVTNVGP +S YKV+VEPP G+ V V P  L F+   K++SF V +ST H  NTG
Sbjct  649  VNLTRTVTNVGPVDSVYKVVVEPPLGVRVAVTPEMLMFNSTTKRVSFTVRVSTTHKINTG  708

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            FYFGSLIW D VHNV IP+S++T+
Sbjct  709  FYFGSLIWTDSVHNVTIPVSIRTQ  732



>ref|XP_009114844.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=774

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 105/144 (73%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            +PGL+YDM   DY+  LC+ GY+  +IS + G+ T C +   S+LD+N PSITIP+LK  
Sbjct  622  EPGLIYDMGPKDYILYLCSAGYNDSSISQLVGKVTVCSNPKPSVLDMNLPSITIPNLKEK  681

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +TLTRTVTNVGP NS YKV+VEPP G+ VVV P  L F+   K++SF V  ST H  NTG
Sbjct  682  VTLTRTVTNVGPVNSVYKVVVEPPLGVRVVVTPKKLVFNSKTKRVSFKVRASTTHKINTG  741

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            +YFGSLIW D VHNV IP+SV+T+
Sbjct  742  YYFGSLIWTDNVHNVTIPVSVRTQ  765



>ref|XP_002298974.2| hypothetical protein POPTR_0001s45470g [Populus trichocarpa]
 gb|EEE83779.2| hypothetical protein POPTR_0001s45470g [Populus trichocarpa]
Length=749

 Score =   167 bits (424),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 104/143 (73%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPI  385
            PGLVYDM T DY+N LCAM Y+  AIS + G  T C ++  SILDVN PSITIP+L+   
Sbjct  598  PGLVYDMGTADYINYLCAMDYNITAISRLTGLPTVCPYEELSILDVNLPSITIPNLRNST  657

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            TLTRTVTNVG  NS Y+ ++EPP G  V VKP+ L F+   KKI+F VT++T H  NTG+
Sbjct  658  TLTRTVTNVGTSNSIYRAVIEPPFGTSVSVKPNVLAFNHKTKKITFTVTVTTAHQVNTGY  717

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
            +FGS+ W DGVH VR P+SV+T+
Sbjct  718  FFGSITWTDGVHTVRSPLSVRTE  740



>gb|AAF31277.1|AC006424_6 Second of four adjacent putative subtilase family> [Arabidopsis 
thaliana]
Length=763

 Score =   167 bits (424),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 105/144 (73%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            +PGL+ DM + DYV  LC+ GY+  +IS + G+ T C +   S+LD+N PSITIP+LK  
Sbjct  611  EPGLILDMDSQDYVLYLCSAGYNDSSISRLVGKVTVCSNPKPSVLDINLPSITIPNLKDE  670

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +TLTRTVTNVGP +S YKV+VEPP GI VVV P TL F+   K +SF V +ST H  NTG
Sbjct  671  VTLTRTVTNVGPVDSVYKVLVEPPLGIQVVVTPETLVFNSKTKSVSFTVIVSTTHKINTG  730

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            FYFGSL W D +HNV IP+SV+T+
Sbjct  731  FYFGSLTWTDSIHNVVIPVSVRTQ  754



>ref|XP_006415136.1| hypothetical protein EUTSA_v10006855mg [Eutrema salsugineum]
 gb|ESQ33489.1| hypothetical protein EUTSA_v10006855mg [Eutrema salsugineum]
Length=782

 Score =   168 bits (425),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 104/143 (73%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPI  385
            PG +YDM T DY+  LC+ GY+  +IS + G+ T C +   S+ DVN PSITIP+LK  +
Sbjct  631  PGFIYDMGTKDYILYLCSAGYNDSSISQLVGKVTVCSNPKPSVFDVNLPSITIPNLKDEV  690

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            TLTRTVTNVGP +S YKV+VEPP G+ VVV P TL F+   K +SF V +ST H  NTGF
Sbjct  691  TLTRTVTNVGPVDSVYKVVVEPPFGVRVVVTPETLRFNSKTKSVSFKVRVSTTHKINTGF  750

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
            +FGSLIW D +HNV IP+SV+T+
Sbjct  751  FFGSLIWTDSLHNVTIPVSVRTQ  773



>ref|XP_009128706.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X3 [Brassica 
rapa]
Length=643

 Score =   167 bits (422),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 107/144 (74%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRP  388
            KPGLVYD+   DYV  +C++GY+  +IS + G+ T+C     S+LD+N PSITIPDLK  
Sbjct  491  KPGLVYDLDLEDYVLYMCSVGYNDSSISQLVGERTTCSNPRPSVLDLNLPSITIPDLKEE  550

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +TLTRTVTNVGP +S YKV VEPP G+ V V P+ L F+   KK+S++V +ST H  NTG
Sbjct  551  VTLTRTVTNVGPPSSVYKVKVEPPLGVQVTVMPNKLVFNSKTKKLSYHVRVSTRHKINTG  610

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            FYFGSL W+D VH+V IP+SV+T+
Sbjct  611  FYFGSLTWSDSVHDVIIPLSVRTQ  634



>ref|NP_564413.2| subtilase family protein [Arabidopsis thaliana]
 gb|AEE31543.1| subtilase family protein [Arabidopsis thaliana]
Length=773

 Score =   167 bits (424),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 105/144 (73%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            +PGL+ DM + DYV  LC+ GY+  +IS + G+ T C +   S+LD+N PSITIP+LK  
Sbjct  621  EPGLILDMDSQDYVLYLCSAGYNDSSISRLVGKVTVCSNPKPSVLDINLPSITIPNLKDE  680

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +TLTRTVTNVGP +S YKV+VEPP GI VVV P TL F+   K +SF V +ST H  NTG
Sbjct  681  VTLTRTVTNVGPVDSVYKVLVEPPLGIQVVVTPETLVFNSKTKSVSFTVIVSTTHKINTG  740

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            FYFGSL W D +HNV IP+SV+T+
Sbjct  741  FYFGSLTWTDSIHNVVIPVSVRTQ  764



>ref|XP_009128705.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Brassica 
rapa]
 ref|XP_009128707.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Brassica 
rapa]
 ref|XP_009128709.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Brassica 
rapa]
Length=723

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 107/144 (74%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRP  388
            KPGLVYD+   DYV  +C++GY+  +IS + G+ T+C     S+LD+N PSITIPDLK  
Sbjct  571  KPGLVYDLDLEDYVLYMCSVGYNDSSISQLVGERTTCSNPRPSVLDLNLPSITIPDLKEE  630

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +TLTRTVTNVGP +S YKV VEPP G+ V V P+ L F+   KK+S++V +ST H  NTG
Sbjct  631  VTLTRTVTNVGPPSSVYKVKVEPPLGVQVTVMPNKLVFNSKTKKLSYHVRVSTRHKINTG  690

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            FYFGSL W+D VH+V IP+SV+T+
Sbjct  691  FYFGSLTWSDSVHDVIIPLSVRTQ  714



>ref|XP_009128704.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Brassica 
rapa]
Length=779

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 107/144 (74%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRP  388
            KPGLVYD+   DYV  +C++GY+  +IS + G+ T+C     S+LD+N PSITIPDLK  
Sbjct  627  KPGLVYDLDLEDYVLYMCSVGYNDSSISQLVGERTTCSNPRPSVLDLNLPSITIPDLKEE  686

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +TLTRTVTNVGP +S YKV VEPP G+ V V P+ L F+   KK+S++V +ST H  NTG
Sbjct  687  VTLTRTVTNVGPPSSVYKVKVEPPLGVQVTVMPNKLVFNSKTKKLSYHVRVSTRHKINTG  746

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            FYFGSL W+D VH+V IP+SV+T+
Sbjct  747  FYFGSLTWSDSVHDVIIPLSVRTQ  770



>ref|XP_010449086.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Camelina 
sativa]
 ref|XP_010449087.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Camelina 
sativa]
Length=755

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 103/143 (72%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYDM+  DY++  CA GY+  AI+I+ G+ T C     SILD N+P+ITIPDLK  +
Sbjct  609  PGLVYDMNVDDYIHFFCASGYNETAITILVGKPTRCSSPLPSILDFNYPAITIPDLKEEV  668

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+TRTVTNVGP +S Y+ +VEPP+G+ +VV+P  L F  N KK+ F V +S+ H  NTG+
Sbjct  669  TITRTVTNVGPVDSVYRAVVEPPEGVKIVVEPEALVFDWNTKKLGFKVRVSSSHKSNTGY  728

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
            +FGS  W DG  NV IP+SV+T+
Sbjct  729  FFGSFTWTDGTRNVTIPLSVRTR  751



>ref|XP_002891020.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67279.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=774

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 106/144 (74%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            +PGL+YDM T DY+  LC+ GY+  +I+ + G  T C +   S+LDVN PSITIP+LK  
Sbjct  622  EPGLIYDMGTQDYILYLCSAGYNDSSITQLVGNVTVCSNPKPSVLDVNLPSITIPNLKDE  681

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +TLTRTVTNVGP +S YKV+++PP GI VVV P TL F+   K +SF V +ST H  NTG
Sbjct  682  VTLTRTVTNVGPVDSVYKVVLDPPLGIRVVVTPETLVFNSKTKSVSFTVGVSTTHKINTG  741

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            FYFG+LIW D +HNV IP+SV+T+
Sbjct  742  FYFGNLIWTDSMHNVTIPVSVRTQ  765



>ref|XP_011075896.1| PREDICTED: subtilisin-like protease SBT3.5 [Sesamum indicum]
Length=783

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 104/144 (72%), Gaps = 1/144 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYD+ T DYVN LCAMGYS   I+ + G+  SC K   S+LD+N PSIT+P+LK  +
Sbjct  634  PGLVYDIGTQDYVNYLCAMGYSETDINQLTGRPKSCKKSSNSVLDLNLPSITVPNLKGSV  693

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+ +TVTNVG ENS Y+ +V PP G +V V P  L FSP V+++SF V I+T H   T +
Sbjct  694  TIRKTVTNVGDENSKYEAVVVPPLGTVVKVNPKHLQFSPEVREMSFKVKITTLHNITTEY  753

Query  204  YFGSLIWNDGVHNVRIPISVKTKY  133
            YFGSL W+DG H V+IPISV+T++
Sbjct  754  YFGSLTWSDGKHEVKIPISVRTEF  777



>ref|XP_006397048.1| hypothetical protein EUTSA_v10028454mg [Eutrema salsugineum]
 gb|ESQ38501.1| hypothetical protein EUTSA_v10028454mg [Eutrema salsugineum]
Length=764

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 107/144 (74%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            KPGLVYDM+T DY+  LCA  YS  +IS +AG+ T C +   S+LD+N PSITIP+L+  
Sbjct  612  KPGLVYDMTTHDYILYLCAADYSDISISRVAGKATVCPNPKPSVLDLNLPSITIPNLRDE  671

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +TLTRTVTNVGP NS YKV+++PP G+ V+V P+ L F+    K+SF V +ST H  NTG
Sbjct  672  VTLTRTVTNVGPVNSVYKVVIDPPMGVNVIVTPTKLVFNSTATKLSFTVKVSTTHKVNTG  731

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            ++FGSL W D +HNV IP+SV+T+
Sbjct  732  YFFGSLTWTDNLHNVAIPVSVRTQ  755



>ref|NP_564412.1| Subtilase 3.5 [Arabidopsis thaliana]
 sp|Q9MAP7.1|SBT35_ARATH RecName: Full=Subtilisin-like protease SBT3.5; AltName: Full=Subtilase 
subfamily 3 member 5; Short=AtSBT3.5; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF31278.1|AC006424_7 First of four adjacent putative subtilase family > [Arabidopsis 
thaliana]
 gb|AAL67022.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AAP04132.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AEE31542.1| Subtilase 3.5 [Arabidopsis thaliana]
Length=774

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 102/143 (71%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHK-GFSILDVNFPSITIPDLKRPI  385
            PGL+YDM   DY+  LC+ GY+  +I+ + G  T C     S+LDVN PSITIPDLK  +
Sbjct  623  PGLIYDMGPRDYILYLCSAGYNDSSITQLVGNVTVCSTPKTSVLDVNLPSITIPDLKDEV  682

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            TLTRTVTNVG  +S YKV+VEPP GI VVV P TL F+   K +SF V +ST H  NTGF
Sbjct  683  TLTRTVTNVGTVDSVYKVVVEPPLGIQVVVAPETLVFNSKTKNVSFTVRVSTTHKINTGF  742

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
            YFG+LIW D +HNV IP+SV+T+
Sbjct  743  YFGNLIWTDSMHNVTIPVSVRTQ  765



>ref|XP_002891021.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67280.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=774

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 105/144 (73%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            +PGL+YDM   DY+  LC+ GY+  +IS++ G+ T C +   S+LD+N PSITIP+LK  
Sbjct  622  EPGLIYDMGPQDYILYLCSAGYNESSISLLVGKVTVCSNPKPSVLDINLPSITIPNLKDE  681

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +TLTRTVTNVGP NS YKV+VEPP G+ V V P+TL F+   K +SF V +ST H  NTG
Sbjct  682  VTLTRTVTNVGPVNSVYKVVVEPPLGVRVAVTPATLVFNSKTKSVSFRVRVSTKHKINTG  741

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            + FGSL W D VHNV IP+SV+T+
Sbjct  742  YLFGSLTWTDSVHNVVIPVSVRTQ  765



>ref|XP_010437012.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X2 [Camelina 
sativa]
Length=666

 Score =   164 bits (416),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 107/147 (73%), Gaps = 1/147 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            +PGL+YD++T DYV  LC+  Y+  +IS + G+ T C +   S+LD+N PSITIP+LK  
Sbjct  514  RPGLIYDINTNDYVLYLCSTDYNDTSISQVVGKKTECPNPKPSVLDLNLPSITIPNLKDK  573

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +TLTRTVTNVGP NS YKV++ PP G+ + VKP+ L F+P  KK+SF VT+ST H  NTG
Sbjct  574  VTLTRTVTNVGPPNSIYKVVINPPTGVRMTVKPNILRFNPRTKKVSFTVTVSTTHKVNTG  633

Query  207  FYFGSLIWNDGVHNVRIPISVKTKY*E  127
            +YFGSL W D V  V IP+SV+T+  E
Sbjct  634  YYFGSLTWTDNVRRVVIPVSVRTQILE  660



>ref|XP_006397045.1| hypothetical protein EUTSA_v10028448mg [Eutrema salsugineum]
 gb|ESQ38498.1| hypothetical protein EUTSA_v10028448mg [Eutrema salsugineum]
Length=777

 Score =   165 bits (418),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 103/144 (72%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRP  388
            KPGLVYD+   DYV  LC+ GY+  +IS + G++T C     S+LD N PSITIP+L   
Sbjct  625  KPGLVYDLGLEDYVLYLCSAGYNESSISQLVGKSTVCSNPRPSVLDFNLPSITIPNLNEE  684

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +TLTR++TNVGP NS YKV VEPP G  V V P TL F+   K++SF VT+ST H  NTG
Sbjct  685  VTLTRSLTNVGPLNSVYKVAVEPPLGFQVTVTPETLVFNSATKRVSFQVTVSTTHKINTG  744

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            +YFGSL W+D VH+V IP+SV+T+
Sbjct  745  YYFGSLTWSDSVHDVTIPLSVRTQ  768



>ref|XP_002891022.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67281.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=774

 Score =   165 bits (418),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 101/144 (70%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            +PGL+YDM   DY+  LC+  Y+  +IS + GQ T C +   S+LDVN PSITIP+LK  
Sbjct  622  EPGLIYDMGPQDYILYLCSADYNESSISQLVGQVTVCSNPKPSVLDVNLPSITIPNLKDE  681

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +T  RTVTNVGP NS YKV VEPP G+ VVV P TL F+   K +SF V +ST H  NTG
Sbjct  682  VTDARTVTNVGPSNSVYKVAVEPPLGVRVVVTPETLVFNSKTKSVSFTVLVSTTHKINTG  741

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            FYFGSL W D VHNV IP+SV+T+
Sbjct  742  FYFGSLTWTDSVHNVVIPLSVRTQ  765



>ref|XP_002518937.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF43470.1| Cucumisin precursor, putative [Ricinus communis]
Length=778

 Score =   165 bits (417),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 104/142 (73%), Gaps = 1/142 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYDM T DYV+ LCAMGY+  AIS + GQ   C K   SILD+N PSITIP+L++ +
Sbjct  627  PGLVYDMGTPDYVHYLCAMGYNHTAISSLTGQPVVCPKNETSILDINLPSITIPNLRKSV  686

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            TLTRTVTNVG  NS Y+V++EPP G  + VKP +L FS   KKI+F VT++  +  NTG+
Sbjct  687  TLTRTVTNVGALNSIYRVVIEPPFGTYISVKPDSLVFSRKTKKITFTVTVTAANQVNTGY  746

Query  204  YFGSLIWNDGVHNVRIPISVKT  139
            YFGSL W +GVH V  P+SV+T
Sbjct  747  YFGSLSWTNGVHTVASPMSVRT  768



>ref|XP_010437005.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X1 [Camelina 
sativa]
Length=762

 Score =   165 bits (417),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 107/147 (73%), Gaps = 1/147 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            +PGL+YD++T DYV  LC+  Y+  +IS + G+ T C +   S+LD+N PSITIP+LK  
Sbjct  610  RPGLIYDINTNDYVLYLCSTDYNDTSISQVVGKKTECPNPKPSVLDLNLPSITIPNLKDK  669

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +TLTRTVTNVGP NS YKV++ PP G+ + VKP+ L F+P  KK+SF VT+ST H  NTG
Sbjct  670  VTLTRTVTNVGPPNSIYKVVINPPTGVRMTVKPNILRFNPRTKKVSFTVTVSTTHKVNTG  729

Query  207  FYFGSLIWNDGVHNVRIPISVKTKY*E  127
            +YFGSL W D V  V IP+SV+T+  E
Sbjct  730  YYFGSLTWTDNVRRVVIPVSVRTQILE  756



>ref|XP_006413792.1| hypothetical protein EUTSA_v10024501mg [Eutrema salsugineum]
 gb|ESQ55245.1| hypothetical protein EUTSA_v10024501mg [Eutrema salsugineum]
Length=748

 Score =   164 bits (416),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 105/143 (73%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYDM+  DY++  CA GY+  AIS++ G+ T C     SILD+N+P+ITIPD+K  +
Sbjct  604  PGLVYDMNLDDYIHYFCASGYNDTAISVLTGKPTKCSSPLPSILDLNYPAITIPDIKEEV  663

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            +L+RTVTNVGP +S Y+ +VEPP GI +VV+P TL F+ + KK+ F V +ST +  NTG+
Sbjct  664  SLSRTVTNVGPVDSVYRAVVEPPPGIKIVVEPETLVFNSSTKKLGFKVRVSTSYKSNTGY  723

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
            +FGS  W DG  NV IP+SV+T+
Sbjct  724  FFGSFTWTDGTRNVTIPLSVRTR  746



>ref|XP_002317663.1| subtilase family protein [Populus trichocarpa]
 gb|EEE98275.1| subtilase family protein [Populus trichocarpa]
Length=770

 Score =   165 bits (417),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 105/144 (73%), Gaps = 1/144 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRPI  385
            PGLVYDM T DY+N LCAM Y++ AIS + G  T C  +  SIL++N PSITIP+L+  I
Sbjct  622  PGLVYDMGTEDYINYLCAMNYNNTAISRLTGNLTVCPIEEPSILNINLPSITIPNLRNSI  681

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            TLTRTVTNVG  NS Y+VM+EPP G  V VKP+ L F+   KKI+F VT++T H  NT +
Sbjct  682  TLTRTVTNVGASNSIYRVMIEPPFGTSVSVKPNVLVFNHKTKKITFTVTVTTAHQVNTEY  741

Query  204  YFGSLIWNDGVHNVRIPISVKTKY  133
             FGSL W DGVH VR P+SV+T++
Sbjct  742  SFGSLTWTDGVHIVRSPLSVRTEF  765



>ref|XP_006287107.1| hypothetical protein CARUB_v10000269mg [Capsella rubella]
 gb|EOA20005.1| hypothetical protein CARUB_v10000269mg [Capsella rubella]
Length=780

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 104/144 (72%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            KPGLVYD+   DYV  +C+ GY+  +IS + G+ T C +   SILD N PSITIP+LK  
Sbjct  628  KPGLVYDLGLEDYVLYMCSAGYNESSISQLVGKATICSNPKLSILDFNLPSITIPNLKDE  687

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +TLTRT+TNVGP +S Y+V+VEPP G  V V+P TL F+   K++SF V IST H  NTG
Sbjct  688  VTLTRTLTNVGPLDSVYRVVVEPPLGFQVTVEPKTLVFNSQTKRVSFKVRISTTHKINTG  747

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            +YFGSL W+D VHNV I +SV+T+
Sbjct  748  YYFGSLTWSDSVHNVTIHVSVRTQ  771



>gb|AGN12874.1| putative transcription factor DYSFUNCTIONAL TAPETUM 1 [Sisymbrium 
irio]
Length=775

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 104/143 (73%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYDM+  DY++ LCA  Y+  AIS++ G+ T C     SILDVN+P+ITIP+LK  +
Sbjct  632  PGLVYDMNIDDYIHFLCASSYNETAISVLTGKPTKCSSPLPSILDVNYPAITIPELKDEV  691

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
             +TRTVTNVGP +S Y+ +VE P+G+ +VV+P TL FS + KK+ F V +ST H  NTG+
Sbjct  692  NITRTVTNVGPVDSVYRAVVEAPEGVKIVVEPQTLVFSSSTKKLGFKVRVSTSHKSNTGY  751

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
            +FGS  W DG  NV IP+SV+T+
Sbjct  752  FFGSFTWTDGTRNVTIPLSVRTR  774



>ref|XP_011040610.1| PREDICTED: subtilisin-like protease SBT3.3 [Populus euphratica]
Length=770

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 104/144 (72%), Gaps = 1/144 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRPI  385
            PGLVYDM T DY+N LCAM Y++ AIS + G  T C  +  SIL++N PSITIP+L+  I
Sbjct  622  PGLVYDMGTEDYINYLCAMNYNNTAISRLTGNLTVCPIEEPSILNINLPSITIPNLRNSI  681

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            TLTRTVTNVG  NS Y+VM+EPP G  V VKP+ L F+   KKI+F VT++T H  NT +
Sbjct  682  TLTRTVTNVGASNSIYRVMIEPPFGTSVSVKPNVLVFNHKTKKITFTVTVTTAHQVNTEY  741

Query  204  YFGSLIWNDGVHNVRIPISVKTKY  133
             FGSL W DG H VR P+SV+T++
Sbjct  742  SFGSLTWTDGEHKVRSPLSVRTEF  765



>gb|KJB74658.1| hypothetical protein B456_012G000900 [Gossypium raimondii]
Length=778

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 102/147 (69%), Gaps = 1/147 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPI  385
            PGLVYDM+T +YV+ LCAMGY++  I  +      C  K  SILDVN PSITIP+LK+P 
Sbjct  630  PGLVYDMNTENYVHYLCAMGYNNSDIFQLTEHPVVCPSKQPSILDVNLPSITIPNLKKPT  689

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
             LTRTVTNVGP NS YK  VE   GI V V+P TL FS   K ISF+V IS+ H  N G+
Sbjct  690  ILTRTVTNVGPVNSKYKASVEFASGINVAVRPETLIFSSRTKAISFSVMISSAHNVNAGY  749

Query  204  YFGSLIWNDGVHNVRIPISVKTKY*ES  124
            YFGSL W DGVH VR PISV+T+  ES
Sbjct  750  YFGSLTWTDGVHVVRSPISVRTEVGES  776



>ref|XP_010455451.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=1533

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 104/144 (72%), Gaps = 1/144 (1%)
 Frame = -1

Query  564   KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRP  388
             KPGLVYD+   DYV+ +C++GY+  +IS + G+ T C     S+LD N PSITIP+LK  
Sbjct  1381  KPGLVYDLGLEDYVHYMCSVGYNESSISQLVGKGTVCSIPKPSVLDFNLPSITIPNLKDV  1440

Query  387   ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
             +TLTRT+TNVGP NS YKVMVEPP GI V V P TL F+   K+ SF V +ST H  NTG
Sbjct  1441  VTLTRTLTNVGPLNSIYKVMVEPPLGIQVTVSPETLVFNSTTKRASFKVRVSTTHKINTG  1500

Query  207   FYFGSLIWNDGVHNVRIPISVKTK  136
             +YFGSL W+D  HNV IP+SV+T+
Sbjct  1501  YYFGSLTWSDSEHNVTIPLSVRTQ  1524


 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 89/130 (68%), Gaps = 1/130 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            KPGLVYD+   DYV  +C+ GY+  +IS + G+ T C +   SILD N PSITIP+LK  
Sbjct  626  KPGLVYDLGLEDYVLYMCSAGYNESSISQLVGKGTVCSNPKPSILDFNLPSITIPNLKDE  685

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +TLTRT+TNVGP  S Y+V VEPP G  V V P TL F    K++SF V IST H  NTG
Sbjct  686  VTLTRTLTNVGPLKSVYRVKVEPPLGFQVTVTPKTLVFKAKTKRVSFKVRISTTHKINTG  745

Query  207  FYFGSLIWND  178
            +YFGSL W+D
Sbjct  746  YYFGSLTWSD  755



>ref|XP_006306827.1| hypothetical protein CARUB_v10008369mg [Capsella rubella]
 gb|EOA39725.1| hypothetical protein CARUB_v10008369mg [Capsella rubella]
Length=769

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 105/145 (72%), Gaps = 5/145 (3%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGL+YDM T DY+  LC+ GY+  +IS + G+ T+C     S+LDVN PSITIP+LK  +
Sbjct  618  PGLIYDMGTQDYILYLCSAGYNDSSISQLTGKVTACSNPRPSVLDVNLPSITIPNLKDEV  677

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKIS--FNVTISTCHGFNT  211
            TLTRTVTNVG  +S YKV+VEPP GI V V P TL F  N KKIS  F V +ST H  NT
Sbjct  678  TLTRTVTNVGLADSVYKVVVEPPLGIRVAVTPETLVF--NTKKISVPFTVRVSTTHKINT  735

Query  210  GFYFGSLIWNDGVHNVRIPISVKTK  136
            GFYFGSL+W D +HNV IP+SV+T+
Sbjct  736  GFYFGSLMWTDSMHNVTIPVSVRTQ  760



>ref|XP_010099424.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB78386.1| Subtilisin-like protease [Morus notabilis]
Length=394

 Score =   159 bits (403),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 100/143 (70%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPI  385
            PGLVYDM T DY++ LCAMGY++ AIS +    TSC  K  S+LD+N PSITIP L +P 
Sbjct  247  PGLVYDMGTEDYLHYLCAMGYNNSAISQLREHPTSCPTKRPSVLDLNLPSITIPSLTKPT  306

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
             LTRTV NVG  NS+YK +V+PP+GI + V+P  L F+     ISF V +S+ H   TG+
Sbjct  307  KLTRTVRNVGHANSSYKAVVKPPQGIRISVRPRLLTFNATNNTISFTVAVSSTHRVTTGY  366

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
            YFGSL W DGVH V  PISV+T+
Sbjct  367  YFGSLTWTDGVHTVNSPISVRTE  389



>ref|XP_002867837.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44096.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=669

 Score =   162 bits (410),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 105/145 (72%), Gaps = 2/145 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRP  388
            KPGLVYDM   DY+N +C+ GY+  +IS + G+ T+C   G SILD+N PSITIP+L++ 
Sbjct  520  KPGLVYDMGIDDYINYMCSAGYNDSSISRVLGKKTNCPIPGPSILDINLPSITIPNLEKE  579

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKK-ISFNVTISTCHGFNT  211
            +TLTRTVTNVGP  S YK ++EPP GI + V P+TL F    K+ ++F+V   T H  N 
Sbjct  580  VTLTRTVTNVGPIKSVYKAVIEPPLGITLTVNPTTLVFKSAAKRVVTFSVKAKTSHKVNG  639

Query  210  GFYFGSLIWNDGVHNVRIPISVKTK  136
            G++FGSL W DGVH+V IP+SVKT+
Sbjct  640  GYFFGSLTWTDGVHDVTIPVSVKTE  664



>ref|XP_010542106.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT3.5 
[Tarenaya hassleriana]
Length=712

 Score =   162 bits (410),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 105/147 (71%), Gaps = 1/147 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
             PGL+YDM T+DYV+ +C++GY+  +IS I    T C +   SILD+N PSITIPDL+  
Sbjct  560  DPGLIYDMGTSDYVHYMCSVGYNDSSISQIVKNATVCPNPRPSILDLNLPSITIPDLRNE  619

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +TLTRTVTNVGP +S YKV+VEPP G+ V V P  + F+   K++SF V +ST H  N+G
Sbjct  620  VTLTRTVTNVGPVDSVYKVVVEPPLGVSVTVTPDMIVFNSTTKRVSFTVRVSTGHKVNSG  679

Query  207  FYFGSLIWNDGVHNVRIPISVKTKY*E  127
            FYFGSL W +  HNV IP+SV+T+  E
Sbjct  680  FYFGSLTWTESAHNVTIPLSVRTQILE  706



>ref|XP_010529677.1| PREDICTED: subtilisin-like protease SBT3.3 [Tarenaya hassleriana]
Length=767

 Score =   163 bits (412),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 104/143 (73%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPI  385
            PGLVYDM T+DY+  +C+ GY+  +IS + G+ TSC +   SILD+N PSITIP+L+  +
Sbjct  616  PGLVYDMGTSDYILYMCSAGYADSSISQLIGKPTSCPNPKPSILDLNLPSITIPNLRDEV  675

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            TLTRTVTNVGP +S YKV++EPP G+ V V P TL F+   K++SF V ++T H  N+GF
Sbjct  676  TLTRTVTNVGPRDSVYKVVMEPPSGVRVDVNPKTLVFNSETKRVSFTVRVTTAHKVNSGF  735

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
            YFG L W D V  V IP+SV+T+
Sbjct  736  YFGRLTWTDSVREVTIPVSVRTQ  758



>ref|XP_010542096.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT3.5 
[Tarenaya hassleriana]
Length=812

 Score =   163 bits (412),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 107/145 (74%), Gaps = 2/145 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            +PGLVYDM   DY+  LC+ GY+  +IS + G+ T+C +   SILD+N PSITIPDL+  
Sbjct  659  EPGLVYDMGIDDYILYLCSAGYNDSSISQLVGKGTACPNPKPSILDLNLPSITIPDLRDE  718

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNF-SPNVKKISFNVTISTCHGFNT  211
            +TL+RTVTNVGP +S YK++VE P GI V V+P TL F +   ++++F V +ST H  NT
Sbjct  719  VTLSRTVTNVGPADSVYKILVENPLGIDVEVRPDTLVFNNSTARRVAFTVRVSTKHKINT  778

Query  210  GFYFGSLIWNDGVHNVRIPISVKTK  136
            GFYFGSL W+D VHNV IP+SV+T+
Sbjct  779  GFYFGSLTWSDSVHNVTIPVSVRTQ  803



>gb|KFK45040.1| hypothetical protein AALP_AA1G336300 [Arabis alpina]
Length=776

 Score =   162 bits (411),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 101/143 (71%), Gaps = 1/143 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            +PGL+YDM   DY+  LC+  Y+  +IS + G+ T C +   S+LDVN PSITIP+LK  
Sbjct  624  EPGLIYDMGPEDYILYLCSASYNDSSISQLVGKVTVCSNPKPSVLDVNLPSITIPNLKDE  683

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            + LTRTVTNVGP +S YKV+VEPP G+ V V P TL F+   K+ SF   +ST H  NTG
Sbjct  684  VNLTRTVTNVGPVDSVYKVVVEPPLGVRVAVTPETLVFNSTTKRASFTARVSTIHKINTG  743

Query  207  FYFGSLIWNDGVHNVRIPISVKT  139
            FYFGSLIW D VHNV IP+SV+T
Sbjct  744  FYFGSLIWTDSVHNVTIPVSVRT  766



>gb|KFK28745.1| hypothetical protein AALP_AA7G041500 [Arabis alpina]
Length=764

 Score =   162 bits (410),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 105/145 (72%), Gaps = 2/145 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHK-GFSILDVNFPSITIPDLKRP  388
            KPGLVYDM   DY+N +C+ GY+  +IS + G+ T C     SILD+N PSITIP+L++ 
Sbjct  615  KPGLVYDMGIEDYINYMCSAGYNDSSISRVVGKKTKCQTPKPSILDINLPSITIPNLEQE  674

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKK-ISFNVTISTCHGFNT  211
            +TLTRTVTNVGP  S YK ++E P GI + V P+ L FS + K+ ++F+V   T H  NT
Sbjct  675  VTLTRTVTNVGPIKSVYKAVIESPLGITLTVNPTILVFSSSAKRLLTFSVKAKTSHKVNT  734

Query  210  GFYFGSLIWNDGVHNVRIPISVKTK  136
            G++FGSL W DGVH+V+IP+SVKTK
Sbjct  735  GYFFGSLTWTDGVHDVKIPVSVKTK  759



>ref|XP_002872522.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48781.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=737

 Score =   162 bits (409),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 105/144 (73%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            KPGL+YDM+T DYV  +C++ YS  +IS + G+TT C +   S+LD+N PSITIP+L+  
Sbjct  585  KPGLIYDMTTDDYVMYMCSVDYSDISISRVLGKTTVCPNPKPSVLDLNLPSITIPNLRGE  644

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +TLTRTVTNVGP NS YKV+++PP G+ V V P+ L F     K SF V +ST H  NTG
Sbjct  645  VTLTRTVTNVGPVNSVYKVVIDPPTGVNVAVTPTELVFDSTTTKRSFTVRVSTTHKVNTG  704

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            +YFGSL W D +HNV IP+SV+T+
Sbjct  705  YYFGSLTWTDNLHNVAIPVSVRTQ  728



>gb|AAD03431.1| similar to the subtilase family of serine proteases (Pfam: PF00082, 
score; 45.8, E=1.1e-11, n=2) [Arabidopsis thaliana]
Length=751

 Score =   162 bits (410),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 103/143 (72%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPI  385
            PGLVYDM   DYV  +C++GY+  +IS + G+TT C +   S+LD N PSITIP+LK  +
Sbjct  600  PGLVYDMGLEDYVLYMCSVGYNETSISQLIGKTTVCSNPKPSVLDFNLPSITIPNLKDEV  659

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+TRTVTNVGP NS Y+V VEPP G  V V P TL F+   KK+ F V +ST H  NTG+
Sbjct  660  TITRTVTNVGPLNSVYRVTVEPPLGFQVTVTPETLVFNSTTKKVYFKVKVSTTHKTNTGY  719

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
            YFGSL W+D +HNV IP+SV+T+
Sbjct  720  YFGSLTWSDSLHNVTIPLSVRTQ  742



>ref|XP_009348701.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease Glyma18g48580 
[Pyrus x bretschneideri]
Length=298

 Score =   156 bits (394),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 103/143 (72%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRPI  385
            PGL+Y+M   DY+N LCA GY++ AIS++  Q TSC     SILDVN PSITIP+L+ P+
Sbjct  147  PGLIYNMDINDYINYLCAFGYNTSAISLLVKQATSCPVPKPSILDVNLPSITIPNLRNPL  206

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T TR+VTNVG  NSTYK  ++P  G  V+V+P TL F+  VK IS++V +ST +  NT +
Sbjct  207  TPTRSVTNVGHGNSTYKAXIDPSPGTNVLVRPETLVFNSTVKTISYSVAVSTTYRVNTAY  266

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
            +FGSL W DGV+ V  PISV+T+
Sbjct  267  FFGSLTWTDGVYAVTSPISVRTQ  289



>ref|NP_001078370.1| subtilisin-like protease [Arabidopsis thaliana]
 gb|AEE82897.1| subtilisin-like protease [Arabidopsis thaliana]
Length=722

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 103/143 (72%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPI  385
            PGLVYDM   DYV  +C++GY+  +IS + G+TT C +   S+LD N PSITIP+LK  +
Sbjct  571  PGLVYDMGLEDYVLYMCSVGYNETSISQLIGKTTVCSNPKPSVLDFNLPSITIPNLKDEV  630

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+TRTVTNVGP NS Y+V VEPP G  V V P TL F+   KK+ F V +ST H  NTG+
Sbjct  631  TITRTVTNVGPLNSVYRVTVEPPLGFQVTVTPETLVFNSTTKKVYFKVKVSTTHKTNTGY  690

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
            YFGSL W+D +HNV IP+SV+T+
Sbjct  691  YFGSLTWSDSLHNVTIPLSVRTQ  713



>dbj|BAE98849.1| subtilisin-like protease -like protein [Arabidopsis thaliana]
Length=722

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 103/143 (72%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPI  385
            PGLVYDM   DYV  +C++GY+  +IS + G+TT C +   S+LD N PSITIP+LK  +
Sbjct  571  PGLVYDMGLEDYVLYMCSVGYNETSISQLIGKTTVCSNPKPSVLDFNLPSITIPNLKDEV  630

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+TRTVTNVGP NS Y+V VEPP G  V V P TL F+   KK+ F V +ST H  NTG+
Sbjct  631  TITRTVTNVGPLNSVYRVTVEPPLGFQVTVTPETLVFNSTTKKVYFKVKVSTTHKTNTGY  690

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
            YFGSL W+D +HNV IP+SV+T+
Sbjct  691  YFGSLTWSDSLHNVTIPLSVRTQ  713



>ref|XP_010529409.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X2 [Tarenaya 
hassleriana]
Length=761

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 103/145 (71%), Gaps = 2/145 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC--HKGFSILDVNFPSITIPDLKR  391
            KPGLVYDM  +DYV+ LC+ GY+  +IS + G+T +C   +  SILDVN PSITIPD+K 
Sbjct  611  KPGLVYDMFMSDYVHYLCSTGYNDSSISNVVGETVTCPTDRKPSILDVNLPSITIPDIKD  670

Query  390  PITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNT  211
             + + RTVTNVGP NS Y+ ++EPP GI V   P  L F    K+++F V IST H  NT
Sbjct  671  EVLVRRTVTNVGPVNSVYEAVIEPPLGINVEATPKKLVFDSRNKRVTFVVKISTRHEVNT  730

Query  210  GFYFGSLIWNDGVHNVRIPISVKTK  136
            G+ FGSL W DGVH+VRIP+SV+T+
Sbjct  731  GYLFGSLTWTDGVHDVRIPLSVRTR  755



>ref|XP_010529408.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X1 [Tarenaya 
hassleriana]
Length=765

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 103/145 (71%), Gaps = 2/145 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC--HKGFSILDVNFPSITIPDLKR  391
            KPGLVYDM  +DYV+ LC+ GY+  +IS + G+T +C   +  SILDVN PSITIPD+K 
Sbjct  615  KPGLVYDMFMSDYVHYLCSTGYNDSSISNVVGETVTCPTDRKPSILDVNLPSITIPDIKD  674

Query  390  PITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNT  211
             + + RTVTNVGP NS Y+ ++EPP GI V   P  L F    K+++F V IST H  NT
Sbjct  675  EVLVRRTVTNVGPVNSVYEAVIEPPLGINVEATPKKLVFDSRNKRVTFVVKISTRHEVNT  734

Query  210  GFYFGSLIWNDGVHNVRIPISVKTK  136
            G+ FGSL W DGVH+VRIP+SV+T+
Sbjct  735  GYLFGSLTWTDGVHDVRIPLSVRTR  759



>emb|CDX84657.1| BnaA03g15730D [Brassica napus]
Length=759

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 102/144 (71%), Gaps = 2/144 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYDM + +YV+ LC+ GY +K+IS + G+  +C     S+LDVN PSITIP L   I
Sbjct  610  PGLVYDMGSDEYVHYLCSAGYENKSISRLLGRIYTCPSPTPSMLDVNVPSITIPYLNEEI  669

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
             LTRTVTNVGP  S YK ++EPP GI + V P TL F PN KKI+F V +ST H +NT +
Sbjct  670  ILTRTVTNVGPVGSVYKAVIEPPLGIKLQVSPETLKFGPNTKKITFTVKVSTTHRWNTDY  729

Query  204  YFGSLIWND-GVHNVRIPISVKTK  136
             FGSL W D G HNVRIP+SV+T+
Sbjct  730  LFGSLTWTDNGAHNVRIPLSVRTR  753



>ref|XP_010318062.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X3 [Solanum 
lycopersicum]
 ref|XP_010318063.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X3 [Solanum 
lycopersicum]
Length=732

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 105/146 (72%), Gaps = 3/146 (2%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRPI  385
            PGLVYDM T DY+  LC+MGY++ AIS++  Q  SC  K  SILDVN PS+TIP L++ +
Sbjct  586  PGLVYDMGTFDYILYLCSMGYNNSAISMLIDQAASCPIKRPSILDVNLPSLTIPSLRKKV  645

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
               RTVTNVGP NS Y+ ++EPP GI + VKP TL F+ + KKISF +TIST H + T +
Sbjct  646  R--RTVTNVGPVNSKYEAIIEPPLGITIKVKPETLIFNSSTKKISFTITISTSHKYTTYY  703

Query  204  YFGSLIWNDGVHNVRIPISVKTKY*E  127
            YFGSL W DG+H VR P SV+ ++ E
Sbjct  704  YFGSLTWTDGMHRVRSPTSVRNEFPE  729



>ref|XP_011470880.1| PREDICTED: subtilisin-like protease SBT3.3 [Fragaria vesca subsp. 
vesca]
Length=780

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 102/144 (71%), Gaps = 1/144 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPI  385
            PGLVYDM   DY++ LCAM Y++  I+ + GQ T+C  K  S+LD+N PSITIP L   I
Sbjct  629  PGLVYDMGAADYMHYLCAMDYNNSDITRLTGQATTCPMKRPSLLDINLPSITIPSLGNSI  688

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+TRTVTNVG   S Y+  ++PP G +V VKP+ L F+  VKK++F + IST H  NTG+
Sbjct  689  TVTRTVTNVGAPKSVYEATIDPPLGTVVSVKPNLLVFNSTVKKLTFEIVISTTHQMNTGY  748

Query  204  YFGSLIWNDGVHNVRIPISVKTKY  133
            YFGSL W D VH VRIP+SV+T +
Sbjct  749  YFGSLTWTDRVHAVRIPLSVRTNF  772



>ref|XP_010318060.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X1 [Solanum 
lycopersicum]
Length=772

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 105/146 (72%), Gaps = 3/146 (2%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRPI  385
            PGLVYDM T DY+  LC+MGY++ AIS++  Q  SC  K  SILDVN PS+TIP L++ +
Sbjct  626  PGLVYDMGTFDYILYLCSMGYNNSAISMLIDQAASCPIKRPSILDVNLPSLTIPSLRKKV  685

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
               RTVTNVGP NS Y+ ++EPP GI + VKP TL F+ + KKISF +TIST H + T +
Sbjct  686  R--RTVTNVGPVNSKYEAIIEPPLGITIKVKPETLIFNSSTKKISFTITISTSHKYTTYY  743

Query  204  YFGSLIWNDGVHNVRIPISVKTKY*E  127
            YFGSL W DG+H VR P SV+ ++ E
Sbjct  744  YFGSLTWTDGMHRVRSPTSVRNEFPE  769



>emb|CAB40021.1| subtilisin-like protease-like protein [Arabidopsis thaliana]
 emb|CAB78178.1| subtilisin-like protease-like protein [Arabidopsis thaliana]
Length=803

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 103/143 (72%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPI  385
            PGLVYDM   DYV  +C++GY+  +IS + G+TT C +   S+LD N PSITIP+LK  +
Sbjct  652  PGLVYDMGLEDYVLYMCSVGYNETSISQLIGKTTVCSNPKPSVLDFNLPSITIPNLKDEV  711

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+TRTVTNVGP NS Y+V VEPP G  V V P TL F+   KK+ F V +ST H  NTG+
Sbjct  712  TITRTVTNVGPLNSVYRVTVEPPLGFQVTVTPETLVFNSTTKKVYFKVKVSTTHKTNTGY  771

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
            YFGSL W+D +HNV IP+SV+T+
Sbjct  772  YFGSLTWSDSLHNVTIPLSVRTQ  794



>ref|XP_010318061.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X2 [Solanum 
lycopersicum]
Length=764

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 105/146 (72%), Gaps = 3/146 (2%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRPI  385
            PGLVYDM T DY+  LC+MGY++ AIS++  Q  SC  K  SILDVN PS+TIP L++ +
Sbjct  618  PGLVYDMGTFDYILYLCSMGYNNSAISMLIDQAASCPIKRPSILDVNLPSLTIPSLRKKV  677

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
               RTVTNVGP NS Y+ ++EPP GI + VKP TL F+ + KKISF +TIST H + T +
Sbjct  678  R--RTVTNVGPVNSKYEAIIEPPLGITIKVKPETLIFNSSTKKISFTITISTSHKYTTYY  735

Query  204  YFGSLIWNDGVHNVRIPISVKTKY*E  127
            YFGSL W DG+H VR P SV+ ++ E
Sbjct  736  YFGSLTWTDGMHRVRSPTSVRNEFPE  761



>ref|XP_009132975.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=759

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 102/144 (71%), Gaps = 2/144 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYDM + +YV+ LC+ GY +K+IS + G+  +C     S+LDVN PSITIP L   I
Sbjct  610  PGLVYDMGSDEYVHYLCSAGYENKSISRLLGRIYTCPSPTPSMLDVNVPSITIPYLNEEI  669

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
             LTRTVTNVGP  S YK ++EPP GI + V P TL F PN KKI+F V +ST H +NT +
Sbjct  670  ILTRTVTNVGPVGSVYKAVIEPPLGIKLQVSPKTLEFGPNTKKITFTVKVSTTHRWNTDY  729

Query  204  YFGSLIWND-GVHNVRIPISVKTK  136
             FGSL W D G HNVRIP+SV+T+
Sbjct  730  LFGSLTWTDNGAHNVRIPLSVRTR  753



>ref|NP_567362.1| subtilisin-like protease [Arabidopsis thaliana]
 gb|AAM91616.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AEE82896.1| subtilisin-like protease [Arabidopsis thaliana]
Length=778

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 103/143 (72%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPI  385
            PGLVYDM   DYV  +C++GY+  +IS + G+TT C +   S+LD N PSITIP+LK  +
Sbjct  627  PGLVYDMGLEDYVLYMCSVGYNETSISQLIGKTTVCSNPKPSVLDFNLPSITIPNLKDEV  686

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+TRTVTNVGP NS Y+V VEPP G  V V P TL F+   KK+ F V +ST H  NTG+
Sbjct  687  TITRTVTNVGPLNSVYRVTVEPPLGFQVTVTPETLVFNSTTKKVYFKVKVSTTHKTNTGY  746

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
            YFGSL W+D +HNV IP+SV+T+
Sbjct  747  YFGSLTWSDSLHNVTIPLSVRTQ  769



>ref|XP_002867836.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44095.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=758

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 105/146 (72%), Gaps = 2/146 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRP  388
            KPGLVYDM   DY+N +C+ GY+  +IS + G+ T C     S+LD+N PSITIP+L++ 
Sbjct  611  KPGLVYDMGIDDYINYMCSAGYNDSSISRVLGKKTKCPIPEPSMLDINLPSITIPNLEKE  670

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKI-SFNVTISTCHGFNT  211
            +TLTRTVTNVGP  S YK ++EPP GI + V P+TL F    K++ +F+V   T H  N+
Sbjct  671  VTLTRTVTNVGPIKSVYKAVIEPPLGITLTVNPTTLVFKSAAKRVLTFSVKAKTSHKVNS  730

Query  210  GFYFGSLIWNDGVHNVRIPISVKTKY  133
            G++FGSL W DGVH+V IP+SVKT+Y
Sbjct  731  GYFFGSLTWTDGVHDVIIPVSVKTRY  756



>ref|NP_001190697.1| subtilisin-like protease [Arabidopsis thaliana]
 gb|AEE82898.1| subtilisin-like protease [Arabidopsis thaliana]
Length=794

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 103/143 (72%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPI  385
            PGLVYDM   DYV  +C++GY+  +IS + G+TT C +   S+LD N PSITIP+LK  +
Sbjct  643  PGLVYDMGLEDYVLYMCSVGYNETSISQLIGKTTVCSNPKPSVLDFNLPSITIPNLKDEV  702

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+TRTVTNVGP NS Y+V VEPP G  V V P TL F+   KK+ F V +ST H  NTG+
Sbjct  703  TITRTVTNVGPLNSVYRVTVEPPLGFQVTVTPETLVFNSTTKKVYFKVKVSTTHKTNTGY  762

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
            YFGSL W+D +HNV IP+SV+T+
Sbjct  763  YFGSLTWSDSLHNVTIPLSVRTQ  785



>ref|XP_010421968.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=759

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 105/144 (73%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            +PGL+YDM+  DYV+ LC+  Y++ +IS +  + T C +   S+LD+N PSITIP+LK  
Sbjct  607  RPGLIYDMTIADYVSYLCSTYYNNVSISQVLEKKTVCPNPKPSVLDLNLPSITIPNLKDE  666

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +TLTRTVTNVGP NS YKVM++PP G+ + V P TL FS   K +SF V +ST H  NTG
Sbjct  667  VTLTRTVTNVGPLNSIYKVMIDPPIGVSMTVTPDTLEFSSTTKIVSFKVRVSTRHKVNTG  726

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            +YFGSL W D VHNV IP+SV+T+
Sbjct  727  YYFGSLTWTDSVHNVVIPVSVRTQ  750



>ref|NP_564414.2| Subtilase family protein SBT3.3 [Arabidopsis thaliana]
 sp|Q9MAP5.1|SBT33_ARATH RecName: Full=Subtilisin-like protease SBT3.3; AltName: Full=Subtilase 
subfamily 3 member 3; Short=AtSBT3.3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF31276.1|AC006424_5 Third of four adjacent putative subtilase family > [Arabidopsis 
thaliana]
 gb|AAM20591.1| subtilase, putative [Arabidopsis thaliana]
 gb|AAQ56790.1| At1g32960 [Arabidopsis thaliana]
 gb|AEE31544.1| Subtilase family protein SBT3.3 [Arabidopsis thaliana]
Length=777

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 102/144 (71%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            +PGL+YDM   DY+  LC+ GY+  +IS + GQ T C +   S+LDVN PSITIP+LK  
Sbjct  625  EPGLIYDMGPQDYILYLCSAGYNDSSISQLVGQITVCSNPKPSVLDVNLPSITIPNLKDE  684

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +TLTRTVTNVG  +S YKV VEPP G+ VVV P TL F+     +SF V +ST H  NTG
Sbjct  685  VTLTRTVTNVGLVDSVYKVSVEPPLGVRVVVTPETLVFNSKTISVSFTVRVSTTHKINTG  744

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            +YFGSL W D VHNV IP+SV+T+
Sbjct  745  YYFGSLTWTDSVHNVVIPLSVRTQ  768



>ref|XP_009344068.1| PREDICTED: subtilisin-like protease SBT5.3, partial [Pyrus x 
bretschneideri]
Length=758

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 102/141 (72%), Gaps = 1/141 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYDM   DY+N LCA+GY++ A+S I GQ T+C     S+LDVN PSITIP+L+  I
Sbjct  611  PGLVYDMGREDYINFLCAVGYNTSALSQIVGQVTACSSTKPSVLDVNLPSITIPNLRDNI  670

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
             LTR+VTNVGP +S YKV ++PP G+ V V+P TL F+ +VK I+F V +ST H  NTG+
Sbjct  671  NLTRSVTNVGPVDSVYKVDIDPPLGVNVAVRPDTLVFNSSVKTITFTVAVSTTHHVNTGY  730

Query  204  YFGSLIWNDGVHNVRIPISVK  142
            YFGSL W DG H V   +SV+
Sbjct  731  YFGSLTWTDGKHVVTSAVSVR  751



>ref|XP_010470055.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=750

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 104/144 (72%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHK-GFSILDVNFPSITIPDLKRP  388
            +PGL+YDM+  DYV  LC+  Y++ ++S I  + T C K   S+LD+N PSITIP+LK  
Sbjct  598  RPGLIYDMTIDDYVLYLCSTYYNNVSVSQILEKKTVCPKPTRSVLDLNLPSITIPNLKDE  657

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +TLTRTVTNVGP NS YKVM++PP G+ + V P TL F+   K +SF V +ST H  NTG
Sbjct  658  VTLTRTVTNVGPLNSIYKVMIDPPIGVSMTVTPYTLEFNSTTKNVSFKVRVSTTHKVNTG  717

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            +YFGSL W D VHNV IP+SV+T+
Sbjct  718  YYFGSLTWTDSVHNVVIPVSVRTQ  741



>gb|KJB52411.1| hypothetical protein B456_008G260500 [Gossypium raimondii]
Length=822

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 104/147 (71%), Gaps = 1/147 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPI  385
            PGLVYDM  +DY++ LCAMGY++ AIS + GQ+T+C  +  S LDVN PSITI  L+  +
Sbjct  671  PGLVYDMGLSDYIHYLCAMGYNNSAISRLTGQSTACPAEKPSFLDVNLPSITISSLRSSV  730

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            TLTRTVTNVG  NS Y+  +EPP G+ V VKP  L F+   KKISFNVT+      NTG+
Sbjct  731  TLTRTVTNVGSPNSIYRADIEPPTGMTVTVKPHILVFNSRTKKISFNVTVCATKQVNTGY  790

Query  204  YFGSLIWNDGVHNVRIPISVKTKY*ES  124
            +FGSL W +  + VRIP+SVKT+  ES
Sbjct  791  FFGSLTWRNEQNAVRIPLSVKTEILES  817



>emb|CDX91186.1| BnaC02g04110D [Brassica napus]
Length=760

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 102/143 (71%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYD    DY+  LCA  Y  K+I+ I+ QT  C     S+LD+N PSITIP LK  +
Sbjct  611  PGLVYDADVQDYIRFLCASSYDEKSITKISKQTVKCPSPRPSMLDLNLPSITIPFLKEDV  670

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            TLTRTVTNVGP NS YK++V+PP G+ + V P TL F+  VKK+S+ VT+ST H  N+ +
Sbjct  671  TLTRTVTNVGPVNSVYKLIVQPPMGVKISVTPQTLVFNSGVKKLSYQVTVSTTHKANSIY  730

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
            +FGSL W DG+HNV IP+S++T+
Sbjct  731  FFGSLTWTDGIHNVVIPLSIRTQ  753



>ref|XP_009128710.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=764

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 104/144 (72%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            KPGLVYDM+T DYV  LCA  YS  +IS + G+ T C     S+LD+N PSITIP+L+  
Sbjct  612  KPGLVYDMATHDYVLYLCAADYSDMSISRVLGKATVCPTPKPSVLDLNLPSITIPNLRDE  671

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +TLTRTVTNVGP NS YKV++ PP G+ V V P+T  F+    K+SF V ++T H  NTG
Sbjct  672  VTLTRTVTNVGPLNSVYKVVINPPTGVNVGVTPTTFVFNSTATKLSFTVRVTTTHRVNTG  731

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            ++FGSL W+D +HNV IP+SV+T+
Sbjct  732  YFFGSLTWSDNMHNVAIPLSVRTQ  755



>emb|CDY54842.1| BnaC05g51310D [Brassica napus]
Length=1424

 Score =   162 bits (411),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 99/140 (71%), Gaps = 1/140 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPI  385
            PGL+YDM   DY+  LC+ GY+  +IS + GQ T C +   S+LDVN PS+TIP+LK  +
Sbjct  563  PGLIYDMGPKDYIIYLCSAGYNDSSISQLVGQVTVCSNPKPSVLDVNLPSLTIPNLKEEV  622

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
             LTRTVTNVGP NS YKV+VEPP G+ VVV P  L F+   K +SF V +ST H  NTGF
Sbjct  623  NLTRTVTNVGPVNSVYKVVVEPPLGVQVVVTPKKLVFNSKTKSLSFMVRVSTIHKINTGF  682

Query  204  YFGSLIWNDGVHNVRIPISV  145
            YFGSLIW D VHNV IP+ +
Sbjct  683  YFGSLIWRDSVHNVTIPVHI  702


 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 93/143 (65%), Gaps = 14/143 (10%)
 Frame = -1

Query  564   KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGFSILDVNFPSITIPDLKRPI  385
             +PGL+YDM   DY+  LC++                  +  S+LD+N PSITIP+LK  +
Sbjct  1287  EPGLIYDMGPKDYILYLCSV--------------VCTDQKPSVLDMNLPSITIPNLKDEV  1332

Query  384   TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
              LTRTVTNVGP +S YKV+VEPP G+ VVV P  L F+   K +SF V +ST H  NTG+
Sbjct  1333  ILTRTVTNVGPVHSVYKVVVEPPLGVRVVVTPKKLVFNSKTKSVSFTVRVSTTHKINTGY  1392

Query  204   YFGSLIWNDGVHNVRIPISVKTK  136
             YFGSLIW+D V  V IP+SV+T+
Sbjct  1393  YFGSLIWSDSVRKVTIPVSVRTQ  1415



>ref|NP_567358.1| Subtilase family protein [Arabidopsis thaliana]
 emb|CAB40044.1| putative subtilisin-like protease [Arabidopsis thaliana]
 emb|CAB78174.1| putative subtilisin-like protease [Arabidopsis thaliana]
 gb|AEE82892.1| Subtilase family protein [Arabidopsis thaliana]
Length=765

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 103/144 (72%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            KPGLVYD+   DYV  +C++GY+  +IS + G+ T C +   S+LD N PSITIP+LK  
Sbjct  613  KPGLVYDLGLEDYVLYMCSVGYNETSISQLVGKGTVCSYPKPSVLDFNLPSITIPNLKEE  672

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +TL RT+TNVGP  S Y+V VEPP G  V V P TL F+   K++SF V++ST H  NTG
Sbjct  673  VTLPRTLTNVGPLESVYRVAVEPPLGTQVTVTPETLVFNSTTKRVSFKVSVSTTHKINTG  732

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            +YFGSL W+D +HNV IP+SV+T+
Sbjct  733  YYFGSLTWSDSLHNVTIPLSVRTQ  756



>ref|XP_006287119.1| hypothetical protein CARUB_v10000289mg, partial [Capsella rubella]
 gb|EOA20017.1| hypothetical protein CARUB_v10000289mg, partial [Capsella rubella]
Length=758

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 105/144 (73%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            +PGL+YDM+  DYV  LC+  Y+  +IS + G+TT C +   S+LD+N PSITIP+LK  
Sbjct  610  RPGLIYDMTIDDYVLYLCSTDYNDTSISQVLGKTTICPNPKPSVLDLNLPSITIPNLKDE  669

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +TLTRTVTNVGP NS YKV+++PP G+ ++V P  L F+   KK+SF V +ST H  N G
Sbjct  670  VTLTRTVTNVGPPNSIYKVVIDPPMGVNMIVTPKWLVFNSMTKKVSFKVRVSTTHKVNNG  729

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            +YFGSL W D VHNV IP+SV+T+
Sbjct  730  YYFGSLTWTDKVHNVVIPVSVRTQ  753



>gb|AAD03438.1| similar to the subtilase family of serine proteases (Pfam: PF00082, 
Score=49.7, E=9.2e-13, n=3) [Arabidopsis thaliana]
Length=774

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 103/144 (72%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            KPGLVYD+   DYV  +C++GY+  +IS + G+ T C +   S+LD N PSITIP+LK  
Sbjct  622  KPGLVYDLGLEDYVLYMCSVGYNETSISQLVGKGTVCSYPKPSVLDFNLPSITIPNLKEE  681

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +TL RT+TNVGP  S Y+V VEPP G  V V P TL F+   K++SF V++ST H  NTG
Sbjct  682  VTLPRTLTNVGPLESVYRVAVEPPLGTQVTVTPETLVFNSTTKRVSFKVSVSTTHKINTG  741

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            +YFGSL W+D +HNV IP+SV+T+
Sbjct  742  YYFGSLTWSDSLHNVTIPLSVRTQ  765



>ref|NP_567360.1| Subtilase family protein [Arabidopsis thaliana]
 gb|AAD03437.1| similar to the subtilase family of serine proteases (Pfam: PF00082, 
Score=50.7, E=4.7e-13, n=3) [Arabidopsis thaliana]
 emb|CAB40046.1| putative subtilisin-like protease [Arabidopsis thaliana]
 emb|CAB78176.1| putative subtilisin-like protease [Arabidopsis thaliana]
 gb|AEE82894.1| Subtilase family protein [Arabidopsis thaliana]
Length=747

 Score =   160 bits (404),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 104/144 (72%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            KPGL+YDM+T DYV  +C++ YS  +IS + G+ T C +   S+LD+N PSITIP+L+  
Sbjct  595  KPGLIYDMTTDDYVMYMCSVDYSDISISRVLGKITVCPNPKPSVLDLNLPSITIPNLRGE  654

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +TLTRTVTNVGP NS YKV+++PP G+ V V P+ L F     K SF V +ST H  NTG
Sbjct  655  VTLTRTVTNVGPVNSVYKVVIDPPTGVNVAVTPTELVFDSTTTKRSFTVRVSTTHKVNTG  714

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            +YFGSL W D +HNV IP+SV+T+
Sbjct  715  YYFGSLTWTDTLHNVAIPVSVRTQ  738



>ref|XP_009137200.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=766

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 105/145 (72%), Gaps = 2/145 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            KPGLVYDM   DY+N +C+ GY+  +IS + G+ T C +   SILD+N PSITIP+L++ 
Sbjct  617  KPGLVYDMGIQDYINYMCSAGYNDSSISGMVGKITKCPNPKPSILDMNLPSITIPNLEKK  676

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKI-SFNVTISTCHGFNT  211
            +TLTRTVTNVGP  S YK ++E P GI + V P+TL FS   K++ +F V   T H  NT
Sbjct  677  VTLTRTVTNVGPIKSVYKAVIESPLGITLTVTPNTLVFSSAAKRVLTFKVKAKTSHKVNT  736

Query  210  GFYFGSLIWNDGVHNVRIPISVKTK  136
            G++FGSL W DGVH+V+IP+SV+TK
Sbjct  737  GYFFGSLTWTDGVHDVKIPVSVQTK  761



>ref|NP_567359.1| Subtilase family protein [Arabidopsis thaliana]
 gb|AAD03440.1| similar to the subtilase family of serine proteases (Pfam: PF00082, 
Score=48.3, E=2.3e-12, n=4) [Arabidopsis thaliana]
 emb|CAB40045.1| putative subtilisin-like protease [Arabidopsis thaliana]
 emb|CAB78175.1| putative subtilisin-like protease [Arabidopsis thaliana]
 gb|AEE82893.1| Subtilase family protein [Arabidopsis thaliana]
Length=756

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 104/144 (72%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            KPGL+YDM+T DYV  +C++ YS  +IS + G+ T C +   S+LD+N PSITIP+L+  
Sbjct  604  KPGLIYDMTTDDYVMYMCSVDYSDISISRVLGKITVCPNPKPSVLDLNLPSITIPNLRGE  663

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +TLTRTVTNVGP NS YKV+++PP GI V V P+ L F     K SF V +ST H  NTG
Sbjct  664  VTLTRTVTNVGPVNSVYKVVIDPPTGINVAVTPAELVFDYTTTKRSFTVRVSTTHKVNTG  723

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            +YFGSL W D +HNV IP+SV+T+
Sbjct  724  YYFGSLTWTDNMHNVAIPVSVRTQ  747



>ref|XP_002874634.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50893.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=781

 Score =   160 bits (405),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 105/144 (73%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            KPGLVYD+   DY   +C++GY+  +IS + G+ T C +   S+LD N PSITIP+LK  
Sbjct  629  KPGLVYDLGLEDYALYMCSVGYNETSISQLVGKGTVCSNPKPSVLDFNLPSITIPNLKEE  688

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +TLT+T+TNVGP  S YKV++EPP G++V V P TL F+   K++SF V +ST H  NTG
Sbjct  689  VTLTKTLTNVGPVESVYKVVIEPPLGVVVTVTPETLVFNSTTKRVSFKVRVSTKHKINTG  748

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            ++FGSL W+D +HNV IP+SV+T+
Sbjct  749  YFFGSLTWSDSLHNVTIPLSVRTQ  772



>ref|XP_006391365.1| hypothetical protein EUTSA_v10018142mg [Eutrema salsugineum]
 gb|ESQ28651.1| hypothetical protein EUTSA_v10018142mg [Eutrema salsugineum]
Length=791

 Score =   160 bits (404),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 100/144 (69%), Gaps = 2/144 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYDM   +YV+ LC+ GY  ++IS + G+  +C     S+LDVN PSITIP L   I
Sbjct  642  PGLVYDMGYNEYVHYLCSAGYDDRSISKLLGKNYTCPSPTPSMLDVNLPSITIPYLSEEI  701

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+TRTVTNVGP  S YK ++EPP+GI V V P TL F  N KKI+F V +ST H  NT +
Sbjct  702  TITRTVTNVGPVGSVYKALIEPPQGINVQVTPETLEFGSNAKKITFKVKVSTTHRTNTDY  761

Query  204  YFGSLIWND-GVHNVRIPISVKTK  136
             FGSL W D G HNVRIP+SV+T+
Sbjct  762  LFGSLTWTDNGAHNVRIPLSVRTR  785



>ref|XP_009105192.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=759

 Score =   159 bits (403),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 101/144 (70%), Gaps = 2/144 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYDM   +YV+ LC+ GY   +IS + G+  +C     S+LDVN PSITIP L + I
Sbjct  610  PGLVYDMGHDEYVHYLCSAGYEDISISKLLGKVYTCPSPTPSMLDVNLPSITIPYLSQEI  669

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+TRTVTNVGP  S YK ++EPP GI + V P TL F PN KKI+F V +ST H  NT +
Sbjct  670  TITRTVTNVGPVGSVYKAVIEPPLGINLQVSPKTLEFGPNTKKITFTVKVSTTHRVNTDY  729

Query  204  YFGSLIWND-GVHNVRIPISVKTK  136
            +FGSL W D G HNVRIP+SV+T+
Sbjct  730  HFGSLTWTDNGAHNVRIPLSVRTR  753



>emb|CDY07491.1| BnaA07g25700D [Brassica napus]
Length=759

 Score =   159 bits (403),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 101/144 (70%), Gaps = 2/144 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYDM   +YV+ LC+ GY   +IS + G+  +C     S+LDVN PSITIP L + I
Sbjct  610  PGLVYDMGHDEYVHYLCSAGYEDISISKLLGKVYTCPSPTPSMLDVNLPSITIPYLSQEI  669

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+TRTVTNVGP  S YK ++EPP GI + V P TL F PN KKI+F V +ST H  NT +
Sbjct  670  TITRTVTNVGPVGSVYKAVIEPPLGINLQVSPKTLEFGPNTKKITFTVKVSTTHRVNTDY  729

Query  204  YFGSLIWND-GVHNVRIPISVKTK  136
            +FGSL W D G HNVRIP+SV+T+
Sbjct  730  HFGSLTWTDNGAHNVRIPLSVRTR  753



>gb|AAD03430.1| similar to the subtilase family of serine proteases (Pfam: PF00082, 
score; 47.5, E=3.8e-12, n=2) [Arabidopsis thaliana]
Length=685

 Score =   159 bits (401),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 104/144 (72%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            KPGLVYD+   DYV  +C++GY+  +IS + G+ T C +   S+LD N PSITIP+LK  
Sbjct  533  KPGLVYDLGLEDYVLYMCSVGYNETSISQLVGKGTVCSNPKPSVLDFNLPSITIPNLKDE  592

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +TLTRT+TNVG   S YKV++EPP GI V V P TL F+   K++SF V +ST H  NTG
Sbjct  593  VTLTRTLTNVGQLESVYKVVIEPPIGIQVTVTPETLLFNSTTKRVSFKVKVSTTHKINTG  652

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            ++FGSL W+D +HNV IP+SV+T+
Sbjct  653  YFFGSLTWSDSLHNVTIPLSVRTQ  676



>emb|CDX79081.1| BnaA01g11480D [Brassica napus]
Length=751

 Score =   159 bits (403),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 104/143 (73%), Gaps = 2/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPI  385
            PGLVYDM   DY++ +C+ GY+  +IS + G+ T+C   G SILD+N PSITIP+L + +
Sbjct  605  PGLVYDMGIKDYISYMCSAGYNDTSISRVLGKKTNCPSPGASILDINLPSITIPNLDQEV  664

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            TLTRT+TNVGP NS YK +++ P GI + V P+TL F    + +S+ VT  T H  NTG+
Sbjct  665  TLTRTLTNVGPNNSVYKAVIKSPLGITLTVSPTTLVFGSG-EVLSYAVTAKTSHKVNTGY  723

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
            +FGSL W DGVH+VRIP+SV+TK
Sbjct  724  FFGSLTWTDGVHDVRIPVSVQTK  746



>ref|XP_010661922.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT3.5 
[Vitis vinifera]
Length=1488

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 106/148 (72%), Gaps = 1/148 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
             PGLVYD+  TD++  LCA+GY++ AIS + GQ+  C  +  SILDVN PSITIP+L+  
Sbjct  632  DPGLVYDVGATDHIYYLCAVGYNNSAISQLTGQSIVCPSERPSILDVNLPSITIPNLRNS  691

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
             TLTRTVTNVG   S Y+V+++PP G+++ V P  L F+   K I+F VT+S+ H  NTG
Sbjct  692  TTLTRTVTNVGAPESIYRVVIQPPIGVVITVNPDVLVFNSMTKSITFKVTVSSTHHVNTG  751

Query  207  FYFGSLIWNDGVHNVRIPISVKTKY*ES  124
            +YFGSL W DGVH VR P+SV+T+  +S
Sbjct  752  YYFGSLTWTDGVHEVRSPLSVRTEIIQS  779


 Score =   157 bits (396),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 104/148 (70%), Gaps = 6/148 (4%)
 Frame = -1

Query  564   KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
             +PGLVYDM T+DY++ LC++GY++ AIS +  Q T C +   SILDVN PSITI +L++ 
Sbjct  1341  EPGLVYDMGTSDYIHYLCSVGYNNSAISQLVEQPTICPNTKASILDVNLPSITISNLRKS  1400

Query  387   ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
              TLTR VTNVGP+NS YK M+EPP GI V V+P  L F+   +     V +ST H  NTG
Sbjct  1401  TTLTRKVTNVGPQNSMYKAMIEPPLGIPVTVRPDILVFNSTXQ-----VEVSTAHQVNTG  1455

Query  207   FYFGSLIWNDGVHNVRIPISVKTKY*ES  124
             +YFGSL W DGVH V  PISV+T+  +S
Sbjct  1456  YYFGSLTWMDGVHTVSSPISVRTQLIQS  1483



>ref|XP_009135013.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=751

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 103/142 (73%), Gaps = 2/142 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPI  385
            PGLVYDM   DY++ +C+ GY+  +IS + G+ T+C   G SILD+N PSITIP+L + +
Sbjct  605  PGLVYDMGIKDYISYMCSAGYNDTSISRVLGKKTNCPSPGASILDINLPSITIPNLDQEV  664

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            TLTRT+TNVGP NS YK ++E P G+ + V P+TL F    + +S+ VT  T H  NTG+
Sbjct  665  TLTRTLTNVGPNNSVYKAVIESPLGVTLTVSPTTLVFGSG-EVLSYAVTAKTSHEVNTGY  723

Query  204  YFGSLIWNDGVHNVRIPISVKT  139
            +FGSL W DGVH+VRIP+SV+T
Sbjct  724  FFGSLTWTDGVHDVRIPVSVQT  745



>ref|XP_002872521.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48780.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=766

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 103/144 (72%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            KPGLVYD+   DYV  +C++GY+  +IS + G+ T C +   S+LD N PSITIP+LK  
Sbjct  614  KPGLVYDLGLEDYVLYMCSIGYNESSISQLVGKGTVCSNPKPSVLDFNLPSITIPNLKEE  673

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +TLTRT+TNVGP +S Y+V VE P GI V V P TL F+   K +SF V +ST H  NTG
Sbjct  674  VTLTRTLTNVGPLDSVYRVAVELPLGIQVTVTPETLVFNSTTKGVSFKVRVSTTHKINTG  733

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            +YFGSL W+D +HNV IP+SV+T+
Sbjct  734  YYFGSLTWSDSLHNVTIPLSVRTQ  757



>ref|XP_010449026.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X2 [Camelina 
sativa]
Length=471

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 102/145 (70%), Gaps = 2/145 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRP  388
            KPGLVYDM   DY+N +C+ GY+  +IS + G+   C     SILD+N PSITIP+L++ 
Sbjct  322  KPGLVYDMGIKDYINYMCSAGYNDSSISRVLGKKNKCPTPEPSILDINLPSITIPNLEKE  381

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKI-SFNVTISTCHGFNT  211
            +TL RTVTNVGP  S YK ++E P GI + VKP+TL F+    ++ +F+V   T H  N+
Sbjct  382  VTLKRTVTNVGPIKSVYKAVIESPLGITLTVKPTTLVFNSAANRVLTFSVQAKTSHKVNS  441

Query  210  GFYFGSLIWNDGVHNVRIPISVKTK  136
            G++FGSL W DGVHNV IP+SVKTK
Sbjct  442  GYFFGSLTWTDGVHNVTIPVSVKTK  466



>ref|XP_008239249.1| PREDICTED: subtilisin-like protease [Prunus mume]
 ref|XP_008239250.1| PREDICTED: subtilisin-like protease [Prunus mume]
 ref|XP_008239251.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=772

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 100/144 (69%), Gaps = 1/144 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRPI  385
            PGLVYD+    Y+  LC+ GY++ AIS + GQ T C  K  SILD+N PSITIP LK PI
Sbjct  621  PGLVYDIGKAGYMQYLCSRGYNNSAISRLVGQNTKCPIKKPSILDMNLPSITIPSLKNPI  680

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+ R+VTNVG   S Y+  +E P G IV V P+ L F+  V+K+ F +TIS  H  NTG+
Sbjct  681  TIKRSVTNVGAPESIYRATIETPFGTIVSVNPNALVFNSTVRKLDFTITISAIHRMNTGY  740

Query  204  YFGSLIWNDGVHNVRIPISVKTKY  133
            YFGSL W DGVH VRIP+SV+T++
Sbjct  741  YFGSLSWADGVHVVRIPLSVRTEF  764



>ref|XP_002867838.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44097.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=658

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 105/145 (72%), Gaps = 2/145 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRP  388
            KPGLVYDM   DY+N +C+ GY+  +IS + G+ T C     S+LD+N PSITIP+L++ 
Sbjct  509  KPGLVYDMGINDYINYMCSAGYNDSSISRVLGKKTKCPIPEPSMLDINLPSITIPNLEKE  568

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKK-ISFNVTISTCHGFNT  211
            +TLTRTVTNVGP  S YK +++PP GI + V P+TL F+   K+ ++F+V   T H  N+
Sbjct  569  VTLTRTVTNVGPIKSVYKAVIKPPLGITLTVNPTTLVFNSAAKRSLTFSVKAKTSHKVNS  628

Query  210  GFYFGSLIWNDGVHNVRIPISVKTK  136
            G++FGSL W DGVH+V IP+SVKT+
Sbjct  629  GYFFGSLTWTDGVHDVTIPVSVKTE  653



>ref|XP_007210025.1| hypothetical protein PRUPE_ppa018629mg [Prunus persica]
 gb|EMJ11224.1| hypothetical protein PRUPE_ppa018629mg [Prunus persica]
Length=773

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 101/144 (70%), Gaps = 1/144 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRPI  385
            PGLVYD+    Y+  LC+ GY++ AIS + GQ T C  K  SILD+N PSITIP LK PI
Sbjct  621  PGLVYDIGKAGYMQYLCSRGYNNSAISRLVGQNTKCPIKKPSILDMNLPSITIPSLKNPI  680

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+ R+VTNVG   S Y+  +E P G IV V P+ L F+  V+K+ F +TIST H  NTG+
Sbjct  681  TIKRSVTNVGAPESIYRATIETPFGTIVSVNPNALVFNSTVRKLDFTITISTIHRMNTGY  740

Query  204  YFGSLIWNDGVHNVRIPISVKTKY  133
            YFGSL W DGVH V+IP+SV+T++
Sbjct  741  YFGSLSWADGVHVVKIPLSVRTEF  764



>ref|NP_567361.1| Subtilase family protein [Arabidopsis thaliana]
 emb|CAB40047.1| putative subtilisin-like protease [Arabidopsis thaliana]
 emb|CAB78177.1| putative subtilisin-like protease [Arabidopsis thaliana]
 gb|AEE82895.1| Subtilase family protein [Arabidopsis thaliana]
Length=775

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 104/144 (72%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            KPGLVYD+   DYV  +C++GY+  +IS + G+ T C +   S+LD N PSITIP+LK  
Sbjct  623  KPGLVYDLGLEDYVLYMCSVGYNETSISQLVGKGTVCSNPKPSVLDFNLPSITIPNLKDE  682

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +TLTRT+TNVG   S YKV++EPP GI V V P TL F+   K++SF V +ST H  NTG
Sbjct  683  VTLTRTLTNVGQLESVYKVVIEPPIGIQVTVTPETLLFNSTTKRVSFKVKVSTTHKINTG  742

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            ++FGSL W+D +HNV IP+SV+T+
Sbjct  743  YFFGSLTWSDSLHNVTIPLSVRTQ  766



>ref|XP_011038011.1| PREDICTED: subtilisin-like protease SBT3.5 [Populus euphratica]
Length=781

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 103/148 (70%), Gaps = 1/148 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            +PGLVYDM T DY++ LCA+GY+  +IS++ G+ T+C     SILDVN PSITIP+L + 
Sbjct  629  EPGLVYDMGTNDYIHYLCAVGYNDSSISLVVGKVTTCPGTKPSILDVNLPSITIPNLSKS  688

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            + LTRTV NVG  NS YK ++ PP GI V V+P TL F+    ++SF VT +T H  NT 
Sbjct  689  VVLTRTVKNVGSVNSMYKSLIVPPIGISVSVRPQTLIFNSTTNRVSFKVTFTTTHKVNTR  748

Query  207  FYFGSLIWNDGVHNVRIPISVKTKY*ES  124
            FYFGSL W DG H V  PISV+T+  +S
Sbjct  749  FYFGSLTWTDGFHAVTSPISVRTQIIQS  776



>ref|XP_010436981.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X2 [Camelina 
sativa]
Length=667

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 105/148 (71%), Gaps = 2/148 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCA-MGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKR  391
            +PGL+YDM+  DYV+ LC+   Y+  +IS + G  T C +   S+LD+N PSITIP+LK 
Sbjct  514  RPGLIYDMTIDDYVSYLCSTYNYNDASISQVLGNKTVCPNPKPSVLDLNLPSITIPNLKD  573

Query  390  PITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNT  211
             +TLTRTVTNVGP NS YKVM++PP GI + V P TL F+   K +SF V +ST H  NT
Sbjct  574  EVTLTRTVTNVGPLNSIYKVMIDPPIGISMTVTPHTLQFNSTTKIVSFKVRVSTRHKVNT  633

Query  210  GFYFGSLIWNDGVHNVRIPISVKTKY*E  127
            G+YFGSL W D +HNV IP+SV+T+  E
Sbjct  634  GYYFGSLTWTDNLHNVVIPVSVRTQILE  661



>ref|XP_010104913.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC02149.1| Subtilisin-like protease [Morus notabilis]
Length=803

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 103/144 (72%), Gaps = 2/144 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKR-P  388
            PGLVYDM T+DY + LCAM Y++ AIS + G  T C  +  S+LDVN PSITIP ++  P
Sbjct  651  PGLVYDMGTSDYAHYLCAMHYNNSAISHLIGNLTKCPLQKPSVLDVNLPSITIPSIRTTP  710

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            I +TRTVTNVG  NS Y+  +EPP G++V VKP  L F+  ++KISF VTIST H  NT 
Sbjct  711  IVVTRTVTNVGSPNSIYEATIEPPSGVLVSVKPEFLVFNSTIEKISFQVTISTTHQMNTD  770

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            + FGSL W D VH VRIP+SV+T+
Sbjct  771  YLFGSLTWTDKVHIVRIPLSVRTE  794



>ref|XP_006397047.1| hypothetical protein EUTSA_v10028468mg [Eutrema salsugineum]
 gb|ESQ38500.1| hypothetical protein EUTSA_v10028468mg [Eutrema salsugineum]
Length=723

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 100/144 (69%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRP  388
            KPGLVYD+   DY+  +C++GY+  AIS +A + T C     S+LD N PSITIP+LK  
Sbjct  571  KPGLVYDLGLEDYILYMCSVGYNESAISQLASKKTLCSNPRPSVLDFNLPSITIPNLKDE  630

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
             TLTR +TNVGP +S YKV VE P G+ V V P  L F+   K++SF V +ST H  NTG
Sbjct  631  ATLTRILTNVGPLDSVYKVAVEAPLGVQVTVTPEKLVFNSTTKRVSFKVKVSTTHKINTG  690

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            +YFGSL W+D VHNV IP+SV+T+
Sbjct  691  YYFGSLTWSDSVHNVTIPLSVRTQ  714



>emb|CDX82843.1| BnaC01g12930D [Brassica napus]
Length=766

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 103/142 (73%), Gaps = 2/142 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPI  385
            PGLVYDM   DY++ +C+ GY+  +IS + G+ T+C   G SILD+N PSITIP+L + +
Sbjct  620  PGLVYDMGIKDYISYMCSAGYNDTSISRVLGKKTNCPSPGASILDINVPSITIPNLDQEV  679

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            TLTRT+TNVGP NS YK ++E P G+ + V P+TL F    + +S+ VT  T H  NTG+
Sbjct  680  TLTRTLTNVGPNNSVYKAVIESPLGVTLTVSPTTLVFDSG-EVLSYAVTAKTSHKVNTGY  738

Query  204  YFGSLIWNDGVHNVRIPISVKT  139
            +FGSL W DGVH+VRIP+SV+T
Sbjct  739  FFGSLTWTDGVHDVRIPVSVQT  760



>ref|XP_002874635.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50894.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=774

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 101/143 (71%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPI  385
            PGLVYD+   DY+  LC++GY+  +IS + G+ T C +   SILD N PSITIP+LK  +
Sbjct  623  PGLVYDLGLEDYILYLCSVGYNETSISQLVGKRTVCSNPKPSILDFNLPSITIPNLKDEV  682

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            TLTRT+TNVG   S YKV VEPP G  V V P TL F+   K++SF V +ST H  NTGF
Sbjct  683  TLTRTLTNVGLLKSVYKVAVEPPLGFKVTVTPETLVFNTRTKRVSFKVKVSTKHKINTGF  742

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
            YFGSL W+D +HNV IP+SV+T+
Sbjct  743  YFGSLTWSDSMHNVTIPLSVRTQ  765



>ref|XP_010554964.1| PREDICTED: subtilisin-like protease SBT3.3 [Tarenaya hassleriana]
Length=762

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 100/143 (70%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPI  385
            PGLVYDM   DYV+ LC+ GY  KAIS + G+  +C +   S+LDVN PSIT+PDL+  +
Sbjct  614  PGLVYDMGYEDYVHYLCSAGYDDKAISGLLGKAHTCPNPKPSMLDVNLPSITVPDLREDV  673

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
             +TRTVTNVGP +S YK ++E P GI + V P +L F+   KK++F V +S+ H  NT F
Sbjct  674  VITRTVTNVGPADSVYKAVIESPSGINLEVNPQSLVFNSATKKVTFKVKVSSTHKVNTEF  733

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
            YFGSL W DG  NV IP+SV+TK
Sbjct  734  YFGSLTWTDGTTNVTIPLSVRTK  756



>ref|XP_010436973.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X1 [Camelina 
sativa]
Length=758

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 105/148 (71%), Gaps = 2/148 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCA-MGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKR  391
            +PGL+YDM+  DYV+ LC+   Y+  +IS + G  T C +   S+LD+N PSITIP+LK 
Sbjct  605  RPGLIYDMTIDDYVSYLCSTYNYNDASISQVLGNKTVCPNPKPSVLDLNLPSITIPNLKD  664

Query  390  PITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNT  211
             +TLTRTVTNVGP NS YKVM++PP GI + V P TL F+   K +SF V +ST H  NT
Sbjct  665  EVTLTRTVTNVGPLNSIYKVMIDPPIGISMTVTPHTLQFNSTTKIVSFKVRVSTRHKVNT  724

Query  210  GFYFGSLIWNDGVHNVRIPISVKTKY*E  127
            G+YFGSL W D +HNV IP+SV+T+  E
Sbjct  725  GYYFGSLTWTDNLHNVVIPVSVRTQILE  752



>emb|CDY65868.1| BnaAnng21170D, partial [Brassica napus]
Length=672

 Score =   156 bits (395),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 100/143 (70%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYD    DY+  LCA  Y   +I+ I+ QT  C     S+LD+N PSITIP LK  +
Sbjct  523  PGLVYDADVQDYIRFLCASSYDEMSITKISKQTVKCPSPRPSMLDLNLPSITIPFLKEDV  582

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            TLTRTVTNVGP NS YK++V+PP G+ + V P TL F+  VKK+S+ VT+ST H  N+ +
Sbjct  583  TLTRTVTNVGPVNSVYKLIVQPPMGVKISVTPQTLVFNSGVKKLSYQVTVSTTHKANSIY  642

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
            +FGSL W DG HNV IP+S++T+
Sbjct  643  FFGSLTWTDGTHNVVIPLSIRTQ  665



>gb|KHN39834.1| Cucumisin, partial [Glycine soja]
Length=753

 Score =   157 bits (396),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 101/142 (71%), Gaps = 1/142 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGFS-ILDVNFPSITIPDLKRPI  385
            PGLVYDM  +DY+  LC+MGY++ AISI+ G  T CHK    +L++N PSITIP+LK+P+
Sbjct  603  PGLVYDMKNSDYIRFLCSMGYNNTAISILTGFPTKCHKSHKFLLNMNLPSITIPELKQPL  662

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T++RTVTNVGP  S Y   V  P GI V+V+PSTL FS   KK+ F VT S+     + F
Sbjct  663  TVSRTVTNVGPVKSNYTARVVAPIGISVIVEPSTLAFSSKRKKMKFKVTFSSKLRVQSRF  722

Query  204  YFGSLIWNDGVHNVRIPISVKT  139
             FG L+W DG+H VRIP++V++
Sbjct  723  SFGYLLWEDGLHEVRIPLAVRS  744



>ref|XP_010437025.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=778

 Score =   157 bits (397),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 100/144 (69%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRP  388
            KPGLVYD+   DYV  +C++GY+  +IS + G+ T C     S+LD N PSITIP+LK  
Sbjct  626  KPGLVYDLGLEDYVLYMCSVGYNETSISQLVGKGTVCSIPKPSVLDFNLPSITIPNLKDE  685

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +TLT+T TNVGP  S Y V VEPP GI V V P TL F+   K+ SF V +ST H  NTG
Sbjct  686  VTLTKTFTNVGPLESVYNVTVEPPLGIQVTVTPETLVFNSTTKRASFKVRVSTTHKINTG  745

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            +YFGSL W+D +HNV IP+SV+T+
Sbjct  746  YYFGSLTWSDSLHNVTIPLSVRTQ  769



>ref|XP_003537841.1| PREDICTED: cucumisin-like [Glycine max]
Length=782

 Score =   157 bits (397),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 101/142 (71%), Gaps = 1/142 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGFS-ILDVNFPSITIPDLKRPI  385
            PGLVYDM  +DY+  LC+MGY++ AISI+ G  T CHK    +L++N PSITIP+LK+P+
Sbjct  632  PGLVYDMKNSDYIRFLCSMGYNNTAISILTGFPTKCHKSHKFLLNMNLPSITIPELKQPL  691

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T++RTVTNVGP  S Y   V  P GI V+V+PSTL FS   KK+ F VT S+     + F
Sbjct  692  TVSRTVTNVGPVKSNYTARVVAPIGISVIVEPSTLAFSSKRKKMKFKVTFSSKLRVQSRF  751

Query  204  YFGSLIWNDGVHNVRIPISVKT  139
             FG L+W DG+H VRIP++V++
Sbjct  752  SFGYLLWEDGLHEVRIPLAVRS  773



>ref|XP_010434151.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=374

 Score =   153 bits (386),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 100/145 (69%), Gaps = 2/145 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            KPGLVYDM   DY++ +C+ GY+  +IS + G    C     SILD+N PSITIP+ ++ 
Sbjct  227  KPGLVYDMGIEDYISYMCSAGYNDSSISRVLGNKNKCPTPDPSILDINLPSITIPNFEKE  286

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKI-SFNVTISTCHGFNT  211
            +TLTRTVTNVGP  S YK ++E P GI + V P+TL F+    ++ +F+V   T H  NT
Sbjct  287  VTLTRTVTNVGPIKSVYKAVIESPLGITLTVNPTTLVFNSAANRVLTFSVKAKTSHKVNT  346

Query  210  GFYFGSLIWNDGVHNVRIPISVKTK  136
            G++FGSL W DGVHNV IP+SVKTK
Sbjct  347  GYFFGSLTWTDGVHNVTIPVSVKTK  371



>ref|XP_002298973.2| subtilase family protein [Populus trichocarpa]
 gb|EEE83778.2| subtilase family protein [Populus trichocarpa]
Length=786

 Score =   157 bits (396),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 107/143 (75%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPI  385
            PGLVYDM T DYVN LCAM Y++ AIS + G+ T C  +G SIL++N PSITIP+L+  +
Sbjct  635  PGLVYDMGTDDYVNYLCAMDYNNTAISRLTGKPTVCPTEGPSILNINLPSITIPNLRNSV  694

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            TLTRTVTNVG  NS Y+V++E P    V+V+P  L F+   KKI+F+VT++T +  NTG+
Sbjct  695  TLTRTVTNVGASNSIYRVVIEAPFCCSVLVEPYVLVFNYTTKKITFSVTVNTTYQVNTGY  754

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
            +FGS+ W DGVH VR P+SV+T+
Sbjct  755  FFGSITWIDGVHTVRSPLSVRTE  777



>ref|XP_006301525.1| hypothetical protein CARUB_v10021953mg [Capsella rubella]
 gb|EOA34423.1| hypothetical protein CARUB_v10021953mg [Capsella rubella]
Length=757

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 102/144 (71%), Gaps = 2/144 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYDM   +YV+ LC+ GY   +IS + G+  +C     S+LDVN PSITIP L + I
Sbjct  608  PGLVYDMGHNEYVHYLCSAGYDDISISKLLGKNNTCPSPMPSMLDVNLPSITIPYLSQEI  667

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+TRTVTNVGP  S YK M++ P+GI + V P TL+FS N  KI+F V +ST H  NT +
Sbjct  668  TITRTVTNVGPAGSVYKAMIQAPQGINLQVSPETLDFSSNTNKITFTVKVSTTHRSNTDY  727

Query  204  YFGSLIW-NDGVHNVRIPISVKTK  136
            +FGSL W ++G HNVRIPISV+T+
Sbjct  728  HFGSLTWIDNGGHNVRIPISVRTR  751



>ref|XP_010449025.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X1 [Camelina 
sativa]
Length=775

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 102/145 (70%), Gaps = 2/145 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRP  388
            KPGLVYDM   DY+N +C+ GY+  +IS + G+   C     SILD+N PSITIP+L++ 
Sbjct  626  KPGLVYDMGIKDYINYMCSAGYNDSSISRVLGKKNKCPTPEPSILDINLPSITIPNLEKE  685

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKI-SFNVTISTCHGFNT  211
            +TL RTVTNVGP  S YK ++E P GI + VKP+TL F+    ++ +F+V   T H  N+
Sbjct  686  VTLKRTVTNVGPIKSVYKAVIESPLGITLTVKPTTLVFNSAANRVLTFSVQAKTSHKVNS  745

Query  210  GFYFGSLIWNDGVHNVRIPISVKTK  136
            G++FGSL W DGVHNV IP+SVKTK
Sbjct  746  GYFFGSLTWTDGVHNVTIPVSVKTK  770



>ref|XP_006286458.1| hypothetical protein CARUB_v10000288mg [Capsella rubella]
 gb|EOA19356.1| hypothetical protein CARUB_v10000288mg [Capsella rubella]
Length=759

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 103/145 (71%), Gaps = 2/145 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLC-AMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKR  391
            +PGLVYDM+  DY++ LC A  ++  +IS + G   +C +   S+LD+N PSITIPDLK 
Sbjct  606  RPGLVYDMTIDDYISYLCSAYNFNDGSISQVLGNKKTCPNPKQSVLDLNLPSITIPDLKD  665

Query  390  PITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNT  211
             +TLTRTVTNVGP NS YKVM++ P G+ + V P+TL F+    K+SF V  ST H  NT
Sbjct  666  EVTLTRTVTNVGPFNSIYKVMIDAPLGVNMTVTPNTLEFNAMTTKVSFKVRFSTTHKVNT  725

Query  210  GFYFGSLIWNDGVHNVRIPISVKTK  136
            G+YFGSL W D VHNV IP+SV+T+
Sbjct  726  GYYFGSLTWTDNVHNVVIPVSVRTQ  750



>ref|XP_009125836.1| PREDICTED: subtilisin-like protease SBT5.4 [Brassica rapa]
Length=760

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 101/143 (71%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYD    DY+  LCA  Y   +I+ I+ QT  C     S+LD+N PSITIP LK  +
Sbjct  611  PGLVYDADVQDYIRFLCASSYDEMSITKISKQTVKCPSPRPSMLDLNLPSITIPFLKEDV  670

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            TLTRTVTNVGP +S YK++V+PP G+ + V P TL F+  VKK+S+ VT+ST H  N+ +
Sbjct  671  TLTRTVTNVGPVDSVYKLIVQPPMGVKISVTPQTLVFNSGVKKLSYQVTVSTTHKANSIY  730

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
            +FGSL W DG+HNV IP+S++T+
Sbjct  731  FFGSLTWTDGIHNVVIPLSIRTQ  753



>ref|XP_006377885.1| hypothetical protein POPTR_0011s15430g [Populus trichocarpa]
 gb|ERP55682.1| hypothetical protein POPTR_0011s15430g [Populus trichocarpa]
Length=587

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 99/135 (73%), Gaps = 1/135 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            +PGLV+DM T DY++ LCA+GY++ +IS++ G+ T+C     SILD+N PSITIP+L  P
Sbjct  431  EPGLVFDMGTNDYIHYLCAVGYNNSSISLVVGKVTTCPSTKPSILDLNLPSITIPNLSMP  490

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            + LTRTV NVGP NS YK +++PP GI + V+P  L F+  +K  SF VT+ST H  NTG
Sbjct  491  VVLTRTVKNVGPVNSIYKSLIDPPFGISISVRPKYLAFNSTIKATSFKVTVSTNHRVNTG  550

Query  207  FYFGSLIWNDGVHNV  163
            ++FGSL W DGVH V
Sbjct  551  YFFGSLTWTDGVHAV  565



>emb|CDX94043.1| BnaC07g36770D [Brassica napus]
Length=773

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 103/144 (72%), Gaps = 2/144 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPI  385
            PGLVYDM   DY+N +C+ GY+  +IS + G+ T C     SILD+N PSITIP++++ +
Sbjct  625  PGLVYDMGIEDYINYMCSKGYNDSSISRVLGKKTKCPTPKPSILDMNLPSITIPNIEKEV  684

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKI-SFNVTISTCHGFNTG  208
            TLTR+VTNVGP  S YK ++E P GI + V P+TL FS   KK+ SF V   T H  NTG
Sbjct  685  TLTRSVTNVGPIKSVYKAVIESPLGITLTVNPTTLVFSSEDKKVLSFTVKAKTSHKVNTG  744

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            ++FGSL W DGVH+V+IP+SV+T+
Sbjct  745  YFFGSLTWTDGVHDVKIPVSVQTR  768



>ref|XP_009114845.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=772

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 102/144 (71%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            +PGL+YDM   DY+  LC++GY+  +IS + G+ T C     S+LD+N PSITIP+LK  
Sbjct  620  EPGLIYDMGPKDYILYLCSVGYNDSSISQLVGKGTVCTDPKPSVLDMNLPSITIPNLKDE  679

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            + LTRTVTNVGP +S YKV VEPP G+ VVV P  L F+   K +SF V +ST H  NTG
Sbjct  680  VILTRTVTNVGPVHSVYKVGVEPPLGVRVVVTPKKLVFNSKTKSVSFTVRVSTTHKINTG  739

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            +YFGSL+W+D V  V IP+SV+T+
Sbjct  740  YYFGSLVWSDSVRKVTIPVSVRTQ  763



>ref|XP_010434150.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=257

 Score =   149 bits (376),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 103/146 (71%), Gaps = 3/146 (2%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSI-TIPDLKR  391
            KP LVYDM   DY++ +CA+GY+  +IS + G+   C     S+LD+N PSI TIP+L++
Sbjct  107  KPELVYDMEIEDYISYMCAVGYNDSSISRVLGKKNKCPTPEPSVLDINLPSIVTIPNLEK  166

Query  390  PITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKI-SFNVTISTCHGFN  214
             +TLT+TVTNVGP  S YK ++E P GI + VKP+TL F+    ++ +F+V   T H  N
Sbjct  167  EVTLTKTVTNVGPIKSVYKAVIESPLGITLTVKPTTLVFNSAANRVLTFSVKAKTSHKVN  226

Query  213  TGFYFGSLIWNDGVHNVRIPISVKTK  136
            TG++FGSL W DGVHNV IP+SVKTK
Sbjct  227  TGYFFGSLTWTDGVHNVTIPVSVKTK  252



>ref|XP_007039203.1| Subtilase family protein, putative [Theobroma cacao]
 gb|EOY23704.1| Subtilase family protein, putative [Theobroma cacao]
Length=776

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 96/147 (65%), Gaps = 1/147 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPI  385
            PGLVYDM+T DY   LCAMGY+  AI  +      C  K  S+LDVN PSITIP L++P 
Sbjct  628  PGLVYDMNTEDYGQYLCAMGYNDSAIFQLTQHPIVCPSKQPSVLDVNLPSITIPSLRKPT  687

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
             LTRTVTNVGP NS YK  VE   GI + V+P  L FS   K I+F V IS+ H  N G+
Sbjct  688  ILTRTVTNVGPVNSKYKANVEFASGINIAVRPEILIFSSKTKTITFTVMISSAHNVNAGY  747

Query  204  YFGSLIWNDGVHNVRIPISVKTKY*ES  124
            YFGSL W DG H VR PISV+T+  ES
Sbjct  748  YFGSLTWTDGGHVVRSPISVRTEVGES  774



>ref|XP_009137202.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=771

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 103/144 (72%), Gaps = 2/144 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPI  385
            PGLVYDM   DY+N +C+ GY+  +IS + G+ T C     SILD+N PSITIP++++ +
Sbjct  623  PGLVYDMGIEDYINYMCSKGYNDSSISRVIGKKTKCPTPKPSILDMNLPSITIPNIEKEV  682

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKI-SFNVTISTCHGFNTG  208
            TLTR+VTNVGP  S YK ++E P GI + V P+TL FS   KK+ SF V   T H  NTG
Sbjct  683  TLTRSVTNVGPIKSIYKAVIESPLGITLTVNPTTLVFSSEDKKVLSFTVKAKTSHKVNTG  742

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            ++FGSL W DGVH+V+IP+SV+T+
Sbjct  743  YFFGSLTWTDGVHDVKIPVSVQTR  766



>gb|KFK41050.1| hypothetical protein AALP_AA2G078900 [Arabis alpina]
Length=757

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 97/144 (67%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            +PGLVYDM   DYV+ LC+  Y   +IS + GQ   C     S+LD N PSITIP L   
Sbjct  608  EPGLVYDMGIDDYVHYLCSADYDDASISKLLGQAYKCPWPKPSMLDFNMPSITIPSLTGE  667

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +TLTRTVTNVGP  S Y+ +VEPP GI + V P+TL F  N  KI+F+V + T H  N+ 
Sbjct  668  VTLTRTVTNVGPSGSVYRPIVEPPSGIELEVNPNTLIFGSNTTKITFSVRVRTNHKVNSD  727

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            FYFGSL W DGVHNV IP+SV+TK
Sbjct  728  FYFGSLCWTDGVHNVTIPVSVRTK  751



>ref|XP_010461117.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT3.3 
[Camelina sativa]
Length=755

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 102/144 (71%), Gaps = 2/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            +PGL+YDM + DY   LC+ GY+  +IS + G+ T C +   S+LDVN PSITIP+LK  
Sbjct  604  EPGLIYDMGSEDYKLYLCSAGYNDSSISQLVGEVTVCSNPKPSVLDVNLPSITIPNLKDE  663

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +TLTRTVTNVGP +S YKV+VEPP G+IVVV P  L F+   K +SF V +ST H  NTG
Sbjct  664  VTLTRTVTNVGPVDSVYKVVVEPPLGVIVVVTPEILVFNSKFKSVSFTVRVSTTHKINTG  723

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
             Y  SL W D VHNV IP+SV+T+
Sbjct  724  -YXSSLTWTDSVHNVIIPVSVRTQ  746



>ref|XP_010461118.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=771

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 102/144 (71%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            KPGLVYDM   DYV  LC++GY+  +I+ +  + T C +   S+LD+N PSITIP+L + 
Sbjct  619  KPGLVYDMGVNDYVLYLCSVGYTDSSITRLVRKKTVCGNPKPSVLDLNLPSITIPNLAKE  678

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +T+TRTVTNVGP  S YK ++E P G+ V V PSTL F+   +K+SF V + T H  NTG
Sbjct  679  VTITRTVTNVGPVGSVYKAVIEAPMGVNVTVTPSTLVFNAKTRKLSFKVRVVTNHRVNTG  738

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            +YFGSL W D VHNV IP+SV+T+
Sbjct  739  YYFGSLTWTDSVHNVVIPLSVRTQ  762



>emb|CBI23066.3| unnamed protein product [Vitis vinifera]
Length=699

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 99/147 (67%), Gaps = 1/147 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKG-FSILDVNFPSITIPDLKRPI  385
            PGLVYDM T DY++ LC +GY++ AI     Q+  C  G  SILD+N PSITIP L+   
Sbjct  548  PGLVYDMGTADYIHYLCTLGYNNSAIFQFTEQSIRCPTGEHSILDLNLPSITIPSLQNST  607

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            +LTR VTNVG  NSTYK  +  P GI + VKP TL F   +K ++F+VT+S+ H  NTG+
Sbjct  608  SLTRNVTNVGAVNSTYKASIISPAGITITVKPDTLIFDSTIKTVTFSVTVSSIHQVNTGY  667

Query  204  YFGSLIWNDGVHNVRIPISVKTKY*ES  124
             FGSL W DGVH VR PISV+T   ES
Sbjct  668  SFGSLTWIDGVHAVRSPISVRTMIEES  694



>ref|XP_002273195.2| PREDICTED: subtilisin-like protease SBT3.5 [Vitis vinifera]
Length=776

 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 99/147 (67%), Gaps = 1/147 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKG-FSILDVNFPSITIPDLKRPI  385
            PGLVYDM T DY++ LC +GY++ AI     Q+  C  G  SILD+N PSITIP L+   
Sbjct  625  PGLVYDMGTADYIHYLCTLGYNNSAIFQFTEQSIRCPTGEHSILDLNLPSITIPSLQNST  684

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            +LTR VTNVG  NSTYK  +  P GI + VKP TL F   +K ++F+VT+S+ H  NTG+
Sbjct  685  SLTRNVTNVGAVNSTYKASIISPAGITITVKPDTLIFDSTIKTVTFSVTVSSIHQVNTGY  744

Query  204  YFGSLIWNDGVHNVRIPISVKTKY*ES  124
             FGSL W DGVH VR PISV+T   ES
Sbjct  745  SFGSLTWIDGVHAVRSPISVRTMIEES  771



>ref|XP_010513580.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=730

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 96/143 (67%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGL+YDM   DYV+ LC+  Y   AIS + G+   C     S+LD N PSI IP L R +
Sbjct  582  PGLIYDMGINDYVHYLCSAEYDDGAISKLVGKPIKCPSPLPSMLDFNMPSIIIPSLTREV  641

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            TLTRTVTNVGP +S YK +VE P GI + V P TL F+ N+ K +FNV + T H  N+ +
Sbjct  642  TLTRTVTNVGPADSVYKPLVESPLGIELDVNPKTLVFASNITKSTFNVRVKTSHRVNSDY  701

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
            YFGSL W DGVHNV IP++V+TK
Sbjct  702  YFGSLCWTDGVHNVTIPVAVRTK  724



>gb|KFK31853.1| hypothetical protein AALP_AA6G166900 [Arabis alpina]
Length=787

 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 100/144 (69%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            KPGLVYD+   DYV  +C+  Y+  +IS + G+ T C +   S+LD N PSITIP+LK  
Sbjct  635  KPGLVYDLGLEDYVLYMCSAAYNESSISQLVGKGTVCSNPKPSVLDFNLPSITIPNLKED  694

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +TLTRT+TNVGP +S YK  VE   G+ V V P TL F+   KK+SF V +ST H  NTG
Sbjct  695  VTLTRTLTNVGPLDSVYKASVELLSGVQVTVTPETLVFNSTTKKVSFKVKVSTTHKINTG  754

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            +YFGSL W+D VHNV IP+SV+T+
Sbjct  755  YYFGSLTWSDSVHNVTIPLSVRTQ  778



>emb|CDY61569.1| BnaCnng38020D [Brassica napus]
Length=1177

 Score =   156 bits (394),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 101/145 (70%), Gaps = 2/145 (1%)
 Frame = -1

Query  561   PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
             PGLVYDM   +YV+ LC+ GY +K+IS + G+  +C     S+LDVN PSITIP L   I
Sbjct  1028  PGLVYDMGYDEYVHYLCSAGYENKSISKLLGKIYTCPSPTPSMLDVNVPSITIPYLNEEI  1087

Query  384   TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
              +TRTVTNVGP  S YK ++E P GI + V P TL F PN KKI+F V +ST H +NT +
Sbjct  1088  IITRTVTNVGPVGSVYKAVIEAPLGIKLQVGPETLEFGPNTKKITFTVKVSTTHRWNTDY  1147

Query  204   YFGSLIWND-GVHNVRIPISVKTKY  133
              FGSL W D G HNVRIP+SV+T++
Sbjct  1148  NFGSLTWTDNGAHNVRIPLSVRTRF  1172



>ref|XP_002893749.1| hypothetical protein ARALYDRAFT_473479 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70008.1| hypothetical protein ARALYDRAFT_473479 [Arabidopsis lyrata subsp. 
lyrata]
Length=717

 Score =   154 bits (388),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 101/144 (70%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            KPGLVYDM   DYV  LC++GY+  +I+ +  + T C +   S+LD+N PSITIP+L + 
Sbjct  565  KPGLVYDMGVNDYVLYLCSVGYTDSSITRLVRKKTVCANPKPSVLDLNLPSITIPNLAKE  624

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +T+TRTVTNVGP  S YK ++E P G+ V V P TL F+   +K+SF V + T H  NTG
Sbjct  625  VTITRTVTNVGPVGSVYKAVIEAPMGVNVTVTPRTLVFNAKTRKLSFKVRVITNHRVNTG  684

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            +YFGSL W D VHNV IP+SV+T+
Sbjct  685  YYFGSLTWTDSVHNVVIPVSVRTQ  708



>ref|XP_006413751.1| hypothetical protein EUTSA_v10024480mg [Eutrema salsugineum]
 gb|ESQ55204.1| hypothetical protein EUTSA_v10024480mg [Eutrema salsugineum]
Length=766

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 101/146 (69%), Gaps = 2/146 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRP  388
            KPGLVYDM    Y++ +C+ GY+  +IS + G+ T C     SILD+N PSITIP+L+  
Sbjct  617  KPGLVYDMGIEGYISYMCSAGYNDSSISRVLGKKTICPTPEPSILDINLPSITIPNLEEE  676

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKI-SFNVTISTCHGFNT  211
            +TLTRTVTNVGP  S YK +VE P GI + V P+TL FS   K++ +F V     H  NT
Sbjct  677  VTLTRTVTNVGPIKSVYKAVVESPLGINLTVSPTTLVFSSATKRVLTFTVKAKRSHKVNT  736

Query  210  GFYFGSLIWNDGVHNVRIPISVKTKY  133
            G++FGSL W DGVHNV IP+SVKTK+
Sbjct  737  GYFFGSLTWTDGVHNVTIPVSVKTKF  762



>emb|CAB36809.1| subtilisin proteinase-like [Arabidopsis thaliana]
 emb|CAB81272.1| subtilisin proteinase-like [Arabidopsis thaliana]
Length=718

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 103/144 (72%), Gaps = 2/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRP  388
            KPGLVYDM   DY+  +C+ GY+  +IS + G+ T+C     S+LD+N PSITIP+L++ 
Sbjct  571  KPGLVYDMGIVDYIKYMCSAGYNDSSISRVLGKKTNCPIPKPSMLDINLPSITIPNLEKE  630

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKI-SFNVTISTCHGFNT  211
            +TLTRTVTNVGP  S Y+ ++E P GI + V P+TL F    K++ +F+V   T H  NT
Sbjct  631  VTLTRTVTNVGPIKSVYRAVIESPLGITLTVNPTTLVFKSAAKRVLTFSVKAKTSHKVNT  690

Query  210  GFYFGSLIWNDGVHNVRIPISVKT  139
            G++FGSL W+DGVH+V IP+SVKT
Sbjct  691  GYFFGSLTWSDGVHDVIIPVSVKT  714



>ref|XP_010445228.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=875

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 101/144 (70%), Gaps = 2/144 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRPI  385
            PGLVYDM   DY++ +C+ GY+  +IS +  + T C     SI D+N PSITIP+L++ +
Sbjct  727  PGLVYDMGIKDYISYMCSAGYNDSSISRVLSKKTKCQIPEPSIFDINLPSITIPNLEKEV  786

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKI-SFNVTISTCHGFNTG  208
            TLTRTVTNVGP  S YK ++E P G+ + VKP+TL F+    ++ +F+V   T H  NTG
Sbjct  787  TLTRTVTNVGPIKSVYKAVIESPLGVTLTVKPTTLVFNSAANRVLTFSVKAKTSHKVNTG  846

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            ++FGSL W DGVHNV IP+SVKTK
Sbjct  847  YFFGSLTWTDGVHNVTIPVSVKTK  870



>gb|AAL24366.1| subtilisin proteinase-like [Arabidopsis thaliana]
 gb|AAM91203.1| subtilisin proteinase-like [Arabidopsis thaliana]
Length=703

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 103/144 (72%), Gaps = 2/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRP  388
            KPGLVYDM   DY+  +C+ GY+  +IS + G+ T+C     S+LD+N PSITIP+L++ 
Sbjct  556  KPGLVYDMGIVDYIKYMCSAGYNDSSISRVLGKKTNCPIPKPSMLDINLPSITIPNLEKE  615

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKI-SFNVTISTCHGFNT  211
            +TLTRTVTNVGP  S Y+ ++E P GI + V P+TL F    K++ +F+V   T H  NT
Sbjct  616  VTLTRTVTNVGPIKSVYRAVIESPLGITLTVNPTTLVFKSAAKRVLTFSVKAKTSHKVNT  675

Query  210  GFYFGSLIWNDGVHNVRIPISVKT  139
            G++FGSL W+DGVH+V IP+SVKT
Sbjct  676  GYFFGSLTWSDGVHDVIIPVSVKT  699



>ref|NP_567632.1| Subtilase family protein [Arabidopsis thaliana]
 emb|CAB36807.1| serine protease-like protein [Arabidopsis thaliana]
 emb|CAB81270.1| serine protease-like protein [Arabidopsis thaliana]
 gb|AEE84483.1| Subtilase family protein [Arabidopsis thaliana]
Length=772

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 102/144 (71%), Gaps = 2/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRP  388
            +PGLVYDM   DY+N +C+ GY   +IS + G+ T C     SILD+N PSITIP+L++ 
Sbjct  625  QPGLVYDMGIKDYINYMCSAGYIDSSISRVLGKKTKCTIPKPSILDINLPSITIPNLEKE  684

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKI-SFNVTISTCHGFNT  211
            +TLTRTVTNVGP  S YK ++E P GI + V P+TL F+   K++ +F+V   T H  N+
Sbjct  685  VTLTRTVTNVGPIKSVYKAVIESPLGITLTVNPTTLVFNSAAKRVLTFSVKAKTSHKVNS  744

Query  210  GFYFGSLIWNDGVHNVRIPISVKT  139
            G++FGSL W DGVH+V IP+SVKT
Sbjct  745  GYFFGSLTWTDGVHDVIIPVSVKT  768



>ref|NP_567633.2| Subtilase family protein [Arabidopsis thaliana]
 gb|AAO00797.1| subtilisin proteinase - like [Arabidopsis thaliana]
 gb|AEE84485.1| Subtilase family protein [Arabidopsis thaliana]
Length=766

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 103/144 (72%), Gaps = 2/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRP  388
            KPGLVYDM   DY+  +C+ GY+  +IS + G+ T+C     S+LD+N PSITIP+L++ 
Sbjct  619  KPGLVYDMGIVDYIKYMCSAGYNDSSISRVLGKKTNCPIPKPSMLDINLPSITIPNLEKE  678

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKI-SFNVTISTCHGFNT  211
            +TLTRTVTNVGP  S Y+ ++E P GI + V P+TL F    K++ +F+V   T H  NT
Sbjct  679  VTLTRTVTNVGPIKSVYRAVIESPLGITLTVNPTTLVFKSAAKRVLTFSVKAKTSHKVNT  738

Query  210  GFYFGSLIWNDGVHNVRIPISVKT  139
            G++FGSL W+DGVH+V IP+SVKT
Sbjct  739  GYFFGSLTWSDGVHDVIIPVSVKT  762



>ref|XP_010421967.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=761

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 101/144 (70%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            KPGL+YDM+T DY+  LC+  YS  +IS + G+ T C +   S+LD+N PSITIP+L+  
Sbjct  609  KPGLIYDMTTDDYILYLCSAEYSDVSISRVLGKATVCPNPKPSVLDLNLPSITIPNLREE  668

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +T  RTVTNVGP  S YKV+++PP G+ V V P+ L F     K+SF V +ST H  NTG
Sbjct  669  VTFKRTVTNVGPLKSIYKVVIDPPTGVNVTVTPTELVFDSTNTKLSFTVRVSTTHKVNTG  728

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            +YFGSL W + +HNV IP+SV+T+
Sbjct  729  YYFGSLTWTNDLHNVVIPVSVRTQ  752



>ref|XP_006306820.1| hypothetical protein CARUB_v10008362mg [Capsella rubella]
 gb|EOA39718.1| hypothetical protein CARUB_v10008362mg [Capsella rubella]
Length=771

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 101/144 (70%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            KPGLVYDM   DYV  LC++GYS  +I+ +  + T C +   S+LD+N PSITIP+L + 
Sbjct  619  KPGLVYDMGVKDYVLYLCSVGYSDSSITRLVSKKTVCGNPKPSVLDLNLPSITIPNLAKE  678

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +T+TRTVTNVG   S YK ++E P G+ V V PSTL F+   +K+SF + + T H  NTG
Sbjct  679  VTITRTVTNVGTVGSVYKAVIEAPMGVNVTVTPSTLVFNAKTRKLSFKIRVLTNHRVNTG  738

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            +YFGSL W D VHNV IP+SV+T+
Sbjct  739  YYFGSLTWTDSVHNVVIPLSVRTQ  762



>emb|CDY67954.1| BnaAnng25710D [Brassica napus]
Length=775

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 100/143 (70%), Gaps = 9/143 (6%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGFSILDVNFPSITIPDLKRPI  385
            KPGLVYD+   DYV  +C         S++  +TT  +   S+LD+N PSITIPDLK  +
Sbjct  633  KPGLVYDLDLEDYVLYMC---------SLVGERTTCSNPRPSVLDLNLPSITIPDLKEEV  683

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            TLTRTVTNVGP +S YKV VEPP G+ V V P+ L F+   KK+S++V +ST H  NTGF
Sbjct  684  TLTRTVTNVGPPSSVYKVKVEPPLGVQVTVMPNKLVFNSKTKKLSYHVRVSTRHKINTGF  743

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
            YFGSL W+D VH+V IP+SV+T+
Sbjct  744  YFGSLTWSDSVHDVIIPLSVRTQ  766



>ref|XP_010499844.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Camelina 
sativa]
 ref|XP_010499845.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Camelina 
sativa]
Length=771

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 101/144 (70%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            KPGLVYDM   DYV  LC++GY+  +I+ +  + T C +   S+LD+N PSITIP+L + 
Sbjct  619  KPGLVYDMGVNDYVLYLCSVGYTDSSITRLVRKKTVCGNPKPSVLDLNLPSITIPNLAKE  678

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +T+TRTVTNVGP  S YK ++E P G+ V V PS L F+   +K+SF V + T H  NTG
Sbjct  679  VTITRTVTNVGPVGSVYKAVIEAPMGVNVNVTPSALVFNAKTRKLSFKVRVVTNHRVNTG  738

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            +YFGSL W D VHNV IP+SV+T+
Sbjct  739  YYFGSLTWTDSVHNVVIPLSVRTQ  762



>ref|XP_010478713.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Camelina 
sativa]
Length=645

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 101/144 (70%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            KPGLVYDM   DYV  LC++GY+  +I+ +  + T C +   S+LD+N PSITIP+L + 
Sbjct  493  KPGLVYDMGVNDYVLYLCSVGYTDSSITRLVRKKTVCGNPKPSVLDLNLPSITIPNLAKE  552

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +T+TRTVTNVG   S YK ++E P G+ V V PSTL F+   +K+SF V + T H  NTG
Sbjct  553  VTITRTVTNVGTVGSVYKAVIEAPMGVNVTVTPSTLVFNAKTRKLSFKVRVLTNHRVNTG  612

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            +YFGSL W D VHNV IP+SV+T+
Sbjct  613  YYFGSLTWTDSVHNVVIPLSVRTQ  636



>gb|AID21654.1| At4g21323p-like protein [Arabidopsis lyrata]
Length=804

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 102/147 (69%), Gaps = 4/147 (3%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMG-YSSKAISIIAGQTTS-C-HKGFSILDVNFPSITIPDLKR  391
            PGLVYDM   DY++ LC+   Y+ K +S + G  TS C   G SILD+N PSITIPDLKR
Sbjct  652  PGLVYDMDINDYIHYLCSQALYTDKKVSALTGNVTSKCPSSGSSILDLNVPSITIPDLKR  711

Query  390  PITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTIST-CHGFN  214
             +T+TR+VTNVGP  S YK ++E P G  VVV P  L F+    K++F V +ST  H  N
Sbjct  712  NVTVTRSVTNVGPVKSVYKPVIETPLGFKVVVSPKKLKFNKRRNKVAFKVRVSTGSHRVN  771

Query  213  TGFYFGSLIWNDGVHNVRIPISVKTKY  133
            T FYFGSL W+DG+HNV IPIS++T++
Sbjct  772  TAFYFGSLTWSDGLHNVTIPISLRTRF  798



>ref|NP_193895.2| Subtilase family protein [Arabidopsis thaliana]
 gb|AEE84484.1| Subtilase family protein [Arabidopsis thaliana]
Length=733

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 101/144 (70%), Gaps = 2/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRP  388
            KPGLVYDM   DY+N +C+ GY+  +IS + G+ T C     S+LD+N PSITIP+L++ 
Sbjct  586  KPGLVYDMGIKDYINYMCSAGYNDSSISRVLGKKTKCPIPKPSMLDINLPSITIPNLEKE  645

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKI-SFNVTISTCHGFNT  211
            +TLTRTVTNVGP  S Y+ ++E P GI + V P+ L F    K++ +F+V   T H  N+
Sbjct  646  VTLTRTVTNVGPIKSVYRAVIESPLGITLTVNPTILVFKSAAKRVLTFSVKAKTSHKVNS  705

Query  210  GFYFGSLIWNDGVHNVRIPISVKT  139
            G++FGSL W DGVH+V IP+SVKT
Sbjct  706  GYFFGSLTWTDGVHDVTIPVSVKT  729



>ref|XP_010474133.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=754

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 96/143 (67%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGL+YDM   DYV+ LC+  Y   +IS + G+   C     S+LD N PSI IP L R +
Sbjct  606  PGLIYDMGINDYVHYLCSAEYDDGSISKLLGKPIKCPYPLPSMLDFNMPSIIIPSLTREV  665

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            TLTRTVTNVGP +S YK +VE P GI + V P TL F+ N+ K +FNV + T H  N+ +
Sbjct  666  TLTRTVTNVGPADSVYKPLVESPLGIELDVNPKTLVFASNITKGTFNVRVKTSHRVNSDY  725

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
            YFGSL W DGVHNV IPI+V+TK
Sbjct  726  YFGSLCWTDGVHNVTIPIAVRTK  748



>ref|XP_010528996.1| PREDICTED: subtilisin-like protease SBT3.5 [Tarenaya hassleriana]
Length=756

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 99/143 (69%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPI  385
            PGLVYD+   DY + LCA G+   +I  +  +  +C +   S+LDVN PSITIP L   +
Sbjct  608  PGLVYDLGLHDYAHYLCAEGFDDMSIRRLLRKHKACPNPRPSMLDVNMPSITIPYLNEDV  667

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+TRTVTNVGP +S Y+ +VE P GI +VVKP TL F+   KK+S+ V++ST H  NTG+
Sbjct  668  TITRTVTNVGPVDSVYRAVVEAPLGIKLVVKPETLVFNSQTKKVSYTVSVSTSHKVNTGY  727

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
             FGSL W DG HNV IP+SV+TK
Sbjct  728  LFGSLTWTDGTHNVAIPVSVRTK  750



>gb|KFK41045.1| hypothetical protein AALP_AA2G078300 [Arabis alpina]
Length=757

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 99/144 (69%), Gaps = 2/144 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYDM   +YV+ LC+ GY  ++ISI+  +  +C     S+LDVN PSITIP L + I
Sbjct  608  PGLVYDMGYDEYVHYLCSAGYDDRSISILLSKPYTCPSPTPSMLDVNLPSITIPYLSQEI  667

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+TRTVTNVGP  S YK ++EPP GI + V P TL F  N  KI+F V +ST H  NT +
Sbjct  668  TITRTVTNVGPVGSIYKAVIEPPLGINLQVSPETLEFGSNTNKITFMVKVSTTHRVNTDY  727

Query  204  YFGSLIWND-GVHNVRIPISVKTK  136
            +FGSL W D G H+VRIP S++T+
Sbjct  728  HFGSLTWTDNGAHDVRIPFSIRTR  751



>ref|XP_011470878.1| PREDICTED: uncharacterized protein LOC101314621 [Fragaria vesca 
subsp. vesca]
Length=1534

 Score =   154 bits (388),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 101/144 (70%), Gaps = 2/144 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYD+   DY+  LCA+GY++  IS + G +T+C     S+LDVN PSIT+P+L+  I
Sbjct  632  PGLVYDLGVYDYILYLCAVGYNNSEISQLVGNSTTCSSTKPSVLDVNLPSITVPNLRENI  691

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            TLTR+VTNVGP NSTYK  + PP GI V V P TL F+ N++ I F V +ST H  NTG+
Sbjct  692  TLTRSVTNVGPVNSTYKARISPPWGISVAVSPETLVFNSNIETIYFTVEVSTTHEVNTGY  751

Query  204  YFGSLIWNDGV-HNVRIPISVKTK  136
            YFGSL W D   H V IP+SV+T+
Sbjct  752  YFGSLAWTDEWGHVVTIPMSVRTQ  775


 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 99/146 (68%), Gaps = 0/146 (0%)
 Frame = -1

Query  561   PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGFSILDVNFPSITIPDLKRPIT  382
             PGL+Y+ +T DY+  LC++GYS+ +++ +   T +C      +++N PSI+IP+L+R  T
Sbjct  1385  PGLIYNATTNDYIQFLCSLGYSTASLTRLTNTTITCLTKADAINLNLPSISIPNLERTST  1444

Query  381   LTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFY  202
             +TRTVTNVG  +S Y+VMV+ P G+ + VKP TL+F+   + +S+ VT  +    N G+ 
Sbjct  1445  VTRTVTNVGKIDSKYRVMVQAPPGVEMTVKPPTLSFNITAQILSYKVTFFSTQKVNGGYK  1504

Query  201   FGSLIWNDGVHNVRIPISVKTKY*ES  124
             FGSL W DG H+VRIPI+++    ES
Sbjct  1505  FGSLTWTDGEHDVRIPIAIRVTAFES  1530



>ref|XP_010478712.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Camelina 
sativa]
Length=771

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 101/144 (70%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            KPGLVYDM   DYV  LC++GY+  +I+ +  + T C +   S+LD+N PSITIP+L + 
Sbjct  619  KPGLVYDMGVNDYVLYLCSVGYTDSSITRLVRKKTVCGNPKPSVLDLNLPSITIPNLAKE  678

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +T+TRTVTNVG   S YK ++E P G+ V V PSTL F+   +K+SF V + T H  NTG
Sbjct  679  VTITRTVTNVGTVGSVYKAVIEAPMGVNVTVTPSTLVFNAKTRKLSFKVRVLTNHRVNTG  738

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            +YFGSL W D VHNV IP+SV+T+
Sbjct  739  YYFGSLTWTDSVHNVVIPLSVRTQ  762



>ref|XP_011038010.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X2 [Populus 
euphratica]
Length=704

 Score =   151 bits (381),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 104/143 (73%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPI  385
            PGLVYDM + DYVN LCAM Y++ AIS + G+ T C  +G SIL++N PSITIP+L+  +
Sbjct  553  PGLVYDMGSDDYVNYLCAMDYNNTAISRLTGKPTVCPTEGPSILNINLPSITIPNLRNSV  612

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            TLTRTVTN G  NS Y+V++E P    V V+P  L F+   KK +F+VT++T +  NTG+
Sbjct  613  TLTRTVTNAGASNSIYRVVIEAPFCCSVSVEPHVLVFNHTTKKNTFSVTVNTTYQVNTGY  672

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
            +FGS+ W DGVH VR P+SV+T+
Sbjct  673  FFGSITWIDGVHTVRSPLSVRTE  695



>emb|CDX98693.1| BnaA03g44780D [Brassica napus]
Length=765

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 102/145 (70%), Gaps = 3/145 (2%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAIS-IIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            PGLVYDM   DY++ +C+ GY   +IS II  +T  C     S+LD+N PSITIP+L++ 
Sbjct  616  PGLVYDMGIQDYIDYMCSAGYKDSSISRIIRKKTNKCPTPKPSVLDMNLPSITIPNLEKE  675

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKI-SFNVTISTCHGFNT  211
            +TLTRTVTNVGP  S YK ++E P GI + V P+TL FS   K++ +F V   T H  NT
Sbjct  676  VTLTRTVTNVGPIKSVYKAVIESPLGITLTVTPNTLVFSSAAKRVLTFKVKAKTSHKVNT  735

Query  210  GFYFGSLIWNDGVHNVRIPISVKTK  136
            G++FGSL W DGVH+V+IP+SV+TK
Sbjct  736  GYFFGSLTWTDGVHDVKIPVSVQTK  760



>emb|CDX94044.1| BnaC07g36780D [Brassica napus]
Length=727

 Score =   151 bits (381),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 103/149 (69%), Gaps = 9/149 (6%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
            KPGLVYDM   DY+N +C+ GY+  +IS   G  T C +   SILD+N PSITIP++++ 
Sbjct  577  KPGLVYDMGIQDYINYMCSAGYNDSSIS---GIITKCPNPKPSILDMNLPSITIPNIEKE  633

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKI-----SFNVTISTCH  223
            +TLTRTVTNVGP  S YK ++E P GI + V P+TL FS   K++     +F V   T H
Sbjct  634  VTLTRTVTNVGPIKSVYKAVIESPLGITLTVTPNTLVFSSAAKRVLTFKPTFKVKAKTSH  693

Query  222  GFNTGFYFGSLIWNDGVHNVRIPISVKTK  136
              NTG++FGSL W DGVH+V+IP+SV+TK
Sbjct  694  KVNTGYFFGSLTWTDGVHDVKIPVSVQTK  722



>ref|XP_006286454.1| hypothetical protein CARUB_v10000290mg [Capsella rubella]
 gb|EOA19352.1| hypothetical protein CARUB_v10000290mg [Capsella rubella]
Length=754

 Score =   151 bits (382),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 101/143 (71%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLC-AMGYSSKAISIIAGQTTSCHKGFSILDVNFPSITIPDLKRPI  385
            PGLVYDM+  DYV+ LC A  ++  +IS +   T   +   S+LD+N PSITIPDL+  +
Sbjct  603  PGLVYDMTINDYVSYLCSAYNFNDVSISQVGNITACPNPKQSLLDLNLPSITIPDLRDEV  662

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            TLTRTVTNVG  NS YKVM++ P G+ ++V P+TL F+   +K+SF V + T H  NTG+
Sbjct  663  TLTRTVTNVGSVNSIYKVMIDAPIGVNMIVTPATLEFNSMTRKVSFKVRVLTTHKVNTGY  722

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
            YFGSL W D VHNV IP+SV+T+
Sbjct  723  YFGSLTWTDNVHNVVIPVSVRTQ  745



>emb|CAB36808.1| subtilisin-like protease [Arabidopsis thaliana]
 emb|CAB81271.1| subtilisin-like protease [Arabidopsis thaliana]
Length=769

 Score =   151 bits (381),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 101/144 (70%), Gaps = 2/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRP  388
            KPGLVYDM   DY+N +C+ GY+  +IS + G+ T C     S+LD+N PSITIP+L++ 
Sbjct  622  KPGLVYDMGIKDYINYMCSAGYNDSSISRVLGKKTKCPIPKPSMLDINLPSITIPNLEKE  681

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKI-SFNVTISTCHGFNT  211
            +TLTRTVTNVGP  S Y+ ++E P GI + V P+ L F    K++ +F+V   T H  N+
Sbjct  682  VTLTRTVTNVGPIKSVYRAVIESPLGITLTVNPTILVFKSAAKRVLTFSVKAKTSHKVNS  741

Query  210  GFYFGSLIWNDGVHNVRIPISVKT  139
            G++FGSL W DGVH+V IP+SVKT
Sbjct  742  GYFFGSLTWTDGVHDVTIPVSVKT  765



>ref|XP_011038008.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Populus 
euphratica]
 ref|XP_011038009.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Populus 
euphratica]
Length=775

 Score =   151 bits (381),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 104/143 (73%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPI  385
            PGLVYDM + DYVN LCAM Y++ AIS + G+ T C  +G SIL++N PSITIP+L+  +
Sbjct  624  PGLVYDMGSDDYVNYLCAMDYNNTAISRLTGKPTVCPTEGPSILNINLPSITIPNLRNSV  683

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            TLTRTVTN G  NS Y+V++E P    V V+P  L F+   KK +F+VT++T +  NTG+
Sbjct  684  TLTRTVTNAGASNSIYRVVIEAPFCCSVSVEPHVLVFNHTTKKNTFSVTVNTTYQVNTGY  743

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
            +FGS+ W DGVH VR P+SV+T+
Sbjct  744  FFGSITWIDGVHTVRSPLSVRTE  766



>ref|NP_564869.1| Subtilase-like protein [Arabidopsis thaliana]
 gb|AAG51764.1|AC066691_4 subtilisin-like protein; 10849-13974 [Arabidopsis thaliana]
 gb|AEE34478.1| Subtilase-like protein [Arabidopsis thaliana]
Length=753

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 98/144 (68%), Gaps = 1/144 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHK-GFSILDVNFPSITIPDLKRPI  385
            PGL+YDM   DY++ LC+  Y   +IS + G+T +C     S+LD N PSITIP L   +
Sbjct  605  PGLIYDMGIDDYLHYLCSAEYDDDSISKLLGKTYNCTSPKPSMLDFNLPSITIPSLTGEV  664

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+TRTV NVGP  S Y+ ++E P GI + VKP TL F  N+ KI+F+V + + H  NT F
Sbjct  665  TVTRTVRNVGPARSVYRPVIESPLGIELDVKPKTLVFGSNITKITFSVRVKSSHRVNTDF  724

Query  204  YFGSLIWNDGVHNVRIPISVKTKY  133
            YFGSL W DGVHNV IP+SV+TK+
Sbjct  725  YFGSLCWTDGVHNVTIPVSVRTKF  748



>ref|NP_174573.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
 gb|AAF31279.1|AC006424_8 Fourth of four adjacent putative subtilase family> [Arabidopsis 
thaliana]
 gb|AEE31545.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
Length=734

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 101/143 (71%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPI  385
            PGLVYDM   DY+  LC++GY+  +I+ +  + T C +   S+LD+N PSITIP+L + +
Sbjct  583  PGLVYDMGVKDYILYLCSVGYTDSSITGLVSKKTVCANPKPSVLDLNLPSITIPNLAKEV  642

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+TRTVTNVGP  S YK ++E P G+ V V PSTL F+   +K+SF V + T H  NTG+
Sbjct  643  TITRTVTNVGPVGSVYKPVIEAPMGVNVTVTPSTLVFNAYTRKLSFKVRVLTNHIVNTGY  702

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
            YFGSL W D VHNV IP+SV+T+
Sbjct  703  YFGSLTWTDSVHNVVIPVSVRTQ  725



>ref|XP_010455450.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=763

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 100/143 (70%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPI  385
            PGL+YDM+T DY+  LC+  YS  +IS + G+ T C +   S+LD+N PSITIP+L+  +
Sbjct  612  PGLIYDMTTDDYILYLCSAEYSDVSISRVLGKATVCPNPKPSVLDLNLPSITIPNLRDEV  671

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T  RTVTNVGP  S YKV+++PP G+ V V P+ L F     K+SF V +ST H  NTG+
Sbjct  672  TFKRTVTNVGPLKSVYKVVIDPPTGVNVTVTPTELVFDSTNTKLSFTVRVSTTHKVNTGY  731

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
            YFGSL W + +HNV IP+SV+T+
Sbjct  732  YFGSLTWTNDLHNVVIPVSVRTQ  754



>gb|AID21679.1| At4g21323p-like protein [Arabidopsis lyrata]
Length=804

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 101/147 (69%), Gaps = 4/147 (3%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMG-YSSKAISIIAGQTTS-C-HKGFSILDVNFPSITIPDLKR  391
            PGLVYDM   DY++ LC+   Y+ K +S + G  TS C   G SILD+N PSITIPDLKR
Sbjct  652  PGLVYDMDINDYIHYLCSQALYTDKKVSALTGNVTSKCPSSGSSILDLNVPSITIPDLKR  711

Query  390  PITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTIS-TCHGFN  214
             +T+TR+VTNVGP  S YK ++E P G  VVV P  L F+    K++F V +S   H  N
Sbjct  712  NVTVTRSVTNVGPVKSVYKPVIETPLGFKVVVSPKKLKFNKRRNKVAFKVRVSPGSHRVN  771

Query  213  TGFYFGSLIWNDGVHNVRIPISVKTKY  133
            T FYFGSL W+DG+HNV IPIS++T++
Sbjct  772  TAFYFGSLTWSDGLHNVTIPISLRTRF  798



>gb|AID21582.1| AT4G21323p [Arabidopsis halleri]
Length=804

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 101/147 (69%), Gaps = 4/147 (3%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMG-YSSKAISIIAGQTTS-C-HKGFSILDVNFPSITIPDLKR  391
            PGLVYDM   DY++ LC+   Y+ K +S + G  TS C   G SILD+N PSITIPDLKR
Sbjct  652  PGLVYDMDINDYIHYLCSQALYTDKKVSALTGNVTSKCPSSGLSILDLNVPSITIPDLKR  711

Query  390  PITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTIS-TCHGFN  214
             +T+TR+VTNVGP  S YK ++E P G  VVV P  L F+    K++F V +S   H  N
Sbjct  712  NVTVTRSVTNVGPVKSVYKPVIETPLGFKVVVSPKKLKFNKKRNKVAFKVRVSPGSHRVN  771

Query  213  TGFYFGSLIWNDGVHNVRIPISVKTKY  133
            T F+FGSL W+DG+HNV IPIS++T++
Sbjct  772  TAFFFGSLTWSDGLHNVTIPISLRTRF  798



>gb|AID21686.1| At4g21323p-like protein [Arabidopsis lyrata]
Length=804

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 101/147 (69%), Gaps = 4/147 (3%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMG-YSSKAISIIAGQTTS-C-HKGFSILDVNFPSITIPDLKR  391
            PGLVYDM   DY++ LC+   Y+ K +S + G  TS C   G SILD+N PSITIPDLKR
Sbjct  652  PGLVYDMDINDYIHYLCSQALYTDKKVSALTGNVTSKCPSSGSSILDLNVPSITIPDLKR  711

Query  390  PITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTIS-TCHGFN  214
             +T+TR+VTNVGP  S YK ++E P G  VVV P  L F+    K++F V +S   H  N
Sbjct  712  NVTVTRSVTNVGPVKSVYKPVIETPLGFKVVVSPKKLKFNKRRSKVAFKVRVSPGSHRVN  771

Query  213  TGFYFGSLIWNDGVHNVRIPISVKTKY  133
            T FYFGSL W+DG+HNV IPIS++T++
Sbjct  772  TAFYFGSLTWSDGLHNVTIPISLRTRF  798



>ref|XP_010463200.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=747

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 102/146 (70%), Gaps = 5/146 (3%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHK----GFSILDVNFPSITIPDLK  394
            PGLVYD    DY   LCA  Y    I+ I+ +T + ++      S+LD+N PSITIP LK
Sbjct  596  PGLVYDAGAEDYRLFLCASNYDEMHITKIS-RTNTLYRCPSPRPSMLDLNLPSITIPFLK  654

Query  393  RPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFN  214
              +TLTRTVTNVGP +S YK++VEPP G+ + V P+TL F+ NVKK+SF VT+ST H  N
Sbjct  655  EDVTLTRTVTNVGPVDSVYKLIVEPPLGVKISVTPNTLLFNSNVKKLSFKVTVSTTHKSN  714

Query  213  TGFYFGSLIWNDGVHNVRIPISVKTK  136
            + +YFGSL W DG HNV IP+SV+T+
Sbjct  715  SIYYFGSLTWTDGSHNVTIPLSVRTQ  740



>ref|XP_010511550.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Camelina 
sativa]
Length=676

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 104/145 (72%), Gaps = 3/145 (2%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYDM   +YV+ LC+ GY++ +IS + G+  +C   F S+LDVN PSITIP L + I
Sbjct  526  PGLVYDMGENEYVHYLCSAGYNNTSISKLLGKIYTCPFPFPSMLDVNLPSITIPYLSKEI  585

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPN-VKKISFNVTISTCHGFNTG  208
            T+TRTVTNVGP  S YK +++ P+GI + V P TL FS N   +I+F V +ST H  NT 
Sbjct  586  TITRTVTNVGPVGSVYKAVIQQPQGINLQVSPETLEFSSNTTNRITFTVKVSTTHKANTD  645

Query  207  FYFGSLIW-NDGVHNVRIPISVKTK  136
            ++FGSL W ++G HNVRIP+SV+T+
Sbjct  646  YHFGSLTWIDNGGHNVRIPLSVRTR  670



>emb|CCI61493.1| unnamed protein product [Arabidopsis halleri]
 gb|AJP61102.1| At4g21323p-like protein [Arabidopsis halleri]
 gb|AJP61121.1| At4g21323p-like protein [Arabidopsis halleri]
Length=804

 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 101/147 (69%), Gaps = 4/147 (3%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMG-YSSKAISIIAGQTTS-C-HKGFSILDVNFPSITIPDLKR  391
            PGLVYDM   DY++ LC+   Y+ K +S + G  TS C   G SILD+N PSITIPDLKR
Sbjct  652  PGLVYDMDINDYIHYLCSQALYTDKKVSALTGNVTSKCPSSGSSILDLNVPSITIPDLKR  711

Query  390  PITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTIS-TCHGFN  214
             +T+TR+VTNVGP  S YK ++E P G  VVV P  L F+    K++F V +S   H  N
Sbjct  712  NVTVTRSVTNVGPVKSVYKPVIETPLGFKVVVWPKKLKFNKRRNKVAFKVRVSPGSHRVN  771

Query  213  TGFYFGSLIWNDGVHNVRIPISVKTKY  133
            T FYFGSL W+DG+HNV IPIS++T++
Sbjct  772  TAFYFGSLTWSDGLHNVTIPISLRTRF  798



>gb|ACN35690.1| unknown [Zea mays]
Length=279

 Score =   143 bits (361),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 95/142 (67%), Gaps = 1/142 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPI  385
            PGLVYDM T+DYV  LC+MGY+  AIS +A Q  +C H   + L++N PSI+IP+L+  +
Sbjct  129  PGLVYDMGTSDYVRFLCSMGYNVSAISSLAQQHETCQHTPKTQLNLNLPSISIPELRGRL  188

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T++RTVTNVG   + Y+  VE P G+ V V PS L F+  V+K++F VT          +
Sbjct  189  TVSRTVTNVGSALTKYRARVEAPPGVDVTVSPSLLTFNSTVRKLTFKVTFQAKLKVQGRY  248

Query  204  YFGSLIWNDGVHNVRIPISVKT  139
            YFGSL W DGVH VRIP+ V+T
Sbjct  249  YFGSLTWEDGVHAVRIPLVVRT  270



>gb|AID21628.1| At4g21326p-like protein [Arabidopsis lyrata]
Length=756

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 104/143 (73%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYDM+  DY++  CA GY+  AI++I G+ T C     SILD+N+P+ITIPDL+  +
Sbjct  610  PGLVYDMNLDDYIHYFCATGYNDTAITLITGKPTKCSSPLLSILDLNYPAITIPDLEEEV  669

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+TRTVTNVGP +S Y+ MVEPP+G+ +VV+P TL F  N KK+ F V +S+ H  NTGF
Sbjct  670  TVTRTVTNVGPVDSVYRAMVEPPQGVKIVVEPETLIFCSNTKKLGFKVRVSSSHKSNTGF  729

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
             FGS  W DG  NV IP+SV+T+
Sbjct  730  IFGSFTWTDGTRNVTIPLSVRTR  752



>ref|XP_010480961.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=747

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 102/146 (70%), Gaps = 5/146 (3%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHK----GFSILDVNFPSITIPDLK  394
            PGLV+D    DY   LCA  Y    I+ I+ +T + ++      S+LD+N PSITIP LK
Sbjct  596  PGLVFDAGAEDYRLFLCASNYDEMHITKIS-RTNTLYRCPSPRPSMLDLNLPSITIPFLK  654

Query  393  RPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFN  214
              +TLTRTVTNVGP +S YK++VEPP G+ + V P+TL F+ NVKKISF VT+ST H  N
Sbjct  655  EDVTLTRTVTNVGPVDSVYKLIVEPPLGVKISVTPNTLLFNSNVKKISFKVTVSTTHKSN  714

Query  213  TGFYFGSLIWNDGVHNVRIPISVKTK  136
            + +YFGSL W DG HNV IP+SV+T+
Sbjct  715  SIYYFGSLTWTDGSHNVTIPLSVRTQ  740



>gb|AID21678.1| At4g21326p-like protein [Arabidopsis lyrata]
Length=756

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 104/143 (73%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYDM+  DY++  CA GY+  AI++I G+ T C     SILD+N+P+ITIPDL+  +
Sbjct  610  PGLVYDMNLDDYIHYFCATGYNDTAITLITGKPTKCSSPLPSILDLNYPAITIPDLEEEV  669

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+TRTVTNVGP +S Y+ MVEPP+G+ +VV+P TL F  N KK+ F V +S+ H  NTGF
Sbjct  670  TVTRTVTNVGPVDSVYRAMVEPPQGVKIVVEPETLIFCSNTKKLGFKVRVSSSHKSNTGF  729

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
             FGS  W DG  NV IP+SV+T+
Sbjct  730  IFGSFTWTDGTRNVTIPLSVRTR  752



>gb|AID21602.1| At4g21323p-like protein [Arabidopsis halleri]
Length=803

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 101/147 (69%), Gaps = 4/147 (3%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMG-YSSKAISIIAGQTTS-C-HKGFSILDVNFPSITIPDLKR  391
            PGLVYDM   DY++ LC+   Y+ K +S + G  TS C   G SILD+N PSITIPDLKR
Sbjct  651  PGLVYDMDINDYIHYLCSQALYTDKKVSALTGNVTSKCPSSGSSILDLNVPSITIPDLKR  710

Query  390  PITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTIS-TCHGFN  214
             +T+TR+VTNVGP  S YK ++E P G  VVV P  L F+    K++F V +S   H  N
Sbjct  711  NVTVTRSVTNVGPVKSVYKPVIETPLGFKVVVSPKKLKFNKRRNKVAFKVRVSPGSHRVN  770

Query  213  TGFYFGSLIWNDGVHNVRIPISVKTKY  133
            T F+FGSL W+DG+HNV IPIS++T++
Sbjct  771  TAFFFGSLTWSDGLHNVTIPISLRTRF  797



>ref|XP_003634153.1| PREDICTED: subtilisin-like protease SBT3.5 [Vitis vinifera]
Length=776

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 99/147 (67%), Gaps = 1/147 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPI  385
            PGLVYDM T DY++ LC +GY++ AI     Q+  C  +  SILD+N PSITIP L+   
Sbjct  625  PGLVYDMGTADYIHYLCTLGYNNSAIFQFTEQSIRCPTREHSILDLNLPSITIPSLQNST  684

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            +LTR VTNVG  NSTYK  +  P GI + VKP TL F+  +K ++F+VT+S+ H  NT +
Sbjct  685  SLTRNVTNVGAVNSTYKASIISPAGITITVKPDTLIFNSTIKTVTFSVTVSSIHQVNTEY  744

Query  204  YFGSLIWNDGVHNVRIPISVKTKY*ES  124
             FGSL W DGVH V+ PISV+T   ES
Sbjct  745  SFGSLTWVDGVHAVKSPISVRTMIEES  771



>ref|XP_010511549.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Camelina 
sativa]
Length=760

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 104/145 (72%), Gaps = 3/145 (2%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYDM   +YV+ LC+ GY++ +IS + G+  +C   F S+LDVN PSITIP L + I
Sbjct  610  PGLVYDMGENEYVHYLCSAGYNNTSISKLLGKIYTCPFPFPSMLDVNLPSITIPYLSKEI  669

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPN-VKKISFNVTISTCHGFNTG  208
            T+TRTVTNVGP  S YK +++ P+GI + V P TL FS N   +I+F V +ST H  NT 
Sbjct  670  TITRTVTNVGPVGSVYKAVIQQPQGINLQVSPETLEFSSNTTNRITFTVKVSTTHKANTD  729

Query  207  FYFGSLIW-NDGVHNVRIPISVKTK  136
            ++FGSL W ++G HNVRIP+SV+T+
Sbjct  730  YHFGSLTWIDNGGHNVRIPLSVRTR  754



>ref|XP_003634152.2| PREDICTED: subtilisin-like protease SBT3.5 [Vitis vinifera]
Length=776

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 97/147 (66%), Gaps = 1/147 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPI  385
            PGLVYDM T DY++ LC +GY++ AI     Q+  C  +  SILD+N PSITIP L+   
Sbjct  625  PGLVYDMGTADYIHYLCTLGYNNSAIFQFTEQSIRCPTREHSILDLNLPSITIPSLQNST  684

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            +LTR VTNVG  NSTYK  +  P G  + VKP TL F   +K ++F+VT+S+    NTG+
Sbjct  685  SLTRNVTNVGAVNSTYKASIISPAGTTITVKPDTLIFDSTIKTVTFSVTVSSIQQVNTGY  744

Query  204  YFGSLIWNDGVHNVRIPISVKTKY*ES  124
             FGSL W DGVH VR PISV+T   ES
Sbjct  745  SFGSLTWIDGVHAVRSPISVRTMIKES  771



>ref|XP_010419003.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=719

 Score =   148 bits (374),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 95/143 (66%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGL+YDM   DYV+ LC+  Y   +IS + G+   C     ++LD N PSI IP L R +
Sbjct  571  PGLIYDMGINDYVHYLCSAEYDDGSISKLVGKPIKCPSPLPTMLDFNMPSIIIPSLTREV  630

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            TLTRTVTNVGP +S YK +VE P GI + V P TL F+ N+ K +FNV + T H  N+ +
Sbjct  631  TLTRTVTNVGPADSVYKPLVESPLGIELDVNPKTLVFASNITKGTFNVRVKTSHRVNSDY  690

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
            YF SL W DGVHNV IPI+V+TK
Sbjct  691  YFCSLCWTDGVHNVTIPIAVRTK  713



>gb|AID21619.1| At4g21323p-like protein [Arabidopsis halleri]
Length=804

 Score =   149 bits (375),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 101/147 (69%), Gaps = 4/147 (3%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMG-YSSKAISIIAGQTTS-C-HKGFSILDVNFPSITIPDLKR  391
            PGLVYDM   DY++ LC+   Y+ K +S + G  TS C   G SILD+N PSITIPDLKR
Sbjct  652  PGLVYDMDINDYIHYLCSQALYTDKKVSALTGNVTSKCPSSGSSILDLNVPSITIPDLKR  711

Query  390  PITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTIS-TCHGFN  214
             +T+TR+VTNVGP  S YK ++E P G  VVV P  L F+    K++F V +S   H  N
Sbjct  712  NVTVTRSVTNVGPVKSVYKPVIETPLGFKVVVSPKKLKFNKRRNKVAFKVRVSPGSHRVN  771

Query  213  TGFYFGSLIWNDGVHNVRIPISVKTKY  133
            T F+FGSL W+DG+HNV IPIS++T++
Sbjct  772  TAFFFGSLTWSDGLHNVTIPISLRTRF  798



>ref|XP_006304869.1| hypothetical protein CARUB_v10012621mg, partial [Capsella rubella]
 gb|EOA37767.1| hypothetical protein CARUB_v10012621mg, partial [Capsella rubella]
Length=759

 Score =   148 bits (374),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 99/145 (68%), Gaps = 3/145 (2%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTT--SCHKGF-SILDVNFPSITIPDLKR  391
            PGLVYD    DY   LCA  Y    I+ I+   T   C     S+LD+N PSITIP LK 
Sbjct  608  PGLVYDAGAEDYRLFLCASNYDEVHITRISRINTLYRCPSPRPSMLDLNLPSITIPFLKE  667

Query  390  PITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNT  211
             +TLTRTVTNVGP +S YK++VEPP GI + V P+TL F+ NVKK+SF VT+ST H  N+
Sbjct  668  DVTLTRTVTNVGPVDSVYKLVVEPPLGIKISVTPNTLLFNSNVKKLSFKVTVSTTHKANS  727

Query  210  GFYFGSLIWNDGVHNVRIPISVKTK  136
             +YFGSL W DG HNV IP+SV+T+
Sbjct  728  IYYFGSLTWTDGSHNVTIPLSVRTQ  752



>emb|CBI23086.3| unnamed protein product [Vitis vinifera]
Length=842

 Score =   149 bits (376),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 99/147 (67%), Gaps = 1/147 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPI  385
            PGLVYDM T DY++ LC +GY++ AI     Q+  C  +  SILD+N PSITIP L+   
Sbjct  691  PGLVYDMGTADYIHYLCTLGYNNSAIFQFTEQSIRCPTREHSILDLNLPSITIPSLQNST  750

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            +LTR VTNVG  NSTYK  +  P GI + VKP TL F+  +K ++F+VT+S+ H  NT +
Sbjct  751  SLTRNVTNVGAVNSTYKASIISPAGITITVKPDTLIFNSTIKTVTFSVTVSSIHQVNTEY  810

Query  204  YFGSLIWNDGVHNVRIPISVKTKY*ES  124
             FGSL W DGVH V+ PISV+T   ES
Sbjct  811  SFGSLTWVDGVHAVKSPISVRTMIEES  837



>gb|AID21627.1| At4g21323p-like protein [Arabidopsis lyrata]
Length=804

 Score =   149 bits (375),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 100/147 (68%), Gaps = 4/147 (3%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMG-YSSKAISIIAGQTTS-CHKGFS-ILDVNFPSITIPDLKR  391
            PGLVYDM   DY++ LC+   Y+ K +S + G  TS C    S ILD+N PSITIPDLKR
Sbjct  652  PGLVYDMDINDYIHYLCSQALYTDKKVSALTGNVTSKCPSSRSSILDLNVPSITIPDLKR  711

Query  390  PITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTIS-TCHGFN  214
             +T+TR+VTNVGP  S YK ++E P G  VVV P  L FS    K++F V +S   H  N
Sbjct  712  NVTVTRSVTNVGPVKSVYKPVIETPLGFKVVVSPKKLKFSKRRSKVAFKVRVSPGSHRVN  771

Query  213  TGFYFGSLIWNDGVHNVRIPISVKTKY  133
            T FYFGSL W+DG+HNV IPIS++T++
Sbjct  772  TAFYFGSLTWSDGLHNVTIPISLRTRF  798



>ref|XP_007131764.1| hypothetical protein PHAVU_011G039900g [Phaseolus vulgaris]
 gb|ESW03758.1| hypothetical protein PHAVU_011G039900g [Phaseolus vulgaris]
Length=746

 Score =   148 bits (373),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 94/142 (66%), Gaps = 1/142 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGFS-ILDVNFPSITIPDLKRPI  385
            PGLVYDM  +DY++ LC+M Y+  AIS + G  T CHK    +L++N PSI IP+LK+P+
Sbjct  596  PGLVYDMKNSDYIHFLCSMDYNDTAISFLTGVPTKCHKSHKYLLNMNLPSIIIPELKQPL  655

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T++RTVTNVGP  S Y   VE P G+ V V P TL FSP  KK+ F VT S+       F
Sbjct  656  TVSRTVTNVGPIKSVYTARVEAPIGVSVTVVPPTLTFSPKRKKMKFKVTFSSKLRIQGRF  715

Query  204  YFGSLIWNDGVHNVRIPISVKT  139
             FG L W DG H VR+P++V++
Sbjct  716  SFGYLFWEDGSHEVRMPLAVRS  737



>gb|KHN12354.1| Subtilisin-like protease [Glycine soja]
Length=148

 Score =   138 bits (348),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 99/142 (70%), Gaps = 1/142 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKG-FSILDVNFPSITIPDLKRPI  385
            PGL+YD++T DYV  LC+M +SS +IS +   TTSC KG    L++N PSI++P+LKR  
Sbjct  3    PGLIYDITTEDYVQFLCSMDHSSASISKVTKTTTSCKKGNHQALNLNLPSISVPNLKRAA  62

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+ RTVTNVG   + YK +V+ P GI V V+P TL+F+ +V+ ++F+V+  +   F+  +
Sbjct  63   TVMRTVTNVGNITAVYKALVKVPHGIKVRVEPQTLSFNSDVRILNFSVSFLSTQKFHGDY  122

Query  204  YFGSLIWNDGVHNVRIPISVKT  139
             FGSL W DG + VR PI+V+T
Sbjct  123  KFGSLTWTDGKYFVRTPIAVRT  144



>emb|CDX93811.1| BnaA09g24110D [Brassica napus]
Length=752

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 96/142 (68%), Gaps = 12/142 (8%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGFSILDVNFPSITIPDLKRPIT  382
            PGL+YDM   DY+  LC+      A+++ +    S      +LDVN PS+TIP+LK  + 
Sbjct  614  PGLIYDMGPKDYILYLCS------AVTVCSNPKPS------VLDVNLPSLTIPNLKEEVN  661

Query  381  LTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFY  202
            LTRTVTNVGP NS YKV+VEPP G+ VVV P  L F+   K +SF V +ST H  NTGFY
Sbjct  662  LTRTVTNVGPVNSVYKVVVEPPLGVRVVVTPKKLVFNSKTKSLSFMVRVSTIHKINTGFY  721

Query  201  FGSLIWNDGVHNVRIPISVKTK  136
            FGSLIW D VHNV IP+SV+T+
Sbjct  722  FGSLIWRDSVHNVTIPVSVRTQ  743



>ref|XP_002888489.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64748.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=760

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 97/144 (67%), Gaps = 2/144 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYDM   +YV+ LC+ GY + +IS + G+  +C     S+LDVN PSITIP L   I
Sbjct  611  PGLVYDMGHDEYVHYLCSAGYDNTSISKLLGKIYTCPSPIPSMLDVNLPSITIPYLSEEI  670

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+TRTVTNVGP  S YK +++ P+GI + V P TL F  N  KI+F V +ST H  NT +
Sbjct  671  TITRTVTNVGPVGSVYKAVIQAPQGINLQVSPETLEFGSNTNKITFTVKVSTTHRANTDY  730

Query  204  YFGSLIWNDGV-HNVRIPISVKTK  136
             FGSL W D   HNVRIP+SV+T+
Sbjct  731  LFGSLTWTDNEGHNVRIPLSVRTR  754



>emb|CDX98690.1| BnaA03g44750D [Brassica napus]
Length=696

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 98/143 (69%), Gaps = 12/143 (8%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGFSILDVNFPSITIPDLKRPIT  382
            PGLVYDM   DY+N +C+ GY+  +IS             SILD+N PSITIP++++ +T
Sbjct  560  PGLVYDMGIEDYINYMCSKGYNDSSISRP-----------SILDMNLPSITIPNIEKEVT  608

Query  381  LTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKI-SFNVTISTCHGFNTGF  205
            LTR+VTNVGP  S YK ++E P GI + V P+TL FS   KK+ SF V   T H  NTG+
Sbjct  609  LTRSVTNVGPIKSVYKAVIESPLGITLTVHPTTLVFSSEDKKVLSFTVKAKTSHKVNTGY  668

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
            +FGSL W DGVH+V+IP+SV+T+
Sbjct  669  FFGSLTWTDGVHDVKIPVSVQTR  691



>gb|ADQ37345.1| unknown [Arabidopsis lyrata]
Length=696

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 104/143 (73%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYDM+  DY++  CA GY+  AI++I G+ T C     S+LD+N+P+ITIPDL+  +
Sbjct  550  PGLVYDMNLDDYIHYFCATGYNDTAITLITGKPTKCSSPLPSVLDLNYPAITIPDLEEEV  609

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+TRTVTNVGP +S Y+ +VEPP+G+ +VV+P TL F  N KK+ F V +S+ H  NTGF
Sbjct  610  TVTRTVTNVGPVDSVYRAVVEPPRGVKIVVEPETLVFCSNTKKLEFKVRVSSSHKSNTGF  669

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
             FGS  W DG  NV IP+SV+T+
Sbjct  670  IFGSFTWTDGTRNVTIPLSVRTR  692



>ref|XP_006399712.1| hypothetical protein EUTSA_v10012766mg [Eutrema salsugineum]
 gb|ESQ41165.1| hypothetical protein EUTSA_v10012766mg [Eutrema salsugineum]
Length=752

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 98/143 (69%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYD    DY   LCA  Y+   I+ ++  T  C     S+ ++N PSITIP LK  +
Sbjct  603  PGLVYDADAEDYRRFLCASDYNEGIIAKLSQTTYKCPTTKPSVFELNLPSITIPFLKEDV  662

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            TLTRTVTNVGP +S YK++VEPP GI + V P+TL F+ +VKK+S+ VT+ST H  N+ +
Sbjct  663  TLTRTVTNVGPVDSLYKLVVEPPLGIKISVTPNTLQFNSSVKKLSYKVTVSTTHKANSIY  722

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
            YFG L W DG HNV IP+S++T+
Sbjct  723  YFGRLTWTDGSHNVTIPLSIRTE  745



>ref|XP_010538146.1| PREDICTED: subtilisin-like protease SBT3.5 [Tarenaya hassleriana]
Length=821

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 101/144 (70%), Gaps = 1/144 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRP  388
            +PGLVYDM   DY   LC  GYS  ++S I G+   C     SILD+N PSITIPDL+  
Sbjct  673  EPGLVYDMGIDDYAQYLCYAGYSDSSLSAIVGKDAKCPSPLPSILDLNLPSITIPDLRED  732

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +T+TRTVTNVGP +S YK +++ P GI V V+P  L F+ N KK+ F+V +ST H  NTG
Sbjct  733  VTVTRTVTNVGPVDSVYKPLIDAPFGINVEVRPEALAFNLNTKKLGFSVKVSTTHKANTG  792

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            FYFGSL W DG+HNV IP+SV+T+
Sbjct  793  FYFGSLTWTDGIHNVTIPLSVRTQ  816



>emb|CBI23085.3| unnamed protein product [Vitis vinifera]
Length=1884

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 97/147 (66%), Gaps = 1/147 (1%)
 Frame = -1

Query  561   PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPI  385
             PGLVYDM T DY++ LC +GY++ AI     Q+  C  +  SILD+N PSITIP L+   
Sbjct  1733  PGLVYDMGTADYIHYLCTLGYNNSAIFQFTEQSIRCPTREHSILDLNLPSITIPSLQNST  1792

Query  384   TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
             +LTR VTNVG  NSTYK  +  P G  + VKP TL F   +K ++F+VT+S+    NTG+
Sbjct  1793  SLTRNVTNVGAVNSTYKASIISPAGTTITVKPDTLIFDSTIKTVTFSVTVSSIQQVNTGY  1852

Query  204   YFGSLIWNDGVHNVRIPISVKTKY*ES  124
              FGSL W DGVH VR PISV+T   ES
Sbjct  1853  SFGSLTWIDGVHAVRSPISVRTMIKES  1879


 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 100/142 (70%), Gaps = 1/142 (1%)
 Frame = -1

Query  561   PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
             PGLVYDM   D +  LCAMGY++ AI+ + G+ TSC     SILDVN PSITIP+L+  +
Sbjct  985   PGLVYDMGKDDCILYLCAMGYNNSAIAKVTGRPTSCPCNRPSILDVNLPSITIPNLQYSV  1044

Query  384   TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
             +LTR+VTNVG  +S Y  +++PP G+ + ++P  L F+  ++ I+F V +S+    +TGF
Sbjct  1045  SLTRSVTNVGAVDSEYNAVIDPPPGVTIKLEPDRLVFNSKIRTITFRVMVSSARRVSTGF  1104

Query  204   YFGSLIWNDGVHNVRIPISVKT  139
              FGSL W+DG H VRIPISV+T
Sbjct  1105  SFGSLAWSDGEHAVRIPISVRT  1126



>emb|CDX86874.1| BnaA09g22640D [Brassica napus]
Length=747

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 95/144 (66%), Gaps = 11/144 (8%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRP  388
            KPGLVYD+   DYV  +C +           G+ T C     S+LD N PSITIP+LK  
Sbjct  605  KPGLVYDLGIEDYVLYMCTL----------VGKGTVCSNPIPSVLDFNLPSITIPNLKEE  654

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +TLTRT+TNVGP +S YKV VEPP G+ V V P TL F+   KK+SF V +ST H  NTG
Sbjct  655  VTLTRTLTNVGPVDSVYKVAVEPPLGVQVTVTPETLVFNSTNKKVSFKVRVSTTHKTNTG  714

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            +YFGSL W+D VHN  IP+SV+T+
Sbjct  715  YYFGSLTWSDYVHNATIPLSVRTQ  738



>dbj|BAD94221.1| subtilisin proteinase like protein [Arabidopsis thaliana]
Length=141

 Score =   137 bits (345),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 96/137 (70%), Gaps = 2/137 (1%)
 Frame = -1

Query  543  MSTTDYVNCLCAMGYSSKAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRPITLTRTV  367
            M   DY+  +C+ GY+  +IS + G+ T+C     S+LD+N PSITIP+L++ +TLTRTV
Sbjct  1    MGIVDYIKYMCSAGYNDSSISRVLGKKTNCPIPKPSMLDINLPSITIPNLEKEVTLTRTV  60

Query  366  TNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKI-SFNVTISTCHGFNTGFYFGSL  190
            TNVGP  S Y+ ++E P GI + V P+TL F    K++ +F+V   T H  NTG++FGSL
Sbjct  61   TNVGPIKSVYRAVIESPLGITLTVNPTTLVFKSAAKRVLTFSVKAKTSHKVNTGYFFGSL  120

Query  189  IWNDGVHNVRIPISVKT  139
             W+DGVH+V IP+SVKT
Sbjct  121  TWSDGVHDVIIPVSVKT  137



>ref|NP_567625.4| subtilase 3.12 [Arabidopsis thaliana]
 gb|AEE84441.1| subtilase 3.12 [Arabidopsis thaliana]
Length=754

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 104/143 (73%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYDM+  DY++  CA GY+  +I+II G+ T C     SILD+N+P+ITIPDL+  +
Sbjct  608  PGLVYDMNIDDYIHYFCATGYNDTSITIITGKPTKCSSPLPSILDLNYPAITIPDLEEEV  667

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+TRTVTNVGP +S Y+ +VEPP+G+ +VV+P TL F  N KK+ F V +S+ H  NTGF
Sbjct  668  TVTRTVTNVGPVDSVYRAVVEPPRGVEIVVEPETLVFCSNTKKLGFKVRVSSSHKSNTGF  727

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
            +FGS  W DG  NV IP+SV+ +
Sbjct  728  FFGSFTWTDGTRNVTIPLSVRIR  750



>gb|ABV21208.1| At4g21326 [Arabidopsis thaliana]
Length=694

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 104/143 (73%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYDM+  DY++  CA GY+  +I+II G+ T C     SILD+N+P+ITIPDL+  +
Sbjct  548  PGLVYDMNIDDYIHYFCATGYNDTSITIITGKPTKCSSPLPSILDLNYPAITIPDLEEEV  607

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+TRTVTNVGP +S Y+ +VEPP+G+ +VV+P TL F  N KK+ F V +S+ H  NT F
Sbjct  608  TVTRTVTNVGPVDSVYRAVVEPPRGVEIVVEPETLVFCSNTKKLGFKVRVSSSHKSNTDF  667

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
            +FGS  W DG  NV IP+SV+T+
Sbjct  668  FFGSFTWTDGTRNVTIPLSVRTR  690



>ref|XP_010449088.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=800

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 100/147 (68%), Gaps = 4/147 (3%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMG-YSSKAISIIAGQTTS-C-HKGFSILDVNFPSITIPDLKR  391
            PGLVYDM   DY++ LC+   Y+ K +S +AG  T  C   G SILDVN PSITIPD+K 
Sbjct  648  PGLVYDMDINDYIHYLCSQALYTDKKVSALAGNVTKKCPSSGSSILDVNVPSITIPDVKG  707

Query  390  PITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTIS-TCHGFN  214
             IT+TRTVTNVGP +S Y  ++E P G  V V P  L F+    KI+F V++S   H  N
Sbjct  708  EITVTRTVTNVGPVDSVYTPVMEAPFGFSVKVSPEKLVFNKGSNKIAFKVSVSPGSHRVN  767

Query  213  TGFYFGSLIWNDGVHNVRIPISVKTKY  133
            T FYFGSL W+DGVHNV IPIS++T++
Sbjct  768  TAFYFGSLTWSDGVHNVTIPISLRTRF  794



>emb|CAB87667.1| subtilisin-like protease-like protein [Arabidopsis thaliana]
Length=755

 Score =   146 bits (369),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 99/145 (68%), Gaps = 3/145 (2%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCH---KGFSILDVNFPSITIPDLKR  391
            PGLVYD+S  DY   LCA  Y  K I+ I+   T         S+LD+N PSITIP LK 
Sbjct  604  PGLVYDISAEDYRLFLCASHYDEKQITKISKTHTPYRCPSPKPSMLDLNLPSITIPFLKE  663

Query  390  PITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNT  211
             +TLTRTVTNVGP +S YK++VEPP G+ + V P+TL F+ NVK +S+ VT+ST H  N+
Sbjct  664  DVTLTRTVTNVGPVDSVYKLIVEPPLGVKISVTPNTLLFNSNVKILSYKVTVSTTHKSNS  723

Query  210  GFYFGSLIWNDGVHNVRIPISVKTK  136
             +YFGSL W DG H V IP+SV+T+
Sbjct  724  IYYFGSLTWTDGSHKVTIPLSVRTQ  748



>ref|NP_568255.1| Subtilase family protein [Arabidopsis thaliana]
 gb|ABE66153.1| subtilase family protein [Arabidopsis thaliana]
 gb|AED91742.1| Subtilase family protein [Arabidopsis thaliana]
Length=762

 Score =   146 bits (369),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 99/145 (68%), Gaps = 3/145 (2%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCH---KGFSILDVNFPSITIPDLKR  391
            PGLVYD+S  DY   LCA  Y  K I+ I+   T         S+LD+N PSITIP LK 
Sbjct  611  PGLVYDISAEDYRLFLCASHYDEKQITKISKTHTPYRCPSPKPSMLDLNLPSITIPFLKE  670

Query  390  PITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNT  211
             +TLTRTVTNVGP +S YK++VEPP G+ + V P+TL F+ NVK +S+ VT+ST H  N+
Sbjct  671  DVTLTRTVTNVGPVDSVYKLIVEPPLGVKISVTPNTLLFNSNVKILSYKVTVSTTHKSNS  730

Query  210  GFYFGSLIWNDGVHNVRIPISVKTK  136
             +YFGSL W DG H V IP+SV+T+
Sbjct  731  IYYFGSLTWTDGSHKVTIPLSVRTQ  755



>ref|XP_006391366.1| hypothetical protein EUTSA_v10018188mg [Eutrema salsugineum]
 gb|ESQ28652.1| hypothetical protein EUTSA_v10018188mg [Eutrema salsugineum]
Length=729

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 92/143 (64%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPI  385
            PGLVYDM   DYV+ LC+  Y    IS + G+   C     S+L+ N PSITIP L   +
Sbjct  581  PGLVYDMGFDDYVHYLCSAEYGDSEISKLIGKDYKCPWPKPSMLNFNLPSITIPSLTGEV  640

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+ RTVTNVGP  S YK MVE P GI + V P TL F  N  KI+++V + T H  N+ F
Sbjct  641  TVARTVTNVGPPGSVYKAMVENPFGIELEVNPKTLEFGSNTTKITYSVRVRTNHKVNSDF  700

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
            YFGSL W DGVHNV IP+SV+TK
Sbjct  701  YFGSLCWTDGVHNVTIPVSVRTK  723



>gb|AID21685.1| At4g21326p-like protein [Arabidopsis lyrata]
Length=756

 Score =   146 bits (368),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 104/143 (73%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYDM+  DY++  CA GY+  AI++I G+ T C     S+LD+N+P+ITIPDL+  +
Sbjct  610  PGLVYDMNLDDYIHYFCATGYNDTAITLITGKPTKCSSPLPSVLDLNYPAITIPDLEEEV  669

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+TRTVTNVGP +S Y+ +VEPP+G+ +VV+P TL F  N KK+ F V +S+ H  NTGF
Sbjct  670  TVTRTVTNVGPVDSVYRAVVEPPQGVKIVVEPETLIFCSNTKKLGFKVRVSSSHKSNTGF  729

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
             FGS  W DG  NV IP+SV+T+
Sbjct  730  IFGSFTWTDGTRNVTIPLSVRTR  752



>gb|ADQ37356.1| unknown [Arabidopsis lyrata]
Length=696

 Score =   145 bits (366),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 103/143 (72%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYDM+  DY++  CA GY+  AI++I G+ T C     SILD+N+P+ITIPDL+  +
Sbjct  550  PGLVYDMNLDDYIHYFCATGYNDTAITLITGKPTKCSSPLPSILDLNYPAITIPDLEEEV  609

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+TRTVTNVGP +S Y+ +VEPP+G+ +VV+P TL F  N KK+ F V +S+ H  NTGF
Sbjct  610  TVTRTVTNVGPVDSVYRAVVEPPRGVKIVVEPETLMFCSNTKKLEFKVRVSSSHKSNTGF  669

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
             FG   W DG  NV IP+SV+T+
Sbjct  670  IFGIFTWTDGTRNVTIPLSVRTR  692



>emb|CDX99526.1| BnaC09g24660D [Brassica napus]
Length=753

 Score =   146 bits (368),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 95/144 (66%), Gaps = 11/144 (8%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRP  388
            KPGLVYD+   DYV  +C +           G+ T C     S+LD N PSIT+P+LK  
Sbjct  611  KPGLVYDLGLEDYVLYMCTL----------VGKGTICSNPIPSVLDFNLPSITVPNLKEE  660

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +TLTRT+TNVGP +S YKV VEPP G+ V V P TL F+   KK+SF V +S  H  NTG
Sbjct  661  VTLTRTLTNVGPVDSVYKVAVEPPFGVQVTVTPETLVFNSTNKKVSFQVRVSATHKTNTG  720

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            +YFGSL W+D VHNV IP+SV+T+
Sbjct  721  YYFGSLTWSDYVHNVTIPLSVRTQ  744



>gb|AAG51763.1|AC066691_3 hypothetical protein; 8963-6048 [Arabidopsis thaliana]
Length=758

 Score =   145 bits (367),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 96/144 (67%), Gaps = 2/144 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYDM   +YV+ LC+ GY + +IS + G+  +C     S+LDVN PSITIP L   I
Sbjct  609  PGLVYDMGHDEYVHYLCSAGYDNTSISKLLGEIYTCPTPIPSMLDVNMPSITIPYLSEEI  668

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+TRTVTNVGP  S YK +++ P+GI + V P TL F  N  K +F V +ST H  NT +
Sbjct  669  TITRTVTNVGPVGSVYKAVIQAPQGINLQVSPETLEFGSNTNKTTFTVKVSTTHRANTDY  728

Query  204  YFGSLIWNDGV-HNVRIPISVKTK  136
             FGSL W D   HNVRIP+SV+T+
Sbjct  729  LFGSLTWADNEGHNVRIPLSVRTR  752



>ref|NP_564868.2| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
 dbj|BAC43166.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64891.1| At1g66210 [Arabidopsis thaliana]
 gb|AEE34477.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
Length=759

 Score =   145 bits (367),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 96/144 (67%), Gaps = 2/144 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYDM   +YV+ LC+ GY + +IS + G+  +C     S+LDVN PSITIP L   I
Sbjct  610  PGLVYDMGHDEYVHYLCSAGYDNTSISKLLGEIYTCPTPIPSMLDVNMPSITIPYLSEEI  669

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+TRTVTNVGP  S YK +++ P+GI + V P TL F  N  K +F V +ST H  NT +
Sbjct  670  TITRTVTNVGPVGSVYKAVIQAPQGINLQVSPETLEFGSNTNKTTFTVKVSTTHRANTDY  729

Query  204  YFGSLIWNDGV-HNVRIPISVKTK  136
             FGSL W D   HNVRIP+SV+T+
Sbjct  730  LFGSLTWADNEGHNVRIPLSVRTR  753



>ref|XP_002869894.1| hypothetical protein ARALYDRAFT_329472 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46153.1| hypothetical protein ARALYDRAFT_329472 [Arabidopsis lyrata subsp. 
lyrata]
Length=1745

 Score =   147 bits (371),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 104/143 (73%), Gaps = 1/143 (1%)
 Frame = -1

Query  561   PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
             PGLVYDM+  DY++  CA GY+  AI++I G+ T C     S+LD+N+P+ITIPDL+  +
Sbjct  1599  PGLVYDMNLDDYIHYFCATGYNDTAITLITGKPTKCSSPLPSVLDLNYPAITIPDLEEEV  1658

Query  384   TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
             T+TRTVTNVGP +S Y+ +VEPP+G+ +VV+P TL F  N KK+ F V +S+ H  NTGF
Sbjct  1659  TVTRTVTNVGPVDSVYRAVVEPPRGVKIVVEPETLVFCSNTKKLEFKVRVSSSHKSNTGF  1718

Query  204   YFGSLIWNDGVHNVRIPISVKTK  136
              FGS  W DG  NV IP+SV+T+
Sbjct  1719  IFGSFTWTDGTRNVTIPLSVRTR  1741


 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 73/112 (65%), Gaps = 3/112 (3%)
 Frame = -1

Query  561   PGLVYDMSTTDYVNCLCAMG-YSSKAISIIAGQTTS-CHKG-FSILDVNFPSITIPDLKR  391
             PGLVYDM   DY++ LC+   Y+ K +S + G  TS C     SILD+N PSITIPDLKR
Sbjct  935   PGLVYDMDINDYIHYLCSQALYTDKKVSALTGNITSKCPSSCSSILDLNVPSITIPDLKR  994

Query  390   PITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTI  235
              +T+TRTVTNVGP  S YK ++E P G  VVV P  L F+    K++F + I
Sbjct  995   DVTVTRTVTNVGPVKSVYKPVIETPLGFKVVVSPKKLKFNKRRNKVAFKIYI  1046



>emb|CAA20197.1| putative protein [Arabidopsis thaliana]
 emb|CAB79131.1| putative protein [Arabidopsis thaliana]
Length=1736

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 104/143 (73%), Gaps = 1/143 (1%)
 Frame = -1

Query  561   PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
             PGLVYDM+  DY++  CA GY+  +I+II G+ T C     SILD+N+P+ITIPDL+  +
Sbjct  1590  PGLVYDMNIDDYIHYFCATGYNDTSITIITGKPTKCSSPLPSILDLNYPAITIPDLEEEV  1649

Query  384   TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
             T+TRTVTNVGP +S Y+ +VEPP+G+ +VV+P TL F  N KK+ F V +S+ H  NTGF
Sbjct  1650  TVTRTVTNVGPVDSVYRAVVEPPRGVEIVVEPETLVFCSNTKKLGFKVRVSSSHKSNTGF  1709

Query  204   YFGSLIWNDGVHNVRIPISVKTK  136
             +FGS  W DG  NV IP+SV+ +
Sbjct  1710  FFGSFTWTDGTRNVTIPLSVRIR  1732


 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 68/112 (61%), Gaps = 3/112 (3%)
 Frame = -1

Query  561   PGLVYDMSTTDYVNCLCAMG-YSSKAISIIAGQTTS-C-HKGFSILDVNFPSITIPDLKR  391
             PGLVYDM   DY + LC+   Y+ K +S + G   + C     SILD+N PSITIPDLK 
Sbjct  938   PGLVYDMDINDYTHYLCSQTLYTDKKVSALTGNVNNKCPSSSSSILDLNVPSITIPDLKG  997

Query  390   PITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTI  235
              + +TRTVTNVG   S YK ++E P G  VVV P  L F+    K++F + +
Sbjct  998   TVNVTRTVTNVGRVKSVYKPVIEAPFGFNVVVSPKKLKFNKTRNKLAFTIYV  1049



>gb|AJP61136.1| At4g21326p-like protein [Arabidopsis halleri]
Length=756

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 103/143 (72%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYDM+  DY++  CA GY+  AI++I G+ T C     SILD+N+P+ITIPDL+  +
Sbjct  610  PGLVYDMNLDDYIHYFCATGYNDTAITLITGKPTRCSSPLPSILDLNYPAITIPDLEEEV  669

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+TRTVTNVGP +S Y+ +VEPP+G+ +VV+P TL F  N KK+ F V +S+ H  NTGF
Sbjct  670  TVTRTVTNVGPVDSVYRAVVEPPRGVKIVVEPETLVFCSNTKKLEFKVRVSSSHKSNTGF  729

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
             FG   W DG  NV IP+SV+T+
Sbjct  730  IFGIFTWTDGTRNVTIPLSVRTR  752



>gb|AID21653.1| At4g21326p-like protein [Arabidopsis lyrata]
Length=756

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 103/143 (72%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYDM+  DY++  CA GY+  AI++I G+ T C     SILD+N+P+ITIPDL+  +
Sbjct  610  PGLVYDMNLDDYIHYFCATGYNDTAITLITGKPTKCSSPLPSILDLNYPAITIPDLEEEV  669

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+TRTVTNVGP +S Y+ +VEPP+G+ +VV+P TL F  N KK+ F V +S+ H  NTGF
Sbjct  670  TVTRTVTNVGPVDSVYRAVVEPPRGVKIVVEPETLVFCSNTKKLEFKVRVSSSHKSNTGF  729

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
             FG   W DG  NV IP+SV+T+
Sbjct  730  IFGIFTWTDGTRNVTIPLSVRTR  752



>gb|AJP61138.1| At4g21323p-like protein, partial [Arabidopsis halleri]
Length=774

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 100/147 (68%), Gaps = 4/147 (3%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMG-YSSKAISIIAGQTTS-C-HKGFSILDVNFPSITIPDLKR  391
            PGLVYDM   DY++ LC+   Y+ K +S + G  TS C   G SILD+N PSITIPDLKR
Sbjct  622  PGLVYDMDINDYIHYLCSQALYTDKKVSALTGNVTSKCPSSGSSILDLNVPSITIPDLKR  681

Query  390  PITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTIS-TCHGFN  214
             +T+TR+VTNVG   S YK ++E P G  VVV P  L F+    K++F V +S   H  N
Sbjct  682  NVTVTRSVTNVGAVKSVYKPVIETPLGFKVVVSPKKLKFNKRRNKVAFKVRVSPGSHRVN  741

Query  213  TGFYFGSLIWNDGVHNVRIPISVKTKY  133
            + F+FGSL W+DG+HNV IPIS++T++
Sbjct  742  SAFFFGSLTWSDGLHNVTIPISLRTRF  768



>ref|XP_010470496.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Camelina 
sativa]
Length=676

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 103/145 (71%), Gaps = 3/145 (2%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPI  385
            PGLVYDM   +YV+ LC+ GY++ +IS + G+  +C     S+LDVN PSITIP L + I
Sbjct  526  PGLVYDMGENEYVHYLCSAGYNNTSISKLLGKIYTCPSPSPSMLDVNLPSITIPYLSKEI  585

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPN-VKKISFNVTISTCHGFNTG  208
            T+TRTVTNVGP  S YK +++ P+GI + V P TL FS N   K++F V +ST H  NT 
Sbjct  586  TVTRTVTNVGPVGSVYKAVIQQPQGINLQVSPETLEFSSNTTNKLTFTVKVSTAHRANTD  645

Query  207  FYFGSLIW-NDGVHNVRIPISVKTK  136
            ++FGSL W ++G H+VRIP+SV+T+
Sbjct  646  YHFGSLSWIDNGGHSVRIPLSVRTR  670



>emb|CDY25259.1| BnaA02g21970D [Brassica napus]
Length=742

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 97/144 (67%), Gaps = 12/144 (8%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGFS-ILDVNFPSITIPDLKRP  388
            KPGLVYDM+T DYV  LCA  Y           TT C      +LD+N PSITIP+L+  
Sbjct  601  KPGLVYDMATHDYVLYLCAADY-----------TTVCPTPKPWVLDLNLPSITIPNLRDE  649

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +TLTRTVTNVGP NS YKV++ PP G+ V V P+T  F+    K+SF V ++T H  NTG
Sbjct  650  VTLTRTVTNVGPLNSVYKVVINPPTGVNVGVTPTTFVFNSTATKLSFTVRVTTTHRVNTG  709

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            ++FGSL W+D +HNV IP+SV+T+
Sbjct  710  YFFGSLTWSDNMHNVAIPLSVRTQ  733



>ref|XP_006283139.1| hypothetical protein CARUB_v10004165mg [Capsella rubella]
 gb|EOA16037.1| hypothetical protein CARUB_v10004165mg [Capsella rubella]
Length=803

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 100/150 (67%), Gaps = 10/150 (7%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMG-YSSKAISIIAGQTT-----SCHKGFSILDVNFPSITIPD  400
            PGLVYDM   DY++ LC+   Y+ K +S + G  T     SC    SILD+N PSITIPD
Sbjct  651  PGLVYDMDINDYIHYLCSQALYTDKKVSALTGNVTKKCPSSCS---SILDLNVPSITIPD  707

Query  399  LKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTIS-TCH  223
            L   IT+TRT+TNVGP +S Y+ ++E P G  VVV P  L F+   KK +F V++S   H
Sbjct  708  LSENITVTRTLTNVGPVDSVYRPVIEAPSGFSVVVSPEKLVFNKGTKKNAFTVSVSPGSH  767

Query  222  GFNTGFYFGSLIWNDGVHNVRIPISVKTKY  133
              NT FYFGSL W+DGVHNV IP+S++T++
Sbjct  768  RVNTAFYFGSLTWSDGVHNVTIPVSLRTRF  797



>gb|ADQ37388.1| unknown [Capsella rubella]
Length=700

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 102/143 (71%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYDM+  DY++  CA GY+  AI+ + G+ T C     SILD+N+P+ITI DL+  +
Sbjct  554  PGLVYDMNVDDYIDFFCASGYNETAITTLVGKPTKCSSPLPSILDLNYPAITITDLEEEV  613

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+TRTVTNVGP NS YK +VEPP+G+ +VV+P TL F  N KK+ F V +S+ H  NTGF
Sbjct  614  TVTRTVTNVGPVNSVYKAVVEPPQGVKIVVEPETLVFCSNTKKLGFKVRVSSSHKSNTGF  673

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
             FGS  W DG  NV IP+SV+T+
Sbjct  674  IFGSFTWTDGSRNVTIPLSVRTR  696



>gb|AID21581.1| AT4G21326p [Arabidopsis halleri]
 gb|AID21618.1| At4g21326p-like protein [Arabidopsis halleri]
Length=756

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 103/143 (72%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYDM+  DY++  CA GY+  AI++I G+ T C     SILD+N+P+ITIPDL+  +
Sbjct  610  PGLVYDMNLDDYIHYFCATGYNDTAITLITGKPTRCSSPLPSILDLNYPAITIPDLEEEV  669

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+TRTVTNVGP +S Y+ +VEPP+G+ +VV+P TL F  N KK+ F V +S+ H  NTGF
Sbjct  670  TVTRTVTNVGPVDSVYRAVVEPPRGVNIVVEPETLVFCSNTKKLEFKVRVSSSHKSNTGF  729

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
             FG   W DG  NV IP+SV+T+
Sbjct  730  IFGIFTWTDGTRNVTIPLSVRTR  752



>ref|XP_002871506.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47765.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=762

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 97/145 (67%), Gaps = 3/145 (2%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTT--SCHKGF-SILDVNFPSITIPDLKR  391
            PGLVYD+   DY   LCA  Y  + I+ I+   T   C     S+LD+N PSITIP LK 
Sbjct  611  PGLVYDIGAEDYRLFLCASDYDERQITKISKTNTPYRCPSPRPSMLDLNLPSITIPFLKE  670

Query  390  PITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNT  211
             +TLTRTVTNVGP +S YK++V PP G+ + V P TL F+ NVKK+SF V +ST H  N+
Sbjct  671  DVTLTRTVTNVGPVDSVYKLVVRPPLGVKISVTPKTLLFNSNVKKLSFKVIVSTTHKSNS  730

Query  210  GFYFGSLIWNDGVHNVRIPISVKTK  136
             +YFGSL W DG H V IP+SV+T+
Sbjct  731  IYYFGSLTWTDGSHKVTIPLSVRTQ  755



>ref|XP_010470495.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Camelina 
sativa]
Length=760

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 103/145 (71%), Gaps = 3/145 (2%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPI  385
            PGLVYDM   +YV+ LC+ GY++ +IS + G+  +C     S+LDVN PSITIP L + I
Sbjct  610  PGLVYDMGENEYVHYLCSAGYNNTSISKLLGKIYTCPSPSPSMLDVNLPSITIPYLSKEI  669

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPN-VKKISFNVTISTCHGFNTG  208
            T+TRTVTNVGP  S YK +++ P+GI + V P TL FS N   K++F V +ST H  NT 
Sbjct  670  TVTRTVTNVGPVGSVYKAVIQQPQGINLQVSPETLEFSSNTTNKLTFTVKVSTAHRANTD  729

Query  207  FYFGSLIW-NDGVHNVRIPISVKTK  136
            ++FGSL W ++G H+VRIP+SV+T+
Sbjct  730  YHFGSLSWIDNGGHSVRIPLSVRTR  754



>ref|XP_006283179.1| hypothetical protein CARUB_v10004209mg [Capsella rubella]
 gb|EOA16077.1| hypothetical protein CARUB_v10004209mg [Capsella rubella]
Length=760

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 102/143 (71%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYDM+  DY++  CA GY+  AI+ + G+ T C     SILD+N+P+ITI DL+  +
Sbjct  614  PGLVYDMNVDDYIDFFCASGYNETAITTLVGKPTKCSSPLPSILDLNYPAITITDLEEEV  673

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+TRTVTNVGP NS YK +VEPP+G+ +VV+P TL F  N KK+ F V +S+ H  NTGF
Sbjct  674  TVTRTVTNVGPVNSVYKAVVEPPQGVKIVVEPETLVFCSNTKKLGFKVRVSSSHKSNTGF  733

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
             FGS  W DG  NV IP+SV+T+
Sbjct  734  IFGSFTWTDGSRNVTIPLSVRTR  756



>ref|XP_006829608.1| hypothetical protein AMTR_s00122p00022570 [Amborella trichopoda]
 gb|ERM97024.1| hypothetical protein AMTR_s00122p00022570 [Amborella trichopoda]
Length=180

 Score =   135 bits (340),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 93/141 (66%), Gaps = 1/141 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGL+YDM  +D++  LCAMGY++ AIS +A +  SC K   SI ++N PSI IP+LK  +
Sbjct  29   PGLIYDMDISDHIMFLCAMGYNNSAISFVASEKISCPKEPPSIPNLNLPSIVIPELKTSV  88

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+TR VTNVG   S Y+ MV  P G+ VVV+P+ L F+   K + F VT +  H     +
Sbjct  89   TITRKVTNVGEVQSVYQAMVLSPTGVKVVVEPAVLYFNNATKVLPFKVTFTVVHQMQGDY  148

Query  204  YFGSLIWNDGVHNVRIPISVK  142
             FGSLIW+DG H VR PI+V+
Sbjct  149  TFGSLIWSDGEHFVRSPIAVR  169



>gb|AID21603.1| At4g21326p-like protein [Arabidopsis halleri]
Length=756

 Score =   144 bits (362),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 103/143 (72%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYDM+  DY++  CA GY+  +I+I+ G+ T C     SILD+N+P+ITIPDL+  +
Sbjct  610  PGLVYDMNLDDYIHYFCATGYNDTSITILTGKPTKCSSPLPSILDLNYPAITIPDLEEEV  669

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+TRTVTNVGP +S Y+ +VEPP+G+ +VV+P TL F  N KK+ F V +S+ H  NTGF
Sbjct  670  TVTRTVTNVGPVDSVYRAVVEPPRGVKIVVEPETLVFCSNTKKLEFKVRVSSSHKSNTGF  729

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
             FG   W DG  NV IP+SV+T+
Sbjct  730  IFGIFTWTDGTRNVTIPLSVRTR  752



>ref|XP_004957446.1| PREDICTED: subtilisin-like protease SDD1-like [Setaria italica]
Length=768

 Score =   144 bits (362),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 94/142 (66%), Gaps = 1/142 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPI  385
            PGLVYDM T+DYV  LC+MGY+S AIS +  Q  +C H   + L++N PSITIP+L+  +
Sbjct  618  PGLVYDMGTSDYVRFLCSMGYNSSAISSMTQQHATCQHTPKTQLNLNLPSITIPELRGKL  677

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T++RTVTNVG   S Y+  VEPP G+ V V PS L F+  V++++F VT          +
Sbjct  678  TVSRTVTNVGSVMSKYRAHVEPPPGVDVAVSPSLLTFNSTVRRLTFKVTFQAKLKVQGRY  737

Query  204  YFGSLIWNDGVHNVRIPISVKT  139
             FGSL W DG H VRIP+ V+T
Sbjct  738  TFGSLTWEDGAHTVRIPLVVRT  759



>gb|AJP61119.1| At4g21326p-like protein [Arabidopsis halleri]
Length=756

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 103/143 (72%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYDM+  DY++  CA GY+  +I+I+ G+ T C     SILD+N+P+ITIPDL+  +
Sbjct  610  PGLVYDMNLDDYIHYFCATGYNDTSITILTGKPTKCSSPLPSILDLNYPAITIPDLEEEV  669

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+TRTVTNVGP +S Y+ +VEPP+G+ +VV+P TL F  N KK+ F V +S+ H  NTGF
Sbjct  670  TVTRTVTNVGPVDSVYRAVVEPPRGVKIVVEPETLVFCSNTKKLEFKVRVSSSHKSNTGF  729

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
             FG   W DG  NV IP+SV+T+
Sbjct  730  IFGIFTWTDGTRNVTIPLSVRTR  752



>emb|CCI61494.1| unnamed protein product [Arabidopsis halleri]
 gb|AJP61099.1| At4g21326p-like protein [Arabidopsis halleri]
 gb|AJP61132.1| At4g21326p-like protein [Arabidopsis halleri]
Length=756

 Score =   143 bits (361),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 103/143 (72%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYDM+  DY++  CA GY+  +I+I+ G+ T C     SILD+N+P+ITIPDL+  +
Sbjct  610  PGLVYDMNLDDYIHYFCATGYNDTSITILTGKPTKCSSPLPSILDLNYPAITIPDLEEEV  669

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+TRTVTNVGP +S Y+ +VEPP+G+ +VV+P TL F  N KK+ F V +S+ H  NTGF
Sbjct  670  TVTRTVTNVGPVDSVYRAVVEPPRGVKIVVEPETLVFCSNTKKLEFKVRVSSSHKSNTGF  729

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
             FG   W DG  NV IP+SV+T+
Sbjct  730  IFGIFTWTDGTRNVTIPLSVRTR  752



>gb|ADQ37368.1| unknown [Arabidopsis lyrata]
Length=696

 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 102/143 (71%), Gaps = 1/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYDM+  DY++  CA GY+  AI++I G+ T C     SILD+N+P+ITIPDL+  +
Sbjct  550  PGLVYDMNLDDYIHYFCATGYNDTAITLITGKPTKCSSPLPSILDLNYPAITIPDLEEEV  609

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+TRTVTNVGP +S Y+ +VEPP+G+ +VV+P  L F  N KK+ F V +S+ H  NTGF
Sbjct  610  TVTRTVTNVGPVDSVYRAVVEPPRGVKIVVEPEILMFCSNTKKLEFKVRVSSSHKSNTGF  669

Query  204  YFGSLIWNDGVHNVRIPISVKTK  136
             FGS  W DG  NV I +SV+T+
Sbjct  670  IFGSFTWTDGTRNVTISLSVRTR  692



>ref|XP_010919043.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X2 [Elaeis 
guineensis]
Length=741

 Score =   143 bits (360),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 94/141 (67%), Gaps = 0/141 (0%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGFSILDVNFPSITIPDLKRPIT  382
            PGLVY+MST DYV  LC++GY+  AIS +  Q  +C    S LD+N PSI IP+LK  +T
Sbjct  592  PGLVYNMSTVDYVPFLCSLGYNDSAISNLINQQINCPITSSALDLNLPSIVIPNLKGTVT  651

Query  381  LTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFY  202
            +TRT+TNVGP NS Y+  V PP+GI + V P  L F+  +  ISF VT ++    ++ + 
Sbjct  652  ITRTMTNVGPANSVYEARVHPPRGIKMEVMPLILEFNSTITSISFTVTFTSSRRVHSDYR  711

Query  201  FGSLIWNDGVHNVRIPISVKT  139
            FGSL W DGVH VR P++V+ 
Sbjct  712  FGSLTWTDGVHVVRSPVAVRA  732



>ref|XP_008778788.1| PREDICTED: subtilisin-like protease SBT5.4, partial [Phoenix 
dactylifera]
Length=411

 Score =   140 bits (352),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 91/142 (64%), Gaps = 1/142 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGL+YDM  +DYV  LC+MGY++  IS +    T CH    S  D+N PSI+IP+LK+ +
Sbjct  261  PGLIYDMEISDYVRFLCSMGYNNSVISSMTQHNTICHNASKSQKDLNLPSISIPELKKTV  320

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T +RTVTNVGP  S Y   VE P G+ V VKPS L F   +KK+ F VT          +
Sbjct  321  TASRTVTNVGPVMSAYAAHVETPPGVSVHVKPSILLFDSTIKKLKFQVTFQPRLKLQGRY  380

Query  204  YFGSLIWNDGVHNVRIPISVKT  139
             FGSL W+DG+H VRIP++V+T
Sbjct  381  SFGSLTWDDGIHLVRIPLAVRT  402



>ref|XP_010919042.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X1 [Elaeis 
guineensis]
Length=792

 Score =   143 bits (360),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 94/141 (67%), Gaps = 0/141 (0%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGFSILDVNFPSITIPDLKRPIT  382
            PGLVY+MST DYV  LC++GY+  AIS +  Q  +C    S LD+N PSI IP+LK  +T
Sbjct  643  PGLVYNMSTVDYVPFLCSLGYNDSAISNLINQQINCPITSSALDLNLPSIVIPNLKGTVT  702

Query  381  LTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFY  202
            +TRT+TNVGP NS Y+  V PP+GI + V P  L F+  +  ISF VT ++    ++ + 
Sbjct  703  ITRTMTNVGPANSVYEARVHPPRGIKMEVMPLILEFNSTITSISFTVTFTSSRRVHSDYR  762

Query  201  FGSLIWNDGVHNVRIPISVKT  139
            FGSL W DGVH VR P++V+ 
Sbjct  763  FGSLTWTDGVHVVRSPVAVRA  783



>ref|XP_009407970.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009407971.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=769

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 96/142 (68%), Gaps = 2/142 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYDM  + YV+ LC++GY++ A+S +    T CH  + S  D+N PSITIP LK   
Sbjct  618  PGLVYDMRVSAYVHFLCSVGYNNSAVSSLTQHPTICHDIYQSHKDLNLPSITIPQLKESF  677

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T+TRTVTNVGP  STY   VE P+G+ V V+PS L F+  V+K+ F VT  +     +G+
Sbjct  678  TVTRTVTNVGPATSTYTAHVEAPRGVSVRVRPSILAFNSTVQKLKFKVTFGSRLKVQSGY  737

Query  204  YFGSLIWNDGVHN-VRIPISVK  142
             FGSL W DGVH+ VRIP++++
Sbjct  738  LFGSLTWKDGVHHLVRIPLAIR  759



>emb|CDY70485.1| BnaA03g58450D, partial [Brassica napus]
Length=734

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 99/144 (69%), Gaps = 2/144 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYD++  DY++  CA GY+  +I+++ G+   C     SILD N+P+ITIP++K  +
Sbjct  590  PGLVYDLNLDDYIHFFCASGYNDTSIALLTGKDAKCPSPLPSILDFNYPAITIPEVKDEV  649

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T++RTVTNVGP +S Y+ ++EPP+G+ + V+P TL F+ + K + F V ++T H  N   
Sbjct  650  TVSRTVTNVGPVDSVYRAVIEPPRGVKIAVEPETLVFNASTKILGFKVRVTTSHKNNMPV  709

Query  204  Y-FGSLIWNDGVHNVRIPISVKTK  136
            Y FGS  W DG  NV IP+SV+T+
Sbjct  710  YLFGSFTWTDGTRNVTIPLSVRTR  733



>ref|XP_009137186.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=746

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 99/144 (69%), Gaps = 2/144 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPI  385
            PGLVYD++  DY++  CA GY+  +I+++ G+   C     SILD N+P+ITIP++K  +
Sbjct  602  PGLVYDLNLDDYIHFFCASGYNDTSIALLTGKDAKCPSPLPSILDFNYPAITIPEVKDEV  661

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T++RTVTNVGP +S Y+ ++EPP+G+ + V+P TL F+ + K + F V ++T H  N   
Sbjct  662  TVSRTVTNVGPVDSVYRAVIEPPRGVKIAVEPETLVFNASTKILGFKVRVTTSHKNNMPV  721

Query  204  Y-FGSLIWNDGVHNVRIPISVKTK  136
            Y FGS  W DG  NV IP+SV+T+
Sbjct  722  YLFGSFTWTDGTRNVTIPLSVRTR  745



>gb|KFK31852.1| hypothetical protein AALP_AA6G166800 [Arabis alpina]
Length=1462

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 107/144 (74%), Gaps = 1/144 (1%)
 Frame = -1

Query  564   KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRP  388
             KPGLVYDM+T DY+  LC+  YS  +IS + G+TT C +   S+LD+N PSITIP+LK  
Sbjct  1310  KPGLVYDMATHDYIMYLCSADYSDISISRVLGKTTVCPNPKPSVLDLNLPSITIPNLKDE  1369

Query  387   ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
             +T+TRTVTNVGP +S Y V+++PP GI V V P+TL F+   +K+SF V +ST H  NTG
Sbjct  1370  VTVTRTVTNVGPLDSIYNVVIDPPTGINVTVTPTTLVFNSTTRKLSFTVRVSTTHKVNTG  1429

Query  207   FYFGSLIWNDGVHNVRIPISVKTK  136
             +YFGSL W D +H+V IP+SV+T+
Sbjct  1430  YYFGSLSWTDNLHDVAIPVSVRTQ  1453


 Score =   113 bits (283),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 75/111 (68%), Gaps = 1/111 (1%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRP  388
            K GLVYD+   DYV  +C+ GY+  +IS + G+ T C     S+LD N PSITIP+LK  
Sbjct  627  KAGLVYDLGLEDYVLYMCSAGYNDSSISQLVGKGTVCSNPRPSVLDFNLPSITIPNLKEE  686

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTI  235
            +TLTRT+TNVGP +S YKV VEPP G+ V V P TL F+   K++SF V +
Sbjct  687  VTLTRTLTNVGPLDSVYKVAVEPPLGVQVTVTPKTLVFNSRTKRVSFKVYV  737



>ref|NP_001159267.1| uncharacterized protein LOC100304357 precursor [Zea mays]
 gb|ACN25629.1| unknown [Zea mays]
Length=768

 Score =   141 bits (356),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 71/142 (50%), Positives = 95/142 (67%), Gaps = 1/142 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPI  385
            PGLVYDM T+DYV  LC+MGY+  AIS +A Q  +C H   + L++N PSI+IP+L+  +
Sbjct  618  PGLVYDMGTSDYVRFLCSMGYNVSAISSLAQQHETCQHTPKTQLNLNLPSISIPELRGRL  677

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T++RTVTNVG   + Y+  VE P G+ V V PS L F+  V+K++F VT          +
Sbjct  678  TVSRTVTNVGSALTKYRARVEAPPGVDVTVSPSLLTFNSTVRKLTFKVTFQAKLKVQGRY  737

Query  204  YFGSLIWNDGVHNVRIPISVKT  139
            YFGSL W DGVH VRIP+ V+T
Sbjct  738  YFGSLTWEDGVHAVRIPLVVRT  759



>ref|XP_010538683.1| PREDICTED: subtilisin-like protease SBT3.5 [Tarenaya hassleriana]
Length=696

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 105/144 (73%), Gaps = 2/144 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDL-KRP  388
            PGLVYDM   DY++  CA  Y+  AIS + G++ +C     SILDVN PSITIPDL +  
Sbjct  549  PGLVYDMGIEDYIHYFCARSYNDSAISKLVGKSVTCPSPRPSILDVNVPSITIPDLDEEA  608

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +T+TRTVTNVGP +S Y+ +VEPP GI ++VKP  L F+ + KK +F++++ST H  NTG
Sbjct  609  VTVTRTVTNVGPVDSVYRAVVEPPLGINILVKPEALAFNSDTKKQTFSMSVSTSHKTNTG  668

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            F+FGSL+W DG  NV +P+SV+T+
Sbjct  669  FFFGSLVWTDGTRNVSVPLSVRTQ  692



>ref|XP_006370728.1| hypothetical protein POPTR_0001s45460g, partial [Populus trichocarpa]
 gb|ERP67297.1| hypothetical protein POPTR_0001s45460g, partial [Populus trichocarpa]
Length=333

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 92/144 (64%), Gaps = 11/144 (8%)
 Frame = -1

Query  564  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRP  388
            +PGLVYDM T DY++ LCA+G +  +IS++ G+ T+C     SILDVN PSITIP+L + 
Sbjct  195  EPGLVYDMGTNDYIHYLCAVGNNDSSISLVVGKVTTCPGTIPSILDVNLPSITIPNLSKS  254

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            + LTRTV NVG           PP GI V V+P T  F+     +SF VT ST H  NT 
Sbjct  255  VVLTRTVKNVG----------SPPFGISVSVRPQTSIFNSTTNTVSFKVTFSTTHKVNTR  304

Query  207  FYFGSLIWNDGVHNVRIPISVKTK  136
            FYFGSL W DG H V  PISV+T+
Sbjct  305  FYFGSLTWTDGFHAVTSPISVRTQ  328



>ref|XP_010109770.1| hypothetical protein L484_008446 [Morus notabilis]
 gb|EXC24675.1| hypothetical protein L484_008446 [Morus notabilis]
Length=745

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 94/143 (66%), Gaps = 2/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGFS--ILDVNFPSITIPDLKRP  388
            PGL+YD+ T+DY+  LC+MGY++ AIS +A  +  C    +  +LD+N PSITIP+L R 
Sbjct  594  PGLIYDLGTSDYIRFLCSMGYNNTAISYLANSSIKCSTKSTEFLLDLNLPSITIPELMRS  653

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            +T+TRTVTNVGP NS Y   VE P G+   VKPS L F+  VKK+ F V+          
Sbjct  654  LTVTRTVTNVGPVNSVYIARVEAPAGVTASVKPSVLVFNSTVKKLKFKVSFCARIRTQGR  713

Query  207  FYFGSLIWNDGVHNVRIPISVKT  139
            + FG+L W DGVH VRIP+ V+T
Sbjct  714  YSFGNLFWGDGVHVVRIPLVVRT  736



>ref|XP_007201744.1| hypothetical protein PRUPE_ppa001956mg [Prunus persica]
 gb|EMJ02943.1| hypothetical protein PRUPE_ppa001956mg [Prunus persica]
Length=736

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 98/142 (69%), Gaps = 1/142 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGFS-ILDVNFPSITIPDLKRPI  385
            PGL+YD+ ++DY++ LC+MGY++ AIS++AG   +C K    I+++N PSITI +LK+ +
Sbjct  586  PGLIYDIESSDYIHFLCSMGYNNTAISLVAGTKITCQKSTKFIVNLNLPSITIHELKQSM  645

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T++R VTNVGP NS Y   V+ P G+ V VKPS L+F+  VKK+ F V   +       F
Sbjct  646  TVSRRVTNVGPVNSVYFARVQAPAGVSVKVKPSVLSFNSTVKKLEFKVIFCSLLRVQGRF  705

Query  204  YFGSLIWNDGVHNVRIPISVKT  139
             FG+L W DG+H VRIP+ V+T
Sbjct  706  TFGNLFWEDGLHVVRIPLVVRT  727



>ref|XP_009351288.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Pyrus 
x bretschneideri]
Length=771

 Score =   140 bits (354),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 97/141 (69%), Gaps = 1/141 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGFSILD-VNFPSITIPDLKRPI  385
            PGL+YD+ ++DY+  LC+MGY++ AIS++AG   +C K  + ++ +N PSITI +LK+  
Sbjct  621  PGLIYDIESSDYIRFLCSMGYNNTAISLVAGAKITCRKSTNFINNLNLPSITIHELKQST  680

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T++RTVTNVGP NSTY   V  P G+ V VKPS L+F+  VKK+ F VT  +       F
Sbjct  681  TVSRTVTNVGPVNSTYNARVITPAGVSVRVKPSILSFNSTVKKLEFKVTFRSLLRIQGRF  740

Query  204  YFGSLIWNDGVHNVRIPISVK  142
             FG+L W DG+H VRIP+ V+
Sbjct  741  SFGNLFWEDGLHVVRIPLIVR  761



>ref|XP_009351289.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Pyrus 
x bretschneideri]
Length=769

 Score =   140 bits (354),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 97/141 (69%), Gaps = 1/141 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGFSILD-VNFPSITIPDLKRPI  385
            PGL+YD+ ++DY+  LC+MGY++ AIS++AG   +C K  + ++ +N PSITI +LK+  
Sbjct  619  PGLIYDIESSDYIRFLCSMGYNNTAISLVAGAKITCRKSTNFINNLNLPSITIHELKQST  678

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T++RTVTNVGP NSTY   V  P G+ V VKPS L+F+  VKK+ F VT  +       F
Sbjct  679  TVSRTVTNVGPVNSTYNARVITPAGVSVRVKPSILSFNSTVKKLEFKVTFRSLLRIQGRF  738

Query  204  YFGSLIWNDGVHNVRIPISVK  142
             FG+L W DG+H VRIP+ V+
Sbjct  739  SFGNLFWEDGLHVVRIPLIVR  759



>gb|EAZ09847.1| hypothetical protein OsI_32138 [Oryza sativa Indica Group]
Length=769

 Score =   140 bits (353),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 92/141 (65%), Gaps = 1/141 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPI  385
            PGLVYDM  +DY+  LC+MGY++ AIS +  Q T+C H   S L++N PSITIP+L+  +
Sbjct  619  PGLVYDMGVSDYMRFLCSMGYNTSAISSMTQQQTTCQHMPKSQLNLNVPSITIPELRGKL  678

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T++RTVTNVGP  S Y+  VE P G+ V V PS L F+  V+K+ F VT          +
Sbjct  679  TVSRTVTNVGPALSKYRARVEAPPGVDVTVSPSLLTFNSTVRKLPFKVTFQAKLKVQGRY  738

Query  204  YFGSLIWNDGVHNVRIPISVK  142
             FGSL W DG H VRIP+ V+
Sbjct  739  TFGSLTWEDGTHTVRIPLVVR  759



>ref|XP_006423460.1| hypothetical protein CICLE_v10027857mg [Citrus clementina]
 gb|ESR36700.1| hypothetical protein CICLE_v10027857mg [Citrus clementina]
Length=623

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 96/143 (67%), Gaps = 2/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGFS--ILDVNFPSITIPDLKRP  388
            PGLVYDM  +DYV  LCAMGY++ AIS++   +T+C+   +  ++++N PSITIP+LK+ 
Sbjct  472  PGLVYDMEVSDYVRFLCAMGYNNSAISLMNRASTTCNDKSTKFLVNLNLPSITIPELKKS  531

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            IT++R VTNV P NS Y   V+ P G  V V+PSTL F+   KK+ F VT  +       
Sbjct  532  ITVSRQVTNVSPMNSVYTARVQAPAGTTVRVEPSTLTFNSTRKKLKFKVTFYSRLRVQGR  591

Query  207  FYFGSLIWNDGVHNVRIPISVKT  139
            + FG+L W DG+H VRIP+ V+T
Sbjct  592  YSFGNLFWEDGIHVVRIPLIVRT  614



>gb|KDO40058.1| hypothetical protein CISIN_1g006582mg [Citrus sinensis]
 gb|KDO40059.1| hypothetical protein CISIN_1g006582mg [Citrus sinensis]
 gb|KDO40060.1| hypothetical protein CISIN_1g006582mg [Citrus sinensis]
 gb|KDO40061.1| hypothetical protein CISIN_1g006582mg [Citrus sinensis]
 gb|KDO40062.1| hypothetical protein CISIN_1g006582mg [Citrus sinensis]
 gb|KDO40063.1| hypothetical protein CISIN_1g006582mg [Citrus sinensis]
 gb|KDO40064.1| hypothetical protein CISIN_1g006582mg [Citrus sinensis]
Length=639

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 96/143 (67%), Gaps = 2/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGFS--ILDVNFPSITIPDLKRP  388
            PGLVYDM  +DYV  LCAMGY++ AIS++   +T+C+   +  ++++N PSITIP+LK+ 
Sbjct  488  PGLVYDMEVSDYVRFLCAMGYNNSAISLMNRASTTCNDKSTKFLVNLNLPSITIPELKKS  547

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            IT++R VTNV P NS Y   V+ P G  V V+PSTL F+   KK+ F VT  +       
Sbjct  548  ITVSRQVTNVSPMNSVYTARVQAPAGTTVRVEPSTLTFNSTRKKLKFKVTFYSRLRVQGR  607

Query  207  FYFGSLIWNDGVHNVRIPISVKT  139
            + FG+L W DG+H VRIP+ V+T
Sbjct  608  YSFGNLFWEDGIHVVRIPLIVRT  630



>ref|XP_010271498.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Nelumbo 
nucifera]
Length=777

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 94/142 (66%), Gaps = 1/142 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHK-GFSILDVNFPSITIPDLKRPI  385
            PGL+YDM  TD+V  LC MGY+  ++S++    T C K   S+ D+N PSI+IP+LK+ +
Sbjct  627  PGLIYDMGITDHVRFLCLMGYNDSSVSLMTRHPTVCSKTSKSLADLNLPSISIPELKKSL  686

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
             ++RTVTNVGP NS Y V V+ P G+IV V PS L+F+   K++ F VT  +       +
Sbjct  687  AVSRTVTNVGPVNSVYSVHVKAPPGVIVHVNPSVLSFNSTAKQLRFKVTFQSQLSVQGRY  746

Query  204  YFGSLIWNDGVHNVRIPISVKT  139
             FGSL W DG+H VRIP+ V+T
Sbjct  747  SFGSLSWEDGIHVVRIPLIVRT  768



>ref|XP_010271499.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Nelumbo 
nucifera]
Length=774

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 94/142 (66%), Gaps = 1/142 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHK-GFSILDVNFPSITIPDLKRPI  385
            PGL+YDM  TD+V  LC MGY+  ++S++    T C K   S+ D+N PSI+IP+LK+ +
Sbjct  624  PGLIYDMGITDHVRFLCLMGYNDSSVSLMTRHPTVCSKTSKSLADLNLPSISIPELKKSL  683

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
             ++RTVTNVGP NS Y V V+ P G+IV V PS L+F+   K++ F VT  +       +
Sbjct  684  AVSRTVTNVGPVNSVYSVHVKAPPGVIVHVNPSVLSFNSTAKQLRFKVTFQSQLSVQGRY  743

Query  204  YFGSLIWNDGVHNVRIPISVKT  139
             FGSL W DG+H VRIP+ V+T
Sbjct  744  SFGSLSWEDGIHVVRIPLIVRT  765



>ref|XP_008236858.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=771

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 97/142 (68%), Gaps = 1/142 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGFS-ILDVNFPSITIPDLKRPI  385
            PGL+YD+ ++DY+  LC+MGY++ AIS++AG   +C K    I+++N PSITI +LK+ +
Sbjct  621  PGLIYDIESSDYIRFLCSMGYNNTAISLMAGTKITCQKSTKFIVNLNLPSITIHELKQNM  680

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T++R VTNVGP NS Y   V+ P G+ V VKPS L+F+  VKK+ F V   +       F
Sbjct  681  TVSRRVTNVGPVNSVYFARVQAPAGVSVKVKPSVLSFNSTVKKLEFKVIFCSLLRVQGRF  740

Query  204  YFGSLIWNDGVHNVRIPISVKT  139
             FG+L W DG+H VRIP+ V+T
Sbjct  741  SFGNLFWEDGLHVVRIPLVVRT  762



>ref|XP_006487362.1| PREDICTED: subtilisin-like protease SDD1-like isoform X2 [Citrus 
sinensis]
Length=719

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 96/143 (67%), Gaps = 2/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGFS--ILDVNFPSITIPDLKRP  388
            PGLVYDM  +DYV  LCAMGY++ AIS++   +T+C+   +  ++++N PSITIP+LK+ 
Sbjct  568  PGLVYDMEVSDYVRFLCAMGYNNSAISLMNRASTTCNDKSTKFLVNLNLPSITIPELKKS  627

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            IT++R VTNV P NS Y   V+ P G  V V+PSTL F+   KK+ F VT  +       
Sbjct  628  ITVSRQVTNVSPMNSVYTARVQAPAGTTVRVEPSTLTFNSTRKKLKFKVTFYSRLRVQGR  687

Query  207  FYFGSLIWNDGVHNVRIPISVKT  139
            + FG+L W DG+H VRIP+ V+T
Sbjct  688  YSFGNLFWEDGIHVVRIPLIVRT  710



>ref|XP_007042043.1| Subtilase family protein, putative isoform 2 [Theobroma cacao]
 gb|EOX97874.1| Subtilase family protein, putative isoform 2 [Theobroma cacao]
Length=637

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 95/141 (67%), Gaps = 1/141 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGFS-ILDVNFPSITIPDLKRPI  385
            PGL+YDM  +DYV  L AMGY+S AIS++    T C K    +L++N PSITIP+LK+ +
Sbjct  486  PGLIYDMEISDYVCFLYAMGYNSTAISLMTRVRTPCRKSAKFLLNLNLPSITIPELKQRL  545

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T++RTVTNVGP NS Y   V+ P G  V VKPS L+F+   KK+ F VTI +       +
Sbjct  546  TVSRTVTNVGPINSVYFARVQAPAGTHVSVKPSNLSFNSTTKKLKFKVTICSQLKVQGRY  605

Query  204  YFGSLIWNDGVHNVRIPISVK  142
             FG+L W DG+H VRIP++V+
Sbjct  606  SFGNLYWEDGIHVVRIPLTVR  626



>ref|XP_006487361.1| PREDICTED: subtilisin-like protease SDD1-like isoform X1 [Citrus 
sinensis]
Length=780

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 96/143 (67%), Gaps = 2/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGFS--ILDVNFPSITIPDLKRP  388
            PGLVYDM  +DYV  LCAMGY++ AIS++   +T+C+   +  ++++N PSITIP+LK+ 
Sbjct  629  PGLVYDMEVSDYVRFLCAMGYNNSAISLMNRASTTCNDKSTKFLVNLNLPSITIPELKKS  688

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            IT++R VTNV P NS Y   V+ P G  V V+PSTL F+   KK+ F VT  +       
Sbjct  689  ITVSRQVTNVSPMNSVYTARVQAPAGTTVRVEPSTLTFNSTRKKLKFKVTFYSRLRVQGR  748

Query  207  FYFGSLIWNDGVHNVRIPISVKT  139
            + FG+L W DG+H VRIP+ V+T
Sbjct  749  YSFGNLFWEDGIHVVRIPLIVRT  771



>gb|EMT21161.1| Cucumisin [Aegilops tauschii]
Length=710

 Score =   138 bits (347),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 69/142 (49%), Positives = 92/142 (65%), Gaps = 1/142 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPI  385
            PGLVYDM  +DYV  LC+MGY++ AI+ +A Q T C H   S L++N PSITIP+L+  +
Sbjct  560  PGLVYDMRPSDYVRFLCSMGYNNSAIASMAQQHTPCQHSPKSQLNLNVPSITIPELRGKL  619

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            +++RTVTNVGP  S Y+  VE P G+ V V PS L F+  V +++F V           +
Sbjct  620  SVSRTVTNVGPVTSKYRARVEAPPGVNVTVNPSLLTFNSTVNRLTFKVAFQAKLKVQGRY  679

Query  204  YFGSLIWNDGVHNVRIPISVKT  139
             FGSL W DG H VRIP+ V+T
Sbjct  680  TFGSLTWEDGTHTVRIPLVVRT  701



>ref|XP_006423459.1| hypothetical protein CICLE_v10027857mg [Citrus clementina]
 gb|ESR36699.1| hypothetical protein CICLE_v10027857mg [Citrus clementina]
Length=780

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 96/143 (67%), Gaps = 2/143 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGFS--ILDVNFPSITIPDLKRP  388
            PGLVYDM  +DYV  LCAMGY++ AIS++   +T+C+   +  ++++N PSITIP+LK+ 
Sbjct  629  PGLVYDMEVSDYVRFLCAMGYNNSAISLMNRASTTCNDKSTKFLVNLNLPSITIPELKKS  688

Query  387  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTG  208
            IT++R VTNV P NS Y   V+ P G  V V+PSTL F+   KK+ F VT  +       
Sbjct  689  ITVSRQVTNVSPMNSVYTARVQAPAGTTVRVEPSTLTFNSTRKKLKFKVTFYSRLRVQGR  748

Query  207  FYFGSLIWNDGVHNVRIPISVKT  139
            + FG+L W DG+H VRIP+ V+T
Sbjct  749  YSFGNLFWEDGIHVVRIPLIVRT  771



>ref|XP_008342302.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=772

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 96/141 (68%), Gaps = 1/141 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGFSILD-VNFPSITIPDLKRPI  385
            PGL+YD+ ++DY+  LC+MGY++ AIS++AG   +C K  + ++ +N PSITI +LK+  
Sbjct  622  PGLIYDIESSDYIRFLCSMGYNNTAISLVAGAKITCRKSTNFINNLNLPSITIHELKQRT  681

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T++RTVTNVGP NS Y   V  P G+ V VKPS L+F+  VKK+ F VT  +       F
Sbjct  682  TVSRTVTNVGPVNSIYNARVITPAGVSVRVKPSILSFNSTVKKLEFKVTFRSLLRIQGRF  741

Query  204  YFGSLIWNDGVHNVRIPISVK  142
             FG+L W DG+H VRIP+ V+
Sbjct  742  SFGNLFWEDGLHVVRIPLIVR  762



>ref|XP_002460565.1| hypothetical protein SORBIDRAFT_02g030760 [Sorghum bicolor]
 gb|EER97086.1| hypothetical protein SORBIDRAFT_02g030760 [Sorghum bicolor]
Length=765

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 94/142 (66%), Gaps = 1/142 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPI  385
            PGLVY+M T+DYV  LC+MGY++ AIS +  Q  +C H   + L++N PSITIP+L+  +
Sbjct  615  PGLVYEMGTSDYVRFLCSMGYNTSAISSMTQQHETCQHTPKTQLNLNLPSITIPELRGRL  674

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T++RTVTNVG  +S Y+  VE P G+ V V PS L F+  ++ ++F VT          +
Sbjct  675  TVSRTVTNVGSASSKYRARVEAPPGVDVTVSPSLLTFNSTMRSLTFKVTFQAKLKVQGRY  734

Query  204  YFGSLIWNDGVHNVRIPISVKT  139
             FGSL W DGVH VRIP+ V+T
Sbjct  735  NFGSLTWEDGVHTVRIPLVVRT  756



>ref|XP_011458289.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X3 [Fragaria 
vesca subsp. vesca]
Length=639

 Score =   137 bits (345),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 97/142 (68%), Gaps = 1/142 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGFSIL-DVNFPSITIPDLKRPI  385
            PGL+YD+ T+DY+  LC+MGY++ AIS +AG + +C+K  ++  ++N PSIT+ ++K+ +
Sbjct  489  PGLIYDIGTSDYIRFLCSMGYNNSAISAVAGASIACYKSTNVQGNLNLPSITVHEVKQRM  548

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T++RTVTNVGP NS Y   V+ P G+ V VKPS L F+  VKK+ F V           F
Sbjct  549  TVSRTVTNVGPVNSIYIARVQTPAGVSVRVKPSVLLFNSTVKKLEFKVVFRPLLKVAGRF  608

Query  204  YFGSLIWNDGVHNVRIPISVKT  139
             FG+L W DG H VRIP++V+T
Sbjct  609  SFGNLYWEDGFHVVRIPLAVRT  630



>emb|CDY49641.1| BnaCnng17930D [Brassica napus]
Length=743

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 91/143 (64%), Gaps = 16/143 (11%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGFSILDVNFPSITIPDLKRPIT  382
            PGLVYDM   +YV+ L     S                  S+LDVN PSITIP L + IT
Sbjct  610  PGLVYDMGHDEYVHYLFYTCPSPTP---------------SMLDVNLPSITIPYLSQEIT  654

Query  381  LTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFY  202
            +TRTVTNVGP  S YK ++EPP GI + V P TL F PN KKI+F V +ST H  NT ++
Sbjct  655  ITRTVTNVGPVGSVYKAVIEPPLGINLQVSPKTLEFGPNTKKITFTVKVSTTHRVNTDYH  714

Query  201  FGSLIWND-GVHNVRIPISVKTK  136
            FGSL W D GVHNVRIP+SV+T+
Sbjct  715  FGSLTWTDNGVHNVRIPLSVRTR  737



>ref|XP_007042042.1| Subtilase family protein, putative isoform 1 [Theobroma cacao]
 gb|EOX97873.1| Subtilase family protein, putative isoform 1 [Theobroma cacao]
Length=778

 Score =   138 bits (347),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 95/141 (67%), Gaps = 1/141 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGFS-ILDVNFPSITIPDLKRPI  385
            PGL+YDM  +DYV  L AMGY+S AIS++    T C K    +L++N PSITIP+LK+ +
Sbjct  627  PGLIYDMEISDYVCFLYAMGYNSTAISLMTRVRTPCRKSAKFLLNLNLPSITIPELKQRL  686

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T++RTVTNVGP NS Y   V+ P G  V VKPS L+F+   KK+ F VTI +       +
Sbjct  687  TVSRTVTNVGPINSVYFARVQAPAGTHVSVKPSNLSFNSTTKKLKFKVTICSQLKVQGRY  746

Query  204  YFGSLIWNDGVHNVRIPISVK  142
             FG+L W DG+H VRIP++V+
Sbjct  747  SFGNLYWEDGIHVVRIPLTVR  767



>ref|XP_007042044.1| Subtilase family protein, putative isoform 3 [Theobroma cacao]
 gb|EOX97875.1| Subtilase family protein, putative isoform 3 [Theobroma cacao]
Length=801

 Score =   138 bits (347),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 95/141 (67%), Gaps = 1/141 (1%)
 Frame = -1

Query  561  PGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGFS-ILDVNFPSITIPDLKRPI  385
            PGL+YDM  +DYV  L AMGY+S AIS++    T C K    +L++N PSITIP+LK+ +
Sbjct  650  PGLIYDMEISDYVCFLYAMGYNSTAISLMTRVRTPCRKSAKFLLNLNLPSITIPELKQRL  709

Query  384  TLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGF  205
            T++RTVTNVGP NS Y   V+ P G  V VKPS L+F+   KK+ F VTI +       +
Sbjct  710  TVSRTVTNVGPINSVYFARVQAPAGTHVSVKPSNLSFNSTTKKLKFKVTICSQLKVQGRY  769

Query  204  YFGSLIWNDGVHNVRIPISVK  142
             FG+L W DG+H VRIP++V+
Sbjct  770  SFGNLYWEDGIHVVRIPLTVR  790



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 658693633920