BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS081F11

Length=627
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009757534.1|  PREDICTED: LRR receptor-like serine/threonin...    162   3e-42   Nicotiana sylvestris
ref|XP_009757535.1|  PREDICTED: LRR receptor-like serine/threonin...    162   4e-42   Nicotiana sylvestris
ref|XP_009600406.1|  PREDICTED: LRR receptor-like serine/threonin...    159   7e-41   Nicotiana tomentosiformis
ref|XP_007038488.1|  ERECTA-like 1                                      155   1e-39   
ref|XP_002318267.2|  PTH-1 family protein                               151   3e-38   
ref|XP_011029995.1|  PREDICTED: LRR receptor-like serine/threonin...    151   3e-38   Populus euphratica
ref|XP_011076298.1|  PREDICTED: LRR receptor-like serine/threonin...    150   5e-38   Sesamum indicum [beniseed]
ref|XP_009345019.1|  PREDICTED: LRR receptor-like serine/threonin...    148   4e-37   
ref|XP_004308156.1|  PREDICTED: LRR receptor-like serine/threonin...    148   5e-37   Fragaria vesca subsp. vesca
ref|XP_008376471.1|  PREDICTED: LRR receptor-like serine/threonin...    147   9e-37   Malus domestica [apple tree]
ref|XP_002864777.1|  hypothetical protein ARALYDRAFT_496399             147   1e-36   
ref|XP_010555314.1|  PREDICTED: LRR receptor-like serine/threonin...    147   1e-36   Tarenaya hassleriana [spider flower]
gb|KJB39364.1|  hypothetical protein B456_007G009000                    146   2e-36   Gossypium raimondii
gb|KHG06831.1|  LRR receptor-like serine/threonine-protein kinase...    146   2e-36   Gossypium arboreum [tree cotton]
ref|XP_008465055.1|  PREDICTED: LRR receptor-like serine/threonin...    146   2e-36   Cucumis melo [Oriental melon]
ref|XP_004234153.1|  PREDICTED: LRR receptor-like serine/threonin...    145   3e-36   Solanum lycopersicum
gb|KGN49592.1|  hypothetical protein Csa_5G014290                       145   5e-36   Cucumis sativus [cucumbers]
gb|KHN24405.1|  LRR receptor-like serine/threonine-protein kinase...    144   8e-36   Glycine soja [wild soybean]
ref|XP_006598682.1|  PREDICTED: ERECTA-like kinase isoform X1           144   8e-36   Glycine max [soybeans]
ref|NP_001235330.1|  ERECTA-like kinase                                 144   9e-36   Glycine max [soybeans]
ref|XP_007143329.1|  hypothetical protein PHAVU_007G063200g             144   1e-35   Phaseolus vulgaris [French bean]
ref|XP_010452673.1|  PREDICTED: LOW QUALITY PROTEIN: LRR receptor...    144   1e-35   
ref|XP_010423243.1|  PREDICTED: LRR receptor-like serine/threonin...    144   1e-35   Camelina sativa [gold-of-pleasure]
ref|XP_009346939.1|  PREDICTED: LRR receptor-like serine/threonin...    143   2e-35   
ref|NP_001190595.1|  LRR receptor-like serine/threonine-protein k...    143   2e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010491322.1|  PREDICTED: LRR receptor-like serine/threonin...    143   2e-35   Camelina sativa [gold-of-pleasure]
dbj|BAA97187.1|  receptor-like protein kinase                           143   2e-35   Arabidopsis thaliana [mouse-ear cress]
gb|AAP69763.1|  ERECTA-like kinase 1                                    143   2e-35   Arabidopsis thaliana [mouse-ear cress]
ref|NP_201029.1|  LRR receptor-like serine/threonine-protein kina...    143   2e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006490262.1|  PREDICTED: LRR receptor-like serine/threonin...    143   3e-35   
ref|XP_006348052.1|  PREDICTED: LRR receptor-like serine/threonin...    142   4e-35   
ref|XP_006348051.1|  PREDICTED: LRR receptor-like serine/threonin...    142   4e-35   Solanum tuberosum [potatoes]
ref|XP_007152392.1|  hypothetical protein PHAVU_004G126100g             142   5e-35   Phaseolus vulgaris [French bean]
ref|XP_006399198.1|  hypothetical protein EUTSA_v10012600mg             142   5e-35   
ref|XP_010483915.1|  PREDICTED: LRR receptor-like serine/threonin...    142   7e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010483916.1|  PREDICTED: LRR receptor-like serine/threonin...    142   7e-35   Camelina sativa [gold-of-pleasure]
ref|XP_006279954.1|  hypothetical protein CARUB_v10025821mg             142   8e-35   Capsella rubella
ref|XP_009151345.1|  PREDICTED: LRR receptor-like serine/threonin...    141   1e-34   Brassica rapa
ref|XP_009151343.1|  PREDICTED: LRR receptor-like serine/threonin...    141   1e-34   Brassica rapa
gb|KDP22376.1|  hypothetical protein JCGZ_26207                         141   1e-34   Jatropha curcas
emb|CDY00268.1|  BnaA06g21690D                                          141   1e-34   
ref|XP_011041677.1|  PREDICTED: LRR receptor-like serine/threonin...    141   1e-34   Populus euphratica
ref|XP_002269540.2|  PREDICTED: LRR receptor-like serine/threonin...    141   1e-34   Vitis vinifera
gb|KFK27954.1|  hypothetical protein AALP_AA8G452900                    141   1e-34   Arabis alpina [alpine rockcress]
ref|XP_010458423.1|  PREDICTED: LRR receptor-like serine/threonin...    141   1e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010277441.1|  PREDICTED: LRR receptor-like serine/threonin...    141   1e-34   Nelumbo nucifera [Indian lotus]
ref|XP_010277439.1|  PREDICTED: LRR receptor-like serine/threonin...    140   2e-34   Nelumbo nucifera [Indian lotus]
ref|XP_006289323.1|  hypothetical protein CARUB_v10002808mg             140   2e-34   
gb|ADM86148.1|  leucine-rich repeat receptor-like kinase                140   3e-34   Populus nigra x Populus x canadensis
ref|XP_007221096.1|  hypothetical protein PRUPE_ppa017398mg             139   7e-34   
emb|CDX86913.1|  BnaC03g51830D                                          139   8e-34   
gb|KHN27841.1|  LRR receptor-like serine/threonine-protein kinase...    139   8e-34   Glycine soja [wild soybean]
ref|XP_004496653.1|  PREDICTED: LRR receptor-like serine/threonin...    139   8e-34   Cicer arietinum [garbanzo]
ref|XP_006587379.1|  PREDICTED: LRR receptor-like serine/threonin...    139   8e-34   Glycine max [soybeans]
ref|XP_010444058.1|  PREDICTED: LRR receptor-like serine/threonin...    137   3e-33   Camelina sativa [gold-of-pleasure]
gb|KEH43759.1|  LRR receptor-like kinase family protein                 137   3e-33   Medicago truncatula
ref|XP_002322426.1|  PTH-1 family protein                               136   4e-33   
ref|XP_006394419.1|  hypothetical protein EUTSA_v100036150mg            126   5e-33   
emb|CDX99001.1|  BnaC09g48340D                                          136   8e-33   
ref|XP_006588387.1|  PREDICTED: ERECTA-like kinase isoform X1           135   9e-33   Glycine max [soybeans]
gb|EYU25015.1|  hypothetical protein MIMGU_mgv1a000865mg                135   1e-32   Erythranthe guttata [common monkey flower]
ref|XP_006588388.1|  PREDICTED: ERECTA-like kinase isoform X2           135   1e-32   Glycine max [soybeans]
ref|NP_196335.2|  LRR receptor-like serine/threonine-protein kina...    135   1e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004149628.1|  PREDICTED: LRR receptor-like serine/threonin...    135   1e-32   
ref|XP_010276048.1|  PREDICTED: LRR receptor-like serine/threonin...    135   2e-32   Nelumbo nucifera [Indian lotus]
emb|CBI24498.3|  unnamed protein product                                134   2e-32   Vitis vinifera
ref|XP_009122365.1|  PREDICTED: LRR receptor-like serine/threonin...    134   3e-32   Brassica rapa
emb|CDX70013.1|  BnaA10g23620D                                          134   3e-32   
ref|XP_006606083.1|  PREDICTED: LRR receptor-like serine/threonin...    134   3e-32   Glycine max [soybeans]
ref|XP_006606082.1|  PREDICTED: LRR receptor-like serine/threonin...    134   3e-32   Glycine max [soybeans]
ref|XP_002873299.1|  hypothetical protein ARALYDRAFT_908657             134   4e-32   Arabidopsis lyrata subsp. lyrata
gb|KDO65362.1|  hypothetical protein CISIN_1g002278mg                   133   7e-32   Citrus sinensis [apfelsine]
ref|XP_006421768.1|  hypothetical protein CICLE_v10004259mg             132   2e-31   
emb|CDP05285.1|  unnamed protein product                                131   2e-31   Coffea canephora [robusta coffee]
ref|XP_011076300.1|  PREDICTED: LRR receptor-like serine/threonin...    131   3e-31   Sesamum indicum [beniseed]
ref|XP_006858024.1|  hypothetical protein AMTR_s00069p00198500          131   4e-31   
ref|XP_008234344.1|  PREDICTED: LRR receptor-like serine/threonin...    131   4e-31   Prunus mume [ume]
ref|XP_010277442.1|  PREDICTED: LRR receptor-like serine/threonin...    129   2e-30   Nelumbo nucifera [Indian lotus]
ref|XP_006598683.1|  PREDICTED: ERECTA-like kinase isoform X2           129   2e-30   Glycine max [soybeans]
gb|KHN15712.1|  LRR receptor-like serine/threonine-protein kinase...    128   3e-30   Glycine soja [wild soybean]
ref|XP_010940921.1|  PREDICTED: LRR receptor-like serine/threonin...    128   3e-30   Elaeis guineensis
ref|XP_008810292.1|  PREDICTED: LRR receptor-like serine/threonin...    127   6e-30   
ref|XP_008810291.1|  PREDICTED: LRR receptor-like serine/threonin...    127   8e-30   Phoenix dactylifera
ref|XP_008810290.1|  PREDICTED: LRR receptor-like serine/threonin...    127   9e-30   
ref|XP_002510897.1|  erecta, putative                                   126   2e-29   
ref|XP_010035002.1|  PREDICTED: LRR receptor-like serine/threonin...    126   2e-29   
ref|NP_001237639.1|  ERECTA-like kinase                                 126   2e-29   Glycine max [soybeans]
gb|EPS66497.1|  hypothetical protein M569_08274                         125   4e-29   Genlisea aurea
emb|CAB87274.1|  receptor-like protein kinase                           124   7e-29   Arabidopsis thaliana [mouse-ear cress]
gb|KDO73636.1|  hypothetical protein CISIN_1g0023492mg                  115   4e-28   Citrus sinensis [apfelsine]
ref|XP_010276057.1|  PREDICTED: LRR receptor-like serine/threonin...    120   1e-27   Nelumbo nucifera [Indian lotus]
ref|XP_006474503.1|  PREDICTED: LRR receptor-like serine/threonin...    119   5e-27   Citrus sinensis [apfelsine]
ref|XP_010429655.1|  PREDICTED: LRR receptor-like serine/threonin...    118   1e-26   Camelina sativa [gold-of-pleasure]
ref|XP_008452789.1|  PREDICTED: LRR receptor-like serine/threonin...    118   1e-26   Cucumis melo [Oriental melon]
ref|XP_004141340.1|  PREDICTED: LRR receptor-like serine/threonin...    117   3e-26   Cucumis sativus [cucumbers]
ref|XP_010417421.1|  PREDICTED: LRR receptor-like serine/threonin...    117   3e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010261893.1|  PREDICTED: LRR receptor-like serine/threonin...    117   3e-26   Nelumbo nucifera [Indian lotus]
ref|XP_002280069.2|  PREDICTED: LRR receptor-like serine/threonin...    117   4e-26   Vitis vinifera
emb|CBI20727.3|  unnamed protein product                                116   4e-26   Vitis vinifera
ref|XP_006452987.1|  hypothetical protein CICLE_v100073971mg            114   5e-26   
gb|KDP34024.1|  hypothetical protein JCGZ_07595                         115   9e-26   Jatropha curcas
dbj|BAK61880.1|  LRR receptor-like serine/threonine-protein kinase      115   1e-25   Citrus unshiu [satsuma mandarin]
ref|XP_009802873.1|  PREDICTED: LRR receptor-like serine/threonin...    114   2e-25   Nicotiana sylvestris
ref|XP_009398741.1|  PREDICTED: LRR receptor-like serine/threonin...    114   3e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010047401.1|  PREDICTED: LRR receptor-like serine/threonin...    114   4e-25   Eucalyptus grandis [rose gum]
ref|XP_009605434.1|  PREDICTED: LRR receptor-like serine/threonin...    113   6e-25   Nicotiana tomentosiformis
ref|XP_002516144.1|  erecta, putative                                   112   9e-25   Ricinus communis
ref|XP_007225368.1|  hypothetical protein PRUPE_ppa000847mg             112   9e-25   
ref|XP_003588942.1|  LRR receptor-like serine/threonine-protein k...    112   1e-24   
gb|AES59193.2|  LRR receptor-like kinase family protein                 112   1e-24   Medicago truncatula
emb|CDP13474.1|  unnamed protein product                                112   2e-24   Coffea canephora [robusta coffee]
gb|AGL91677.1|  erecta leucine-rich-repeat receptor-like kinase         112   2e-24   Brassica napus [oilseed rape]
ref|XP_004245043.1|  PREDICTED: LRR receptor-like serine/threonin...    111   3e-24   Solanum lycopersicum
ref|XP_009117015.1|  PREDICTED: LRR receptor-like serine/threonin...    111   3e-24   Brassica rapa
ref|XP_009337156.1|  PREDICTED: LRR receptor-like serine/threonin...    111   3e-24   Pyrus x bretschneideri [bai li]
ref|XP_010474472.1|  PREDICTED: LRR receptor-like serine/threonin...    110   4e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010273915.1|  PREDICTED: LRR receptor-like serine/threonin...    110   4e-24   Nelumbo nucifera [Indian lotus]
ref|XP_008220576.1|  PREDICTED: LRR receptor-like serine/threonin...    110   5e-24   Prunus mume [ume]
ref|XP_008220575.1|  PREDICTED: LRR receptor-like serine/threonin...    110   5e-24   Prunus mume [ume]
ref|XP_007012431.1|  Leucine-rich receptor-like protein kinase fa...    110   5e-24   
ref|XP_010273914.1|  PREDICTED: LRR receptor-like serine/threonin...    110   5e-24   Nelumbo nucifera [Indian lotus]
ref|XP_011081595.1|  PREDICTED: LRR receptor-like serine/threonin...    110   6e-24   Sesamum indicum [beniseed]
ref|XP_004303459.1|  PREDICTED: LRR receptor-like serine/threonin...    110   7e-24   Fragaria vesca subsp. vesca
ref|XP_008786640.1|  PREDICTED: LRR receptor-like serine/threonin...    110   7e-24   Phoenix dactylifera
ref|XP_003544548.1|  PREDICTED: LRR receptor-like serine/threonin...    109   1e-23   Glycine max [soybeans]
ref|XP_002880777.1|  hypothetical protein ARALYDRAFT_481491             109   1e-23   
ref|XP_006408746.1|  hypothetical protein EUTSA_v10001898mg             109   1e-23   Eutrema salsugineum [saltwater cress]
ref|XP_006656595.1|  PREDICTED: LRR receptor-like serine/threonin...    109   2e-23   Oryza brachyantha
gb|KHN37058.1|  LRR receptor-like serine/threonine-protein kinase...    109   2e-23   Glycine soja [wild soybean]
dbj|BAD44800.1|  putative transmembrane protein kinase                  109   2e-23   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ89970.1|  predicted protein                                      108   2e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006296065.1|  hypothetical protein CARUB_v10025215mg             108   2e-23   Capsella rubella
ref|NP_180201.1|  LRR receptor-like serine/threonine-protein kina...    108   2e-23   Arabidopsis thaliana [mouse-ear cress]
gb|KFK32516.1|  hypothetical protein AALP_AA6G252800                    108   3e-23   Arabis alpina [alpine rockcress]
ref|XP_006353850.1|  PREDICTED: LRR receptor-like serine/threonin...    108   4e-23   Solanum tuberosum [potatoes]
ref|XP_006849687.1|  hypothetical protein AMTR_s00024p00237440          107   5e-23   
gb|KJB07391.1|  hypothetical protein B456_001G019800                    107   5e-23   Gossypium raimondii
ref|XP_009362801.1|  PREDICTED: LRR receptor-like serine/threonin...    107   6e-23   Pyrus x bretschneideri [bai li]
ref|XP_010917192.1|  PREDICTED: LRR receptor-like serine/threonin...    107   7e-23   Elaeis guineensis
ref|XP_010669304.1|  PREDICTED: LRR receptor-like serine/threonin...    107   8e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011069519.1|  PREDICTED: LOW QUALITY PROTEIN: LRR receptor...    107   9e-23   Sesamum indicum [beniseed]
ref|XP_010526027.1|  PREDICTED: LRR receptor-like serine/threonin...    106   1e-22   Tarenaya hassleriana [spider flower]
ref|XP_006381995.1|  hypothetical protein POPTR_0006s23680g             106   1e-22   
ref|XP_004498860.1|  PREDICTED: LRR receptor-like serine/threonin...    105   2e-22   Cicer arietinum [garbanzo]
ref|XP_004498859.1|  PREDICTED: LRR receptor-like serine/threonin...    105   2e-22   Cicer arietinum [garbanzo]
ref|XP_009408412.1|  PREDICTED: LRR receptor-like serine/threonin...    105   2e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008393446.1|  PREDICTED: LRR receptor-like serine/threonin...    105   3e-22   
ref|XP_011019342.1|  PREDICTED: LRR receptor-like serine/threonin...    105   4e-22   Populus euphratica
ref|XP_004964941.1|  PREDICTED: LRR receptor-like serine/threonin...    105   4e-22   Setaria italica
ref|XP_004964942.1|  PREDICTED: LRR receptor-like serine/threonin...    105   4e-22   Setaria italica
ref|XP_010227884.1|  PREDICTED: LRR receptor-like serine/threonin...    105   4e-22   Brachypodium distachyon [annual false brome]
ref|XP_003564133.1|  PREDICTED: LRR receptor-like serine/threonin...    105   4e-22   Brachypodium distachyon [annual false brome]
gb|AFW86034.1|  putative leucine-rich repeat receptor-like protei...    104   6e-22   
ref|XP_004964421.1|  PREDICTED: LRR receptor-like serine/threonin...    104   6e-22   Setaria italica
ref|NP_001056687.1|  Os06g0130100                                       104   7e-22   
gb|ACY07616.1|  stress-induced protein kinase                           104   8e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008658489.1|  PREDICTED: uncharacterized protein LOC100279...    104   8e-22   
gb|AFJ14786.1|  ERECTA-like kinase                                      103   1e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002436407.1|  hypothetical protein SORBIDRAFT_10g001970          103   2e-21   Sorghum bicolor [broomcorn]
ref|XP_003561134.2|  PREDICTED: LRR receptor-like serine/threonin...    103   2e-21   
ref|XP_008393579.1|  PREDICTED: LRR receptor-like serine/threonin...    103   2e-21   Malus domestica [apple tree]
ref|XP_006649092.1|  PREDICTED: LRR receptor-like serine/threonin...    102   5e-21   Oryza brachyantha
gb|EYU32328.1|  hypothetical protein MIMGU_mgv1a000790mg                101   9e-21   Erythranthe guttata [common monkey flower]
ref|XP_007161049.1|  hypothetical protein PHAVU_001G038400g             101   9e-21   Phaseolus vulgaris [French bean]
ref|XP_006656743.1|  PREDICTED: LRR receptor-like serine/threonin...    100   1e-20   Oryza brachyantha
gb|AFW86033.1|  putative leucine-rich repeat receptor-like protei...  99.8    1e-20   
gb|AFW86032.1|  putative leucine-rich repeat receptor-like protei...  99.4    1e-20   
gb|AFW86031.1|  putative leucine-rich repeat receptor-like protei...    100   2e-20   
ref|XP_002438023.1|  hypothetical protein SORBIDRAFT_10g006670          100   2e-20   Sorghum bicolor [broomcorn]
ref|XP_004498861.1|  PREDICTED: LRR receptor-like serine/threonin...  99.0    5e-20   
ref|XP_007161048.1|  hypothetical protein PHAVU_001G038400g           98.6    6e-20   Phaseolus vulgaris [French bean]
ref|XP_003522304.1|  PREDICTED: LRR receptor-like serine/threonin...  99.0    6e-20   
ref|XP_006578096.1|  PREDICTED: LRR receptor-like serine/threonin...  98.6    6e-20   Glycine max [soybeans]
gb|AGL91674.1|  erecta-like leucine-rich-repeat receptor-like kinase  98.6    7e-20   Triticum aestivum [Canadian hard winter wheat]
gb|AGT17158.1|  ERECTA-like 2                                         97.8    1e-19   Saccharum hybrid cultivar R570
gb|EEC74102.1|  hypothetical protein OsI_09151                        96.7    3e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_008786642.1|  PREDICTED: LRR receptor-like serine/threonin...  96.7    4e-19   
gb|EEE57902.1|  hypothetical protein OsJ_08587                        96.3    4e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008786639.1|  PREDICTED: LRR receptor-like serine/threonin...  95.9    5e-19   Phoenix dactylifera
gb|AAL68842.1|AF466199_1  putative receptor protein kinase            95.9    6e-19   Sorghum bicolor [broomcorn]
gb|AFC88469.1|  ERECTA                                                95.9    6e-19   Triticum aestivum [Canadian hard winter wheat]
gb|KEH39916.1|  LRR receptor-like kinase family protein               95.5    7e-19   Medicago truncatula
ref|XP_006581305.1|  PREDICTED: LRR receptor-like serine/threonin...  95.5    8e-19   Glycine max [soybeans]
gb|EEC80197.1|  hypothetical protein OsI_22078                        95.5    8e-19   Oryza sativa Indica Group [Indian rice]
ref|NP_001057087.1|  Os06g0203800                                     95.1    9e-19   
gb|EPS61595.1|  hypothetical protein M569_13200                       94.0    1e-18   Genlisea aurea
ref|XP_007136889.1|  hypothetical protein PHAVU_009G082500g           94.7    2e-18   Phaseolus vulgaris [French bean]
gb|EMS63677.1|  LRR receptor-like serine/threonine-protein kinase...  94.4    2e-18   Triticum urartu
ref|XP_002982573.1|  hypothetical protein SELMODRAFT_155267           94.0    3e-18   
ref|XP_002981099.1|  hypothetical protein SELMODRAFT_114051           94.0    3e-18   
gb|EEE65279.1|  hypothetical protein OsJ_20503                        92.4    7e-18   Oryza sativa Japonica Group [Japonica rice]
gb|EYU20292.1|  hypothetical protein MIMGU_mgv1a026417mg              92.4    7e-18   Erythranthe guttata [common monkey flower]
gb|KJB65473.1|  hypothetical protein B456_010G096300                  92.4    8e-18   Gossypium raimondii
gb|KJB65472.1|  hypothetical protein B456_010G096300                  92.0    1e-17   Gossypium raimondii
gb|KJB65471.1|  hypothetical protein B456_010G096300                  92.0    1e-17   Gossypium raimondii
ref|XP_002975149.1|  hypothetical protein SELMODRAFT_102522           91.7    1e-17   
ref|XP_008647408.1|  PREDICTED: uncharacterized protein LOC100193...  91.7    2e-17   Zea mays [maize]
ref|XP_008647407.1|  PREDICTED: uncharacterized protein LOC100193...  91.7    2e-17   Zea mays [maize]
gb|AFW76644.1|  putative leucine-rich repeat receptor-like protei...  91.3    2e-17   
ref|XP_002977553.1|  hypothetical protein SELMODRAFT_107124           91.3    2e-17   
gb|EMT11370.1|  LRR receptor-like serine/threonine-protein kinase...  90.5    4e-17   
gb|AGL91671.1|  erecta leucine-rich-repeat receptor-like kinase       90.1    5e-17   Triticum aestivum [Canadian hard winter wheat]
gb|AFJ38187.2|  receptor-like serine/threonine protein kinase 2       90.1    6e-17   Triticum aestivum [Canadian hard winter wheat]
gb|AGL91672.1|  erecta leucine-rich-repeat receptor-like kinase       89.7    6e-17   Triticum aestivum [Canadian hard winter wheat]
gb|AFJ38186.2|  receptor-like serine/threonine protein kinase 1       89.7    7e-17   Triticum aestivum [Canadian hard winter wheat]
gb|AFW73724.1|  putative leucine-rich repeat receptor-like protei...  89.4    8e-17   
dbj|BAJ96098.1|  predicted protein                                    89.4    9e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK07025.1|  predicted protein                                    89.4    9e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010109086.1|  hypothetical protein L484_012962                 79.7    1e-15   
gb|EMS68149.1|  LRR receptor-like serine/threonine-protein kinase...  82.4    2e-14   Triticum urartu
emb|CAN74952.1|  hypothetical protein VITISV_025649                   79.3    2e-13   Vitis vinifera
gb|EEE65024.1|  hypothetical protein OsJ_19993                        79.3    2e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010098375.1|  LRR receptor-like serine/threonine-protein k...  78.6    4e-13   
ref|XP_004955237.1|  PREDICTED: LRR receptor-like serine/threonin...  77.8    6e-13   
gb|AGL91675.1|  erecta-like leucine-rich-repeat receptor-like kinase  74.7    6e-12   Triticum aestivum [Canadian hard winter wheat]
gb|KHG04654.1|  LRR receptor-like serine/threonine-protein kinase...  71.6    4e-11   Gossypium arboreum [tree cotton]
ref|XP_003592397.1|  LRR receptor-like serine/threonine-protein k...  67.0    5e-11   
gb|EMS58253.1|  LRR receptor-like serine/threonine-protein kinase...  72.0    5e-11   Triticum urartu
gb|EMT12712.1|  LRR receptor-like serine/threonine-protein kinase...  67.8    1e-09   
gb|KHN47744.1|  LRR receptor-like serine/threonine-protein kinase...  67.0    2e-09   Glycine soja [wild soybean]
gb|AAT08020.1|  putative receptor protein kinase                      64.3    2e-09   Zea mays [maize]
ref|XP_003547404.2|  PREDICTED: LRR receptor-like serine/threonin...  67.0    2e-09   Glycine max [soybeans]
ref|XP_001755991.1|  ERL1d AtERECTA-like receptor S/T protein kin...  66.6    2e-09   
ref|XP_002993357.1|  hypothetical protein SELMODRAFT_431458           66.6    3e-09   
emb|CDY00321.1|  BnaA06g22220D                                        65.9    3e-09   
ref|XP_009151389.1|  PREDICTED: LRR receptor-like serine/threonin...  65.9    3e-09   Brassica rapa
gb|KHG25582.1|  LRR receptor-like serine/threonine-protein kinase...  66.2    3e-09   Gossypium arboreum [tree cotton]
emb|CDX84346.1|  BnaC03g51540D                                        65.9    3e-09   
ref|XP_010933053.1|  PREDICTED: LRR receptor-like serine/threonin...  65.1    5e-09   Elaeis guineensis
ref|XP_006439659.1|  hypothetical protein CICLE_v10019379mg           65.1    5e-09   Citrus clementina [clementine]
ref|XP_007138872.1|  hypothetical protein PHAVU_009G244600g           65.5    6e-09   Phaseolus vulgaris [French bean]
ref|XP_008374516.1|  PREDICTED: LRR receptor-like serine/threonin...  65.1    7e-09   
ref|XP_010647299.1|  PREDICTED: probable LRR receptor-like serine...  63.2    7e-09   Vitis vinifera
ref|XP_006476661.1|  PREDICTED: LRR receptor-like serine/threonin...  64.7    8e-09   Citrus sinensis [apfelsine]
ref|XP_010647298.1|  PREDICTED: probable LRR receptor-like serine...  63.2    8e-09   Vitis vinifera
ref|XP_010533910.1|  PREDICTED: protein NSP-INTERACTING KINASE 3      64.7    8e-09   Tarenaya hassleriana [spider flower]
ref|XP_008381992.1|  PREDICTED: probable LRR receptor-like serine...  64.7    9e-09   
ref|XP_002972743.1|  hypothetical protein SELMODRAFT_413321           64.7    9e-09   
ref|XP_007040985.1|  Leucine-rich repeat transmembrane protein ki...  64.7    9e-09   
ref|XP_010647297.1|  PREDICTED: probable LRR receptor-like serine...  63.2    9e-09   Vitis vinifera
ref|XP_002312685.1|  leucine-rich repeat family protein               64.3    1e-08   
ref|XP_010647293.1|  PREDICTED: probable LRR receptor-like serine...  63.2    1e-08   
ref|XP_010647295.1|  PREDICTED: probable LRR receptor-like serine...  63.2    1e-08   
ref|XP_006380012.1|  hypothetical protein POPTR_0008s19310g           64.3    1e-08   
ref|XP_009390528.1|  PREDICTED: LRR receptor-like serine/threonin...  64.3    1e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001763775.1|  ERL2a AtERECTA-like receptor S/T protein kin...  64.3    1e-08   
emb|CBI29551.3|  unnamed protein product                              63.5    1e-08   Vitis vinifera
ref|XP_008802949.1|  PREDICTED: LRR receptor-like serine/threonin...  63.9    1e-08   Phoenix dactylifera
gb|KJB08256.1|  hypothetical protein B456_001G074000                  63.9    1e-08   Gossypium raimondii
ref|XP_007138218.1|  hypothetical protein PHAVU_009G190400g           63.9    1e-08   Phaseolus vulgaris [French bean]
ref|XP_007138217.1|  hypothetical protein PHAVU_009G190400g           63.9    1e-08   Phaseolus vulgaris [French bean]
ref|XP_001783127.1|  ERL1a AtERECTA-like receptor S/T protein kin...  63.9    2e-08   
ref|XP_010459245.1|  PREDICTED: LRR receptor-like serine/threonin...  63.9    2e-08   Camelina sativa [gold-of-pleasure]
gb|AFW76643.1|  putative leucine-rich repeat receptor-like protei...  63.9    2e-08   
gb|KHG18268.1|  LRR receptor-like serine/threonine-protein kinase...  63.5    2e-08   Gossypium arboreum [tree cotton]
gb|KJB08255.1|  hypothetical protein B456_001G074000                  63.5    2e-08   Gossypium raimondii
gb|AFW76897.1|  putative leucine-rich repeat receptor-like protei...  63.5    2e-08   
dbj|BAB01326.1|  receptor-like kinase                                 63.5    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008453173.1|  PREDICTED: LRR receptor-like serine/threonin...  63.5    2e-08   Cucumis melo [Oriental melon]
ref|XP_004138149.1|  PREDICTED: LRR receptor-like serine/threonin...  63.5    2e-08   Cucumis sativus [cucumbers]
ref|XP_004489819.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  63.5    2e-08   Cicer arietinum [garbanzo]
ref|XP_004504632.1|  PREDICTED: LRR receptor-like serine/threonin...  63.5    2e-08   Cicer arietinum [garbanzo]
ref|XP_009343456.1|  PREDICTED: LRR receptor-like serine/threonin...  63.2    2e-08   Pyrus x bretschneideri [bai li]
tpg|DAA54784.1|  TPA: putative leucine-rich repeat receptor-like ...  63.2    2e-08   
ref|XP_010473260.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  63.2    2e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010473259.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  63.2    2e-08   Camelina sativa [gold-of-pleasure]
tpg|DAA54785.1|  TPA: putative leucine-rich repeat receptor-like ...  63.2    2e-08   
ref|XP_010510907.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...  63.2    2e-08   Camelina sativa [gold-of-pleasure]
ref|XP_002448922.1|  hypothetical protein SORBIDRAFT_05g001640        63.5    2e-08   
ref|XP_006468654.1|  PREDICTED: LRR receptor-like serine/threonin...  63.5    2e-08   Citrus sinensis [apfelsine]
gb|KJB48056.1|  hypothetical protein B456_008G051700                  63.5    2e-08   Gossypium raimondii
ref|XP_010510906.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...  63.2    2e-08   Camelina sativa [gold-of-pleasure]
ref|XP_009369360.1|  PREDICTED: LRR receptor-like serine/threonin...  63.2    3e-08   Pyrus x bretschneideri [bai li]
ref|XP_010910388.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  63.2    3e-08   Elaeis guineensis
ref|NP_001147056.1|  ATP binding protein                              63.2    3e-08   Zea mays [maize]
gb|EYU37463.1|  hypothetical protein MIMGU_mgv1a003320mg              62.8    3e-08   Erythranthe guttata [common monkey flower]
ref|XP_008647816.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  62.8    3e-08   Zea mays [maize]
ref|XP_001770079.1|  ERL1c AtERECTA-like receptor S/T protein kin...  63.2    3e-08   
dbj|BAD18102.1|  leucine-rich repeat receptor-like kinase             62.8    3e-08   Ipomoea batatas [batate]
ref|XP_007044708.1|  Nsp-interacting kinase 3 isoform 1               62.8    3e-08   
emb|CDY61461.1|  BnaC01g43240D                                        62.8    3e-08   
ref|XP_008232304.1|  PREDICTED: probable LRR receptor-like serine...  62.8    4e-08   
ref|XP_008346409.1|  PREDICTED: probable LRR receptor-like serine...  60.1    4e-08   
ref|NP_201077.2|  leucine-rich repeat protein kinase-like protein     62.8    4e-08   
ref|XP_010444123.1|  PREDICTED: LRR receptor-like serine/threonin...  62.8    4e-08   
ref|XP_010651607.1|  PREDICTED: protein NSP-INTERACTING KINASE 3      62.8    4e-08   
emb|CAN75190.1|  hypothetical protein VITISV_035381                   62.4    4e-08   
ref|XP_008647814.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  62.4    4e-08   
ref|XP_006448579.1|  hypothetical protein CICLE_v10014061mg           62.8    4e-08   
ref|NP_001147975.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...  62.4    4e-08   
ref|XP_010483983.1|  PREDICTED: LRR receptor-like serine/threonin...  62.4    4e-08   
gb|AFO67891.1|  leucine-rich repeat receptor-like kinase              62.4    4e-08   
ref|XP_009797107.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  62.4    4e-08   
ref|XP_001755734.1|  ERL1b AtERECTA-like receptor S/T protein kin...  62.4    4e-08   
ref|XP_010668554.1|  PREDICTED: probably inactive leucine-rich re...  62.4    5e-08   
ref|XP_011034114.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  62.4    5e-08   
ref|XP_009104025.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...  62.4    5e-08   
ref|XP_009104018.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...  62.4    5e-08   
ref|XP_011034116.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  62.4    5e-08   
emb|CDY46185.1|  BnaA01g23070D                                        62.4    5e-08   
ref|XP_009596637.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  62.4    5e-08   
ref|XP_009370984.1|  PREDICTED: probable LRR receptor-like serine...  61.6    5e-08   
ref|XP_004508778.1|  PREDICTED: LRR receptor-like serine/threonin...  62.0    5e-08   
ref|NP_189183.2|  NSP-interacting kinase 2                            62.0    5e-08   
ref|NP_974360.1|  NSP-interacting kinase 2                            62.0    5e-08   
ref|NP_001189971.1|  NSP-interacting kinase 2                         62.0    5e-08   
ref|XP_004508779.1|  PREDICTED: LRR receptor-like serine/threonin...  62.0    5e-08   
ref|XP_007037205.1|  Leucine-rich repeat protein kinase family pr...  62.0    6e-08   
ref|XP_007037206.1|  Leucine-rich repeat protein kinase family pr...  62.0    6e-08   
ref|XP_002468123.1|  hypothetical protein SORBIDRAFT_01g040010        62.0    6e-08   
dbj|BAK02609.1|  predicted protein                                    62.0    6e-08   
ref|XP_010034579.1|  PREDICTED: putative receptor-like protein ki...  62.0    6e-08   
ref|XP_010940158.1|  PREDICTED: protein NSP-INTERACTING KINASE 3      62.0    6e-08   
ref|XP_009345675.1|  PREDICTED: probable LRR receptor-like serine...  62.0    7e-08   
ref|XP_011085266.1|  PREDICTED: LRR receptor-like serine/threonin...  62.0    7e-08   
gb|AFW88861.1|  putative leucine-rich repeat receptor-like protei...  61.6    7e-08   
ref|XP_002864814.1|  leucine-rich repeat family protein               61.6    7e-08   
ref|XP_010942962.1|  PREDICTED: LRR receptor-like serine/threonin...  61.6    8e-08   
ref|NP_001147917.1|  LOC100281527 precursor                           61.6    8e-08   
ref|XP_004984668.1|  PREDICTED: LRR receptor-like serine/threonin...  61.6    8e-08   
ref|XP_002299290.2|  leucine-rich repeat transmembrane protein ki...  61.6    8e-08   
ref|XP_010418025.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  61.6    8e-08   
ref|XP_010418023.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  61.6    8e-08   
ref|XP_009394924.1|  PREDICTED: LRR receptor-like serine/threonin...  61.6    8e-08   
gb|KHG14766.1|  LRR receptor-like serine/threonine-protein kinase...  61.6    8e-08   
ref|XP_009394917.1|  PREDICTED: LRR receptor-like serine/threonin...  61.6    9e-08   
gb|KHG00413.1|  hypothetical protein F383_17290                       61.6    9e-08   
ref|XP_002863549.1|  predicted protein                                61.6    9e-08   
ref|XP_001770421.1|  ERL2b AtERECTA-like receptor S/T protein kin...  61.6    9e-08   
ref|XP_006849970.1|  hypothetical protein AMTR_s00022p00151480        61.6    9e-08   
ref|XP_002436855.1|  hypothetical protein SORBIDRAFT_10g010010        61.2    1e-07   
ref|XP_007210873.1|  hypothetical protein PRUPE_ppa003105mg           61.2    1e-07   
gb|EPS73511.1|  hypothetical protein M569_01245                       61.2    1e-07   
ref|XP_009390158.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  61.2    1e-07   
ref|XP_002455108.1|  hypothetical protein SORBIDRAFT_03g004450        61.2    1e-07   
ref|XP_008647815.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  61.2    1e-07   
gb|KJB18215.1|  hypothetical protein B456_003G039900                  61.2    1e-07   
gb|KJB18216.1|  hypothetical protein B456_003G039900                  61.2    1e-07   
ref|XP_009390157.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  61.2    1e-07   
ref|XP_010100426.1|  Protein NSP-INTERACTING KINASE 3                 61.2    1e-07   
ref|XP_010942960.1|  PREDICTED: LRR receptor-like serine/threonin...  61.2    1e-07   
ref|XP_003615565.1|  Receptor protein kinase-like protein             61.2    1e-07   
emb|CAN63733.1|  hypothetical protein VITISV_025883                   61.2    1e-07   
ref|XP_008389688.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  61.2    1e-07   
ref|XP_010942956.1|  PREDICTED: LRR receptor-like serine/threonin...  61.2    1e-07   
ref|XP_008673396.1|  PREDICTED: LOC100280440 isoform X2               61.2    1e-07   
gb|AES98523.2|  LRR receptor-like kinase family protein               61.2    1e-07   
ref|XP_008389685.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  61.2    1e-07   
gb|ACM89541.1|  leucine-rich repeat receptor-like kinase              60.8    1e-07   
ref|NP_001146833.1|  LOC100280440 precursor                           61.2    1e-07   
ref|XP_008239850.1|  PREDICTED: LRR receptor-like serine/threonin...  61.2    1e-07   
ref|XP_008389687.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  61.2    1e-07   
ref|XP_008673399.1|  PREDICTED: LOC100280440 isoform X1               61.2    1e-07   
ref|XP_010550651.1|  PREDICTED: LRR receptor-like serine/threonin...  61.2    1e-07   
ref|XP_010686227.1|  PREDICTED: probable LRR receptor-like serine...  61.2    1e-07   
ref|XP_010942959.1|  PREDICTED: LRR receptor-like serine/threonin...  60.8    1e-07   
ref|XP_006280205.1|  hypothetical protein CARUB_v10026113mg           60.8    1e-07   
gb|KCW45147.1|  hypothetical protein EUGRSUZ_L01244                   61.2    1e-07   
emb|CBI27385.3|  unnamed protein product                              61.2    1e-07   
gb|KHN00370.1|  Protein NSP-INTERACTING KINASE 3                      60.8    1e-07   
ref|XP_003519642.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...  60.8    1e-07   
gb|KJB39878.1|  hypothetical protein B456_007G035200                  60.8    1e-07   
ref|XP_008340071.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  60.8    1e-07   
dbj|BAB10839.1|  receptor-like protein kinase                         60.8    1e-07   
ref|XP_008340072.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  60.8    1e-07   
ref|XP_008340070.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  60.8    1e-07   
ref|XP_008813582.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  60.8    1e-07   
ref|XP_008813583.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  60.8    1e-07   
ref|XP_009415746.1|  PREDICTED: leucine-rich repeat receptor-like...  60.8    1e-07   
ref|XP_009412457.1|  PREDICTED: LRR receptor-like serine/threonin...  60.8    2e-07   
ref|XP_003613191.1|  Leucine-rich repeat receptor-like kinase         60.8    2e-07   
ref|XP_011036960.1|  PREDICTED: probable LRR receptor-like serine...  60.8    2e-07   
gb|KDP31199.1|  hypothetical protein JCGZ_11575                       60.5    2e-07   
ref|XP_006356418.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  60.5    2e-07   
ref|XP_009403877.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  60.5    2e-07   
dbj|BAD68256.1|  putative brassinosteroid insensitive 1-associate...  60.1    2e-07   
gb|KHN14560.1|  Protein NSP-INTERACTING KINASE 3                      60.5    2e-07   
ref|XP_007221991.1|  hypothetical protein PRUPE_ppa002873mg           60.5    2e-07   
ref|XP_003517653.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  60.5    2e-07   
ref|XP_009403878.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  60.5    2e-07   
ref|XP_011086598.1|  PREDICTED: protein NSP-INTERACTING KINASE 3      60.5    2e-07   
gb|EMT30323.1|  Putative LRR receptor-like serine/threonine-prote...  60.5    2e-07   
emb|CBI15282.3|  unnamed protein product                              60.1    2e-07   
ref|XP_002270994.2|  PREDICTED: LRR receptor-like serine/threonin...  60.1    2e-07   
gb|KFK28003.1|  hypothetical protein AALP_AA8G459000                  60.1    2e-07   
ref|XP_003558273.1|  PREDICTED: LRR receptor-like serine/threonin...  60.1    2e-07   
ref|XP_010040521.1|  PREDICTED: putative receptor-like protein ki...  60.1    2e-07   
ref|XP_002452905.1|  hypothetical protein SORBIDRAFT_04g034820        60.5    2e-07   
ref|XP_004488225.1|  PREDICTED: LRR receptor-like serine/threonin...  60.5    2e-07   
ref|XP_006392114.1|  hypothetical protein EUTSA_v10023342mg           60.1    2e-07   
ref|NP_176279.1|  NSP-interacting kinase 3                            60.1    3e-07   
emb|CDY16762.1|  BnaA09g06200D                                        60.1    3e-07   
emb|CAN59710.1|  hypothetical protein VITISV_040317                   60.1    3e-07   
ref|XP_010276923.1|  PREDICTED: LRR receptor-like serine/threonin...  60.1    3e-07   
ref|XP_008658830.1|  PREDICTED: uncharacterized LOC100382590 isof...  60.1    3e-07   
ref|XP_004968347.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  60.1    3e-07   
ref|XP_008437655.1|  PREDICTED: LRR receptor-like serine/threonin...  60.1    3e-07   
ref|XP_011002164.1|  PREDICTED: probable leucine-rich repeat rece...  60.1    3e-07   
ref|XP_004238646.1|  PREDICTED: protein NSP-INTERACTING KINASE 3      60.1    3e-07   
ref|XP_006378225.1|  hypothetical protein POPTR_0010s05300g           60.1    3e-07   
ref|XP_008654537.1|  PREDICTED: uncharacterized LOC100272802 isof...  60.1    3e-07   
gb|ACN30679.1|  unknown                                               60.1    3e-07   
dbj|BAD68255.1|  putative brassinosteroid insensitive 1-associate...  60.1    3e-07   
ref|XP_011071715.1|  PREDICTED: LRR receptor-like serine/threonin...  59.7    3e-07   
ref|XP_008658828.1|  PREDICTED: uncharacterized LOC100382590 isof...  59.7    3e-07   
ref|XP_004157847.1|  PREDICTED: LRR receptor-like serine/threonin...  59.7    3e-07   
gb|KJB60823.1|  hypothetical protein B456_009G327400                  59.7    3e-07   
ref|XP_007009033.1|  Serine-threonine protein kinase, plant-type,...  60.1    3e-07   
ref|XP_002437981.1|  hypothetical protein SORBIDRAFT_10g005850        60.1    3e-07   
ref|XP_003563067.1|  PREDICTED: LRR receptor-like serine/threonin...  60.1    3e-07   
ref|XP_006394359.1|  hypothetical protein EUTSA_v10003855mg           59.7    3e-07   
ref|XP_006854255.1|  hypothetical protein AMTR_s00039p00029750        60.1    3e-07   
ref|XP_009344696.1|  PREDICTED: putative receptor-like protein ki...  60.1    3e-07   
ref|XP_009112029.1|  PREDICTED: LRR receptor-like serine/threonin...  59.7    3e-07   
ref|XP_006301740.1|  hypothetical protein CARUB_v10022201mg           59.7    3e-07   
gb|EMT09348.1|  LRR receptor-like serine/threonine-protein kinase...  59.7    3e-07   
ref|XP_011071714.1|  PREDICTED: LRR receptor-like serine/threonin...  59.7    3e-07   
ref|XP_004152539.1|  PREDICTED: LRR receptor-like serine/threonin...  59.7    3e-07   
gb|EYU28436.1|  hypothetical protein MIMGU_mgv1a002888mg              59.7    3e-07   
ref|XP_010318957.1|  PREDICTED: LRR receptor-like serine/threonin...  59.7    3e-07   
ref|XP_002886588.1|  nsp-interacting kinase 3                         59.7    4e-07   
ref|XP_008440179.1|  PREDICTED: LRR receptor-like serine/threonin...  59.7    4e-07   
gb|KFK39861.1|  hypothetical protein AALP_AA3G298300                  58.5    4e-07   
ref|NP_001057376.1|  Os06g0274500                                     59.7    4e-07   
ref|XP_006367065.1|  PREDICTED: LRR receptor-like serine/threonin...  59.7    4e-07   
gb|EAZ36607.1|  hypothetical protein OsJ_20953                        59.7    4e-07   
gb|EMT25229.1|  Putative LRR receptor-like serine/threonine-prote...  59.7    4e-07   
emb|CDY26481.1|  BnaC09g41870D                                        59.3    4e-07   
ref|XP_008373262.1|  PREDICTED: probable LRR receptor-like serine...  59.3    4e-07   
ref|XP_007157369.1|  hypothetical protein PHAVU_002G064400g           59.3    4e-07   
ref|XP_010267619.1|  PREDICTED: probable LRR receptor-like serine...  59.3    4e-07   
gb|KGN62469.1|  hypothetical protein Csa_2G354950                     59.7    4e-07   
ref|XP_006579547.1|  PREDICTED: LRR receptor-like serine/threonin...  59.3    4e-07   
ref|XP_011012222.1|  PREDICTED: probable leucine-rich repeat rece...  59.7    4e-07   
ref|XP_008444587.1|  PREDICTED: probable LRR receptor-like serine...  59.7    4e-07   
emb|CDX69484.1|  BnaA10g18330D                                        59.3    4e-07   
gb|KCW86694.1|  hypothetical protein EUGRSUZ_B03306                   59.3    4e-07   
ref|XP_010102407.1|  Probably inactive leucine-rich repeat recept...  59.3    4e-07   
ref|XP_009370700.1|  PREDICTED: probable LRR receptor-like serine...  59.3    4e-07   
gb|ADD60682.1|  putative somatic embryogenesis protein kinase 1       59.3    4e-07   
ref|XP_006432209.1|  hypothetical protein CICLE_v10003538mg           59.3    4e-07   
ref|XP_010267641.1|  PREDICTED: probable LRR receptor-like serine...  59.3    4e-07   
emb|CBI38425.3|  unnamed protein product                              58.9    5e-07   
ref|XP_010251173.1|  PREDICTED: protein NSP-INTERACTING KINASE 3      59.3    5e-07   
ref|XP_004299405.1|  PREDICTED: LRR receptor-like serine/threonin...  59.3    5e-07   
ref|XP_009417563.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  58.9    5e-07   
gb|ACN34523.1|  unknown                                               59.3    5e-07   
gb|ABR16631.1|  unknown                                               59.3    5e-07   
ref|XP_004143019.1|  PREDICTED: probable LRR receptor-like serine...  59.3    5e-07   
ref|XP_003533521.2|  PREDICTED: LRR receptor-like serine/threonin...  59.3    6e-07   
gb|KCW86687.1|  hypothetical protein EUGRSUZ_B03306                   58.9    6e-07   
ref|XP_010044597.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  58.9    6e-07   
ref|XP_010044596.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  58.9    6e-07   
ref|XP_010044595.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  58.9    6e-07   
ref|XP_010044598.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  58.9    6e-07   
ref|XP_002315684.2|  hypothetical protein POPTR_0010s05300g           58.9    6e-07   
ref|XP_010044599.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  58.9    6e-07   
gb|KCW86689.1|  hypothetical protein EUGRSUZ_B03306                   58.9    6e-07   
ref|XP_010044594.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  58.9    6e-07   
gb|KCW86693.1|  hypothetical protein EUGRSUZ_B03306                   58.9    6e-07   
gb|KCW86692.1|  hypothetical protein EUGRSUZ_B03306                   58.9    6e-07   
ref|XP_009417562.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  58.9    6e-07   
ref|XP_006398094.1|  hypothetical protein EUTSA_v10000741mg           58.9    6e-07   
ref|XP_003616617.1|  Kinase-like protein                              58.9    6e-07   
gb|KCW86691.1|  hypothetical protein EUGRSUZ_B03306                   58.9    6e-07   
gb|KCW86690.1|  hypothetical protein EUGRSUZ_B03306                   58.9    6e-07   
ref|XP_003572984.2|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  58.9    7e-07   
ref|XP_008809723.1|  PREDICTED: probable LRR receptor-like serine...  58.9    7e-07   
ref|XP_010236002.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  58.5    7e-07   
ref|XP_002311408.2|  hypothetical protein POPTR_0008s10970g           58.5    7e-07   
gb|KDP44797.1|  hypothetical protein JCGZ_01297                       58.9    7e-07   
ref|XP_004965216.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  58.5    7e-07   
ref|XP_002265191.2|  PREDICTED: LRR receptor-like serine/threonin...  58.9    7e-07   
gb|EAY96704.1|  hypothetical protein OsI_18626                        58.9    7e-07   
dbj|BAK05926.1|  predicted protein                                    58.5    7e-07   
ref|XP_010528022.1|  PREDICTED: protein NSP-INTERACTING KINASE 2      58.5    8e-07   
ref|XP_011021146.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  58.5    8e-07   
ref|XP_002305057.2|  hypothetical protein POPTR_0004s05880g           58.9    8e-07   
emb|CDX87267.1|  BnaC09g05820D                                        58.5    8e-07   
ref|XP_010249628.1|  PREDICTED: receptor-like protein 12              58.5    8e-07   
ref|XP_010229813.1|  PREDICTED: putative receptor-like protein ki...  56.2    8e-07   
gb|KJB18214.1|  hypothetical protein B456_003G039900                  58.5    8e-07   
ref|XP_008243752.1|  PREDICTED: protein NSP-INTERACTING KINASE 2      58.5    8e-07   
ref|XP_007155343.1|  hypothetical protein PHAVU_003G193100g           58.5    8e-07   
ref|XP_010549936.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      58.5    8e-07   
gb|KHN18521.1|  LRR receptor-like serine/threonine-protein kinase...  58.5    8e-07   
ref|XP_006338306.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  58.5    8e-07   
ref|XP_011021148.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  58.5    8e-07   
ref|XP_010917821.1|  PREDICTED: putative receptor-like protein ki...  58.5    9e-07   
ref|XP_002453589.1|  hypothetical protein SORBIDRAFT_04g008570        58.5    9e-07   
gb|KEH21801.1|  NSP-interacting kinase-like protein                   58.2    9e-07   
gb|AAU44328.1|  unknown protein                                       58.5    9e-07   
ref|XP_010230509.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...  58.2    9e-07   
ref|XP_010023506.1|  PREDICTED: protein NSP-INTERACTING KINASE 3      58.2    9e-07   
ref|XP_003569325.2|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...  58.2    9e-07   
gb|EAY80966.1|  hypothetical protein OsI_36147                        56.2    9e-07   
ref|NP_001054768.2|  Os05g0170300                                     58.5    9e-07   
ref|XP_009121529.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      58.2    1e-06   
gb|KEH37336.1|  LRR receptor-like kinase family protein               58.5    1e-06   
gb|EMS63784.1|  LRR receptor-like serine/threonine-protein kinase...  58.2    1e-06   



>ref|XP_009757534.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Nicotiana sylvestris]
Length=967

 Score =   162 bits (411),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +1

Query  223  MEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGV  402
            M+F    VL  ILL  P+ S + +EGK LMSIKESFSNVANVLLDWDDVHNEDFCSWRGV
Sbjct  1    MKFRSRAVLWSILLLLPIVSSLNEEGKALMSIKESFSNVANVLLDWDDVHNEDFCSWRGV  60

Query  403  SCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislill  582
             CGNFSMSVV+LNLSNLNLGGEISPAIGDL+NLQSIDLQGN+LTGQIPDEIG+CISLI L
Sbjct  61   LCGNFSMSVVALNLSNLNLGGEISPAIGDLKNLQSIDLQGNKLTGQIPDEIGSCISLIFL  120

Query  583  dlsdnllYGDIPFSI  627
            DLSDNLL+GDIPFSI
Sbjct  121  DLSDNLLFGDIPFSI  135



>ref|XP_009757535.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X2 [Nicotiana sylvestris]
Length=964

 Score =   162 bits (411),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +1

Query  223  MEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGV  402
            M+F    VL  ILL  P+ S + +EGK LMSIKESFSNVANVLLDWDDVHNEDFCSWRGV
Sbjct  1    MKFRSRAVLWSILLLLPIVSSLNEEGKALMSIKESFSNVANVLLDWDDVHNEDFCSWRGV  60

Query  403  SCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislill  582
             CGNFSMSVV+LNLSNLNLGGEISPAIGDL+NLQSIDLQGN+LTGQIPDEIG+CISLI L
Sbjct  61   LCGNFSMSVVALNLSNLNLGGEISPAIGDLKNLQSIDLQGNKLTGQIPDEIGSCISLIFL  120

Query  583  dlsdnllYGDIPFSI  627
            DLSDNLL+GDIPFSI
Sbjct  121  DLSDNLLFGDIPFSI  135



>ref|XP_009600406.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Nicotiana tomentosiformis]
Length=967

 Score =   159 bits (402),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = +1

Query  223  MEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGV  402
            M+     VL  ILL  P+ S + +EGK LMSIKESFSNVAN+LLDWDDVHNEDFCSWRGV
Sbjct  1    MKLRSRAVLWAILLLLPIVSSLNEEGKALMSIKESFSNVANMLLDWDDVHNEDFCSWRGV  60

Query  403  SCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislill  582
             CGNFSMSVV+LNLSNLNLGGEISPA+GDL+NLQSIDLQGN+LTGQIPDEIGNCISLI L
Sbjct  61   FCGNFSMSVVALNLSNLNLGGEISPAVGDLKNLQSIDLQGNKLTGQIPDEIGNCISLIFL  120

Query  583  dlsdnllYGDIPFSI  627
            DLSDNLL+GDIPFSI
Sbjct  121  DLSDNLLFGDIPFSI  135



>ref|XP_007038488.1| ERECTA-like 1 [Theobroma cacao]
 gb|EOY22989.1| ERECTA-like 1 [Theobroma cacao]
Length=991

 Score =   155 bits (393),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 121/149 (81%), Gaps = 2/149 (1%)
 Frame = +1

Query  187  MVEKVLFPG-IRKMEFALACVLALILLSF-PLTSCIGDEGKTLMSIKESFSNVANVLLDW  360
            M E+VL     R+ E     V+ ++ L   P+ S + DEGK LMSIKESFSNVANVLLDW
Sbjct  1    MEEEVLLERRKRRKELYGGLVMVMVFLVLCPIASSLNDEGKALMSIKESFSNVANVLLDW  60

Query  361  DDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQ  540
            DDVHN DFCSWRGV C N S+SVVSLNLSNL LGGEISPAIGDL+NLQSIDL+GN+LTGQ
Sbjct  61   DDVHNADFCSWRGVFCDNISLSVVSLNLSNLILGGEISPAIGDLKNLQSIDLEGNKLTGQ  120

Query  541  IPDEIGncislilldlsdnllYGDIPFSI  627
            IPDEIGNC SL+ LDLSDNLLYGDIPFSI
Sbjct  121  IPDEIGNCGSLVHLDLSDNLLYGDIPFSI  149



>ref|XP_002318267.2| PTH-1 family protein [Populus trichocarpa]
 gb|EEE96487.2| PTH-1 family protein [Populus trichocarpa]
Length=984

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = +1

Query  271  PLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsn  450
            PL S + DEGK LMSIKESFSNV NVLLDWDDVHNEDFCSWRGV C N S+SVVSLNLSN
Sbjct  23   PLVSPLNDEGKALMSIKESFSNVVNVLLDWDDVHNEDFCSWRGVFCDNVSLSVVSLNLSN  82

Query  451  lnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            LNLGGEISPAIGDLRNLQSID QGN+LTGQIP+EIGNC SL  LDLSDNLLYGD+PFSI
Sbjct  83   LNLGGEISPAIGDLRNLQSIDFQGNKLTGQIPEEIGNCASLFNLDLSDNLLYGDMPFSI  141



>ref|XP_011029995.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Populus euphratica]
Length=984

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 103/119 (87%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +1

Query  271  PLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsn  450
            PL   + DEGK LMSIKESFSNVANVLLDWDDVHNEDFCSWRGV C N S SVVSLNLSN
Sbjct  23   PLVFPLNDEGKALMSIKESFSNVANVLLDWDDVHNEDFCSWRGVFCDNVSFSVVSLNLSN  82

Query  451  lnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            LNLGGEISPAIGDLRNLQSID QGN+LTGQIP+EIGNC SL  LDLSDNLLYGDIPFSI
Sbjct  83   LNLGGEISPAIGDLRNLQSIDFQGNKLTGQIPEEIGNCASLFNLDLSDNLLYGDIPFSI  141



>ref|XP_011076298.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Sesamum indicum]
Length=993

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = +1

Query  187  MVEKVLF-PGIRKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWD  363
            +VE+ LF  G   M+  L   + +  L FPL S + DEGK LMSIK SFSNVANVLLDWD
Sbjct  3    VVEEQLFVEGKTNMKMGLLYFVLVFFLLFPLASPLSDEGKALMSIKASFSNVANVLLDWD  62

Query  364  DVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQI  543
            +VHN+DFCSWRGVSCGN S SVV+LNLSNLNL GEIS AIGDL++LQS+DLQGN+LTGQI
Sbjct  63   EVHNDDFCSWRGVSCGNISTSVVALNLSNLNLCGEISAAIGDLKSLQSLDLQGNKLTGQI  122

Query  544  PDEIGncislilldlsdnllYGDIPFSI  627
            PDEIGNCISL+LLDLS+NLL GDIPFSI
Sbjct  123  PDEIGNCISLLLLDLSNNLLEGDIPFSI  150



>ref|XP_009345019.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Pyrus x bretschneideri]
Length=955

 Score =   148 bits (374),  Expect = 4e-37, Method: Composition-based stats.
 Identities = 99/120 (83%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  268  FPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnls  447
            FPL S + DEGK LMSIK SFSNVANVLLDW+D H+ DFCSWRGV C N S+SV SLNLS
Sbjct  5    FPLGSPLNDEGKALMSIKASFSNVANVLLDWNDAHDGDFCSWRGVFCDNVSLSVASLNLS  64

Query  448  nlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            NLNLGGEISPAIGDL NL SIDLQGN+LTGQIPDEIGNC SLI LDLSDNLLYGDIPFS+
Sbjct  65   NLNLGGEISPAIGDLGNLDSIDLQGNKLTGQIPDEIGNCASLIHLDLSDNLLYGDIPFSV  124



>ref|XP_004308156.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Fragaria vesca subsp. vesca]
Length=989

 Score =   148 bits (373),  Expect = 5e-37, Method: Composition-based stats.
 Identities = 98/126 (78%), Positives = 109/126 (87%), Gaps = 1/126 (1%)
 Frame = +1

Query  247  LALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsms  426
            LAL LL FP+ S + DEGK LM+IK SFSNVANVLLDW+D H++DFCSWRGV C N S+S
Sbjct  24   LALFLL-FPVASSLNDEGKALMAIKASFSNVANVLLDWNDAHDDDFCSWRGVFCDNVSLS  82

Query  427  vvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllY  606
            V SLNLS+LNLGGEISPA+GDL NL+SIDLQGN+LTGQIPDEIGNC SLI LDLSDN L 
Sbjct  83   VASLNLSSLNLGGEISPAVGDLGNLESIDLQGNKLTGQIPDEIGNCASLIYLDLSDNNLS  142

Query  607  GDIPFS  624
            GDIPFS
Sbjct  143  GDIPFS  148



>ref|XP_008376471.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Malus domestica]
Length=987

 Score =   147 bits (371),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 118/147 (80%), Gaps = 2/147 (1%)
 Frame = +1

Query  187  MVEKVLFPGIRKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDD  366
            M  +VL+   +K E      LAL+ + FPL S + DEGK LMSIK SFSNVANVLLDW+D
Sbjct  1    MERRVLWR--KKTELVFCFGLALMAVLFPLGSPLNDEGKALMSIKASFSNVANVLLDWND  58

Query  367  VHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIP  546
             H+ DFCSWRGV C N S+SV SLNLSNLNLGGEISPAIGDL NL+ IDLQGN+LTGQIP
Sbjct  59   AHDGDFCSWRGVFCDNVSLSVASLNLSNLNLGGEISPAIGDLGNLEYIDLQGNKLTGQIP  118

Query  547  DEIGncislilldlsdnllYGDIPFSI  627
            DEIG+C SLI LDLSDNLLYGDIPFS+
Sbjct  119  DEIGDCASLIHLDLSDNLLYGDIPFSV  145



>ref|XP_002864777.1| hypothetical protein ARALYDRAFT_496399 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41036.1| hypothetical protein ARALYDRAFT_496399 [Arabidopsis lyrata subsp. 
lyrata]
Length=966

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = +1

Query  217  RKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWR  396
             KM+  + C+  ++ L   + S I +EGK LM+IK SFSN+ N+LLDWDDVHN DFCSWR
Sbjct  3    EKMQRMVLCLAMVVFLLLGVASSINNEGKALMAIKGSFSNLVNMLLDWDDVHNSDFCSWR  62

Query  397  GVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncisli  576
            GV C   + SVVSLNLS+LNLGGEISPA+GDLRNL+SIDLQGN+L GQIPDEIGNC SL+
Sbjct  63   GVYCDIVTFSVVSLNLSSLNLGGEISPAMGDLRNLESIDLQGNKLAGQIPDEIGNCASLV  122

Query  577  lldlsdnllYGDIPFSI  627
             LDLSDNLLYGDIPFSI
Sbjct  123  YLDLSDNLLYGDIPFSI  139



>ref|XP_010555314.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Tarenaya hassleriana]
Length=986

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 116/138 (84%), Gaps = 1/138 (1%)
 Frame = +1

Query  214  IRKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSW  393
            +R   + L+  +A+ +L   + S I DEGK LM+IK SFSNVANVLLDWDDVHN+DFCSW
Sbjct  3    VRVKGWVLSLAMAVFVL-VGVASSINDEGKALMAIKASFSNVANVLLDWDDVHNDDFCSW  61

Query  394  RGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncisl  573
            RGV C N S+SVVSLNLSNLNLGGEISPA+GDLRNL+SIDLQGN+L GQIPDEIGNC SL
Sbjct  62   RGVYCDNISLSVVSLNLSNLNLGGEISPAVGDLRNLKSIDLQGNKLAGQIPDEIGNCASL  121

Query  574  illdlsdnllYGDIPFSI  627
            + LD S+NLL+GDIPFSI
Sbjct  122  VYLDFSNNLLFGDIPFSI  139



>gb|KJB39364.1| hypothetical protein B456_007G009000 [Gossypium raimondii]
 gb|KJB39365.1| hypothetical protein B456_007G009000 [Gossypium raimondii]
Length=993

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 118/149 (79%), Gaps = 2/149 (1%)
 Frame = +1

Query  187  MVEKVLFPGIRKMEFALACVLALILLSF--PLTSCIGDEGKTLMSIKESFSNVANVLLDW  360
            M E VL   I + +  L  V+A +LL       S + DEGK LMSIK SFSNVANVLLDW
Sbjct  1    MEEGVLLKKIMRRQELLVMVIAFLLLFLLCSHASSLNDEGKALMSIKASFSNVANVLLDW  60

Query  361  DDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQ  540
            DDV+N DFCSWRGV C N S++VVSLNLSNL LGGEISPAIGDLR+LQS+DL GN+LTGQ
Sbjct  61   DDVNNFDFCSWRGVFCDNSSLAVVSLNLSNLILGGEISPAIGDLRSLQSLDLMGNKLTGQ  120

Query  541  IPDEIGncislilldlsdnllYGDIPFSI  627
            +PDEIGNC SL+ LDLSDNLLYGDIPFSI
Sbjct  121  VPDEIGNCGSLVYLDLSDNLLYGDIPFSI  149



>gb|KHG06831.1| LRR receptor-like serine/threonine-protein kinase ERL2 [Gossypium 
arboreum]
Length=991

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 117/147 (80%), Gaps = 0/147 (0%)
 Frame = +1

Query  187  MVEKVLFPGIRKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDD  366
            M E VL   I K +  L  V+A +LL     S + DEGK LMSIK SFSNVANVLLDWDD
Sbjct  1    MEEGVLLKKIMKRQEPLVMVIAFLLLLCSHASSLNDEGKALMSIKASFSNVANVLLDWDD  60

Query  367  VHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIP  546
            V+N DFCSWRGV C N S++VVSLNLSNL LGGEIS AIGDLR+L+S+DL GN+LTGQ+P
Sbjct  61   VNNFDFCSWRGVFCDNSSLAVVSLNLSNLILGGEISSAIGDLRSLRSLDLMGNKLTGQVP  120

Query  547  DEIGncislilldlsdnllYGDIPFSI  627
            DEIGNC SL+ LDLSDNLLYGDIPFSI
Sbjct  121  DEIGNCGSLVYLDLSDNLLYGDIPFSI  147



>ref|XP_008465055.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Cucumis melo]
Length=1000

 Score =   146 bits (369),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 94/121 (78%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +1

Query  265  SFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnl  444
            S P++S   +EG+ LMSIK SFSNVANVLLDWDD HN DFCSWRGV C N S+SV +LNL
Sbjct  33   SSPVSSLPHNEGRALMSIKASFSNVANVLLDWDDDHNHDFCSWRGVFCDNVSLSVAALNL  92

Query  445  snlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFS  624
            SNLNLGGEISP+IGDLRNLQSID QGN+LTGQIPDEIGNC  L+ LDLSDNLLYGDIPF+
Sbjct  93   SNLNLGGEISPSIGDLRNLQSIDFQGNKLTGQIPDEIGNCGLLVHLDLSDNLLYGDIPFT  152

Query  625  I  627
            +
Sbjct  153  V  153



>ref|XP_004234153.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Solanum lycopersicum]
Length=976

 Score =   145 bits (367),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 120/136 (88%), Gaps = 0/136 (0%)
 Frame = +1

Query  220  KMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRG  399
            KM+F    +L ++LL FP+   + +EGK LMSIK SFSNVANVLLDWDD+H+EDFCSWRG
Sbjct  7    KMKFRSQALLLVLLLVFPIVLALTEEGKALMSIKASFSNVANVLLDWDDIHDEDFCSWRG  66

Query  400  VSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislil  579
            V CGNFSMSVV+LNLSNLNLGGEISP IG+L+NL+++DLQGN+LTGQ+PDEIGNCISLI 
Sbjct  67   VLCGNFSMSVVALNLSNLNLGGEISPDIGELKNLETLDLQGNKLTGQVPDEIGNCISLIY  126

Query  580  ldlsdnllYGDIPFSI  627
            LDLSDNL YGDIPFSI
Sbjct  127  LDLSDNLFYGDIPFSI  142



>gb|KGN49592.1| hypothetical protein Csa_5G014290 [Cucumis sativus]
Length=994

 Score =   145 bits (366),  Expect = 5e-36, Method: Composition-based stats.
 Identities = 94/121 (78%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = +1

Query  265  SFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnl  444
            S P+ S   +EG+ LMSIK SFSNVANVLLDWDD HN DFCSWRGV C N S+SV +LNL
Sbjct  30   SSPVYSLPHNEGRALMSIKASFSNVANVLLDWDDDHNHDFCSWRGVFCDNVSLSVAALNL  89

Query  445  snlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFS  624
            SNLNLGGEISP+IGDLRNLQSID QGN+LTGQIPDEIGNC  L+ LDLSDNLLYGDIPF+
Sbjct  90   SNLNLGGEISPSIGDLRNLQSIDFQGNKLTGQIPDEIGNCGLLVHLDLSDNLLYGDIPFT  149

Query  625  I  627
            +
Sbjct  150  V  150



>gb|KHN24405.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Glycine 
soja]
Length=949

 Score =   144 bits (364),  Expect = 8e-36, Method: Composition-based stats.
 Identities = 93/119 (78%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +1

Query  271  PLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsn  450
            P  S +GDEG+ LM IK SFSNVA+VL DWD +HN+DFCSWRGV C N S+SV+ LNLS+
Sbjct  32   PFVSPLGDEGQALMKIKSSFSNVADVLHDWDALHNDDFCSWRGVLCDNVSLSVLFLNLSS  91

Query  451  lnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            LNLGGEISPAIGDL NLQSIDLQGN+LTGQIPDEIGNC  LI LDLSDN LYGDIPFSI
Sbjct  92   LNLGGEISPAIGDLVNLQSIDLQGNKLTGQIPDEIGNCAELIYLDLSDNQLYGDIPFSI  150



>ref|XP_006598682.1| PREDICTED: ERECTA-like kinase isoform X1 [Glycine max]
Length=993

 Score =   144 bits (364),  Expect = 8e-36, Method: Composition-based stats.
 Identities = 93/119 (78%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +1

Query  271  PLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsn  450
            P  S +GDEG+ LM IK SFSNVA+VL DWD +HN+DFCSWRGV C N S+SV+ LNLS+
Sbjct  32   PFVSPLGDEGQALMKIKSSFSNVADVLHDWDALHNDDFCSWRGVLCDNVSLSVLFLNLSS  91

Query  451  lnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            LNLGGEISPAIGDL NLQSIDLQGN+LTGQIPDEIGNC  LI LDLSDN LYGDIPFSI
Sbjct  92   LNLGGEISPAIGDLVNLQSIDLQGNKLTGQIPDEIGNCAELIYLDLSDNQLYGDIPFSI  150



>ref|NP_001235330.1| ERECTA-like kinase [Glycine max]
 gb|ACM89560.1| ERECTA-like kinase [Glycine max]
Length=1009

 Score =   144 bits (364),  Expect = 9e-36, Method: Composition-based stats.
 Identities = 93/119 (78%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +1

Query  271  PLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsn  450
            P  S +GDEG+ LM IK SFSNVA+VL DWD +HN+DFCSWRGV C N S+SV+ LNLS+
Sbjct  32   PFVSPLGDEGQALMKIKSSFSNVADVLHDWDALHNDDFCSWRGVLCDNVSLSVLFLNLSS  91

Query  451  lnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            LNLGGEISPAIGDL NLQSIDLQGN+LTGQIPDEIGNC  LI LDLSDN LYGDIPFSI
Sbjct  92   LNLGGEISPAIGDLVNLQSIDLQGNKLTGQIPDEIGNCAELIYLDLSDNQLYGDIPFSI  150



>ref|XP_007143329.1| hypothetical protein PHAVU_007G063200g [Phaseolus vulgaris]
 gb|ESW15323.1| hypothetical protein PHAVU_007G063200g [Phaseolus vulgaris]
Length=987

 Score =   144 bits (363),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 90/114 (79%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +1

Query  286  IGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGG  465
            + +EG+ LM++K +FSN+ +VLLDWDDVHN+DFCSWRGVSC N S+SVVSLNLS+LNLGG
Sbjct  38   LSEEGQALMAMKATFSNMPDVLLDWDDVHNDDFCSWRGVSCDNGSLSVVSLNLSSLNLGG  97

Query  466  EISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            EISPAIGDLRNLQSIDLQGN+LTGQIPDEIGNC +L  LDLSDN LYGDIPFS+
Sbjct  98   EISPAIGDLRNLQSIDLQGNKLTGQIPDEIGNCAALFHLDLSDNQLYGDIPFSL  151



>ref|XP_010452673.1| PREDICTED: LOW QUALITY PROTEIN: LRR receptor-like serine/threonine-protein 
kinase ERL2 [Camelina sativa]
Length=923

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 115/141 (82%), Gaps = 6/141 (4%)
 Frame = +1

Query  214  IRKME---FALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDF  384
            I KM+   F L  V+ +++ +    S + +EGK LM+IK SFSNVAN+LLDWDDVHN DF
Sbjct  4    IEKMKGLVFGLGMVVFMLIGA---VSPMNNEGKALMAIKASFSNVANMLLDWDDVHNNDF  60

Query  385  CSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGnc  564
            CSWRGVSC N ++SVVSLNLS LNLGGEISPA+GDLRNLQSIDLQGN+L GQIPDEIGNC
Sbjct  61   CSWRGVSCDNLTLSVVSLNLSTLNLGGEISPALGDLRNLQSIDLQGNKLGGQIPDEIGNC  120

Query  565  islilldlsdnllYGDIPFSI  627
             SL  LDLS NLL+GDIPFSI
Sbjct  121  ASLAYLDLSTNLLFGDIPFSI  141



>ref|XP_010423243.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 isoform X1 [Camelina sativa]
Length=967

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 115/141 (82%), Gaps = 6/141 (4%)
 Frame = +1

Query  214  IRKME---FALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDF  384
            I KM+   F L  V+ +++ +    S + +EGK LM+IK SFSNVAN+LLDWDDVHN DF
Sbjct  4    IEKMKGLVFGLGMVVFMLIGA---VSPMNNEGKALMAIKASFSNVANMLLDWDDVHNNDF  60

Query  385  CSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGnc  564
            CSWRGVSC N ++SVVSLNLS LNLGGEISPA+GDLRNLQSIDLQGN+L GQIPDEIGNC
Sbjct  61   CSWRGVSCDNLTLSVVSLNLSTLNLGGEISPALGDLRNLQSIDLQGNKLGGQIPDEIGNC  120

Query  565  islilldlsdnllYGDIPFSI  627
             SL  +DLS NLL+GDIPFSI
Sbjct  121  ASLAYVDLSTNLLFGDIPFSI  141



>ref|XP_009346939.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Pyrus x bretschneideri]
Length=959

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  268  FPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnls  447
            FPL S + DEGK LMSIK SFSNVANVLLDW+D H+ DFCSWRGV C N S+SV SLNLS
Sbjct  5    FPLGSPLNDEGKALMSIKASFSNVANVLLDWNDAHDGDFCSWRGVFCDNVSLSVASLNLS  64

Query  448  nlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            NLNLGGEISPAIGDL NL+SIDLQGN+LTGQIPDEIGNC SLI LDLSDNLLYGDIPFS+
Sbjct  65   NLNLGGEISPAIGDLGNLESIDLQGNKLTGQIPDEIGNCASLIHLDLSDNLLYGDIPFSV  124



>ref|NP_001190595.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Arabidopsis 
thaliana]
 gb|AED97584.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Arabidopsis 
thaliana]
Length=918

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 114/138 (83%), Gaps = 3/138 (2%)
 Frame = +1

Query  214  IRKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSW  393
            +++M  +LA V  ++   F + S + +EGK LM+IK SFSN+ N+LLDWDDVHN D CSW
Sbjct  5    MQRMVLSLAMVGFMV---FGVASAMNNEGKALMAIKGSFSNLVNMLLDWDDVHNSDLCSW  61

Query  394  RGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncisl  573
            RGV C N S SVVSLNLS+LNLGGEISPAIGDLRNLQSIDLQGN+L GQIPDEIGNC SL
Sbjct  62   RGVFCDNVSYSVVSLNLSSLNLGGEISPAIGDLRNLQSIDLQGNKLAGQIPDEIGNCASL  121

Query  574  illdlsdnllYGDIPFSI  627
            + LDLS+NLLYGDIPFSI
Sbjct  122  VYLDLSENLLYGDIPFSI  139



>ref|XP_010491322.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Camelina sativa]
Length=961

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +1

Query  280  SCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnl  459
            S + +EGK LM+IK SFSNVAN+LLDWDDVHN DFCSWRGVSC N ++SVVSLNLS LNL
Sbjct  20   SPMNNEGKALMAIKASFSNVANMLLDWDDVHNNDFCSWRGVSCDNLTLSVVSLNLSTLNL  79

Query  460  GGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            GGEISPA+GDLRNLQSIDLQGN+L GQIPDEIGNC SL  +DLS NLL+GDIPFSI
Sbjct  80   GGEISPALGDLRNLQSIDLQGNKLGGQIPDEIGNCASLAYVDLSTNLLFGDIPFSI  135



>dbj|BAA97187.1| receptor-like protein kinase [Arabidopsis thaliana]
Length=938

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 114/138 (83%), Gaps = 3/138 (2%)
 Frame = +1

Query  214  IRKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSW  393
            +++M  +LA V  ++   F + S + +EGK LM+IK SFSN+ N+LLDWDDVHN D CSW
Sbjct  5    MQRMVLSLAMVGFMV---FGVASAMNNEGKALMAIKGSFSNLVNMLLDWDDVHNSDLCSW  61

Query  394  RGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncisl  573
            RGV C N S SVVSLNLS+LNLGGEISPAIGDLRNLQSIDLQGN+L GQIPDEIGNC SL
Sbjct  62   RGVFCDNVSYSVVSLNLSSLNLGGEISPAIGDLRNLQSIDLQGNKLAGQIPDEIGNCASL  121

Query  574  illdlsdnllYGDIPFSI  627
            + LDLS+NLLYGDIPFSI
Sbjct  122  VYLDLSENLLYGDIPFSI  139



>gb|AAP69763.1| ERECTA-like kinase 1 [Arabidopsis thaliana]
Length=966

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 114/138 (83%), Gaps = 3/138 (2%)
 Frame = +1

Query  214  IRKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSW  393
            +++M  +LA V  ++   F + S + +EGK LM+IK SFSN+ N+LLDWDDVHN D CSW
Sbjct  5    MQRMVLSLAMVGFMV---FGVASAMNNEGKALMAIKGSFSNLVNMLLDWDDVHNSDLCSW  61

Query  394  RGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncisl  573
            RGV C N S SVVSLNLS+LNLGGEISPAIGDLRNLQSIDLQGN+L GQIPDEIGNC SL
Sbjct  62   RGVFCDNVSYSVVSLNLSSLNLGGEISPAIGDLRNLQSIDLQGNKLAGQIPDEIGNCASL  121

Query  574  illdlsdnllYGDIPFSI  627
            + LDLS+NLLYGDIPFSI
Sbjct  122  VYLDLSENLLYGDIPFSI  139



>ref|NP_201029.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Arabidopsis 
thaliana]
 sp|C0LGW6.1|ERL1_ARATH RecName: Full=LRR receptor-like serine/threonine-protein kinase 
ERL1; AltName: Full=Protein ERECTA-like kinase 1; Flags: 
Precursor [Arabidopsis thaliana]
 gb|ACN59401.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED97583.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Arabidopsis 
thaliana]
Length=966

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 114/138 (83%), Gaps = 3/138 (2%)
 Frame = +1

Query  214  IRKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSW  393
            +++M  +LA V  ++   F + S + +EGK LM+IK SFSN+ N+LLDWDDVHN D CSW
Sbjct  5    MQRMVLSLAMVGFMV---FGVASAMNNEGKALMAIKGSFSNLVNMLLDWDDVHNSDLCSW  61

Query  394  RGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncisl  573
            RGV C N S SVVSLNLS+LNLGGEISPAIGDLRNLQSIDLQGN+L GQIPDEIGNC SL
Sbjct  62   RGVFCDNVSYSVVSLNLSSLNLGGEISPAIGDLRNLQSIDLQGNKLAGQIPDEIGNCASL  121

Query  574  illdlsdnllYGDIPFSI  627
            + LDLS+NLLYGDIPFSI
Sbjct  122  VYLDLSENLLYGDIPFSI  139



>ref|XP_006490262.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2-like [Citrus sinensis]
Length=965

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = +1

Query  292  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  471
            DEGK LM+IK SFSN+ANVLLDWDDVHN DFCSWRGV C N S+SVVSLNLS+LNLGGEI
Sbjct  17   DEGKALMAIKASFSNLANVLLDWDDVHNSDFCSWRGVFCDNSSLSVVSLNLSSLNLGGEI  76

Query  472  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            SP+IGDLRNLQSID QGN+LTGQIPDEIGNC SL+ ++LSDN LYGDIPFSI
Sbjct  77   SPSIGDLRNLQSIDFQGNKLTGQIPDEIGNCGSLVHIELSDNSLYGDIPFSI  128



>ref|XP_006348052.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1-like isoform X2 [Solanum tuberosum]
Length=973

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 98/112 (88%), Positives = 108/112 (96%), Gaps = 0/112 (0%)
 Frame = +1

Query  292  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  471
            +EGK LMSIK SFSNVANVLLDWDDVH+EDFCSWRGV CGNFS+SVV+LNLSNLNLGGEI
Sbjct  30   EEGKALMSIKASFSNVANVLLDWDDVHDEDFCSWRGVLCGNFSISVVALNLSNLNLGGEI  89

Query  472  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            SPAIGDL+NL+++DLQGN+LTGQ+PDEIGNCISLI LDLSDNLLYGDIPFSI
Sbjct  90   SPAIGDLKNLETLDLQGNKLTGQVPDEIGNCISLIYLDLSDNLLYGDIPFSI  141



>ref|XP_006348051.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1-like isoform X1 [Solanum tuberosum]
Length=975

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 98/112 (88%), Positives = 108/112 (96%), Gaps = 0/112 (0%)
 Frame = +1

Query  292  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  471
            +EGK LMSIK SFSNVANVLLDWDDVH+EDFCSWRGV CGNFS+SVV+LNLSNLNLGGEI
Sbjct  30   EEGKALMSIKASFSNVANVLLDWDDVHDEDFCSWRGVLCGNFSISVVALNLSNLNLGGEI  89

Query  472  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            SPAIGDL+NL+++DLQGN+LTGQ+PDEIGNCISLI LDLSDNLLYGDIPFSI
Sbjct  90   SPAIGDLKNLETLDLQGNKLTGQVPDEIGNCISLIYLDLSDNLLYGDIPFSI  141



>ref|XP_007152392.1| hypothetical protein PHAVU_004G126100g [Phaseolus vulgaris]
 gb|ESW24386.1| hypothetical protein PHAVU_004G126100g [Phaseolus vulgaris]
Length=989

 Score =   142 bits (358),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 93/119 (78%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +1

Query  271  PLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsn  450
            P  S + DEG+ LM IK SFSNVA+VL DWDD+HN+DFCSWRGV C N S++V+SLNLSN
Sbjct  31   PFASPLSDEGQALMKIKASFSNVADVLHDWDDLHNDDFCSWRGVLCDNVSLTVLSLNLSN  90

Query  451  lnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            LNLGGEI PAIGDL NLQSIDLQGN+LTGQIPDEIGNC +LI LDLSDN LYGDIPFSI
Sbjct  91   LNLGGEIPPAIGDLGNLQSIDLQGNKLTGQIPDEIGNCAALIHLDLSDNQLYGDIPFSI  149



>ref|XP_006399198.1| hypothetical protein EUTSA_v10012600mg [Eutrema salsugineum]
 gb|ESQ40651.1| hypothetical protein EUTSA_v10012600mg [Eutrema salsugineum]
Length=935

 Score =   142 bits (358),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 109/132 (83%), Gaps = 1/132 (1%)
 Frame = +1

Query  235  LACVLALILLSF-PLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCG  411
            LA  L +++ +F    S I +EGK LM+IK SFSNVAN+LLDWD+VHN DFCSWRGV C 
Sbjct  4    LALCLGMVVFTFLGFVSPINNEGKALMAIKASFSNVANMLLDWDNVHNNDFCSWRGVICD  63

Query  412  nfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldls  591
            N S SVVSLNLSNLNLGGEISPA+GDLRNLQSIDLQGN+L GQIPDEIGNC SL  +DLS
Sbjct  64   NVSFSVVSLNLSNLNLGGEISPALGDLRNLQSIDLQGNKLGGQIPDEIGNCASLAYVDLS  123

Query  592  dnllYGDIPFSI  627
             N L+GDIPFSI
Sbjct  124  TNFLFGDIPFSI  135



>ref|XP_010483915.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Camelina sativa]
Length=965

 Score =   142 bits (357),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = +1

Query  220  KMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRG  399
            KM+  + C+  ++ +   + S + +EGK LM+IK SFSN+ N+LLDWDDVHN DFCSWRG
Sbjct  2    KMQRVVLCLAVVVSMLLGVASSMNNEGKALMAIKGSFSNLVNMLLDWDDVHNTDFCSWRG  61

Query  400  VSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislil  579
            V C N + SVVSLNLSNLNLGGEISPAIGDLRNL+SIDL GN+L GQIPDEIGNC+SL+ 
Sbjct  62   VFCDNVTFSVVSLNLSNLNLGGEISPAIGDLRNLKSIDLVGNKLAGQIPDEIGNCVSLVH  121

Query  580  ldlsdnllYGDIPFSI  627
            LDL+DNLLYGDIPFSI
Sbjct  122  LDLTDNLLYGDIPFSI  137



>ref|XP_010483916.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X2 [Camelina sativa]
Length=964

 Score =   142 bits (357),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = +1

Query  220  KMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRG  399
            KM+  + C+  ++ +   + S + +EGK LM+IK SFSN+ N+LLDWDDVHN DFCSWRG
Sbjct  2    KMQRVVLCLAVVVSMLLGVASSMNNEGKALMAIKGSFSNLVNMLLDWDDVHNTDFCSWRG  61

Query  400  VSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislil  579
            V C N + SVVSLNLSNLNLGGEISPAIGDLRNL+SIDL GN+L GQIPDEIGNC+SL+ 
Sbjct  62   VFCDNVTFSVVSLNLSNLNLGGEISPAIGDLRNLKSIDLVGNKLAGQIPDEIGNCVSLVH  121

Query  580  ldlsdnllYGDIPFSI  627
            LDL+DNLLYGDIPFSI
Sbjct  122  LDLTDNLLYGDIPFSI  137



>ref|XP_006279954.1| hypothetical protein CARUB_v10025821mg [Capsella rubella]
 gb|EOA12852.1| hypothetical protein CARUB_v10025821mg [Capsella rubella]
Length=970

 Score =   142 bits (357),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 113/137 (82%), Gaps = 0/137 (0%)
 Frame = +1

Query  217  RKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWR  396
            +KM+  + C+  ++ +   + S + +EGK LM+IK SFSN+ N+LLDWDDVHN DFCSWR
Sbjct  4    KKMQRVVLCLAVVLSMLLGVASSMNNEGKALMAIKGSFSNLVNMLLDWDDVHNTDFCSWR  63

Query  397  GVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncisli  576
            GV C N S SVVSLNLSNLNLGGEISPAIGDL+NLQS+DL GN+L GQIPDEIGNC SLI
Sbjct  64   GVFCDNVSFSVVSLNLSNLNLGGEISPAIGDLKNLQSVDLVGNKLAGQIPDEIGNCASLI  123

Query  577  lldlsdnllYGDIPFSI  627
             LDLSDNLLYGDIPFSI
Sbjct  124  YLDLSDNLLYGDIPFSI  140



>ref|XP_009151345.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X2 [Brassica rapa]
Length=966

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +1

Query  274  LTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnl  453
            + S + DEGK LM+IK SFSNV N+LLDWDDVHN DFCSWRGV C N S SVVSLNLSNL
Sbjct  18   VASPMNDEGKALMAIKGSFSNVVNMLLDWDDVHNSDFCSWRGVFCDNVSFSVVSLNLSNL  77

Query  454  nlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            NLGGEISPA+GDLRNLQSIDLQGN+L GQIPDEIGNC SL+ LD SDNLLYGDIPFSI
Sbjct  78   NLGGEISPAVGDLRNLQSIDLQGNKLAGQIPDEIGNCASLVYLDFSDNLLYGDIPFSI  135



>ref|XP_009151343.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Brassica rapa]
Length=967

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +1

Query  274  LTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnl  453
            + S + DEGK LM+IK SFSNV N+LLDWDDVHN DFCSWRGV C N S SVVSLNLSNL
Sbjct  18   VASPMNDEGKALMAIKGSFSNVVNMLLDWDDVHNSDFCSWRGVFCDNVSFSVVSLNLSNL  77

Query  454  nlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            NLGGEISPA+GDLRNLQSIDLQGN+L GQIPDEIGNC SL+ LD SDNLLYGDIPFSI
Sbjct  78   NLGGEISPAVGDLRNLQSIDLQGNKLAGQIPDEIGNCASLVYLDFSDNLLYGDIPFSI  135



>gb|KDP22376.1| hypothetical protein JCGZ_26207 [Jatropha curcas]
Length=992

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 119/148 (80%), Gaps = 2/148 (1%)
 Frame = +1

Query  190  VEKVLFPGI-RKMEFALACVLALILLSF-PLTSCIGDEGKTLMSIKESFSNVANVLLDWD  363
            VE ++  G+ RKM+ +  C++ ++ +    L   + +EGK LM +K SFSNVANVLLDWD
Sbjct  4    VEAIIVKGMKRKMDVSFMCLIMVVFMLLCSLALPLNNEGKALMVMKASFSNVANVLLDWD  63

Query  364  DVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQI  543
            DVHN DFCSWRGV C N S+SVVSLNLSNLNLGGEISPAIG+L NLQSID QGN+LTGQI
Sbjct  64   DVHNGDFCSWRGVFCDNVSLSVVSLNLSNLNLGGEISPAIGELSNLQSIDFQGNKLTGQI  123

Query  544  PDEIGncislilldlsdnllYGDIPFSI  627
            PDEIGNC+SL  LDLSDNLL GDIPFSI
Sbjct  124  PDEIGNCLSLFHLDLSDNLLTGDIPFSI  151



>emb|CDY00268.1| BnaA06g21690D [Brassica napus]
Length=967

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +1

Query  274  LTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnl  453
            + S + DEGK LM+IK SFSNV N+LLDWDDVHN DFCSWRGV C N S SVVSLNLSNL
Sbjct  18   VASPMNDEGKALMAIKGSFSNVVNMLLDWDDVHNSDFCSWRGVFCDNVSFSVVSLNLSNL  77

Query  454  nlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            NLGGEISPA+GDLRNLQSIDLQGN+L GQIPDEIGNC SL+ LD SDNLLYGDIPFSI
Sbjct  78   NLGGEISPAVGDLRNLQSIDLQGNKLAGQIPDEIGNCASLVYLDFSDNLLYGDIPFSI  135



>ref|XP_011041677.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Populus euphratica]
Length=982

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +1

Query  280  SCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnl  459
            S + DEGK LMS+KESFSNV NVL+DWDDVHN DFCSWRGV C N S SVVSLNLSNLNL
Sbjct  29   SPLNDEGKALMSLKESFSNVVNVLVDWDDVHNVDFCSWRGVFCDNNSFSVVSLNLSNLNL  88

Query  460  GGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            GGEISPAIGDLRNLQSID QGN LTGQIP+EIGNC SL  LDLS NLLYGDIPFS+
Sbjct  89   GGEISPAIGDLRNLQSIDFQGNMLTGQIPEEIGNCASLYHLDLSGNLLYGDIPFSL  144



>ref|XP_002269540.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Vitis vinifera]
Length=989

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 116/147 (79%), Gaps = 2/147 (1%)
 Frame = +1

Query  187  MVEKVLFPGIRKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDD  366
            M EK+L    +++   L   + L L S      + DEGK LMSIK SFSNVAN LLDWDD
Sbjct  2    MGEKLLLEVKKRVVVCLFIWVFLFLSSLAFQ--LNDEGKALMSIKASFSNVANALLDWDD  59

Query  367  VHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIP  546
            VHN DFCSWRGV C N S+SVVSLNLSNLNLGGEIS A+GDL+NLQSIDLQGN+LTGQ+P
Sbjct  60   VHNADFCSWRGVFCDNVSLSVVSLNLSNLNLGGEISSAVGDLKNLQSIDLQGNRLTGQLP  119

Query  547  DEIGncislilldlsdnllYGDIPFSI  627
            DEIGNC+SL  LDLSDNLLYGDIPFSI
Sbjct  120  DEIGNCVSLSTLDLSDNLLYGDIPFSI  146



>gb|KFK27954.1| hypothetical protein AALP_AA8G452900 [Arabis alpina]
Length=975

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 111/137 (81%), Gaps = 0/137 (0%)
 Frame = +1

Query  217  RKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWR  396
            +KM+    C+  ++ +     S + DEGK LM IK SFSN+ N+LLDWDDVH+ DFCSWR
Sbjct  3    KKMQRMCLCLAMVVFMLLGSASPLNDEGKALMEIKGSFSNLVNMLLDWDDVHSNDFCSWR  62

Query  397  GVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncisli  576
            GV C NFS SVVSLNLSNLNLGGEISPA+GDLRNLQSIDLQGN+L GQIPDEIGNC SL+
Sbjct  63   GVFCDNFSSSVVSLNLSNLNLGGEISPAVGDLRNLQSIDLQGNKLAGQIPDEIGNCASLV  122

Query  577  lldlsdnllYGDIPFSI  627
             LD SDNLLYGDIPFSI
Sbjct  123  YLDFSDNLLYGDIPFSI  139



>ref|XP_010458423.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Camelina sativa]
Length=1007

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = +1

Query  220  KMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRG  399
            KM+  + C+  ++ +   + S + +EGK LM+IK SFSN+ N+LLDWDDVHN DFCSWRG
Sbjct  2    KMQRVVLCLAVVVSMLLGVASSMNNEGKALMAIKGSFSNLVNMLLDWDDVHNTDFCSWRG  61

Query  400  VSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislil  579
            V C N S SVVSLNLS LNLGGEISPAIGDLRNL+SIDL GN+L GQIPDEIGNC SL+ 
Sbjct  62   VFCDNVSFSVVSLNLSKLNLGGEISPAIGDLRNLKSIDLVGNKLGGQIPDEIGNCASLVH  121

Query  580  ldlsdnllYGDIPFSI  627
            LDL+DNLLYGDIPFSI
Sbjct  122  LDLTDNLLYGDIPFSI  137



>ref|XP_010277441.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X2 [Nelumbo nucifera]
Length=962

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 108/133 (81%), Gaps = 2/133 (2%)
 Frame = +1

Query  235  LACVLALILLSFPL--TSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSC  408
            L   +AL+ LS  L   S + DEG  LMSIK SFSNVANVLLDWDD  NED+CSWRGVSC
Sbjct  13   LILSIALVTLSLLLQVASPLSDEGNALMSIKASFSNVANVLLDWDDARNEDYCSWRGVSC  72

Query  409  GnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldl  588
             N + SVVSLNLSNLNLGGEISPAIGDLRNLQ+ DL+GN+L GQIPDEIGNC+SL  LDL
Sbjct  73   DNVTFSVVSLNLSNLNLGGEISPAIGDLRNLQATDLKGNRLIGQIPDEIGNCVSLKTLDL  132

Query  589  sdnllYGDIPFSI  627
            SDN  YGDIPFS+
Sbjct  133  SDNSFYGDIPFSL  145



>ref|XP_010277439.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Nelumbo nucifera]
Length=986

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 108/133 (81%), Gaps = 2/133 (2%)
 Frame = +1

Query  235  LACVLALILLSFPL--TSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSC  408
            L   +AL+ LS  L   S + DEG  LMSIK SFSNVANVLLDWDD  NED+CSWRGVSC
Sbjct  13   LILSIALVTLSLLLQVASPLSDEGNALMSIKASFSNVANVLLDWDDARNEDYCSWRGVSC  72

Query  409  GnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldl  588
             N + SVVSLNLSNLNLGGEISPAIGDLRNLQ+ DL+GN+L GQIPDEIGNC+SL  LDL
Sbjct  73   DNVTFSVVSLNLSNLNLGGEISPAIGDLRNLQATDLKGNRLIGQIPDEIGNCVSLKTLDL  132

Query  589  sdnllYGDIPFSI  627
            SDN  YGDIPFS+
Sbjct  133  SDNSFYGDIPFSL  145



>ref|XP_006289323.1| hypothetical protein CARUB_v10002808mg [Capsella rubella]
 gb|EOA22221.1| hypothetical protein CARUB_v10002808mg [Capsella rubella]
Length=967

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 114/141 (81%), Gaps = 6/141 (4%)
 Frame = +1

Query  214  IRKME---FALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDF  384
            I KM+   F L  V+ ++L    + S + ++GK LM+IK SFSNVAN+LLDWDDVHN DF
Sbjct  4    IEKMKGLGFRLGMVVFMLL---GVVSPMNNQGKALMAIKASFSNVANMLLDWDDVHNNDF  60

Query  385  CSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGnc  564
            CSWRGV C N S+SVVSLNLSNLNLGGEISPA+GDLRNLQSIDLQGN+L GQIPDEIGNC
Sbjct  61   CSWRGVFCDNVSLSVVSLNLSNLNLGGEISPALGDLRNLQSIDLQGNKLGGQIPDEIGNC  120

Query  565  islilldlsdnllYGDIPFSI  627
             SL  +D S NLL+GDIPFSI
Sbjct  121  ASLAYVDFSTNLLFGDIPFSI  141



>gb|ADM86148.1| leucine-rich repeat receptor-like kinase [Populus nigra x Populus 
x canadensis]
Length=947

 Score =   140 bits (352),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 94/106 (89%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  310  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  489
            MSIKESFSNV NVLLDWDDVHNEDFCSWRGV C N S+SVVSLNLSNLNLGGEISPAIGD
Sbjct  1    MSIKESFSNVVNVLLDWDDVHNEDFCSWRGVFCDNVSLSVVSLNLSNLNLGGEISPAIGD  60

Query  490  LRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            LRNLQSID +GN+LTGQIP+EIGNC SL  LDLSDNLLYGDIPFSI
Sbjct  61   LRNLQSIDFKGNKLTGQIPEEIGNCASLFNLDLSDNLLYGDIPFSI  106



>ref|XP_007221096.1| hypothetical protein PRUPE_ppa017398mg [Prunus persica]
 gb|EMJ22295.1| hypothetical protein PRUPE_ppa017398mg [Prunus persica]
Length=992

 Score =   139 bits (350),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 114/157 (73%), Gaps = 23/157 (15%)
 Frame = +1

Query  226  EFALACV-LALILLSFPLTSCIGDEG----------------------KTLMSIKESFSN  336
            E  + CV LAL+ L FP  S + DEG                      K LMSIK SFSN
Sbjct  3    ERVVFCVGLALLPLFFPFASPLNDEGSSLSLSLSLSPAASLSAFMLKRKALMSIKASFSN  62

Query  337  VANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDL  516
            VANVLLDW+D H+EDFCSWRGV C N ++SV SLNLSNLNLGGEISPAIGDL NLQSIDL
Sbjct  63   VANVLLDWNDAHDEDFCSWRGVFCDNVTLSVASLNLSNLNLGGEISPAIGDLGNLQSIDL  122

Query  517  QGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            QGN+LTGQIPDEIGNC SL+ LDLSDN LYGD+PFS+
Sbjct  123  QGNKLTGQIPDEIGNCASLMHLDLSDNFLYGDVPFSV  159



>emb|CDX86913.1| BnaC03g51830D [Brassica napus]
Length=970

 Score =   139 bits (349),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = +1

Query  244  VLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsm  423
            ++ + +L   + S + +EG  LM+IK SFSNV N+LLDWDDVHN DFCSWRGV C NFS 
Sbjct  7    LMVVFMLLLGVASPMNNEGTALMAIKGSFSNVVNMLLDWDDVHNSDFCSWRGVFCDNFSF  66

Query  424  svvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnll  603
            SVV+LNLSNLNLGGEISPA+GDLRNLQSIDLQGN+L GQIPDEIGNC SL+ LD SDNLL
Sbjct  67   SVVTLNLSNLNLGGEISPAVGDLRNLQSIDLQGNKLAGQIPDEIGNCASLVYLDFSDNLL  126

Query  604  YGDIPFSI  627
            YGDIPFSI
Sbjct  127  YGDIPFSI  134



>gb|KHN27841.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Glycine 
soja]
Length=940

 Score =   139 bits (349),  Expect = 8e-34, Method: Composition-based stats.
 Identities = 90/118 (76%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = +1

Query  274  LTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnl  453
              S + DEG+ LM IK SFSNVA+VL DWDD+HN+DFCSWRGV C N S++V SLNLS+L
Sbjct  34   FASPLSDEGQALMKIKASFSNVADVLHDWDDLHNDDFCSWRGVLCDNVSLTVFSLNLSSL  93

Query  454  nlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            NLGGEISPAIGDL  LQSIDLQGN+LTGQIPDEIGNC  LI LDLSDN LYGD+PFSI
Sbjct  94   NLGGEISPAIGDLVTLQSIDLQGNKLTGQIPDEIGNCAELIYLDLSDNQLYGDLPFSI  151



>ref|XP_004496653.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2-like [Cicer arietinum]
Length=986

 Score =   139 bits (349),  Expect = 8e-34, Method: Composition-based stats.
 Identities = 85/121 (70%), Positives = 103/121 (85%), Gaps = 2/121 (2%)
 Frame = +1

Query  271  PLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvsln--l  444
            P  S + +EG+ LM++K SF+N+A+VLLDWDDVHN+D CSWRGV C N +++   ++  L
Sbjct  36   PFASPLSEEGQALMAMKSSFNNIADVLLDWDDVHNDDLCSWRGVFCDNVTLTQTVVSLNL  95

Query  445  snlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFS  624
            S+LNLGGEISPAIG LRNLQSIDLQGN+LTGQIPDEIGNC +L+ LDLSDNLLYGDIPFS
Sbjct  96   SSLNLGGEISPAIGGLRNLQSIDLQGNKLTGQIPDEIGNCGALVHLDLSDNLLYGDIPFS  155

Query  625  I  627
            I
Sbjct  156  I  156



>ref|XP_006587379.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1-like [Glycine max]
Length=984

 Score =   139 bits (349),  Expect = 8e-34, Method: Composition-based stats.
 Identities = 90/118 (76%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = +1

Query  274  LTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnl  453
              S + DEG+ LM IK SFSNVA+VL DWDD+HN+DFCSWRGV C N S++V SLNLS+L
Sbjct  34   FASPLSDEGQALMKIKASFSNVADVLHDWDDLHNDDFCSWRGVLCDNVSLTVFSLNLSSL  93

Query  454  nlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            NLGGEISPAIGDL  LQSIDLQGN+LTGQIPDEIGNC  LI LDLSDN LYGD+PFSI
Sbjct  94   NLGGEISPAIGDLVTLQSIDLQGNKLTGQIPDEIGNCAELIYLDLSDNQLYGDLPFSI  151



>ref|XP_010444058.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Camelina sativa]
Length=968

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +1

Query  274  LTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnl  453
            + S + +EGK LM+IK SFSN+ N+LLDWDDVHN DFCSWRGV C N S SVVSLNLSNL
Sbjct  23   VASSMNNEGKALMAIKGSFSNLVNMLLDWDDVHNTDFCSWRGVFCDNVSFSVVSLNLSNL  82

Query  454  nlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            NLGGEISPAIGDLRNLQSIDL GN+L GQIPDEIGNC+SL+ LDL+DNLLYGDIPFSI
Sbjct  83   NLGGEISPAIGDLRNLQSIDLVGNKLAGQIPDEIGNCVSLVHLDLTDNLLYGDIPFSI  140



>gb|KEH43759.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=993

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 113/139 (81%), Gaps = 2/139 (1%)
 Frame = +1

Query  217  RKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWR  396
            +K  F    +  ++LL  P    + +EG+ LM++K SF+N+A+VLLDWDDVHN+DFCSWR
Sbjct  15   KKWWFHATTMFLMLLLLSPFAFSLQEEGQALMAMKSSFNNIADVLLDWDDVHNDDFCSWR  74

Query  397  GVSC--GnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncis  570
            GV C   + +++VVSLNLS+LNLGGEISPAIGDLRNLQSIDLQGN+LTGQIPDEIGNC +
Sbjct  75   GVFCDNASHALTVVSLNLSSLNLGGEISPAIGDLRNLQSIDLQGNKLTGQIPDEIGNCGA  134

Query  571  lilldlsdnllYGDIPFSI  627
            L  LDLSDN LYGDIPFSI
Sbjct  135  LFHLDLSDNQLYGDIPFSI  153



>ref|XP_002322426.1| PTH-1 family protein [Populus trichocarpa]
 gb|EEF06553.1| PTH-1 family protein [Populus trichocarpa]
Length=870

 Score =   136 bits (343),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 91/106 (86%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +1

Query  310  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  489
            MSIKESFSNV NVL+DWDDVHNEDFCSWRGV C N S SVVSLNLSNLNLGGEISP IGD
Sbjct  1    MSIKESFSNVVNVLVDWDDVHNEDFCSWRGVFCDNDSFSVVSLNLSNLNLGGEISPGIGD  60

Query  490  LRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            LRNLQSID QGN LTGQIP+EIGNC SL  LDLS NLLYGDIPFS+
Sbjct  61   LRNLQSIDFQGNMLTGQIPEEIGNCASLYHLDLSGNLLYGDIPFSL  106



>ref|XP_006394419.1| hypothetical protein EUTSA_v100036150mg, partial [Eutrema salsugineum]
 gb|ESQ31705.1| hypothetical protein EUTSA_v100036150mg, partial [Eutrema salsugineum]
Length=115

 Score =   126 bits (316),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +1

Query  310  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  489
            M+IK SFSN+ N+LLDWDDVHN DFCSWRGV C N S+SVVSLNLSNLNLGGEISPA+GD
Sbjct  1    MAIKGSFSNLVNMLLDWDDVHNTDFCSWRGVFCDNVSLSVVSLNLSNLNLGGEISPAVGD  60

Query  490  LRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            LRNLQSID QGN+L GQIPDEIGNC SL+ LD SDNLLYGDIPFSI
Sbjct  61   LRNLQSIDFQGNKLAGQIPDEIGNCASLVYLDFSDNLLYGDIPFSI  106



>emb|CDX99001.1| BnaC09g48340D [Brassica napus]
Length=964

 Score =   136 bits (342),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +1

Query  247  LALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsms  426
            LAL  +   + S + DEG+ LM +K SFSNVAN+LLDWDDVHN DFCSWRGV C N S+S
Sbjct  7    LALFFMLCGVVSPMNDEGRALMEMKASFSNVANMLLDWDDVHNSDFCSWRGVLCDNVSLS  66

Query  427  vvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllY  606
            VVSLNLSNLNLGGEISPA+GDLR+LQSIDLQGN L GQIPDE+GNC SL  LD S N L+
Sbjct  67   VVSLNLSNLNLGGEISPALGDLRSLQSIDLQGNNLGGQIPDELGNCASLAYLDFSTNCLF  126

Query  607  GDIPFSI  627
            GDIPFSI
Sbjct  127  GDIPFSI  133



>ref|XP_006588387.1| PREDICTED: ERECTA-like kinase isoform X1 [Glycine max]
 gb|KHN02765.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Glycine 
soja]
Length=993

 Score =   135 bits (341),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = +1

Query  199  VLFPGIRKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNE  378
            + +PG  K +  ++ +L ++LL  PL S   +EG+ LM++K  FSN+A+VLLDWDD HN+
Sbjct  9    LFYPGRHKWKLLMSPLLLMLLLISPLASSFSEEGQALMAMKALFSNMADVLLDWDDAHND  68

Query  379  DFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIG  558
            DFCSWRGV C N S +VVSLNLS+LNLGGEISPAIGDL NLQSIDLQGN+LTGQIPDEIG
Sbjct  69   DFCSWRGVFCDNVSHTVVSLNLSSLNLGGEISPAIGDLTNLQSIDLQGNKLTGQIPDEIG  128

Query  559  ncislilldlsdnllYGDIPFSI  627
            NC +L+ LDLSDN LYGDIPFS+
Sbjct  129  NCAALVHLDLSDNQLYGDIPFSL  151



>gb|EYU25015.1| hypothetical protein MIMGU_mgv1a000865mg [Erythranthe guttata]
Length=955

 Score =   135 bits (341),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 91/106 (86%), Positives = 103/106 (97%), Gaps = 0/106 (0%)
 Frame = +1

Query  310  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  489
            MSIK SFSN+ANVLLDWD+VHN+DFCSW+GVSCGNFSMSVVSLNLSNLNLGGEISPAIGD
Sbjct  1    MSIKASFSNIANVLLDWDEVHNDDFCSWKGVSCGNFSMSVVSLNLSNLNLGGEISPAIGD  60

Query  490  LRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            L++L+S+DLQGN+LTGQIPDEIGNC+SL+ LDLSDN+L GDIPFSI
Sbjct  61   LKSLESVDLQGNKLTGQIPDEIGNCVSLVFLDLSDNMLEGDIPFSI  106



>ref|XP_006588388.1| PREDICTED: ERECTA-like kinase isoform X2 [Glycine max]
Length=989

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = +1

Query  199  VLFPGIRKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNE  378
            + +PG  K +  ++ +L ++LL  PL S   +EG+ LM++K  FSN+A+VLLDWDD HN+
Sbjct  9    LFYPGRHKWKLLMSPLLLMLLLISPLASSFSEEGQALMAMKALFSNMADVLLDWDDAHND  68

Query  379  DFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIG  558
            DFCSWRGV C N S +VVSLNLS+LNLGGEISPAIGDL NLQSIDLQGN+LTGQIPDEIG
Sbjct  69   DFCSWRGVFCDNVSHTVVSLNLSSLNLGGEISPAIGDLTNLQSIDLQGNKLTGQIPDEIG  128

Query  559  ncislilldlsdnllYGDIPFSI  627
            NC +L+ LDLSDN LYGDIPFS+
Sbjct  129  NCAALVHLDLSDNQLYGDIPFSL  151



>ref|NP_196335.2| LRR receptor-like serine/threonine-protein kinase ERL2 [Arabidopsis 
thaliana]
 sp|Q6XAT2.1|ERL2_ARATH RecName: Full=LRR receptor-like serine/threonine-protein kinase 
ERL2; AltName: Full=Protein ERECTA-like kinase 2; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAP69764.1| ERECTA-like kinase 2 [Arabidopsis thaliana]
 gb|ACN59363.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED91118.1| LRR receptor-like serine/threonine-protein kinase ERL2 [Arabidopsis 
thaliana]
Length=967

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 109/138 (79%), Gaps = 0/138 (0%)
 Frame = +1

Query  214  IRKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSW  393
            I  M+    C+  ++ +     S + +EGK LM+IK SFSNVAN+LLDWDDVHN DFCSW
Sbjct  4    IETMKGLFFCLGMVVFMLLGSVSPMNNEGKALMAIKASFSNVANMLLDWDDVHNHDFCSW  63

Query  394  RGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncisl  573
            RGV C N S++VVSLNLSNLNLGGEIS A+GDL NLQSIDLQGN+L GQIPDEIGNC+SL
Sbjct  64   RGVFCDNVSLNVVSLNLSNLNLGGEISSALGDLMNLQSIDLQGNKLGGQIPDEIGNCVSL  123

Query  574  illdlsdnllYGDIPFSI  627
              +D S NLL+GDIPFSI
Sbjct  124  AYVDFSTNLLFGDIPFSI  141



>ref|XP_004149628.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1-like [Cucumis sativus]
 ref|XP_004166661.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1-like [Cucumis sativus]
Length=950

 Score =   135 bits (340),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 88/106 (83%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +1

Query  310  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  489
            MSIK SFSNVANVLLDWDD HN DFCSWRGV C N S+SV +LNLSNLNLGGEISP+IGD
Sbjct  1    MSIKASFSNVANVLLDWDDDHNHDFCSWRGVFCDNVSLSVAALNLSNLNLGGEISPSIGD  60

Query  490  LRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            LRNLQSID QGN+LTGQIPDEIGNC  L+ LDLSDNLLYGDIPF++
Sbjct  61   LRNLQSIDFQGNKLTGQIPDEIGNCGLLVHLDLSDNLLYGDIPFTV  106



>ref|XP_010276048.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Nelumbo nucifera]
Length=981

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 109/134 (81%), Gaps = 0/134 (0%)
 Frame = +1

Query  226  EFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVS  405
            +F++  V+A++ L F +   + DEG  LMSIK SFS+VANVLLDWD   NED CSWRGV+
Sbjct  10   KFSILSVMAMLFLFFQVVLPLSDEGNALMSIKASFSDVANVLLDWDAARNEDHCSWRGVN  69

Query  406  CGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilld  585
            C N + SVVSLNLSNLNLGGEISP+IG L+ LQ++DL+GN+LTGQIPDEIGNC+SL  LD
Sbjct  70   CDNITFSVVSLNLSNLNLGGEISPSIGGLKVLQTLDLKGNRLTGQIPDEIGNCVSLKTLD  129

Query  586  lsdnllYGDIPFSI  627
            LS N LYGDIPFSI
Sbjct  130  LSSNSLYGDIPFSI  143



>emb|CBI24498.3| unnamed protein product [Vitis vinifera]
Length=930

 Score =   134 bits (338),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 91/106 (86%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  310  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  489
            MSIK SFSNVAN LLDWDDVHN DFCSWRGV C N S+SVVSLNLSNLNLGGEIS A+GD
Sbjct  1    MSIKASFSNVANALLDWDDVHNADFCSWRGVFCDNVSLSVVSLNLSNLNLGGEISSAVGD  60

Query  490  LRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            L+NLQSIDLQGN+LTGQ+PDEIGNC+SL  LDLSDNLLYGDIPFSI
Sbjct  61   LKNLQSIDLQGNRLTGQLPDEIGNCVSLSTLDLSDNLLYGDIPFSI  106



>ref|XP_009122365.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Brassica rapa]
Length=963

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = +1

Query  274  LTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnl  453
            + S + DEGK LM +K SFSNVAN+LLDWDDVHN DFCSWRGV C N S+SVVSLNLSNL
Sbjct  19   VVSPMNDEGKALMEMKASFSNVANMLLDWDDVHNSDFCSWRGVLCDNVSLSVVSLNLSNL  78

Query  454  nlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            NLGGEISPA+GDLR+LQSIDLQGN L GQIPDE+GNC SL  LD+S N L GDIPFSI
Sbjct  79   NLGGEISPALGDLRSLQSIDLQGNNLGGQIPDELGNCASLAYLDISTNCLVGDIPFSI  136



>emb|CDX70013.1| BnaA10g23620D [Brassica napus]
Length=963

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = +1

Query  274  LTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnl  453
            + S + DEGK LM +K SFSNVAN+LLDWDDVHN DFCSWRGV C N S+SVVSLNLSNL
Sbjct  19   VVSPMNDEGKALMEMKASFSNVANMLLDWDDVHNSDFCSWRGVLCDNVSLSVVSLNLSNL  78

Query  454  nlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            NLGGEISPA+GDLR+LQSIDLQGN L GQIPDE+GNC SL  LD+S N L GDIPFSI
Sbjct  79   NLGGEISPALGDLRSLQSIDLQGNNLGGQIPDELGNCASLAYLDISTNCLVGDIPFSI  136



>ref|XP_006606083.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2-like isoform X2 [Glycine max]
Length=989

 Score =   134 bits (337),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 85/112 (76%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +1

Query  292  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  471
            +EG+ LM++K SF N+A+ LLDWDD HN+DFCSWRGV C N S++VVSLNLS+LNLGGEI
Sbjct  40   EEGQALMAMKASFGNMADTLLDWDDAHNDDFCSWRGVFCDNVSLTVVSLNLSSLNLGGEI  99

Query  472  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            SPAIGDL NLQSIDLQG++LTGQIPDEIGNC +L+ LDLSDN LYGDIPFS+
Sbjct  100  SPAIGDLGNLQSIDLQGSKLTGQIPDEIGNCAALVHLDLSDNQLYGDIPFSL  151



>ref|XP_006606082.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2-like isoform X1 [Glycine max]
Length=993

 Score =   134 bits (337),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 85/112 (76%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +1

Query  292  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  471
            +EG+ LM++K SF N+A+ LLDWDD HN+DFCSWRGV C N S++VVSLNLS+LNLGGEI
Sbjct  40   EEGQALMAMKASFGNMADTLLDWDDAHNDDFCSWRGVFCDNVSLTVVSLNLSSLNLGGEI  99

Query  472  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            SPAIGDL NLQSIDLQG++LTGQIPDEIGNC +L+ LDLSDN LYGDIPFS+
Sbjct  100  SPAIGDLGNLQSIDLQGSKLTGQIPDEIGNCAALVHLDLSDNQLYGDIPFSL  151



>ref|XP_002873299.1| hypothetical protein ARALYDRAFT_908657 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49558.1| hypothetical protein ARALYDRAFT_908657 [Arabidopsis lyrata subsp. 
lyrata]
Length=966

 Score =   134 bits (337),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 110/138 (80%), Gaps = 2/138 (1%)
 Frame = +1

Query  214  IRKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSW  393
            ++ + F L  V+  +LL F ++    +EGK LM+IK SFSNVAN+LLDW DVHN DFCSW
Sbjct  5    LKGLVFGLVMVV-FMLLGF-VSPMNNNEGKALMAIKASFSNVANMLLDWGDVHNNDFCSW  62

Query  394  RGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncisl  573
            RGV C N S++VVSLNLSNLNLGGEIS A+GDLRNLQSIDLQGN+L GQIPDEIGNC SL
Sbjct  63   RGVFCDNVSLTVVSLNLSNLNLGGEISSALGDLRNLQSIDLQGNKLGGQIPDEIGNCASL  122

Query  574  illdlsdnllYGDIPFSI  627
              +D S N L+GDIPFSI
Sbjct  123  AYVDFSTNSLFGDIPFSI  140



>gb|KDO65362.1| hypothetical protein CISIN_1g002278mg [Citrus sinensis]
Length=943

 Score =   133 bits (334),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  310  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  489
            M+IK SFSN+ANVLLDWDDVHN DFCSWRGV C N S+SVVSLNLS+LNLGGEISP+IGD
Sbjct  1    MAIKASFSNLANVLLDWDDVHNSDFCSWRGVFCDNSSLSVVSLNLSSLNLGGEISPSIGD  60

Query  490  LRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            LRNLQSID QGN+LTGQIPDEIGNC SL+ ++LSDN LYGDIPFSI
Sbjct  61   LRNLQSIDFQGNKLTGQIPDEIGNCGSLVHIELSDNSLYGDIPFSI  106



>ref|XP_006421768.1| hypothetical protein CICLE_v10004259mg [Citrus clementina]
 gb|ESR35008.1| hypothetical protein CICLE_v10004259mg [Citrus clementina]
Length=943

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  310  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  489
            M+IK SFSN+ANVLLDWDDVHN DFCSWRGV C N S+SVVSLNLS+LNLGGEISP+IGD
Sbjct  1    MAIKASFSNLANVLLDWDDVHNSDFCSWRGVFCDNSSLSVVSLNLSSLNLGGEISPSIGD  60

Query  490  LRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            LRNLQSID QGN+LTGQIPDEIGNC SL+ ++LSDN LYGDIPFS+
Sbjct  61   LRNLQSIDFQGNKLTGQIPDEIGNCGSLVHIELSDNSLYGDIPFSM  106



>emb|CDP05285.1| unnamed protein product [Coffea canephora]
Length=948

 Score =   131 bits (330),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 89/106 (84%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = +1

Query  310  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  489
            MSIK SFSNVANVLLDW+D+HNEDFC+WRGV CGN +MSVV+LNLSNL+LGGEIS A+GD
Sbjct  1    MSIKASFSNVANVLLDWNDIHNEDFCTWRGVICGNLTMSVVALNLSNLDLGGEISMAVGD  60

Query  490  LRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            LR LQS+DLQGN+LTGQIPDEIGNCISLILLDLS+NLL GDIPFS+
Sbjct  61   LRGLQSLDLQGNKLTGQIPDEIGNCISLILLDLSNNLLSGDIPFSV  106



>ref|XP_011076300.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 isoform X2 [Sesamum indicum]
Length=949

 Score =   131 bits (329),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 91/106 (86%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = +1

Query  310  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  489
            MSIK SFSNVANVLLDWD+VHN+DFCSWRGVSCGN S SVV+LNLSNLNL GEIS AIGD
Sbjct  1    MSIKASFSNVANVLLDWDEVHNDDFCSWRGVSCGNISTSVVALNLSNLNLCGEISAAIGD  60

Query  490  LRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            L++LQS+DLQGN+LTGQIPDEIGNCISL+LLDLS+NLL GDIPFSI
Sbjct  61   LKSLQSLDLQGNKLTGQIPDEIGNCISLLLLDLSNNLLEGDIPFSI  106



>ref|XP_006858024.1| hypothetical protein AMTR_s00069p00198500 [Amborella trichopoda]
 gb|ERN19491.1| hypothetical protein AMTR_s00069p00198500 [Amborella trichopoda]
Length=977

 Score =   131 bits (329),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 92/135 (68%), Positives = 105/135 (78%), Gaps = 2/135 (1%)
 Frame = +1

Query  223  MEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGV  402
            ME   A V+ L+ L     S   DEG+ L+S+K SFS+VANVLLDW++   +D CSWRGV
Sbjct  1    MEGFTAMVVLLVFLQ--ALSAQSDEGRALLSLKASFSDVANVLLDWNEDSIDDHCSWRGV  58

Query  403  SCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislill  582
            SC N +  VVSLNLSNLNLGGEI+P+IGDLRNLQSID +GN LTGQIPDEIGNC SL LL
Sbjct  59   SCDNVTFDVVSLNLSNLNLGGEIAPSIGDLRNLQSIDFKGNHLTGQIPDEIGNCQSLKLL  118

Query  583  dlsdnllYGDIPFSI  627
            DLS N LYGDIPFSI
Sbjct  119  DLSSNALYGDIPFSI  133



>ref|XP_008234344.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Prunus mume]
Length=951

 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +1

Query  310  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  489
            MSIK SFSNVANVLLDW+D H+EDFCSWRGV C N ++SV SLNLSNLNLGGEISPAIGD
Sbjct  1    MSIKASFSNVANVLLDWNDAHDEDFCSWRGVFCDNVTLSVASLNLSNLNLGGEISPAIGD  60

Query  490  LRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            L NLQSIDLQGN+LTGQIPDEIGNC SL+ LDLSDN LYGDIPFS+
Sbjct  61   LGNLQSIDLQGNKLTGQIPDEIGNCASLMHLDLSDNFLYGDIPFSV  106



>ref|XP_010277442.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X3 [Nelumbo nucifera]
 ref|XP_010277443.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X3 [Nelumbo nucifera]
Length=947

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +1

Query  310  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  489
            MSIK SFSNVANVLLDWDD  NED+CSWRGVSC N + SVVSLNLSNLNLGGEISPAIGD
Sbjct  1    MSIKASFSNVANVLLDWDDARNEDYCSWRGVSCDNVTFSVVSLNLSNLNLGGEISPAIGD  60

Query  490  LRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            LRNLQ+ DL+GN+L GQIPDEIGNC+SL  LDLSDN  YGDIPFS+
Sbjct  61   LRNLQATDLKGNRLIGQIPDEIGNCVSLKTLDLSDNSFYGDIPFSL  106



>ref|XP_006598683.1| PREDICTED: ERECTA-like kinase isoform X2 [Glycine max]
Length=949

 Score =   129 bits (324),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 86/106 (81%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = +1

Query  310  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  489
            M IK SFSNVA+VL DWD +HN+DFCSWRGV C N S+SV+ LNLS+LNLGGEISPAIGD
Sbjct  1    MKIKSSFSNVADVLHDWDALHNDDFCSWRGVLCDNVSLSVLFLNLSSLNLGGEISPAIGD  60

Query  490  LRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            L NLQSIDLQGN+LTGQIPDEIGNC  LI LDLSDN LYGDIPFSI
Sbjct  61   LVNLQSIDLQGNKLTGQIPDEIGNCAELIYLDLSDNQLYGDIPFSI  106



>gb|KHN15712.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Glycine 
soja]
Length=993

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +1

Query  292  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  471
            +EG+ LM++K SF N+A+ LLDWDD HN+DFCSWRGV C N S++VVSLNLS+LNLGGEI
Sbjct  40   EEGQALMAMKASFGNMADTLLDWDDAHNDDFCSWRGVFCDNVSLTVVSLNLSSLNLGGEI  99

Query  472  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            SPAIGDL NLQSIDLQG++LTGQIPDEIGNC  L+ LDLSDN LYGDIPFS+
Sbjct  100  SPAIGDLGNLQSIDLQGSKLTGQIPDEIGNCAGLVHLDLSDNQLYGDIPFSL  151



>ref|XP_010940921.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Elaeis guineensis]
Length=988

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 107/145 (74%), Gaps = 8/145 (6%)
 Frame = +1

Query  217  RKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDV--------H  372
            RK        +A +L  FP  S   DEG+ LM++K SFSNVANVLLDW+ V         
Sbjct  7    RKEMLRFLVSMAFLLAFFPAVSSFSDEGRALMALKASFSNVANVLLDWNPVAAGGDANRS  66

Query  373  NEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDE  552
            ++D C+WRGV C N + +VVSLNLSNLNLGGEISPA+G+L++LQSIDL+GN+LTGQIPDE
Sbjct  67   SDDHCAWRGVVCDNLTSAVVSLNLSNLNLGGEISPAVGELKSLQSIDLKGNKLTGQIPDE  126

Query  553  IGncislilldlsdnllYGDIPFSI  627
            IG+ +SL  LDLS N LYGDIPFSI
Sbjct  127  IGDSVSLRHLDLSGNALYGDIPFSI  151



>ref|XP_008810292.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X3 [Phoenix dactylifera]
Length=939

 Score =   127 bits (320),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 108/145 (74%), Gaps = 8/145 (6%)
 Frame = +1

Query  217  RKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDV--------H  372
            RK    L   +A +L  FP  S   DEG+ LM++K SFSNV NVLLDW+ V         
Sbjct  7    RKEMLRLLVSMAFLLAFFPAVSSFSDEGRALMALKASFSNVVNVLLDWNPVAAGGDANRS  66

Query  373  NEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDE  552
            ++D C+WRGV C + + +VVSLNLSNLNLGGEISPA+G+L++LQSIDL+GN+LTGQIPDE
Sbjct  67   SDDHCAWRGVVCDSLTSAVVSLNLSNLNLGGEISPAVGELKSLQSIDLKGNRLTGQIPDE  126

Query  553  IGncislilldlsdnllYGDIPFSI  627
            IG+C+SL  LDLS N LYGDIPFSI
Sbjct  127  IGDCVSLKHLDLSGNALYGDIPFSI  151



>ref|XP_008810291.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X2 [Phoenix dactylifera]
Length=987

 Score =   127 bits (319),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 108/145 (74%), Gaps = 8/145 (6%)
 Frame = +1

Query  217  RKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDV--------H  372
            RK    L   +A +L  FP  S   DEG+ LM++K SFSNV NVLLDW+ V         
Sbjct  7    RKEMLRLLVSMAFLLAFFPAVSSFSDEGRALMALKASFSNVVNVLLDWNPVAAGGDANRS  66

Query  373  NEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDE  552
            ++D C+WRGV C + + +VVSLNLSNLNLGGEISPA+G+L++LQSIDL+GN+LTGQIPDE
Sbjct  67   SDDHCAWRGVVCDSLTSAVVSLNLSNLNLGGEISPAVGELKSLQSIDLKGNRLTGQIPDE  126

Query  553  IGncislilldlsdnllYGDIPFSI  627
            IG+C+SL  LDLS N LYGDIPFSI
Sbjct  127  IGDCVSLKHLDLSGNALYGDIPFSI  151



>ref|XP_008810290.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Phoenix dactylifera]
Length=1017

 Score =   127 bits (319),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 108/145 (74%), Gaps = 8/145 (6%)
 Frame = +1

Query  217  RKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDV--------H  372
            RK    L   +A +L  FP  S   DEG+ LM++K SFSNV NVLLDW+ V         
Sbjct  7    RKEMLRLLVSMAFLLAFFPAVSSFSDEGRALMALKASFSNVVNVLLDWNPVAAGGDANRS  66

Query  373  NEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDE  552
            ++D C+WRGV C + + +VVSLNLSNLNLGGEISPA+G+L++LQSIDL+GN+LTGQIPDE
Sbjct  67   SDDHCAWRGVVCDSLTSAVVSLNLSNLNLGGEISPAVGELKSLQSIDLKGNRLTGQIPDE  126

Query  553  IGncislilldlsdnllYGDIPFSI  627
            IG+C+SL  LDLS N LYGDIPFSI
Sbjct  127  IGDCVSLKHLDLSGNALYGDIPFSI  151



>ref|XP_002510897.1| erecta, putative [Ricinus communis]
 gb|EEF51499.1| erecta, putative [Ricinus communis]
Length=948

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +1

Query  310  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  489
            MSIKESFSNVANVLLDWDDVHN DFCSWRGV C N S SVVSLNLSNLNL GEIS AIGD
Sbjct  1    MSIKESFSNVANVLLDWDDVHNGDFCSWRGVFCDNVSFSVVSLNLSNLNLDGEISTAIGD  60

Query  490  LRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            LRNLQSID QGN+LTGQIPDEIGNC SL  LDLSDNLL GDIPFS+
Sbjct  61   LRNLQSIDFQGNKLTGQIPDEIGNCASLYHLDLSDNLLDGDIPFSV  106



>ref|XP_010035002.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Eucalyptus grandis]
 gb|KCW46259.1| hypothetical protein EUGRSUZ_K00138 [Eucalyptus grandis]
Length=948

 Score =   126 bits (317),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 85/106 (80%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +1

Query  310  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  489
            M++K SF NVAN LLDWDD H+ DFC+WRGV C N S+SVVSLNLSNLNLGGEISPAIGD
Sbjct  1    MAVKASFINVANALLDWDDAHDGDFCAWRGVFCDNASLSVVSLNLSNLNLGGEISPAIGD  60

Query  490  LRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            LRNL SIDLQGN+LTGQIPDEIG+C  L+ LDLSDNLLYGDIP+SI
Sbjct  61   LRNLLSIDLQGNKLTGQIPDEIGDCSLLVYLDLSDNLLYGDIPYSI  106



>ref|NP_001237639.1| ERECTA-like kinase [Glycine max]
 gb|ACM89517.1| ERECTA-like kinase [Glycine max]
Length=828

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +1

Query  310  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  489
            M++K  FSN+A+VLLDWDD HN+DFCSWRGV C N S +VVSLNLS+LNLGGEISPAIGD
Sbjct  1    MAMKALFSNMADVLLDWDDAHNDDFCSWRGVFCDNVSHTVVSLNLSSLNLGGEISPAIGD  60

Query  490  LRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            L NLQSIDLQGN+LTGQIPDEIGNC +L+ LDLSDN LYGDIPFS+
Sbjct  61   LTNLQSIDLQGNKLTGQIPDEIGNCAALVHLDLSDNQLYGDIPFSL  106



>gb|EPS66497.1| hypothetical protein M569_08274, partial [Genlisea aurea]
Length=941

 Score =   125 bits (314),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 81/106 (76%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +1

Query  310  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  489
            MSIK SFSNVANVL DWDD H+ D CSWRGV CG+   SVV+LNLSNLNLGGE+SP+IG+
Sbjct  1    MSIKASFSNVANVLPDWDDAHSSDLCSWRGVVCGDAITSVVALNLSNLNLGGEVSPSIGE  60

Query  490  LRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            LRNLQS+DL+GN+LTGQIP+EIGNCI L+++DLSDNL+ GDIPFSI
Sbjct  61   LRNLQSLDLRGNKLTGQIPEEIGNCIPLVVIDLSDNLIEGDIPFSI  106



>emb|CAB87274.1| receptor-like protein kinase [Arabidopsis thaliana]
Length=932

 Score =   124 bits (312),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +1

Query  310  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  489
            M+IK SFSNVAN+LLDWDDVHN DFCSWRGV C N S++VVSLNLSNLNLGGEIS A+GD
Sbjct  1    MAIKASFSNVANMLLDWDDVHNHDFCSWRGVFCDNVSLNVVSLNLSNLNLGGEISSALGD  60

Query  490  LRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            L NLQSIDLQGN+L GQIPDEIGNC+SL  +D S NLL+GDIPFSI
Sbjct  61   LMNLQSIDLQGNKLGGQIPDEIGNCVSLAYVDFSTNLLFGDIPFSI  106



>gb|KDO73636.1| hypothetical protein CISIN_1g0023492mg, partial [Citrus sinensis]
Length=168

 Score =   115 bits (287),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 101/136 (74%), Gaps = 1/136 (1%)
 Frame = +1

Query  223  MEFALACVLALILL-SFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRG  399
            M F L  +L L+ L      S   ++G TL+ IK+SF +V NVL DW D  + D+C WRG
Sbjct  1    MAFRLEFILLLVFLFCLSFGSVDSEDGATLLKIKKSFRDVDNVLYDWTDSPSSDYCVWRG  60

Query  400  VSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislil  579
            ++C N + +V++LNLS LNL GEISPA+GDL++LQSIDL+GN+L+GQIPDEIG+C SL  
Sbjct  61   ITCDNVTFTVIALNLSGLNLDGEISPAVGDLKDLQSIDLRGNRLSGQIPDEIGDCSSLKS  120

Query  580  ldlsdnllYGDIPFSI  627
            LDLS N LYGDIPFSI
Sbjct  121  LDLSFNELYGDIPFSI  136



>ref|XP_010276057.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X2 [Nelumbo nucifera]
Length=965

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = +1

Query  298  GKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISP  477
            G  LMSIK SFS+VANVLLDWD   NED CSWRGV+C N + SVVSLNLSNLNLGGEISP
Sbjct  18   GNALMSIKASFSDVANVLLDWDAARNEDHCSWRGVNCDNITFSVVSLNLSNLNLGGEISP  77

Query  478  AIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            +IG L+ LQ++DL+GN+LTGQIPDEIGNC+SL  LDLS N LYGDIPFSI
Sbjct  78   SIGGLKVLQTLDLKGNRLTGQIPDEIGNCVSLKTLDLSSNSLYGDIPFSI  127



>ref|XP_006474503.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Citrus sinensis]
Length=981

 Score =   119 bits (298),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 79/136 (58%), Positives = 101/136 (74%), Gaps = 1/136 (1%)
 Frame = +1

Query  223  MEFALACVLALILL-SFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRG  399
            M F L  +L L+ L      S   ++G TL+ IK+SF +V NVL DW D  + D+C WRG
Sbjct  1    MAFRLEFILLLVFLFCLSFGSVDSEDGATLLKIKKSFRDVDNVLYDWTDSPSSDYCVWRG  60

Query  400  VSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislil  579
            ++C N + +V++LNLS LNL GEISPA+GDL++LQSIDL+GN+L+GQIPDEIG+C SL  
Sbjct  61   ITCDNVTFTVIALNLSGLNLDGEISPAVGDLKDLQSIDLRGNRLSGQIPDEIGDCSSLKS  120

Query  580  ldlsdnllYGDIPFSI  627
            LDLS N LYGDIPFSI
Sbjct  121  LDLSFNELYGDIPFSI  136



>ref|XP_010429655.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Camelina sativa]
Length=982

 Score =   118 bits (295),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 86/140 (61%), Positives = 103/140 (74%), Gaps = 2/140 (1%)
 Frame = +1

Query  214  IRKMEFALACVLA--LILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFC  387
            +RKM      VL   LI LSF  T+   DEG TL+ IK+SF +V NVL DW    + D+C
Sbjct  3    VRKMALFGDIVLLGFLICLSFGSTAVNSDEGATLLEIKKSFKDVNNVLYDWTASPSSDYC  62

Query  388  SWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGnci  567
             WRGVSC N + +VV+LNLS+LNL GEISPAIGDL++L SIDL+GN+L+GQIPDEIG+C 
Sbjct  63   VWRGVSCENVTFNVVALNLSDLNLDGEISPAIGDLKSLLSIDLKGNRLSGQIPDEIGDCS  122

Query  568  slilldlsdnllYGDIPFSI  627
            SL  LDLS N L GDIPFSI
Sbjct  123  SLQNLDLSFNELSGDIPFSI  142



>ref|XP_008452789.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Cucumis melo]
Length=991

 Score =   118 bits (295),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 77/136 (57%), Positives = 106/136 (78%), Gaps = 4/136 (3%)
 Frame = +1

Query  232  ALACVLALILLSFPLTSCIG----DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRG  399
            A+A ++ L++L+F   + +G    D+G TL+ IK+SF +V NVL DW    + DFC WRG
Sbjct  8    AMAFLVELVILAFLFCATVGVVDSDDGATLLEIKKSFRDVDNVLYDWTSSPSSDFCVWRG  67

Query  400  VSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislil  579
            V+C N +++V+SLNLS LNL GEISP+IG+L++LQ++DL+GN L+GQIPDEIG+C SLI 
Sbjct  68   VTCDNATLNVISLNLSGLNLDGEISPSIGNLKSLQTLDLRGNGLSGQIPDEIGDCSSLIN  127

Query  580  ldlsdnllYGDIPFSI  627
            +DLS N +YGDIPFSI
Sbjct  128  MDLSFNEIYGDIPFSI  143



>ref|XP_004141340.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Cucumis sativus]
 ref|XP_004157376.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Cucumis sativus]
 gb|KGN55381.1| Erecta [Cucumis sativus]
Length=991

 Score =   117 bits (293),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 76/136 (56%), Positives = 106/136 (78%), Gaps = 4/136 (3%)
 Frame = +1

Query  232  ALACVLALILLSFPLTSCIG----DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRG  399
            A+A ++ L++L+F   + +G    D+G TL+ IK+S+ +V NVL DW    + DFC WRG
Sbjct  8    AMALLVELVILAFLFCATVGVVDSDDGATLLEIKKSYRDVDNVLYDWTSSPSSDFCVWRG  67

Query  400  VSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislil  579
            V+C N +++V+SLNLS LNL GEISP+IG+L++LQ++DL+GN L+GQIPDEIG+C SLI 
Sbjct  68   VTCDNATLNVISLNLSGLNLDGEISPSIGNLKSLQTLDLRGNGLSGQIPDEIGDCSSLIN  127

Query  580  ldlsdnllYGDIPFSI  627
            +DLS N +YGDIPFSI
Sbjct  128  MDLSFNEIYGDIPFSI  143



>ref|XP_010417421.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Camelina sativa]
Length=975

 Score =   117 bits (292),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 81/125 (65%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvv  432
            LI LSF  T+   DEG TL+ IK+SF +V NVL DW    + D+C WRGVSC N + +VV
Sbjct  13   LICLSFGSTAVNSDEGATLLEIKKSFKDVNNVLYDWTASPSSDYCVWRGVSCENVTFNVV  72

Query  433  slnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGD  612
            +LNLS+LNL GEISPAIGDL++L SIDL+GN+L+GQIPDEIG+C SL  LDLS N L GD
Sbjct  73   ALNLSDLNLDGEISPAIGDLKSLLSIDLKGNRLSGQIPDEIGDCSSLQNLDLSFNELSGD  132

Query  613  IPFSI  627
            IPFSI
Sbjct  133  IPFSI  137


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +1

Query  463  GEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            G ISP +  L  L   DL+GN+L+GQIPDEIG+C SL  LDLS N L GDIPFSI
Sbjct  203  GNISPDLCQLTGLWYFDLKGNRLSGQIPDEIGDCSSLQNLDLSFNELSGDIPFSI  257



>ref|XP_010261893.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Nelumbo nucifera]
Length=979

 Score =   117 bits (292),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 72/118 (61%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = +1

Query  274  LTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnl  453
             +S + ++G TL+ IK+SF +V NVL DW D  + D+C+WRG++C N +  V++LNLS+L
Sbjct  18   FSSSVSNDGATLLEIKKSFRDVDNVLYDWTDSPSSDYCAWRGITCDNVTFDVIALNLSDL  77

Query  454  nlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            NLGGEISPAIGDL+++ SIDL+GN+LTGQIPDEIG C SL  LDLS N ++GDIPFSI
Sbjct  78   NLGGEISPAIGDLKSVLSIDLRGNRLTGQIPDEIGGCSSLKSLDLSFNDIFGDIPFSI  135



>ref|XP_002280069.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Vitis vinifera]
Length=994

 Score =   117 bits (292),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 74/116 (64%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = +1

Query  280  SCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnl  459
            S + D+G TL+ IK+SF +V NVL DW D  + D+C WRGVSC N + +V++LNLS LNL
Sbjct  28   SVVSDDGATLLEIKKSFRDVDNVLYDWTDSPSSDYCVWRGVSCDNVTFNVIALNLSGLNL  87

Query  460  GGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
             GEISPAIGDL+ L S+DL+GN+L+GQIPDEIG+C S+  LDLS N LYGDIPFSI
Sbjct  88   DGEISPAIGDLKGLLSVDLRGNRLSGQIPDEIGDCSSMSSLDLSFNELYGDIPFSI  143



>emb|CBI20727.3| unnamed protein product [Vitis vinifera]
Length=986

 Score =   116 bits (291),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 74/116 (64%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = +1

Query  280  SCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnl  459
            S + D+G TL+ IK+SF +V NVL DW D  + D+C WRGVSC N + +V++LNLS LNL
Sbjct  20   SVVSDDGATLLEIKKSFRDVDNVLYDWTDSPSSDYCVWRGVSCDNVTFNVIALNLSGLNL  79

Query  460  GGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
             GEISPAIGDL+ L S+DL+GN+L+GQIPDEIG+C S+  LDLS N LYGDIPFSI
Sbjct  80   DGEISPAIGDLKGLLSVDLRGNRLSGQIPDEIGDCSSMSSLDLSFNELYGDIPFSI  135



>ref|XP_006452987.1| hypothetical protein CICLE_v100073971mg, partial [Citrus clementina]
 gb|ESR66227.1| hypothetical protein CICLE_v100073971mg, partial [Citrus clementina]
Length=503

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 101/136 (74%), Gaps = 1/136 (1%)
 Frame = +1

Query  223  MEFALACVLALILL-SFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRG  399
            M F L  +L L+ L      S   ++G TL+ IK+SF +V NVL DW D  + D+C WRG
Sbjct  1    MAFRLEFILLLVFLFCLSFGSVDSEDGATLLEIKKSFRDVDNVLYDWTDSPSSDYCVWRG  60

Query  400  VSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislil  579
            ++C N + +V++LNLS LNL GEISPA+GDL++LQSIDL+GN+L+GQIPDEIG+C SL  
Sbjct  61   ITCDNVTFTVIALNLSGLNLDGEISPAVGDLKDLQSIDLRGNRLSGQIPDEIGDCSSLKS  120

Query  580  ldlsdnllYGDIPFSI  627
            LDLS N LYGDIPFSI
Sbjct  121  LDLSINELYGDIPFSI  136



>gb|KDP34024.1| hypothetical protein JCGZ_07595 [Jatropha curcas]
Length=986

 Score =   115 bits (289),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 80/139 (58%), Positives = 99/139 (71%), Gaps = 5/139 (4%)
 Frame = +1

Query  211  GIRKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCS  390
             +R   F LA VL L        S   D+G TL+ IK+SF +V NVL DW D  + D+C 
Sbjct  2    AVRVQFFFLALVLCL-----GFGSVTSDDGSTLLEIKKSFRDVGNVLYDWTDSPSSDYCV  56

Query  391  WRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncis  570
            WRG++C N + +VV+LNLS LNL GEISPAIG+L++L SIDL+GN+L GQIPDEIG+C S
Sbjct  57   WRGITCDNATFNVVALNLSGLNLDGEISPAIGNLKDLVSIDLRGNRLAGQIPDEIGDCSS  116

Query  571  lilldlsdnllYGDIPFSI  627
            L  LDLS N +YGDIPFSI
Sbjct  117  LKSLDLSFNEIYGDIPFSI  135



>dbj|BAK61880.1| LRR receptor-like serine/threonine-protein kinase [Citrus unshiu]
Length=933

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 101/136 (74%), Gaps = 1/136 (1%)
 Frame = +1

Query  223  MEFALACVLALILL-SFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRG  399
            M F L  +L L+ L      S   ++G TL+ IK+SF +V NVL DW D  + D+C WRG
Sbjct  1    MAFRLEFILLLVFLFCLSFGSVDSEDGATLLKIKKSFRDVDNVLYDWTDSPSSDYCVWRG  60

Query  400  VSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislil  579
            ++C N + +V++LNLS LNL GEISPA+GDL++LQSIDL+GN+L+GQIPDEIG+C SL  
Sbjct  61   ITCDNVTFTVIALNLSGLNLDGEISPAVGDLKDLQSIDLRGNRLSGQIPDEIGDCSSLKS  120

Query  580  ldlsdnllYGDIPFSI  627
            LDLS N LYGDIPFSI
Sbjct  121  LDLSFNELYGDIPFSI  136



>ref|XP_009802873.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Nicotiana sylvestris]
Length=990

 Score =   114 bits (286),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 73/116 (63%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = +1

Query  280  SCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnl  459
            S + D+G TL+ IK+SF +V NVL DW D  + D+C+WRGV+C N + ++VSLNLS+LNL
Sbjct  31   SVLSDDGSTLLEIKKSFMDVENVLYDWTDSPSSDYCAWRGVTCDNVTFNIVSLNLSSLNL  90

Query  460  GGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
             GE+SPA+G L++L SIDL+GN+LTGQIPDEIG+C +L  LDLS N LYGDIPFSI
Sbjct  91   DGELSPAVGQLKDLISIDLRGNRLTGQIPDEIGDCSALKNLDLSFNELYGDIPFSI  146



>ref|XP_009398741.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Musa acuminata subsp. malaccensis]
Length=996

 Score =   114 bits (285),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 80/134 (60%), Positives = 96/134 (72%), Gaps = 17/134 (13%)
 Frame = +1

Query  271  PLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHN-----------------EDFCSWRG  399
            P  S + DEG  L+S+K SFSNVAN+LLDW                      +D CSWRG
Sbjct  24   PPVSPLSDEGIALLSLKASFSNVANMLLDWTPAGAGAGAAAGGGSANATGDADDHCSWRG  83

Query  400  VSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislil  579
            V C N + +V++LNLSNLNLGGEISPA+G+L+NLQSIDL+GNQLTGQIPDEIG+C++L  
Sbjct  84   VLCDNLTSAVIALNLSNLNLGGEISPAVGELKNLQSIDLKGNQLTGQIPDEIGDCVALKY  143

Query  580  ldlsdnllYGDIPF  621
            LDLS N LYGDIPF
Sbjct  144  LDLSGNALYGDIPF  157



>ref|XP_010047401.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Eucalyptus grandis]
 gb|KCW79310.1| hypothetical protein EUGRSUZ_C00732 [Eucalyptus grandis]
Length=988

 Score =   114 bits (284),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 79/137 (58%), Positives = 100/137 (73%), Gaps = 4/137 (3%)
 Frame = +1

Query  223  MEFALACVLALILLSFP--LTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWR  396
            M F LA VLA+ L+ F   L  C  D+G TL+ +K+SF +V NVL DW D  + D+C WR
Sbjct  1    MAFRLALVLAVSLVCFSSGLVDC--DDGATLLEVKKSFRDVDNVLYDWTDSPSSDYCVWR  58

Query  397  GVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncisli  576
            GVSC N + +VV++NL+ LNL GEISP++GDL+ L S+DL  N+L+GQIPDEIG+C SL 
Sbjct  59   GVSCDNVTFNVVAINLTGLNLDGEISPSVGDLKGLLSLDLSSNRLSGQIPDEIGDCSSLT  118

Query  577  lldlsdnllYGDIPFSI  627
             LDLS N L GDIPFSI
Sbjct  119  SLDLSFNELDGDIPFSI  135



>ref|XP_009605434.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Nicotiana tomentosiformis]
Length=991

 Score =   113 bits (283),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 72/114 (63%), Positives = 91/114 (80%), Gaps = 0/114 (0%)
 Frame = +1

Query  286  IGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGG  465
            + D+G TL+ IK+SF +V NVL DW D  + D+C+WRGV+C N + ++VSLN S+LNL G
Sbjct  33   VSDDGSTLLEIKKSFRDVENVLYDWTDSPSSDYCAWRGVTCDNVTFNIVSLNFSSLNLDG  92

Query  466  EISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            E+SPAIG L+ L SIDL+GN+LTGQIPDEIG+C +L  LDLS N LYGDIPFSI
Sbjct  93   ELSPAIGQLKGLISIDLRGNRLTGQIPDEIGDCSALKNLDLSFNELYGDIPFSI  146



>ref|XP_002516144.1| erecta, putative [Ricinus communis]
 gb|EEF46146.1| erecta, putative [Ricinus communis]
Length=980

 Score =   112 bits (281),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 75/135 (56%), Positives = 97/135 (72%), Gaps = 0/135 (0%)
 Frame = +1

Query  223  MEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGV  402
            M F +  V   +LL         D+G TL+ +K+SF +V NVL DW D  + D+C WRGV
Sbjct  1    MAFRVEVVFLALLLCLGFGFVDSDDGATLLEVKKSFRDVDNVLYDWTDSPSSDYCVWRGV  60

Query  403  SCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislill  582
            +C N + +V++LNLS LNL GEISPAIG+L+++ SIDL+GN L+GQIPDEIG+C SL  L
Sbjct  61   TCDNATFNVIALNLSGLNLDGEISPAIGNLKDIVSIDLRGNLLSGQIPDEIGDCSSLKSL  120

Query  583  dlsdnllYGDIPFSI  627
            DLS N +YGDIPFSI
Sbjct  121  DLSFNEIYGDIPFSI  135



>ref|XP_007225368.1| hypothetical protein PRUPE_ppa000847mg [Prunus persica]
 gb|EMJ26567.1| hypothetical protein PRUPE_ppa000847mg [Prunus persica]
Length=983

 Score =   112 bits (281),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 72/112 (64%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +1

Query  292  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  471
            ++G TL+ IK+SF +V NVL DW D  + D+C WRGV+C N + +V++LNLS LNL GEI
Sbjct  24   EDGTTLLEIKKSFRDVDNVLYDWTDAPSLDYCVWRGVTCDNVTFNVIALNLSGLNLDGEI  83

Query  472  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            SPAIG+L+ LQSIDL+GN+L+GQIPDEIG+C SL  LDLS N +YGDIPFSI
Sbjct  84   SPAIGNLKGLQSIDLRGNRLSGQIPDEIGDCSSLRNLDLSFNEIYGDIPFSI  135



>ref|XP_003588942.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Medicago 
truncatula]
Length=978

 Score =   112 bits (280),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 75/136 (55%), Positives = 96/136 (71%), Gaps = 1/136 (1%)
 Frame = +1

Query  223  MEFALACVLALILLS-FPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRG  399
            M F    V  L+LLS F + S   D+G T++ IK+SF +V NVL DW D    D+C+WRG
Sbjct  1    MAFEFGVVFVLVLLSCFNVNSVESDDGSTMLEIKKSFRDVDNVLYDWTDSPTSDYCAWRG  60

Query  400  VSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislil  579
            ++C N + +VV+LNLS LNL GEISP IG L++L SIDL+ N+L+GQIPDEIG+C  L  
Sbjct  61   ITCDNVTFNVVALNLSGLNLDGEISPTIGKLQSLVSIDLKQNRLSGQIPDEIGDCSLLQT  120

Query  580  ldlsdnllYGDIPFSI  627
            LD S N + GDIPFSI
Sbjct  121  LDFSFNEIRGDIPFSI  136



>gb|AES59193.2| LRR receptor-like kinase family protein [Medicago truncatula]
Length=985

 Score =   112 bits (280),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 75/136 (55%), Positives = 96/136 (71%), Gaps = 1/136 (1%)
 Frame = +1

Query  223  MEFALACVLALILLS-FPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRG  399
            M F    V  L+LLS F + S   D+G T++ IK+SF +V NVL DW D    D+C+WRG
Sbjct  1    MAFEFGVVFVLVLLSCFNVNSVESDDGSTMLEIKKSFRDVDNVLYDWTDSPTSDYCAWRG  60

Query  400  VSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislil  579
            ++C N + +VV+LNLS LNL GEISP IG L++L SIDL+ N+L+GQIPDEIG+C  L  
Sbjct  61   ITCDNVTFNVVALNLSGLNLDGEISPTIGKLQSLVSIDLKQNRLSGQIPDEIGDCSLLQT  120

Query  580  ldlsdnllYGDIPFSI  627
            LD S N + GDIPFSI
Sbjct  121  LDFSFNEIRGDIPFSI  136



>emb|CDP13474.1| unnamed protein product [Coffea canephora]
Length=992

 Score =   112 bits (279),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 75/123 (61%), Positives = 91/123 (74%), Gaps = 0/123 (0%)
 Frame = +1

Query  259  LLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvsl  438
            LL F   S   D+G TL+ IK+SF +V NVL DW D  + D C WRGV+C N + +VV+L
Sbjct  23   LLCFSFGSVDSDDGATLLEIKKSFRDVDNVLYDWTDSPSSDCCVWRGVTCDNVTFNVVAL  82

Query  439  nlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIP  618
            NLS LNL GEISPA+G L+ L SIDL+GN+L+GQIPDEIG+C +L  LD S N LYGDIP
Sbjct  83   NLSGLNLDGEISPAVGHLKALLSIDLRGNRLSGQIPDEIGDCSALTSLDFSFNELYGDIP  142

Query  619  FSI  627
            FSI
Sbjct  143  FSI  145



>gb|AGL91677.1| erecta leucine-rich-repeat receptor-like kinase [Brassica napus]
 emb|CDX76712.1| BnaC08g32980D [Brassica napus]
Length=987

 Score =   112 bits (279),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 79/125 (63%), Positives = 97/125 (78%), Gaps = 1/125 (1%)
 Frame = +1

Query  253  LILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvv  432
            LI LSF  T+   D G TL+ IK+SF +V NVL DW    + D+C+WRGV+C N + +VV
Sbjct  13   LICLSFG-TTVNSDNGATLLEIKKSFKDVNNVLYDWTGSPSSDYCAWRGVTCDNVTFNVV  71

Query  433  slnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGD  612
            +LNLS+LNL GEISPAIGDL++L SIDL+GN+L+GQIPDEIG+C SL  LDLS N L GD
Sbjct  72   ALNLSDLNLDGEISPAIGDLKSLLSIDLRGNRLSGQIPDEIGDCSSLQNLDLSFNELSGD  131

Query  613  IPFSI  627
            IPFSI
Sbjct  132  IPFSI  136



>ref|XP_004245043.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Solanum lycopersicum]
Length=990

 Score =   111 bits (278),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 72/123 (59%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +1

Query  259  LLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvsl  438
            L+ F   S + D+G  L+ IK+S  +V NVL DW D  + D+C+WRGV+C N + +VV L
Sbjct  22   LIFFSFGSVVSDDGSALLEIKKSIRDVENVLYDWTDSPSSDYCAWRGVTCDNVTFNVVQL  81

Query  439  nlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIP  618
            NLS+LNL GE+SPAIG L+ L SID++GN+L+GQIPDEIG+C +L  LDLS N LYGDIP
Sbjct  82   NLSSLNLDGELSPAIGQLKGLVSIDMRGNRLSGQIPDEIGDCSALKNLDLSFNELYGDIP  141

Query  619  FSI  627
            FSI
Sbjct  142  FSI  144



>ref|XP_009117015.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Brassica rapa]
 ref|XP_009117016.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Brassica rapa]
 gb|AGL91676.1| erecta leucine-rich-repeat receptor-like kinase [Brassica napus]
 emb|CDY11488.1| BnaA09g40540D [Brassica napus]
Length=987

 Score =   111 bits (277),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 79/126 (63%), Positives = 97/126 (77%), Gaps = 1/126 (1%)
 Frame = +1

Query  250  ALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsv  429
            +LI LSF  T+   D G TL+ IK+SF +V NVL DW    + D+C WRGV+C N + +V
Sbjct  12   SLICLSFG-TTVNSDNGATLLEIKKSFKDVNNVLYDWTGSPSSDYCVWRGVTCDNVTFNV  70

Query  430  vslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYG  609
            V+LNLS+LNL GEISPAIGDL++L SIDL+GN+L+GQIPDEIG+C SL  LDLS N L G
Sbjct  71   VALNLSDLNLDGEISPAIGDLKSLLSIDLRGNRLSGQIPDEIGDCSSLQNLDLSFNELSG  130

Query  610  DIPFSI  627
            DIPFSI
Sbjct  131  DIPFSI  136



>ref|XP_009337156.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Pyrus x bretschneideri]
Length=992

 Score =   111 bits (277),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 71/144 (49%), Positives = 92/144 (64%), Gaps = 4/144 (3%)
 Frame = +1

Query  205  FPGIRKMEFALACVLALILL---SFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHN  375
            F G   M F +  VL ++LL   SF       D+G+TL+ IK++F +V NVL +W D  +
Sbjct  3    FDGRAVMAFRVEFVLLILLLGCVSFGYGDSRNDQGRTLLGIKKAFRDVDNVLYEWTDSPS  62

Query  376  EDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEI  555
             D+C WRGV+C N    +          GGEIS  IGDL  LQSIDL+GN+L+GQIPDEI
Sbjct  63   LDYCVWRGVTCDNSLNVIALNLSGLNL-GGEISSVIGDLETLQSIDLRGNRLSGQIPDEI  121

Query  556  GncislilldlsdnllYGDIPFSI  627
            G+C +L  LDLS N ++GDIPFSI
Sbjct  122  GDCAALQNLDLSFNEIFGDIPFSI  145



>ref|XP_010474472.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Camelina sativa]
Length=796

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = +1

Query  253  LILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvv  432
            LI LSF  T+   DEG TL+ IK+SF +V NVL DW    + D+C WRGVSC N + +VV
Sbjct  13   LICLSFGSTAVNSDEGATLLEIKKSFKDVNNVLYDWTASPSSDYCVWRGVSCENVTFNVV  72

Query  433  slnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGD  612
            +LNLS+LNL GEISPAIGD ++L SIDL+GN+L+GQIPDEIG+C SL  LDLS N L GD
Sbjct  73   ALNLSDLNLDGEISPAIGDFKSLLSIDLKGNRLSGQIPDEIGDCSSLQNLDLSFNELSGD  132

Query  613  IPFSI  627
            IPFSI
Sbjct  133  IPFSI  137



>ref|XP_010273915.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X2 [Nelumbo nucifera]
Length=965

 Score =   110 bits (276),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 76/128 (59%), Positives = 94/128 (73%), Gaps = 0/128 (0%)
 Frame = +1

Query  244  VLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsm  423
            VL + L      S   ++G TL+ IK+SF +V NVL DW D     +CSWRG++C N + 
Sbjct  8    VLLVFLAWLSFGSSDSNDGATLLEIKKSFRDVDNVLYDWTDSPTYGYCSWRGITCDNVTF  67

Query  424  svvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnll  603
            +VV+LNLS LNLGGEISPAIGDL++L SIDL+ N L+GQIPDEIG+C SL  LDLS N +
Sbjct  68   NVVALNLSGLNLGGEISPAIGDLKSLLSIDLRENLLSGQIPDEIGDCSSLKSLDLSFNNI  127

Query  604  YGDIPFSI  627
            YGDIPFSI
Sbjct  128  YGDIPFSI  135



>ref|XP_008220576.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X2 [Prunus mume]
Length=991

 Score =   110 bits (276),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 72/112 (64%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = +1

Query  292  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  471
            ++G TL+ IK+SF +V NVL DW D  + D+C WRGV C N + +V++LNLS LNL GEI
Sbjct  32   EDGTTLLEIKKSFRDVDNVLYDWTDAPSLDYCVWRGVICDNVTFNVIALNLSGLNLDGEI  91

Query  472  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            SPAIG+L+ LQSIDL+GN+L+GQIPDEIG+C SL  LDLS N +YGDIPFSI
Sbjct  92   SPAIGNLKGLQSIDLRGNRLSGQIPDEIGDCSSLRNLDLSFNEIYGDIPFSI  143



>ref|XP_008220575.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X1 [Prunus mume]
Length=992

 Score =   110 bits (276),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 72/112 (64%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = +1

Query  292  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  471
            ++G TL+ IK+SF +V NVL DW D  + D+C WRGV C N + +V++LNLS LNL GEI
Sbjct  32   EDGTTLLEIKKSFRDVDNVLYDWTDAPSLDYCVWRGVICDNVTFNVIALNLSGLNLDGEI  91

Query  472  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            SPAIG+L+ LQSIDL+GN+L+GQIPDEIG+C SL  LDLS N +YGDIPFSI
Sbjct  92   SPAIGNLKGLQSIDLRGNRLSGQIPDEIGDCSSLRNLDLSFNEIYGDIPFSI  143



>ref|XP_007012431.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY30050.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=983

 Score =   110 bits (276),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 76/136 (56%), Positives = 100/136 (74%), Gaps = 4/136 (3%)
 Frame = +1

Query  220  KMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRG  399
            ++EF    +++L  L F       ++G TL+ IK+SF +V NVL DW D  + D+C WRG
Sbjct  7    RLEFIF--LVSLFYLGFAFVD--SEDGATLLEIKKSFRDVDNVLYDWADTPSSDYCVWRG  62

Query  400  VSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislil  579
            V+C N + +VV+LNLS LNL GEISPAIG+L++L ++DL+GN L+GQIPDEIG+C SL  
Sbjct  63   VTCDNVTFNVVALNLSGLNLDGEISPAIGNLKDLLTVDLRGNSLSGQIPDEIGDCSSLKS  122

Query  580  ldlsdnllYGDIPFSI  627
            LDLS N LYGDIPFSI
Sbjct  123  LDLSFNELYGDIPFSI  138



>ref|XP_010273914.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X1 [Nelumbo nucifera]
Length=988

 Score =   110 bits (275),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 76/128 (59%), Positives = 94/128 (73%), Gaps = 0/128 (0%)
 Frame = +1

Query  244  VLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsm  423
            VL + L      S   ++G TL+ IK+SF +V NVL DW D     +CSWRG++C N + 
Sbjct  8    VLLVFLAWLSFGSSDSNDGATLLEIKKSFRDVDNVLYDWTDSPTYGYCSWRGITCDNVTF  67

Query  424  svvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnll  603
            +VV+LNLS LNLGGEISPAIGDL++L SIDL+ N L+GQIPDEIG+C SL  LDLS N +
Sbjct  68   NVVALNLSGLNLGGEISPAIGDLKSLLSIDLRENLLSGQIPDEIGDCSSLKSLDLSFNNI  127

Query  604  YGDIPFSI  627
            YGDIPFSI
Sbjct  128  YGDIPFSI  135



>ref|XP_011081595.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Sesamum indicum]
Length=973

 Score =   110 bits (275),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 75/124 (60%), Positives = 94/124 (76%), Gaps = 2/124 (2%)
 Frame = +1

Query  256  ILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvs  435
            + L+F    C  D+G  L+ IK SF +V NVL DW D  + D+C+WRGV+C N + +VV+
Sbjct  23   VCLNFASVDC--DDGTVLLEIKRSFRDVENVLYDWIDSPSSDYCAWRGVTCDNVTFNVVA  80

Query  436  lnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDI  615
            LNLS LNL GEISPAIG L+ L SIDL+GN+L+GQIPDEIG+C +LI LDLS N LYGDI
Sbjct  81   LNLSGLNLDGEISPAIGQLKGLLSIDLRGNRLSGQIPDEIGDCSALISLDLSFNELYGDI  140

Query  616  PFSI  627
            PFS+
Sbjct  141  PFSM  144



>ref|XP_004303459.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Fragaria vesca subsp. vesca]
Length=983

 Score =   110 bits (274),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 71/112 (63%), Positives = 92/112 (82%), Gaps = 0/112 (0%)
 Frame = +1

Query  292  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  471
            DEG TL+ IK+SF +  NVL DW D  + D+C+WRGV+C N + +V++LNLS+LNL GEI
Sbjct  25   DEGATLLEIKKSFRDEDNVLYDWRDSPSLDYCAWRGVTCDNVTFNVIALNLSSLNLDGEI  84

Query  472  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            +PAIG+L+ LQSIDL+GN+L+GQIPDEIG+C SL  LDLS N ++GDIPFSI
Sbjct  85   APAIGNLKGLQSIDLRGNRLSGQIPDEIGDCSSLRYLDLSFNEIHGDIPFSI  136



>ref|XP_008786640.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X2 [Phoenix dactylifera]
Length=985

 Score =   110 bits (274),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 78/132 (59%), Positives = 100/132 (76%), Gaps = 5/132 (4%)
 Frame = +1

Query  247  LALILLSFPLTSCI-GD----EGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCG  411
            LAL++L   L+S + GD    +G TL+ IK+SF NV NVL DW +    D+CSWRGV+C 
Sbjct  9    LALLVLFGVLSSAVVGDTGTNDGATLLEIKKSFRNVENVLYDWTEATGSDYCSWRGVTCD  68

Query  412  nfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldls  591
            N + +VV+LNLS LNL GEI+PA G+L+ L SIDL+ N+L+GQIPDEIG+C SL +LDLS
Sbjct  69   NITFNVVALNLSGLNLDGEIAPAFGNLKGLVSIDLKANRLSGQIPDEIGDCSSLKVLDLS  128

Query  592  dnllYGDIPFSI  627
             N +YGDIPFSI
Sbjct  129  FNNIYGDIPFSI  140



>ref|XP_003544548.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Glycine max]
 gb|KHN17259.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Glycine 
soja]
Length=980

 Score =   109 bits (273),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 74/135 (55%), Positives = 97/135 (72%), Gaps = 0/135 (0%)
 Frame = +1

Query  223  MEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGV  402
            M F    ++  +L+   + S   D+G TL+ IK+SF +V NVL DW D  + D+C+WRG+
Sbjct  1    MAFRFGVLILALLICLSVNSVESDDGATLLEIKKSFRDVDNVLYDWTDSPSSDYCAWRGI  60

Query  403  SCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislill  582
            +C N + +VV+LNLS LNL GEISPAIG L +L SIDL+ N+L+GQIPDEIG+C SL  L
Sbjct  61   ACDNVTFNVVALNLSGLNLDGEISPAIGKLHSLVSIDLRENRLSGQIPDEIGDCSSLKNL  120

Query  583  dlsdnllYGDIPFSI  627
            DLS N + GDIPFSI
Sbjct  121  DLSFNEIRGDIPFSI  135



>ref|XP_002880777.1| hypothetical protein ARALYDRAFT_481491 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57036.1| hypothetical protein ARALYDRAFT_481491 [Arabidopsis lyrata subsp. 
lyrata]
Length=976

 Score =   109 bits (273),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 78/129 (60%), Positives = 97/129 (75%), Gaps = 1/129 (1%)
 Frame = +1

Query  244  VLALILLSFPLTSCI-GDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfs  420
            VL   L+   L + +  DEG TL+ IK+SF +V NVL DW    + D+C WRGV+C N +
Sbjct  8    VLLGFLICLSLVATVNSDEGATLLEIKKSFKDVNNVLYDWTASPSSDYCVWRGVTCENVT  67

Query  421  msvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnl  600
             +VV+LNLS+LNL GEISPAIGDL++L SIDL+GN+L+GQIPDEIG+C SL  LDLS N 
Sbjct  68   FNVVALNLSDLNLDGEISPAIGDLKSLLSIDLRGNRLSGQIPDEIGDCSSLQNLDLSFNE  127

Query  601  lYGDIPFSI  627
            L GDIPFSI
Sbjct  128  LSGDIPFSI  136



>ref|XP_006408746.1| hypothetical protein EUTSA_v10001898mg [Eutrema salsugineum]
 gb|ESQ50199.1| hypothetical protein EUTSA_v10001898mg [Eutrema salsugineum]
Length=977

 Score =   109 bits (272),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 78/125 (62%), Positives = 95/125 (76%), Gaps = 1/125 (1%)
 Frame = +1

Query  253  LILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvv  432
            LI LSF  T+   D G TL+ IK+SF +V N+L DW    + D+C WRGV+C N + +VV
Sbjct  13   LICLSFG-TTVNSDNGATLLEIKKSFKDVNNILYDWTSSPSSDYCVWRGVTCENVTFNVV  71

Query  433  slnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGD  612
            +LNLS+LNL GEISPAIGDL++L SIDL GN+L+GQIPDEIG+C SL  LDLS N L GD
Sbjct  72   ALNLSDLNLDGEISPAIGDLKSLLSIDLGGNRLSGQIPDEIGDCSSLQNLDLSFNELSGD  131

Query  613  IPFSI  627
            IPFSI
Sbjct  132  IPFSI  136



>ref|XP_006656595.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1-like [Oryza brachyantha]
Length=984

 Score =   109 bits (272),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 76/109 (70%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +1

Query  301  KTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPA  480
            K LM++K  F N AN L+DWD     D C+WRGV+C N S +V +LNLSNLNLGGEISPA
Sbjct  42   KALMAVKAGFGNSANALVDWDG--GGDHCAWRGVTCDNASFAVAALNLSNLNLGGEISPA  99

Query  481  IGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            IG+L+NLQ +DL+GN+LTGQIPDEIG+CISL  LDLS NLLYGDIPFSI
Sbjct  100  IGELKNLQFVDLKGNKLTGQIPDEIGDCISLKYLDLSGNLLYGDIPFSI  148



>gb|KHN37058.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Glycine 
soja]
Length=980

 Score =   109 bits (272),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 74/135 (55%), Positives = 97/135 (72%), Gaps = 0/135 (0%)
 Frame = +1

Query  223  MEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGV  402
            M F    ++  +++     S   D+G TL+ IK+SF +V NVL DW D  + D+C+WRG+
Sbjct  1    MAFRFGVLILALVICLNFNSVESDDGATLLEIKKSFRDVDNVLYDWTDSPSSDYCAWRGI  60

Query  403  SCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislill  582
            SC N + +VV+LNLS LNL GEISPAIG L++L SIDL+ N+L+GQIPDEIG+C SL  L
Sbjct  61   SCDNVTFNVVALNLSGLNLDGEISPAIGKLQSLVSIDLRENRLSGQIPDEIGDCSSLKNL  120

Query  583  dlsdnllYGDIPFSI  627
            DLS N + GDIPFSI
Sbjct  121  DLSFNEIRGDIPFSI  135



>dbj|BAD44800.1| putative transmembrane protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAD67663.1| putative transmembrane protein kinase [Oryza sativa Japonica 
Group]
 gb|EEC79921.1| hypothetical protein OsI_21484 [Oryza sativa Indica Group]
Length=980

 Score =   109 bits (272),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 76/109 (70%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +1

Query  301  KTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPA  480
            K LM +K  F N AN L+DWD     D C+WRGV+C N S +V++LNLSNLNLGGEISPA
Sbjct  37   KALMGVKAGFGNAANALVDWDG--GADHCAWRGVTCDNASFAVLALNLSNLNLGGEISPA  94

Query  481  IGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            IG+L+NLQ +DL+GN+LTGQIPDEIG+CISL  LDLS NLLYGDIPFSI
Sbjct  95   IGELKNLQFVDLKGNKLTGQIPDEIGDCISLKYLDLSGNLLYGDIPFSI  143



>dbj|BAJ89970.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=982

 Score =   108 bits (271),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 75/113 (66%), Positives = 89/113 (79%), Gaps = 2/113 (2%)
 Frame = +1

Query  289  GDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGE  468
            G +G+ LM +K  F N AN L DWD     D C+WRGV+C   S +V+SLNLSNLNLGGE
Sbjct  31   GGDGEALMDVKAGFGNAANALADWDG--GRDHCAWRGVACDANSFAVLSLNLSNLNLGGE  88

Query  469  ISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            ISPAIG+L+ LQ +DL+GN+LTGQIPDEIG+C+SL  LDLS NLLYGDIPFSI
Sbjct  89   ISPAIGELKTLQFLDLKGNKLTGQIPDEIGDCVSLKYLDLSFNLLYGDIPFSI  141



>ref|XP_006296065.1| hypothetical protein CARUB_v10025215mg [Capsella rubella]
 gb|EOA28963.1| hypothetical protein CARUB_v10025215mg [Capsella rubella]
Length=976

 Score =   108 bits (271),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 74/112 (66%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = +1

Query  292  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  471
            DEG TL+ IK+SF +V NVL DW    + D+C WRGV+C N + +VV+LNLS+LNL GEI
Sbjct  25   DEGATLLEIKKSFKDVNNVLYDWTASPSSDYCVWRGVTCENVTFNVVALNLSDLNLDGEI  84

Query  472  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            SPAIGDL++L SIDL+GN+L+GQIPDEIG+C SL  LDLS N L GDIPFSI
Sbjct  85   SPAIGDLKSLLSIDLKGNRLSGQIPDEIGDCSSLQDLDLSFNELSGDIPFSI  136



>ref|NP_180201.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Arabidopsis 
thaliana]
 sp|Q42371.1|ERECT_ARATH RecName: Full=LRR receptor-like serine/threonine-protein kinase 
ERECTA; AltName: Full=Protein QUANTITATIVE RESISTANCE TO 
PLECTOSPHAERELLA 1; AltName: Full=Protein QUANTITATIVE RESISTANCE 
TO RALSTONIA SOLANACEARUM 1; AltName: Full=Protein TRANSPIRATION 
EFFICIENCY 1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC49302.1| ERECTA [Arabidopsis thaliana]
 dbj|BAA11869.1| receptor protein kinase [Arabidopsis thaliana]
 gb|AAC14518.1| putative receptor-like protein kinase, ERECTA [Arabidopsis thaliana]
 gb|AAK59615.1| putative receptor protein kinase, ERECTA [Arabidopsis thaliana]
 gb|ACN59296.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEC07825.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Arabidopsis 
thaliana]
Length=976

 Score =   108 bits (271),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 78/129 (60%), Positives = 96/129 (74%), Gaps = 1/129 (1%)
 Frame = +1

Query  244  VLALILLSFPLTSCI-GDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfs  420
            VL   L    L + +  +EG TL+ IK+SF +V NVL DW    + D+C WRGVSC N +
Sbjct  8    VLLGFLFCLSLVATVTSEEGATLLEIKKSFKDVNNVLYDWTTSPSSDYCVWRGVSCENVT  67

Query  421  msvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnl  600
             +VV+LNLS+LNL GEISPAIGDL++L SIDL+GN+L+GQIPDEIG+C SL  LDLS N 
Sbjct  68   FNVVALNLSDLNLDGEISPAIGDLKSLLSIDLRGNRLSGQIPDEIGDCSSLQNLDLSFNE  127

Query  601  lYGDIPFSI  627
            L GDIPFSI
Sbjct  128  LSGDIPFSI  136



>gb|KFK32516.1| hypothetical protein AALP_AA6G252800 [Arabis alpina]
Length=981

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 96/129 (74%), Gaps = 1/129 (1%)
 Frame = +1

Query  244  VLALILLSFPLTSCIGDE-GKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfs  420
            VL   L+ F   S +  E G TL+ IK+SF +V NVL DW    + D+C WRGVSC N +
Sbjct  12   VLVGFLICFSFASTVNSEDGATLLEIKKSFKDVNNVLYDWTSSPSSDYCVWRGVSCDNVT  71

Query  421  msvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnl  600
             +VV+LNLS+LNL GEISPAIGDL+NL SIDL+GN+L+GQIPDEIG+C SL  LDLS N 
Sbjct  72   FNVVALNLSDLNLDGEISPAIGDLKNLFSIDLRGNRLSGQIPDEIGDCSSLQNLDLSFNE  131

Query  601  lYGDIPFSI  627
            L GDIPFSI
Sbjct  132  LSGDIPFSI  140



>ref|XP_006353850.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Solanum tuberosum]
Length=990

 Score =   108 bits (269),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 70/116 (60%), Positives = 90/116 (78%), Gaps = 0/116 (0%)
 Frame = +1

Query  280  SCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnl  459
            S + D+G  L+ IK+S  +V NVL DW D  + D+C+WRGV+C N + +VV LNLS+LNL
Sbjct  29   SVVSDDGSALLEIKKSIRDVENVLYDWTDSPSSDYCAWRGVTCDNVTFNVVQLNLSSLNL  88

Query  460  GGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
             GE+SPAIG L+ L SID++GN+L+GQIPDEIG+C +L  LDLS N LYGDIPFSI
Sbjct  89   DGELSPAIGQLKGLISIDVRGNRLSGQIPDEIGDCSALKNLDLSFNELYGDIPFSI  144



>ref|XP_006849687.1| hypothetical protein AMTR_s00024p00237440 [Amborella trichopoda]
 gb|ERN11268.1| hypothetical protein AMTR_s00024p00237440 [Amborella trichopoda]
Length=995

 Score =   107 bits (268),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 71/112 (63%), Positives = 86/112 (77%), Gaps = 0/112 (0%)
 Frame = +1

Query  292  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  471
            D+G TL+ IK++F +V NVL DW    + ++CSWRG++C N +  VVSLNLS LNL GEI
Sbjct  35   DDGATLLEIKKAFRDVDNVLYDWTGASSSEYCSWRGITCDNMTFDVVSLNLSGLNLDGEI  94

Query  472  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            SPAIG+L+ L SIDL+GN L GQIPDEIG C SL  LDLS N +YGDIPFSI
Sbjct  95   SPAIGNLKGLLSIDLRGNHLLGQIPDEIGGCSSLTSLDLSFNDIYGDIPFSI  146



>gb|KJB07391.1| hypothetical protein B456_001G019800 [Gossypium raimondii]
 gb|KJB07392.1| hypothetical protein B456_001G019800 [Gossypium raimondii]
 gb|KJB07393.1| hypothetical protein B456_001G019800 [Gossypium raimondii]
Length=983

 Score =   107 bits (268),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 76/135 (56%), Positives = 98/135 (73%), Gaps = 4/135 (3%)
 Frame = +1

Query  223  MEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGV  402
            +EF    +++L  L F       ++G TL+ IK+SF +V NVL DW D  + D+C WRGV
Sbjct  8    LEFVF--LVSLFCLGFAFVD--SEDGTTLLEIKKSFKDVDNVLYDWTDTPSSDYCVWRGV  63

Query  403  SCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislill  582
            +C N + +VV+LNLS LNL GEIS AIG L++L +IDL+GN+L+GQIPDEIG+C SL  L
Sbjct  64   TCDNVTFNVVALNLSGLNLDGEISTAIGKLKDLVTIDLRGNRLSGQIPDEIGDCSSLKSL  123

Query  583  dlsdnllYGDIPFSI  627
            DLS N LYGDIPFSI
Sbjct  124  DLSFNELYGDIPFSI  138



>ref|XP_009362801.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Pyrus x bretschneideri]
Length=992

 Score =   107 bits (268),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 63/122 (52%), Positives = 83/122 (68%), Gaps = 1/122 (1%)
 Frame = +1

Query  262  LSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvsln  441
            +SF       D+G+TL+ IK++F +V NVL +W D  + D+C WRGV+C N    +    
Sbjct  25   MSFGNGDSQNDQGRTLLEIKKAFRDVDNVLYEWTDQPSLDYCVWRGVTCDNSLNVIALNL  84

Query  442  lsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPF  621
                  GGEIS  IGDL NLQSIDL+GN+L+GQIPDEIG+C +L  +DLS N ++GDIPF
Sbjct  85   SGLNL-GGEISSVIGDLENLQSIDLRGNRLSGQIPDEIGDCSALQNIDLSFNEIFGDIPF  143

Query  622  SI  627
            SI
Sbjct  144  SI  145



>ref|XP_010917192.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Elaeis guineensis]
Length=986

 Score =   107 bits (267),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 69/111 (62%), Positives = 88/111 (79%), Gaps = 0/111 (0%)
 Frame = +1

Query  295  EGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEIS  474
            +G TLM IK+SF NV NVL DW +    D+CSWRGV+C N + ++V+LNLS LNL G+IS
Sbjct  30   DGATLMEIKKSFRNVDNVLYDWTEATGSDYCSWRGVTCDNTTFNIVALNLSGLNLDGDIS  89

Query  475  PAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            PA G+L+ + SIDL+ N+L+GQIPDEIG+C SL +LDLS N +YGDIPFSI
Sbjct  90   PAFGNLKGIVSIDLKANRLSGQIPDEIGDCSSLKVLDLSFNNIYGDIPFSI  140



>ref|XP_010669304.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Beta vulgaris subsp. vulgaris]
Length=992

 Score =   107 bits (267),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 79/148 (53%), Positives = 103/148 (70%), Gaps = 3/148 (2%)
 Frame = +1

Query  190  VEKVLFPGIRKMEFALACVLAL--ILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWD  363
            +E   F G ++   +L  ++ L  +LLS  L S   D+G TL+ IK+S  +V NVL DW 
Sbjct  1    MEVGFFSGFQQWRHSLVTLVILTSVLLS-SLGSVDSDDGVTLLEIKKSIRDVDNVLYDWS  59

Query  364  DVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQI  543
            D  + D+C WRGV+C N + ++V+LNLS LNL GEIS +IGDL++L SIDL  N+L+GQI
Sbjct  60   DSPSADYCVWRGVTCDNATFNIVALNLSGLNLDGEISSSIGDLKSLLSIDLSRNRLSGQI  119

Query  544  PDEIGncislilldlsdnllYGDIPFSI  627
            PDEIG+C  L  LDLS N LYGDIPFSI
Sbjct  120  PDEIGDCSPLKSLDLSFNELYGDIPFSI  147



>ref|XP_011069519.1| PREDICTED: LOW QUALITY PROTEIN: LRR receptor-like serine/threonine-protein 
kinase ERECTA [Sesamum indicum]
Length=992

 Score =   107 bits (266),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 73/134 (54%), Positives = 96/134 (72%), Gaps = 3/134 (2%)
 Frame = +1

Query  226  EFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVS  405
            ++ L   L + L S  + S   D+G  L+ +K+SF +V NVL DW D  + D+C WRG++
Sbjct  21   QYVLVGFLVVFLNSASVDS---DDGAILLEVKKSFRDVDNVLYDWTDTPSSDYCVWRGIT  77

Query  406  CGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilld  585
            C N + +VV+LNLS LNL GEISPA G L+ L SIDL+GN+L+GQIPDEIG+C +L  LD
Sbjct  78   CDNVTFNVVALNLSGLNLDGEISPAFGHLKGLVSIDLRGNRLSGQIPDEIGDCSALESLD  137

Query  586  lsdnllYGDIPFSI  627
            LS N LYGDIPFS+
Sbjct  138  LSFNELYGDIPFSV  151



>ref|XP_010526027.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Tarenaya hassleriana]
Length=982

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 96/125 (77%), Gaps = 2/125 (2%)
 Frame = +1

Query  253  LILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvv  432
            L+ LSF   S   D+G TL+ IK+SF +V NVL DW D  + D C WRGV+C N + +VV
Sbjct  22   LVCLSFGTVS--SDDGATLLEIKKSFKDVNNVLYDWTDSSSSDCCVWRGVTCDNVTFNVV  79

Query  433  slnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGD  612
            +LNLS L+L GEISPAIGDL++L SIDL+GN+L+GQIPDEIG+C SL +LDLS N L GD
Sbjct  80   ALNLSGLSLDGEISPAIGDLKSLVSIDLRGNRLSGQIPDEIGDCSSLQMLDLSFNELSGD  139

Query  613  IPFSI  627
            IPFSI
Sbjct  140  IPFSI  144



>ref|XP_006381995.1| hypothetical protein POPTR_0006s23680g [Populus trichocarpa]
 gb|ERP59792.1| hypothetical protein POPTR_0006s23680g [Populus trichocarpa]
Length=890

 Score =   106 bits (265),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 70/112 (63%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = +1

Query  292  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  471
            D+G TL+ IK+SF +V NVL DW D  + D+C WRGV C N + +V++LNLS LNL GEI
Sbjct  24   DDGATLLEIKKSFRDVDNVLYDWTDSPSSDYCVWRGVICDNVTYNVIALNLSGLNLEGEI  83

Query  472  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            SPAIG+L++L SIDL+GN+L+GQIPDE+G+C SL  LDLS N + GDIPFSI
Sbjct  84   SPAIGNLKDLTSIDLKGNRLSGQIPDEMGDCSSLQDLDLSFNEINGDIPFSI  135



>ref|XP_004498860.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X2 [Cicer arietinum]
Length=980

 Score =   105 bits (263),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 73/122 (60%), Positives = 93/122 (76%), Gaps = 0/122 (0%)
 Frame = +1

Query  262  LSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvsln  441
            + F + S   D+G TL+ IK+SF +V NVL DW +    D+C+WRG+SC N + +VV+LN
Sbjct  15   ICFNVNSVDSDDGATLLEIKKSFRDVDNVLYDWTNSPTSDYCAWRGISCDNVTFNVVALN  74

Query  442  lsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPF  621
            LS LNL GEISPAIG L++L SIDL+ N+L+GQIPDEIG+C SLI LDLS N + GDIPF
Sbjct  75   LSGLNLEGEISPAIGSLQSLVSIDLKENRLSGQIPDEIGDCSSLISLDLSFNEIRGDIPF  134

Query  622  SI  627
            SI
Sbjct  135  SI  136



>ref|XP_004498859.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X1 [Cicer arietinum]
Length=984

 Score =   105 bits (263),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 73/122 (60%), Positives = 93/122 (76%), Gaps = 0/122 (0%)
 Frame = +1

Query  262  LSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvsln  441
            + F + S   D+G TL+ IK+SF +V NVL DW +    D+C+WRG+SC N + +VV+LN
Sbjct  15   ICFNVNSVDSDDGATLLEIKKSFRDVDNVLYDWTNSPTSDYCAWRGISCDNVTFNVVALN  74

Query  442  lsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPF  621
            LS LNL GEISPAIG L++L SIDL+ N+L+GQIPDEIG+C SLI LDLS N + GDIPF
Sbjct  75   LSGLNLEGEISPAIGSLQSLVSIDLKENRLSGQIPDEIGDCSSLISLDLSFNEIRGDIPF  134

Query  622  SI  627
            SI
Sbjct  135  SI  136



>ref|XP_009408412.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Musa acuminata subsp. malaccensis]
Length=980

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 98/131 (75%), Gaps = 5/131 (4%)
 Frame = +1

Query  244  VLALILLSFPLTSCI-GD--EGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGn  414
            +++L+LL     SC+ GD  EG TL+ IK+SF NV NVL DW D  + D CSWRGV C N
Sbjct  8    IVSLVLLGS--LSCVCGDTSEGATLVEIKKSFRNVDNVLYDWADDPSSDHCSWRGVICDN  65

Query  415  fsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsd  594
             + SVV+LNLS LNL GEISPAIG+L+ L SIDL+ N+L+GQIPDEIG C SL  LDLS 
Sbjct  66   VTFSVVALNLSGLNLDGEISPAIGNLKALVSIDLKANRLSGQIPDEIGACSSLKTLDLSY  125

Query  595  nllYGDIPFSI  627
            N +YGDIPFS+
Sbjct  126  NSIYGDIPFSV  136



>ref|XP_008393446.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Malus domestica]
Length=992

 Score =   105 bits (263),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 63/122 (52%), Positives = 82/122 (67%), Gaps = 1/122 (1%)
 Frame = +1

Query  262  LSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvsln  441
            +SF       D+G+TL+ IK++F +V NVL +W D  + D+C WRGV+C N    +    
Sbjct  25   VSFGYGDSQNDQGRTLLGIKKAFRDVDNVLYEWTDSPSLDYCVWRGVTCDNSLNVIALNL  84

Query  442  lsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPF  621
                  GGEIS  IGDL +LQSIDL+GN L+GQIPDEIG+C +L  LDLS N ++GDIPF
Sbjct  85   SGLNL-GGEISSVIGDLESLQSIDLRGNHLSGQIPDEIGDCXALXNLDLSFNEIFGDIPF  143

Query  622  SI  627
            SI
Sbjct  144  SI  145



>ref|XP_011019342.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Populus euphratica]
Length=980

 Score =   105 bits (261),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 71/112 (63%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +1

Query  292  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  471
            D+G TL+ IK+SF +V NVL DW D  + D C WRGV C N +  V++LNLS LNL GEI
Sbjct  24   DDGATLLEIKKSFRDVDNVLYDWTDSPSSDCCVWRGVICDNVTYYVIALNLSGLNLEGEI  83

Query  472  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            SPAIG+L++L SIDL+GN+L+GQIPDEIG+C SL  LDLS N + GDIPFSI
Sbjct  84   SPAIGNLKDLTSIDLKGNRLSGQIPDEIGDCSSLQDLDLSFNEINGDIPFSI  135



>ref|XP_004964941.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X1 [Setaria italica]
Length=996

 Score =   105 bits (261),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 72/112 (64%), Positives = 86/112 (77%), Gaps = 3/112 (3%)
 Frame = +1

Query  292  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  471
            D+G TL+ IK+SF NV NVL DW     +D+CSWRGV C N + +V +LNLS LNLGGEI
Sbjct  32   DDGSTLLEIKKSFRNVGNVLYDW---AGDDYCSWRGVVCDNVTFAVAALNLSGLNLGGEI  88

Query  472  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            SPA+G L++L SIDL+ N L+GQIPDEIG+C SL  LDLS N L GDIPFSI
Sbjct  89   SPAVGSLKSLSSIDLKSNGLSGQIPDEIGDCSSLRTLDLSFNNLDGDIPFSI  140



>ref|XP_004964942.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X2 [Setaria italica]
Length=990

 Score =   105 bits (261),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 72/112 (64%), Positives = 86/112 (77%), Gaps = 3/112 (3%)
 Frame = +1

Query  292  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  471
            D+G TL+ IK+SF NV NVL DW     +D+CSWRGV C N + +V +LNLS LNLGGEI
Sbjct  32   DDGSTLLEIKKSFRNVGNVLYDW---AGDDYCSWRGVVCDNVTFAVAALNLSGLNLGGEI  88

Query  472  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            SPA+G L++L SIDL+ N L+GQIPDEIG+C SL  LDLS N L GDIPFSI
Sbjct  89   SPAVGSLKSLSSIDLKSNGLSGQIPDEIGDCSSLRTLDLSFNNLDGDIPFSI  140



>ref|XP_010227884.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X2 [Brachypodium distachyon]
Length=977

 Score =   105 bits (261),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 71/114 (62%), Positives = 87/114 (76%), Gaps = 3/114 (3%)
 Frame = +1

Query  286  IGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGG  465
            +GD+G TL+ IK+SF NV NVL DW     +D+CSWRGV C N + +V +LNLS LNL G
Sbjct  25   VGDDGSTLLEIKKSFRNVENVLYDWS---GDDYCSWRGVLCDNVTFAVAALNLSGLNLEG  81

Query  466  EISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            EISPA+G L++L SIDL+ N LTGQIPDEIG+C S+  LDLS N L GDIPFS+
Sbjct  82   EISPAVGSLKSLVSIDLKSNGLTGQIPDEIGDCSSIKTLDLSFNNLDGDIPFSV  135



>ref|XP_003564133.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X1 [Brachypodium distachyon]
Length=978

 Score =   105 bits (261),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 71/114 (62%), Positives = 87/114 (76%), Gaps = 3/114 (3%)
 Frame = +1

Query  286  IGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGG  465
            +GD+G TL+ IK+SF NV NVL DW     +D+CSWRGV C N + +V +LNLS LNL G
Sbjct  25   VGDDGSTLLEIKKSFRNVENVLYDWS---GDDYCSWRGVLCDNVTFAVAALNLSGLNLEG  81

Query  466  EISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            EISPA+G L++L SIDL+ N LTGQIPDEIG+C S+  LDLS N L GDIPFS+
Sbjct  82   EISPAVGSLKSLVSIDLKSNGLTGQIPDEIGDCSSIKTLDLSFNNLDGDIPFSV  135



>gb|AFW86034.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=1007

 Score =   104 bits (260),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 75/114 (66%), Positives = 89/114 (78%), Gaps = 3/114 (3%)
 Frame = +1

Query  289  GD-EGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGG  465
            GD +G+ LM++K  F N AN L DWD     D C+WRGV+C   S +VV LNLSNLNLGG
Sbjct  29   GDGDGQALMAVKAGFRNAANALADWDG--GRDHCAWRGVACDAASFAVVGLNLSNLNLGG  86

Query  466  EISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            EISPAIG L++LQ +DL+ N+LTGQIPDEIG+C+SL  LDLS NLLYGDIPFSI
Sbjct  87   EISPAIGQLKSLQFVDLKLNKLTGQIPDEIGDCVSLKYLDLSGNLLYGDIPFSI  140



>ref|XP_004964421.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2-like [Setaria italica]
Length=978

 Score =   104 bits (260),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 75/114 (66%), Positives = 91/114 (80%), Gaps = 3/114 (3%)
 Frame = +1

Query  289  GD-EGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGG  465
            GD E + LM++K  F N AN L+DWD     D C+WRGV+C + S +VV LNLSNLNLGG
Sbjct  27   GDGERRALMAVKAGFGNAANALVDWDG--GRDHCAWRGVACDSASFAVVGLNLSNLNLGG  84

Query  466  EISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            EISPAIG+L++LQ +DL+ N+LTGQIPDEIG+C+SL  LDLS NLLYGDIPFSI
Sbjct  85   EISPAIGELKSLQFVDLKLNKLTGQIPDEIGDCVSLKYLDLSGNLLYGDIPFSI  138



>ref|NP_001056687.1| Os06g0130100 [Oryza sativa Japonica Group]
 gb|AAQ01160.1| transmembrane protein kinase [Oryza sativa]
 dbj|BAF18601.1| Os06g0130100 [Oryza sativa Japonica Group]
Length=999

 Score =   104 bits (259),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +1

Query  301  KTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPA  480
            K LM +K  F N AN L+DWD     D C+WRGV+C N S +V++LNLSNLNLGGEISPA
Sbjct  37   KALMGVKAGFGNAANALVDWDG--GADHCAWRGVTCDNASFAVLALNLSNLNLGGEISPA  94

Query  481  IGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            IG+L+NLQ +DL+GN+LTGQIPDEIG+CISL  LDLS NLLYGDIPFSI
Sbjct  95   IGELKNLQFVDLKGNKLTGQIPDEIGDCISLKYLDLSGNLLYGDIPFSI  143



>gb|ACY07616.1| stress-induced protein kinase [Oryza sativa Japonica Group]
Length=980

 Score =   104 bits (259),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 75/109 (69%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +1

Query  301  KTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPA  480
            K LM +K  F N AN L+DWD     D C+WRGVSC N S +V++LNLS+LNLGGEISPA
Sbjct  37   KALMGVKAGFGNAANALVDWDG--GADHCAWRGVSCENASFAVLALNLSDLNLGGEISPA  94

Query  481  IGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            IG+L+NLQ +DL+GN+L+GQIPDEIG+CISL  LDLS NLLYGDIPFSI
Sbjct  95   IGELKNLQFVDLKGNKLSGQIPDEIGDCISLQYLDLSGNLLYGDIPFSI  143



>ref|XP_008658489.1| PREDICTED: uncharacterized protein LOC100279811 isoform X1 [Zea 
mays]
 gb|AFW86035.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=985

 Score =   104 bits (259),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 75/114 (66%), Positives = 89/114 (78%), Gaps = 3/114 (3%)
 Frame = +1

Query  289  GD-EGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGG  465
            GD +G+ LM++K  F N AN L DWD     D C+WRGV+C   S +VV LNLSNLNLGG
Sbjct  29   GDGDGQALMAVKAGFRNAANALADWDG--GRDHCAWRGVACDAASFAVVGLNLSNLNLGG  86

Query  466  EISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            EISPAIG L++LQ +DL+ N+LTGQIPDEIG+C+SL  LDLS NLLYGDIPFSI
Sbjct  87   EISPAIGQLKSLQFVDLKLNKLTGQIPDEIGDCVSLKYLDLSGNLLYGDIPFSI  140



>gb|AFJ14786.1| ERECTA-like kinase [Oryza sativa Japonica Group]
Length=986

 Score =   103 bits (258),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 72/113 (64%), Positives = 89/113 (79%), Gaps = 1/113 (1%)
 Frame = +1

Query  292  DEGKTLMSIKESFSNVANVLLDW-DDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGE  468
            D+G+TL+ IK+SF NV NVL DW  D     +CSWRGV C N + +V +LNLS LNLGGE
Sbjct  23   DDGQTLLEIKKSFRNVDNVLYDWAGDGAPRRYCSWRGVLCDNVTFAVAALNLSGLNLGGE  82

Query  469  ISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            ISPAIG+L++++SIDL+ N+L+GQIPDEIG+C SL  LDLS N L GDIPFSI
Sbjct  83   ISPAIGNLKSVESIDLKSNELSGQIPDEIGDCTSLKTLDLSSNNLGGDIPFSI  135



>ref|XP_002436407.1| hypothetical protein SORBIDRAFT_10g001970 [Sorghum bicolor]
 gb|EER87774.1| hypothetical protein SORBIDRAFT_10g001970 [Sorghum bicolor]
Length=978

 Score =   103 bits (257),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 73/109 (67%), Positives = 86/109 (79%), Gaps = 2/109 (2%)
 Frame = +1

Query  301  KTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPA  480
            +TLM++K  F N AN L DWD     D C+WRGV+C   S +VV LNLSNLNLGGEISPA
Sbjct  31   QTLMAVKAGFGNAANALADWDG--GRDHCAWRGVACDAASFAVVGLNLSNLNLGGEISPA  88

Query  481  IGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            IG L++LQ +DL+ N+LTGQIPDEIG+C+SL  LDLS NLLYGDIPFSI
Sbjct  89   IGQLKSLQFVDLKLNKLTGQIPDEIGDCVSLKYLDLSGNLLYGDIPFSI  137



>ref|XP_003561134.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Brachypodium distachyon]
Length=943

 Score =   103 bits (256),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 70/106 (66%), Positives = 89/106 (84%), Gaps = 1/106 (1%)
 Frame = +1

Query  310  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  489
            M++K  F N AN L+DWD    + +C+WRGV+C N S +V++LNLSNLNLGGEISPA+G+
Sbjct  1    MAVKAGFGNAANALVDWDG-GRDHYCAWRGVTCDNASFAVLALNLSNLNLGGEISPAVGE  59

Query  490  LRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            L++LQ +DL+GN+LTGQIPDEIG+C+SL  LDLS NLLYGDIPFSI
Sbjct  60   LKSLQLVDLKGNKLTGQIPDEIGDCVSLKYLDLSFNLLYGDIPFSI  105



>ref|XP_008393579.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Malus domestica]
Length=991

 Score =   103 bits (256),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 63/122 (52%), Positives = 81/122 (66%), Gaps = 2/122 (2%)
 Frame = +1

Query  262  LSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvsln  441
            +SF       D+G TL+ IK++F +V NVL +W D  + D+C WRGV+C N    +    
Sbjct  25   MSFGYGDSQNDQG-TLLEIKKAFRDVDNVLYEWTDPPSLDYCVWRGVTCDNSLNVIALNL  83

Query  442  lsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPF  621
                  GGEIS  IGDL NLQSIDL+GN L+GQIPDEIG+C +L  +DLS N ++GDIPF
Sbjct  84   SGLNL-GGEISSVIGDLENLQSIDLRGNHLSGQIPDEIGDCSALQNIDLSFNEIFGDIPF  142

Query  622  SI  627
            SI
Sbjct  143  SI  144



>ref|XP_006649092.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Oryza brachyantha]
Length=999

 Score =   102 bits (253),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 70/113 (62%), Positives = 88/113 (78%), Gaps = 1/113 (1%)
 Frame = +1

Query  292  DEGKTLMSIKESFSNVANVLLDWD-DVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGE  468
            D+G+TL+ IK+SF NV NVL DW  D   + +CSWRGV C N + +V +LNLS LNLGGE
Sbjct  35   DDGRTLLEIKKSFRNVDNVLYDWSGDGAPQRYCSWRGVLCDNVTFAVAALNLSGLNLGGE  94

Query  469  ISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            ISPAIG+L+++ SID + N+L+GQIPDEIG+C SL  LDLS N L GDIPFS+
Sbjct  95   ISPAIGNLKSVVSIDFKSNELSGQIPDEIGDCTSLKTLDLSSNNLEGDIPFSM  147



>gb|EYU32328.1| hypothetical protein MIMGU_mgv1a000790mg [Erythranthe guttata]
Length=985

 Score =   101 bits (251),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 69/108 (64%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = +1

Query  304  TLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAI  483
            TL+ +K+SF +V NVL DW +  + D+C WRG+ C N + +VV+LNLS LNL GEISPAI
Sbjct  32   TLVEVKKSFRDVDNVLYDWTESPSSDYCVWRGILCDNVTFNVVALNLSGLNLDGEISPAI  91

Query  484  GDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            G L+ L SIDL+GN+LTGQIPDEIG+C +L  LDLS N LYGDIPFSI
Sbjct  92   GLLKGLVSIDLRGNRLTGQIPDEIGDCSNLESLDLSFNELYGDIPFSI  139



>ref|XP_007161049.1| hypothetical protein PHAVU_001G038400g [Phaseolus vulgaris]
 gb|ESW33043.1| hypothetical protein PHAVU_001G038400g [Phaseolus vulgaris]
Length=958

 Score =   101 bits (251),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 69/118 (58%), Positives = 90/118 (76%), Gaps = 0/118 (0%)
 Frame = +1

Query  274  LTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnl  453
            + S   D+G TL+ +K+ F +V NVL DW D  + D+C+WRG++C N + +VV+LNLS L
Sbjct  18   VNSVESDDGATLLEMKKLFRDVDNVLYDWTDSPSSDYCAWRGITCDNVTFNVVALNLSGL  77

Query  454  nlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            NL GEISPAIG L++L SIDL+ N+L+GQIPDEIG+C SL  LDLS N + GDIPFSI
Sbjct  78   NLDGEISPAIGKLQSLVSIDLRENRLSGQIPDEIGDCSSLKNLDLSFNEIRGDIPFSI  135



>ref|XP_006656743.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Oryza brachyantha]
Length=979

 Score =   100 bits (250),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 70/112 (63%), Positives = 85/112 (76%), Gaps = 3/112 (3%)
 Frame = +1

Query  292  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  471
            D+G TL+ IK+SF NV NVL DW      D+CSWRGV C N + +V +LNLS LNLGGEI
Sbjct  26   DDGSTLLEIKKSFRNVDNVLYDW---AGADYCSWRGVLCDNVTFAVAALNLSGLNLGGEI  82

Query  472  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            SPA+G L+NL S+DL+ N L+GQIPDEIG+C SL  +DLS N L GDIPFS+
Sbjct  83   SPAVGRLKNLVSMDLELNGLSGQIPDEIGDCSSLKTVDLSFNSLDGDIPFSV  134



>gb|AFW86033.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=550

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 87/111 (78%), Gaps = 2/111 (2%)
 Frame = +1

Query  295  EGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEIS  474
            +G+ LM++K  F N AN L DWD     D C+WRGV+C   S +VV LNLSNLNLGGEIS
Sbjct  32   DGQALMAVKAGFRNAANALADWDG--GRDHCAWRGVACDAASFAVVGLNLSNLNLGGEIS  89

Query  475  PAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            PAIG L++LQ +DL+ N+LTGQIPDEIG+C+SL  LDLS NLLYGDIPFSI
Sbjct  90   PAIGQLKSLQFVDLKLNKLTGQIPDEIGDCVSLKYLDLSGNLLYGDIPFSI  140



>gb|AFW86032.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=508

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 87/111 (78%), Gaps = 2/111 (2%)
 Frame = +1

Query  295  EGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEIS  474
            +G+ LM++K  F N AN L DWD     D C+WRGV+C   S +VV LNLSNLNLGGEIS
Sbjct  32   DGQALMAVKAGFRNAANALADWDG--GRDHCAWRGVACDAASFAVVGLNLSNLNLGGEIS  89

Query  475  PAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            PAIG L++LQ +DL+ N+LTGQIPDEIG+C+SL  LDLS NLLYGDIPFSI
Sbjct  90   PAIGQLKSLQFVDLKLNKLTGQIPDEIGDCVSLKYLDLSGNLLYGDIPFSI  140



>gb|AFW86031.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=944

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 87/111 (78%), Gaps = 2/111 (2%)
 Frame = +1

Query  295  EGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEIS  474
            +G+ LM++K  F N AN L DWD     D C+WRGV+C   S +VV LNLSNLNLGGEIS
Sbjct  32   DGQALMAVKAGFRNAANALADWDG--GRDHCAWRGVACDAASFAVVGLNLSNLNLGGEIS  89

Query  475  PAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            PAIG L++LQ +DL+ N+LTGQIPDEIG+C+SL  LDLS NLLYGDIPFSI
Sbjct  90   PAIGQLKSLQFVDLKLNKLTGQIPDEIGDCVSLKYLDLSGNLLYGDIPFSI  140



>ref|XP_002438023.1| hypothetical protein SORBIDRAFT_10g006670 [Sorghum bicolor]
 gb|EER89390.1| hypothetical protein SORBIDRAFT_10g006670 [Sorghum bicolor]
Length=982

 Score =   100 bits (248),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 70/112 (63%), Positives = 84/112 (75%), Gaps = 3/112 (3%)
 Frame = +1

Query  292  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  471
            D+G TL+ IK+SF NV NVL DW     +D+CSWRGV C N + +V +LNLS LNL GEI
Sbjct  29   DDGATLVEIKKSFRNVGNVLYDW---AGDDYCSWRGVLCDNVTFAVAALNLSGLNLEGEI  85

Query  472  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            SPA+G L++L SIDL+ N L+GQIPDEIG+C SL  LD S N L GDIPFSI
Sbjct  86   SPAVGSLKSLVSIDLKSNGLSGQIPDEIGDCSSLRTLDFSFNNLDGDIPFSI  137



>ref|XP_004498861.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X3 [Cicer arietinum]
Length=959

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 69/108 (64%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +1

Query  304  TLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAI  483
            TL+ IK+SF +V NVL DW +    D+C+WRG+SC N + +VV+LNLS LNL GEISPAI
Sbjct  4    TLLEIKKSFRDVDNVLYDWTNSPTSDYCAWRGISCDNVTFNVVALNLSGLNLEGEISPAI  63

Query  484  GDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            G L++L SIDL+ N+L+GQIPDEIG+C SLI LDLS N + GDIPFSI
Sbjct  64   GSLQSLVSIDLKENRLSGQIPDEIGDCSSLISLDLSFNEIRGDIPFSI  111



>ref|XP_007161048.1| hypothetical protein PHAVU_001G038400g [Phaseolus vulgaris]
 gb|ESW33042.1| hypothetical protein PHAVU_001G038400g [Phaseolus vulgaris]
Length=744

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 90/118 (76%), Gaps = 0/118 (0%)
 Frame = +1

Query  274  LTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnl  453
            + S   D+G TL+ +K+ F +V NVL DW D  + D+C+WRG++C N + +VV+LNLS L
Sbjct  18   VNSVESDDGATLLEMKKLFRDVDNVLYDWTDSPSSDYCAWRGITCDNVTFNVVALNLSGL  77

Query  454  nlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            NL GEISPAIG L++L SIDL+ N+L+GQIPDEIG+C SL  LDLS N + GDIPFSI
Sbjct  78   NLDGEISPAIGKLQSLVSIDLRENRLSGQIPDEIGDCSSLKNLDLSFNEIRGDIPFSI  135



>ref|XP_003522304.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X1 [Glycine max]
 gb|KHN29675.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Glycine 
soja]
Length=985

 Score = 99.0 bits (245),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 66/111 (59%), Positives = 86/111 (77%), Gaps = 0/111 (0%)
 Frame = +1

Query  295  EGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEIS  474
            +G+TL+ IK+SFS+V NVL DW D  + D+C WRGV+C N + +VV+LNLS LNL GEIS
Sbjct  26   DGETLLEIKKSFSDVDNVLYDWTDSPSSDYCVWRGVTCDNVTFNVVALNLSGLNLEGEIS  85

Query  475  PAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            P IG L +L SID + N+L+GQIPDE+G+C SL  +DLS N + GDIPFS+
Sbjct  86   PVIGRLNSLVSIDFKENRLSGQIPDELGDCSSLKSIDLSFNEIRGDIPFSV  136



>ref|XP_006578096.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X2 [Glycine max]
Length=992

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 66/111 (59%), Positives = 86/111 (77%), Gaps = 0/111 (0%)
 Frame = +1

Query  295  EGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEIS  474
            +G+TL+ IK+SFS+V NVL DW D  + D+C WRGV+C N + +VV+LNLS LNL GEIS
Sbjct  26   DGETLLEIKKSFSDVDNVLYDWTDSPSSDYCVWRGVTCDNVTFNVVALNLSGLNLEGEIS  85

Query  475  PAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            P IG L +L SID + N+L+GQIPDE+G+C SL  +DLS N + GDIPFS+
Sbjct  86   PVIGRLNSLVSIDFKENRLSGQIPDELGDCSSLKSIDLSFNEIRGDIPFSV  136



>gb|AGL91674.1| erecta-like leucine-rich-repeat receptor-like kinase [Triticum 
aestivum]
Length=981

 Score = 98.6 bits (244),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 85/106 (80%), Gaps = 2/106 (2%)
 Frame = +1

Query  310  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  489
            M++K  F N AN L DWD     D C+WRGV+C   S +V+SLNLSNLNLGGEISPAIG+
Sbjct  38   MAVKAGFGNAANALADWDG--GRDHCAWRGVACDANSFAVLSLNLSNLNLGGEISPAIGE  95

Query  490  LRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            L+ LQ +DL+GN+LTGQIPDEIG+C+SL  LDLS NLLYGDIPFSI
Sbjct  96   LKALQFVDLKGNRLTGQIPDEIGDCVSLKYLDLSFNLLYGDIPFSI  141



>gb|AGT17158.1| ERECTA-like 2 [Saccharum hybrid cultivar R570]
Length=986

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 71/107 (66%), Positives = 82/107 (77%), Gaps = 2/107 (2%)
 Frame = +1

Query  307  LMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIG  486
            LM++K  F N AN L DWD     D C+WRGV+C   S +VV LNLSNLNLGGEISP IG
Sbjct  41   LMAVKAGFGNAANALADWDG--GRDHCAWRGVACDAASFAVVGLNLSNLNLGGEISPVIG  98

Query  487  DLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
             L+NLQ +DL+ N+LTGQIPDEIG+C+SL  LDLS NLL GDIPFSI
Sbjct  99   QLKNLQFVDLKLNKLTGQIPDEIGDCVSLKYLDLSGNLLNGDIPFSI  145



>gb|EEC74102.1| hypothetical protein OsI_09151 [Oryza sativa Indica Group]
Length=913

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 56/90 (62%), Positives = 72/90 (80%), Gaps = 1/90 (1%)
 Frame = +1

Query  292  DEGKTLMSIKESFSNVANVLLDW-DDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGE  468
            D+G+TL+ IK+SF NV NVL DW  D     +CSWRGV C N + +V +LNLS LNLGGE
Sbjct  23   DDGQTLLEIKKSFRNVDNVLYDWAGDGAPRRYCSWRGVLCDNVTFAVAALNLSGLNLGGE  82

Query  469  ISPAIGDLRNLQSIDLQGNQLTGQIPDEIG  558
            ISPAIG+L++++SIDL+ N+L+GQIPDEIG
Sbjct  83   ISPAIGNLKSVESIDLKSNELSGQIPDEIG  112



>ref|XP_008786642.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X3 [Phoenix dactylifera]
Length=960

 Score = 96.7 bits (239),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 77/154 (50%), Positives = 100/154 (65%), Gaps = 27/154 (18%)
 Frame = +1

Query  247  LALILLSFPLTSCI-GD----EGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCG  411
            LAL++L   L+S + GD    +G TL+ IK+SF NV NVL DW +    D+CSWRGV+C 
Sbjct  9    LALLVLFGVLSSAVVGDTGTNDGATLLEIKKSFRNVENVLYDWTEATGSDYCSWRGVTCD  68

Query  412  nfsmsvvslnlsnlnlGGEISPAIGDLRNLQSI----------------------DLQGN  525
            N + +VV+LNLS LNL GEI+PA G+L+ L S+                      DL+ N
Sbjct  69   NITFNVVALNLSGLNLDGEIAPAFGNLKGLVSMYDLPSSVCFQDVDLSFLVSSFSDLKAN  128

Query  526  QLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            +L+GQIPDEIG+C SL +LDLS N +YGDIPFSI
Sbjct  129  RLSGQIPDEIGDCSSLKVLDLSFNNIYGDIPFSI  162



>gb|EEE57902.1| hypothetical protein OsJ_08587 [Oryza sativa Japonica Group]
Length=913

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 56/90 (62%), Positives = 72/90 (80%), Gaps = 1/90 (1%)
 Frame = +1

Query  292  DEGKTLMSIKESFSNVANVLLDW-DDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGE  468
            D+G+TL+ IK+SF NV NVL DW  D     +CSWRGV C N + +V +LNLS LNLGGE
Sbjct  23   DDGQTLLEIKKSFRNVDNVLYDWAGDGAPRRYCSWRGVLCDNVTFAVAALNLSGLNLGGE  82

Query  469  ISPAIGDLRNLQSIDLQGNQLTGQIPDEIG  558
            ISPAIG+L++++SIDL+ N+L+GQIPDEIG
Sbjct  83   ISPAIGNLKSVESIDLKSNELSGQIPDEIG  112



>ref|XP_008786639.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X1 [Phoenix dactylifera]
Length=1007

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 77/154 (50%), Positives = 100/154 (65%), Gaps = 27/154 (18%)
 Frame = +1

Query  247  LALILLSFPLTSCI-GD----EGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCG  411
            LAL++L   L+S + GD    +G TL+ IK+SF NV NVL DW +    D+CSWRGV+C 
Sbjct  9    LALLVLFGVLSSAVVGDTGTNDGATLLEIKKSFRNVENVLYDWTEATGSDYCSWRGVTCD  68

Query  412  nfsmsvvslnlsnlnlGGEISPAIGDLRNLQSI----------------------DLQGN  525
            N + +VV+LNLS LNL GEI+PA G+L+ L S+                      DL+ N
Sbjct  69   NITFNVVALNLSGLNLDGEIAPAFGNLKGLVSMYDLPSSVCFQDVDLSFLVSSFSDLKAN  128

Query  526  QLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            +L+GQIPDEIG+C SL +LDLS N +YGDIPFSI
Sbjct  129  RLSGQIPDEIGDCSSLKVLDLSFNNIYGDIPFSI  162



>gb|AAL68842.1|AF466199_1 putative receptor protein kinase [Sorghum bicolor]
Length=921

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 84/112 (75%), Gaps = 3/112 (3%)
 Frame = +1

Query  292  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  471
            D+G TL+ IK+SF NV NVL DW     +D+CSWRGV C N + +V +LNLS LNL GEI
Sbjct  21   DDGATLVEIKKSFRNVGNVLYDWA---GDDYCSWRGVLCDNVTFAVAALNLSGLNLEGEI  77

Query  472  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            SPA+G L++L SIDL+ N L+GQIPDEIG+C SL  LD S N L GDIPFSI
Sbjct  78   SPAVGSLKSLVSIDLKSNGLSGQIPDEIGDCSSLRTLDFSFNNLDGDIPFSI  129



>gb|AFC88469.1| ERECTA [Triticum aestivum]
Length=977

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 90/124 (73%), Gaps = 4/124 (3%)
 Frame = +1

Query  259  LLSFPLTS-CIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvs  435
            L++F L +    D+G TL+ IK+SF NV NVL DW      D+CSWRGV C N + +V +
Sbjct  14   LIAFLLVAGAAADDGSTLLEIKKSFRNVDNVLYDWA---GGDYCSWRGVLCDNVTFAVAA  70

Query  436  lnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDI  615
            LNLS LNLGGEISPA+G L+ + SIDL+ N L+GQIPDEIG+C SL  LDLS N L GDI
Sbjct  71   LNLSGLNLGGEISPAVGRLKGIVSIDLKSNGLSGQIPDEIGDCSSLKTLDLSFNSLDGDI  130

Query  616  PFSI  627
            PFS+
Sbjct  131  PFSV  134



>gb|KEH39916.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=956

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 63/107 (59%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +1

Query  307  LMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIG  486
            ++ IK+SF +V NVL DW D    D+C+WRG++C N + +VV+LNLS LNL GEISP IG
Sbjct  1    MLEIKKSFRDVDNVLYDWTDSPTSDYCAWRGITCDNVTFNVVALNLSGLNLDGEISPTIG  60

Query  487  DLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
             L++L SIDL+ N+L+GQIPDEIG+C  L  LD S N + GDIPFSI
Sbjct  61   KLQSLVSIDLKQNRLSGQIPDEIGDCSLLQTLDFSFNEIRGDIPFSI  107



>ref|XP_006581305.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Glycine max]
 gb|KHN32167.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Glycine 
soja]
Length=984

 Score = 95.5 bits (236),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 65/110 (59%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = +1

Query  298  GKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISP  477
            G+TL+ IK+ F +V NVL DW D  + D+C WRGV+C N + +VV+LNLS LNL GEISP
Sbjct  27   GETLLEIKKWFRDVDNVLYDWTDSTSSDYCVWRGVTCDNVTFNVVALNLSGLNLEGEISP  86

Query  478  AIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            AIG L +L SID + N+L+GQIPDE+G+C SL  +DLS N + GDIPFS+
Sbjct  87   AIGRLNSLISIDFKENRLSGQIPDELGDCSSLKSIDLSFNEIRGDIPFSV  136



>gb|EEC80197.1| hypothetical protein OsI_22078 [Oryza sativa Indica Group]
Length=930

 Score = 95.5 bits (236),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 84/112 (75%), Gaps = 3/112 (3%)
 Frame = +1

Query  292  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  471
            D+G TL+ IK+SF NV NVL DW      D+CSWRGV C N + +V +LNLS LNLGGEI
Sbjct  25   DDGSTLLEIKKSFRNVDNVLYDW---AGGDYCSWRGVLCDNVTFAVAALNLSGLNLGGEI  81

Query  472  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            SPA+G L+ + SIDL+ N L+GQIPDEIG+C SL  LDLS N L GDIPFS+
Sbjct  82   SPAVGRLKGIVSIDLKSNGLSGQIPDEIGDCSSLKTLDLSFNSLDGDIPFSV  133



>ref|NP_001057087.1| Os06g0203800 [Oryza sativa Japonica Group]
 dbj|BAD35990.1| putative receptor protein kinase [Oryza sativa Japonica Group]
 dbj|BAF19001.1| Os06g0203800 [Oryza sativa Japonica Group]
Length=978

 Score = 95.1 bits (235),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 84/112 (75%), Gaps = 3/112 (3%)
 Frame = +1

Query  292  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  471
            D+G TL+ IK+SF NV NVL DW      D+CSWRGV C N + +V +LNLS LNLGGEI
Sbjct  25   DDGSTLLEIKKSFRNVDNVLYDW---AGGDYCSWRGVLCDNVTFAVAALNLSGLNLGGEI  81

Query  472  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            SPA+G L+ + SIDL+ N L+GQIPDEIG+C SL  LDLS N L GDIPFS+
Sbjct  82   SPAVGRLKGIVSIDLKSNGLSGQIPDEIGDCSSLKTLDLSFNSLDGDIPFSV  133



>gb|EPS61595.1| hypothetical protein M569_13200, partial [Genlisea aurea]
Length=612

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = +1

Query  286  IGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGG  465
            I  EG+TL  I++S  +V +VL DW D  + D+C+WRGVSC N + SVV+LNLS LNL G
Sbjct  1    IRGEGETLREIQKSIRDVNSVLYDWSDSPSSDYCAWRGVSCDNVTFSVVALNLSGLNLEG  60

Query  466  EISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            EISP+IG L+ L SIDL+ N L+GQIPDEIG+C +L  LDLS N L GDIPFSI
Sbjct  61   EISPSIGKLKALVSIDLKANLLSGQIPDEIGDCSALKSLDLSFNQLRGDIPFSI  114



>ref|XP_007136889.1| hypothetical protein PHAVU_009G082500g [Phaseolus vulgaris]
 gb|ESW08883.1| hypothetical protein PHAVU_009G082500g [Phaseolus vulgaris]
Length=958

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 65/111 (59%), Positives = 84/111 (76%), Gaps = 0/111 (0%)
 Frame = +1

Query  295  EGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEIS  474
            +G TL  +K+S  +V NVL DW D  + D+C WRGV+C N + +VV+LNLS LNL GEIS
Sbjct  22   DGATLWEMKKSLRDVDNVLFDWTDTPSSDYCLWRGVTCDNVTYNVVALNLSGLNLEGEIS  81

Query  475  PAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            PA+G L +L SIDL+ N+L+GQIPDE+G+C SL  +DLS N + GDIPFSI
Sbjct  82   PALGRLSSLVSIDLKENRLSGQIPDELGDCSSLKNVDLSFNEIRGDIPFSI  132



>gb|EMS63677.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Triticum 
urartu]
Length=922

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 67/110 (61%), Positives = 81/110 (74%), Gaps = 3/110 (3%)
 Frame = +1

Query  298  GKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISP  477
            G  L+ +K+SF NV NVL DW     +D CSWRGV C N + +V +LNLS LNL GEISP
Sbjct  12   GAALLEVKKSFRNVGNVLYDWS---GDDHCSWRGVLCDNVTFAVAALNLSGLNLEGEISP  68

Query  478  AIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            A+G L++L SIDL+ N LTGQIPDEIG+C S+  LDLS N L GDIPFS+
Sbjct  69   AVGALKSLVSIDLKSNGLTGQIPDEIGDCSSIKTLDLSFNNLDGDIPFSV  118



>ref|XP_002982573.1| hypothetical protein SELMODRAFT_155267 [Selaginella moellendorffii]
 gb|EFJ16326.1| hypothetical protein SELMODRAFT_155267 [Selaginella moellendorffii]
Length=977

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 61/110 (55%), Positives = 80/110 (73%), Gaps = 0/110 (0%)
 Frame = +1

Query  298  GKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISP  477
            G  L+ IK+S +N  NVL DW+   + D C WRGVSC N +++V+ LNL+ L L GEISP
Sbjct  14   GVVLLEIKKSLNNADNVLYDWEGAIDRDPCFWRGVSCDNVTLAVIGLNLTQLGLSGEISP  73

Query  478  AIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            A G L++LQ +DL+ N L+GQIPDEIG C++L  +DLS N  +GDIPFSI
Sbjct  74   AFGRLKSLQYLDLRENSLSGQIPDEIGQCVNLKTIDLSFNAFHGDIPFSI  123



>ref|XP_002981099.1| hypothetical protein SELMODRAFT_114051 [Selaginella moellendorffii]
 gb|EFJ17800.1| hypothetical protein SELMODRAFT_114051 [Selaginella moellendorffii]
Length=976

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 61/110 (55%), Positives = 80/110 (73%), Gaps = 0/110 (0%)
 Frame = +1

Query  298  GKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISP  477
            G  L+ IK+S +N  NVL DW+   + D C WRGVSC N +++V+ LNL+ L L GEISP
Sbjct  14   GVVLLEIKKSLNNADNVLYDWEGAIDRDPCFWRGVSCDNVTLAVIGLNLTQLGLSGEISP  73

Query  478  AIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            A G L++LQ +DL+ N L+GQIPDEIG C++L  +DLS N  +GDIPFSI
Sbjct  74   AFGRLKSLQYLDLRENSLSGQIPDEIGQCVNLKTIDLSFNAFHGDIPFSI  123



>gb|EEE65279.1| hypothetical protein OsJ_20503 [Oryza sativa Japonica Group]
Length=882

 Score = 92.4 bits (228),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 55/89 (62%), Positives = 67/89 (75%), Gaps = 3/89 (3%)
 Frame = +1

Query  292  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  471
            D+G TL+ IK+SF NV NVL DW      D+CSWRGV C N + +V +LNLS LNLGGEI
Sbjct  25   DDGSTLLEIKKSFRNVDNVLYDW---AGGDYCSWRGVLCDNVTFAVAALNLSGLNLGGEI  81

Query  472  SPAIGDLRNLQSIDLQGNQLTGQIPDEIG  558
            SPA+G L+ + SIDL+ N L+GQIPDEIG
Sbjct  82   SPAVGRLKGIVSIDLKSNGLSGQIPDEIG  110



>gb|EYU20292.1| hypothetical protein MIMGU_mgv1a026417mg, partial [Erythranthe 
guttata]
Length=953

 Score = 92.4 bits (228),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 65/107 (61%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +1

Query  307  LMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIG  486
            L+ +K+SF +V NVL DW D  + D C WRGV+C N + +V++LNLS LNL GEIS +IG
Sbjct  3    LVEVKKSFRDVDNVLYDWTDSPSSDCCVWRGVTCDNVTFNVLALNLSGLNLEGEISSSIG  62

Query  487  DLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
             L+ L ++DL+GN+L+GQIPD+IG+C SLI LDLS N LYGDIPFSI
Sbjct  63   QLKALLTLDLKGNRLSGQIPDDIGDCSSLISLDLSFNELYGDIPFSI  109



>gb|KJB65473.1| hypothetical protein B456_010G096300 [Gossypium raimondii]
Length=978

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 72/112 (64%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +1

Query  292  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  471
            ++G TL+ IK+ F +V NVL DW D  + D+C WRGV+C N + +VV+LNLS+LNL GEI
Sbjct  27   EDGATLLEIKKFFRDVDNVLYDWSDTPSSDYCVWRGVTCDNVTFNVVALNLSDLNLDGEI  86

Query  472  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            SPAIGDLR+L S+DL+GN+L+GQIPDE+G+C SL  LDLS N LYGDIPFSI
Sbjct  87   SPAIGDLRDLLSLDLRGNRLSGQIPDEMGDCSSLKSLDLSFNELYGDIPFSI  138



>gb|KJB65472.1| hypothetical protein B456_010G096300 [Gossypium raimondii]
Length=972

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 72/112 (64%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +1

Query  292  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  471
            ++G TL+ IK+ F +V NVL DW D  + D+C WRGV+C N + +VV+LNLS+LNL GEI
Sbjct  27   EDGATLLEIKKFFRDVDNVLYDWSDTPSSDYCVWRGVTCDNVTFNVVALNLSDLNLDGEI  86

Query  472  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            SPAIGDLR+L S+DL+GN+L+GQIPDE+G+C SL  LDLS N LYGDIPFSI
Sbjct  87   SPAIGDLRDLLSLDLRGNRLSGQIPDEMGDCSSLKSLDLSFNELYGDIPFSI  138



>gb|KJB65471.1| hypothetical protein B456_010G096300 [Gossypium raimondii]
Length=971

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 72/112 (64%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +1

Query  292  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  471
            ++G TL+ IK+ F +V NVL DW D  + D+C WRGV+C N + +VV+LNLS+LNL GEI
Sbjct  27   EDGATLLEIKKFFRDVDNVLYDWSDTPSSDYCVWRGVTCDNVTFNVVALNLSDLNLDGEI  86

Query  472  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            SPAIGDLR+L S+DL+GN+L+GQIPDE+G+C SL  LDLS N LYGDIPFSI
Sbjct  87   SPAIGDLRDLLSLDLRGNRLSGQIPDEMGDCSSLKSLDLSFNELYGDIPFSI  138



>ref|XP_002975149.1| hypothetical protein SELMODRAFT_102522, partial [Selaginella 
moellendorffii]
 gb|EFJ23934.1| hypothetical protein SELMODRAFT_102522, partial [Selaginella 
moellendorffii]
Length=944

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 60/110 (55%), Positives = 78/110 (71%), Gaps = 0/110 (0%)
 Frame = +1

Query  298  GKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISP  477
            G  L+ IK+SFSN  N L DWD   + D C WRGV+C N ++SV  LNL+ L+L G ISP
Sbjct  1    GAVLLEIKKSFSNAGNALYDWDGSADHDPCFWRGVTCDNVTLSVTGLNLTQLSLSGVISP  60

Query  478  AIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            ++G L++LQ +DL+ N + GQIPDEIG+C  L  +DLS N L GDIPFS+
Sbjct  61   SVGKLKSLQYLDLRENSIGGQIPDEIGDCAVLKYIDLSFNALVGDIPFSV  110



>ref|XP_008647408.1| PREDICTED: uncharacterized protein LOC100193598 isoform X2 [Zea 
mays]
Length=993

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 66/106 (62%), Positives = 79/106 (75%), Gaps = 3/106 (3%)
 Frame = +1

Query  310  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  489
            + IK+SF NV NVL DW     +D+CSWRGV C N + +V +LNLS LNL GEISPA+G 
Sbjct  40   VEIKKSFRNVGNVLYDW---AGDDYCSWRGVLCDNVTFAVAALNLSGLNLEGEISPAVGS  96

Query  490  LRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            L++L SIDL+ N L+GQIPDEIG+C SL  LD S N L GDIPFSI
Sbjct  97   LKSLVSIDLKSNGLSGQIPDEIGDCSSLRTLDFSFNNLDGDIPFSI  142



>ref|XP_008647407.1| PREDICTED: uncharacterized protein LOC100193598 isoform X1 [Zea 
mays]
 gb|ACN29076.1| unknown [Zea mays]
 gb|AFW76645.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=994

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 66/106 (62%), Positives = 79/106 (75%), Gaps = 3/106 (3%)
 Frame = +1

Query  310  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  489
            + IK+SF NV NVL DW     +D+CSWRGV C N + +V +LNLS LNL GEISPA+G 
Sbjct  40   VEIKKSFRNVGNVLYDW---AGDDYCSWRGVLCDNVTFAVAALNLSGLNLEGEISPAVGS  96

Query  490  LRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            L++L SIDL+ N L+GQIPDEIG+C SL  LD S N L GDIPFSI
Sbjct  97   LKSLVSIDLKSNGLSGQIPDEIGDCSSLRTLDFSFNNLDGDIPFSI  142



>gb|AFW76644.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=898

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 66/106 (62%), Positives = 79/106 (75%), Gaps = 3/106 (3%)
 Frame = +1

Query  310  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  489
            + IK+SF NV NVL DW     +D+CSWRGV C N + +V +LNLS LNL GEISPA+G 
Sbjct  40   VEIKKSFRNVGNVLYDW---AGDDYCSWRGVLCDNVTFAVAALNLSGLNLEGEISPAVGS  96

Query  490  LRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            L++L SIDL+ N L+GQIPDEIG+C SL  LD S N L GDIPFSI
Sbjct  97   LKSLVSIDLKSNGLSGQIPDEIGDCSSLRTLDFSFNNLDGDIPFSI  142



>ref|XP_002977553.1| hypothetical protein SELMODRAFT_107124, partial [Selaginella 
moellendorffii]
 gb|EFJ21557.1| hypothetical protein SELMODRAFT_107124, partial [Selaginella 
moellendorffii]
Length=944

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 59/110 (54%), Positives = 78/110 (71%), Gaps = 0/110 (0%)
 Frame = +1

Query  298  GKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISP  477
            G  L+ IK+SFSN  N L DWD   + D C WRGV+C N ++SV  LNL+ L+L G ISP
Sbjct  1    GAVLLEIKKSFSNAGNALYDWDGSADHDPCFWRGVTCDNVTLSVTGLNLTQLSLSGVISP  60

Query  478  AIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            ++G L++LQ +DL+ N + GQ+PDEIG+C  L  +DLS N L GDIPFS+
Sbjct  61   SVGKLKSLQYLDLRENSIGGQVPDEIGDCAVLKYIDLSFNALVGDIPFSV  110



>gb|EMT11370.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Aegilops 
tauschii]
Length=1019

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 65/104 (63%), Positives = 78/104 (75%), Gaps = 3/104 (3%)
 Frame = +1

Query  316  IKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLR  495
            +K+SF NV NVL DW     +D CSWRGV C N + +V +LNLS LNL GEISPA+G L+
Sbjct  34   VKKSFRNVGNVLYDWS---GDDHCSWRGVLCDNVTFAVAALNLSGLNLEGEISPAVGALK  90

Query  496  NLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            +L SIDL+ N LTGQIPDEIG+C S+  LDLS N L GDIPFS+
Sbjct  91   SLVSIDLKSNGLTGQIPDEIGDCSSIKTLDLSFNNLDGDIPFSV  134



>gb|AGL91671.1| erecta leucine-rich-repeat receptor-like kinase [Triticum aestivum]
Length=939

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 65/104 (63%), Positives = 78/104 (75%), Gaps = 3/104 (3%)
 Frame = +1

Query  316  IKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLR  495
            +K+SF NV NVL DW     +D CSWRGV C N + +V +LNLS LNL GEISPA+G L+
Sbjct  35   VKKSFRNVGNVLYDWS---GDDHCSWRGVLCDNVTFAVAALNLSGLNLEGEISPAVGALK  91

Query  496  NLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            +L SIDL+ N LTGQIPDEIG+C S+  LDLS N L GDIPFS+
Sbjct  92   SLVSIDLKSNGLTGQIPDEIGDCSSIKTLDLSFNNLDGDIPFSV  135



>gb|AFJ38187.2| receptor-like serine/threonine protein kinase 2 [Triticum aestivum]
Length=976

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 65/104 (63%), Positives = 78/104 (75%), Gaps = 3/104 (3%)
 Frame = +1

Query  316  IKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLR  495
            +K+SF NV NVL DW     +D CSWRGV C N + +V +LNLS LNL GEISPA+G L+
Sbjct  35   VKKSFRNVGNVLYDWS---GDDHCSWRGVLCDNVTFAVAALNLSGLNLEGEISPAVGALK  91

Query  496  NLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            +L SIDL+ N LTGQIPDEIG+C S+  LDLS N L GDIPFS+
Sbjct  92   SLVSIDLKSNGLTGQIPDEIGDCSSIKTLDLSFNNLDGDIPFSV  135



>gb|AGL91672.1| erecta leucine-rich-repeat receptor-like kinase [Triticum aestivum]
Length=976

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 65/104 (63%), Positives = 78/104 (75%), Gaps = 3/104 (3%)
 Frame = +1

Query  316  IKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLR  495
            +K+SF NV NVL DW     +D CSWRGV C N + +V +LNLS LNL GEISPA+G L+
Sbjct  35   VKKSFRNVGNVLYDWS---GDDHCSWRGVLCDNVTFAVAALNLSGLNLEGEISPAVGALK  91

Query  496  NLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            +L SIDL+ N LTGQIPDEIG+C S+  LDLS N L GDIPFS+
Sbjct  92   SLVSIDLKSNGLTGQIPDEIGDCSSIKTLDLSFNNLDGDIPFSV  135



>gb|AFJ38186.2| receptor-like serine/threonine protein kinase 1 [Triticum aestivum]
 gb|AGL91673.1| erecta leucine-rich-repeat receptor-like kinase [Triticum aestivum]
Length=975

 Score = 89.7 bits (221),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 64/104 (62%), Positives = 77/104 (74%), Gaps = 3/104 (3%)
 Frame = +1

Query  316  IKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLR  495
            +K+SF NV NVL DW     +D CSWRGV C N + +V +LNLS  NL GEISPA+G L+
Sbjct  34   VKKSFRNVGNVLYDWS---GDDHCSWRGVLCDNVTFAVAALNLSGFNLEGEISPAVGALK  90

Query  496  NLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            +L SIDL+ N LTGQIPDEIG+C S+  LDLS N L GDIPFS+
Sbjct  91   SLVSIDLKSNGLTGQIPDEIGDCSSIKTLDLSFNNLDGDIPFSV  134



>gb|AFW73724.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=999

 Score = 89.4 bits (220),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 66/113 (58%), Positives = 81/113 (72%), Gaps = 1/113 (1%)
 Frame = +1

Query  292  DEGKTLMSIKESFSNVANVLLDWD-DVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGE  468
            D+G+TL+ IK+SF +  N L DW  D  +  +CSWRGV C N + +V +LNLS LNL GE
Sbjct  25   DDGETLLEIKKSFRDGGNALYDWSGDGASPGYCSWRGVLCDNVTFAVAALNLSGLNLEGE  84

Query  469  ISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            IS AIG L+ L SIDL+ N L+GQIPDEIG+C  L  LDLS N L GDIPFS+
Sbjct  85   ISAAIGSLQRLVSIDLKSNGLSGQIPDEIGDCSLLETLDLSSNNLEGDIPFSM  137



>dbj|BAJ96098.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=977

 Score = 89.4 bits (220),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 65/104 (63%), Positives = 78/104 (75%), Gaps = 3/104 (3%)
 Frame = +1

Query  316  IKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLR  495
            +K+SF NV NVL DW     +D CSWRGV C N + +V +LNLS LNL GEISPA+G L+
Sbjct  34   VKKSFRNVGNVLYDWS---GDDHCSWRGVLCDNVTFAVTALNLSGLNLEGEISPAVGVLK  90

Query  496  NLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            +L SIDL+ N LTGQIPDEIG+C S+  LDLS N L GDIPFS+
Sbjct  91   SLVSIDLKSNGLTGQIPDEIGDCSSIKTLDLSFNNLDGDIPFSV  134



>dbj|BAK07025.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=977

 Score = 89.4 bits (220),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 65/104 (63%), Positives = 78/104 (75%), Gaps = 3/104 (3%)
 Frame = +1

Query  316  IKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLR  495
            +K+SF NV NVL DW     +D CSWRGV C N + +V +LNLS LNL GEISPA+G L+
Sbjct  34   VKKSFRNVGNVLYDWS---GDDHCSWRGVLCDNVTFAVTALNLSGLNLEGEISPAVGVLK  90

Query  496  NLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            +L SIDL+ N LTGQIPDEIG+C S+  LDLS N L GDIPFS+
Sbjct  91   SLVSIDLKSNGLTGQIPDEIGDCSSIKTLDLSFNNLDGDIPFSV  134



>ref|XP_010109086.1| hypothetical protein L484_012962 [Morus notabilis]
 gb|EXC20886.1| hypothetical protein L484_012962 [Morus notabilis]
Length=107

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 69/123 (56%), Gaps = 24/123 (20%)
 Frame = +1

Query  190  VEKVLFPGIRKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDV  369
            +E+  F   RK +     V+AL+LL  P+ S + DEGK LM+IK SFSNVANVLL W+D 
Sbjct  1    MEENAFLQWRKKDTNFLVVMALLLLLTPIASPLNDEGKALMAIKASFSNVANVLLGWNDD  60

Query  370  HNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPD  549
            H+ DFCSWRGV C N S+                        ++ S++L+ NQLTG IP 
Sbjct  61   HDGDFCSWRGVICDNVSL------------------------SVVSLNLKNNQLTGPIPS  96

Query  550  EIG  558
             + 
Sbjct  97   TLS  99



>gb|EMS68149.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Triticum 
urartu]
Length=847

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 62/116 (53%), Positives = 75/116 (65%), Gaps = 10/116 (9%)
 Frame = +1

Query  310  MSIKESFSNVANVLLDWD-DVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIG  486
            M IK+SF +  N L DW  D  +  +CSWRGV C N +  V +LNLS  NLGGEISPAIG
Sbjct  1    MEIKKSFHDADNALDDWSGDGASPGYCSWRGVLCDNVTFQVAALNLSGFNLGGEISPAIG  60

Query  487  DLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllY---------GDIPFSI  627
            DL++  SID Q + L+GQIPDEIG+C SL +L    + LY         GDIPFSI
Sbjct  61   DLKSGVSIDFQSSGLSGQIPDEIGDCSSLKMLCRIPSDLYKNLSSNNLEGDIPFSI  116



>emb|CAN74952.1| hypothetical protein VITISV_025649 [Vitis vinifera]
Length=756

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 73/125 (58%), Gaps = 26/125 (21%)
 Frame = +1

Query  280  SCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnl  459
            S + D+G TL+ IK+SF +V NVL DW D  + D+C WRGVSC N + +           
Sbjct  20   SVVSDDGATLLEIKKSFRDVDNVLYDWTDSPSSDYCVWRGVSCDNVTFN-----------  68

Query  460  GGEISPAIGDLRNLQSI---------DLQGNQLTGQIPDEIGncislilldlsdnllYGD  612
                   I  + +L+ I         DL GN+L+GQIPDEIG+C S+  LDLS N LYGD
Sbjct  69   ------VIALVSHLRVIVITMFCLISDLXGNRLSGQIPDEIGDCSSMSSLDLSFNELYGD  122

Query  613  IPFSI  627
            IPFSI
Sbjct  123  IPFSI  127



>gb|EEE65024.1| hypothetical protein OsJ_19993 [Oryza sativa Japonica Group]
Length=908

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +1

Query  301  KTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPA  480
            K LM +K  F N AN L+DWD     D C+WRGV+C N S +V++LNLSNLNLGGEISPA
Sbjct  37   KALMGVKAGFGNAANALVDWDG--GADHCAWRGVTCDNASFAVLALNLSNLNLGGEISPA  94

Query  481  IGDLRNLQSIDLQGNQLTGQIP  546
            IG+L+NLQ +DL GN L G IP
Sbjct  95   IGELKNLQFVDLSGNLLYGDIP  116



>ref|XP_010098375.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Morus 
notabilis]
 gb|EXB74899.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Morus 
notabilis]
Length=1011

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 56/138 (41%), Positives = 75/138 (54%), Gaps = 24/138 (17%)
 Frame = +1

Query  214  IRKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSW  393
            ++ M F +  VL   L      S   D+G TL+ IK+SF +V N L DW D  + D+C W
Sbjct  15   LKVMAFPVEFVLLAFLACAAFGSVDSDDGVTLLEIKKSFRDVDNDLYDWADSPSSDYCGW  74

Query  394  RGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncisl  573
            RGV+C N +                         ++ S+D +GN+L+GQIPDEIG+C SL
Sbjct  75   RGVTCDNVTF------------------------SVVSLDFRGNRLSGQIPDEIGDCSSL  110

Query  574  illdlsdnllYGDIPFSI  627
              LDLS N + GDIPFSI
Sbjct  111  TNLDLSFNEICGDIPFSI  128



>ref|XP_004955237.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Setaria italica]
Length=975

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 63/86 (73%), Gaps = 1/86 (1%)
 Frame = +1

Query  304  TLMSIKESFSNVANVLLDWD-DVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPA  480
            TL+ IK+SFSN  N L DW  +  +  +CSWRGV C N + +V +LNLS LNL GEISPA
Sbjct  25   TLLEIKKSFSNGGNALHDWSGEGASPTYCSWRGVLCDNVTFAVAALNLSGLNLEGEISPA  84

Query  481  IGDLRNLQSIDLQGNQLTGQIPDEIG  558
            IG L+ + SIDL+ N L+GQIPDEIG
Sbjct  85   IGSLKRVISIDLKSNGLSGQIPDEIG  110



>gb|AGL91675.1| erecta-like leucine-rich-repeat receptor-like kinase [Triticum 
aestivum]
Length=958

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 58/83 (70%), Gaps = 2/83 (2%)
 Frame = +1

Query  307  LMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIG  486
            LM++K  F N AN L DWD     D C+WRGV+C   S +V+SLNLSNLNLGGEISPAIG
Sbjct  35   LMTVKAGFGNAANALADWDG--GRDHCAWRGVACDANSFAVLSLNLSNLNLGGEISPAIG  92

Query  487  DLRNLQSIDLQGNQLTGQIPDEI  555
            +L+ LQ +DL  N L G IP  I
Sbjct  93   ELKALQFVDLSFNLLYGDIPFSI  115



>gb|KHG04654.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Gossypium 
arboreum]
Length=503

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 70/108 (65%), Gaps = 0/108 (0%)
 Frame = +1

Query  295  EGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEIS  474
             G TL+ IK+SF +V NVL DW D  + D+C WRGV+C N + +VV+L+L    L G+I 
Sbjct  8    RGTTLLEIKKSFKDVDNVLYDWTDTPSSDYCVWRGVTCDNMTFNVVALDLRGNRLSGQIP  67

Query  475  PAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIP  618
              IGD  +L+S+ L+ NQL G IP  +    +L +LDLS N L G+IP
Sbjct  68   DEIGDCSSLKSLVLKNNQLIGPIPSTLSQIPNLKVLDLSQNKLSGEIP  115



>ref|XP_003592397.1| LRR receptor-like serine/threonine-protein kinase ERL2 [Medicago 
truncatula]
Length=99

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  298  GKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSC  408
            G+ LM++K SF+N+A+VLLDWDDVHN+DFCSWRGV C
Sbjct  51   GQALMAMKSSFNNIADVLLDWDDVHNDDFCSWRGVFC  87



>gb|EMS58253.1| LRR receptor-like serine/threonine-protein kinase ERL2 [Triticum 
urartu]
Length=933

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 44/56 (79%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +1

Query  460  GGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            GGEISPAIG+L+ LQ +DL+GN+LTGQIPDEIG+C+SL  LDLS NLLYGDIPFSI
Sbjct  79   GGEISPAIGELKALQFVDLKGNKLTGQIPDEIGDCVSLKYLDLSFNLLYGDIPFSI  134



>gb|EMT12712.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Aegilops 
tauschii]
Length=961

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +1

Query  460  GGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
            GGEISPAIG+L+ LQ +DL+GN+LTGQIPDEIG+C+SL  LDLS NLLYGDIPFSI
Sbjct  123  GGEISPAIGELKALQFVDLKGNKLTGQIPDEIGDCVSLKYLDLSFNLLYGDIPFSI  178



>gb|KHN47744.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Glycine 
soja]
Length=1231

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 76/121 (63%), Gaps = 10/121 (8%)
 Frame = +1

Query  283  CIGDEG--KTLMSIKESFS-NVANVLLDWDDVHNEDFCSWRGVSCGnfsm------svvs  435
            C G+E   + L+ +K SF+ +  NVL DW  V+N D+CSWRGVSCG+ S       SVV 
Sbjct  21   CHGNESTMRVLLEVKTSFTEDPENVLSDWS-VNNTDYCSWRGVSCGSKSKPLDHDDSVVG  79

Query  436  lnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDI  615
            LNLS L+L G ISP++G L+NL  +DL  N+L+G IP  + N  SL  L L  N L G I
Sbjct  80   LNLSELSLSGSISPSLGRLKNLIHLDLSSNRLSGPIPPTLSNLTSLESLLLHSNQLTGHI  139

Query  616  P  618
            P
Sbjct  140  P  140



>gb|AAT08020.1| putative receptor protein kinase [Zea mays]
Length=207

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 82/164 (50%), Gaps = 35/164 (21%)
 Frame = +1

Query  160  PFAFFVCPGMV----EKVLFPGIRKMEFALACVLALILLSFP---LTS-CIGDEGKTLMS  315
            PF F    G++     +  F G   + FA  C+L  + L  P   LT   +   G  L+ 
Sbjct  38   PFRFLSSLGVLLLRTGEQRFRGGGWIPFAENCLLGFLPLCNPFFVLTRLALHLPGAALVE  97

Query  316  IKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLR  495
            IK+SF NV NVL DW     +D+CSWRGV C                    ++ A+    
Sbjct  98   IKKSFRNVGNVLYDW---AGDDYCSWRGVLC------------------DNVTFAVA---  133

Query  496  NLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
               ++DL+ N L+GQIPDEIG+C SL  LD S N L GDIPFSI
Sbjct  134  ---ALDLKSNGLSGQIPDEIGDCSSLRTLDFSFNNLDGDIPFSI  174



>ref|XP_003547404.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Glycine max]
Length=1257

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 76/121 (63%), Gaps = 10/121 (8%)
 Frame = +1

Query  283  CIGDEG--KTLMSIKESFS-NVANVLLDWDDVHNEDFCSWRGVSCGnfsm------svvs  435
            C G+E   + L+ +K SF+ +  NVL DW  V+N D+CSWRGVSCG+ S       SVV 
Sbjct  26   CHGNESTMRVLLEVKTSFTEDPENVLSDWS-VNNTDYCSWRGVSCGSKSKPLDHDDSVVG  84

Query  436  lnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDI  615
            LNLS L+L G ISP++G L+NL  +DL  N+L+G IP  + N  SL  L L  N L G I
Sbjct  85   LNLSELSLSGSISPSLGRLKNLIHLDLSSNRLSGPIPPTLSNLTSLESLLLHSNQLTGHI  144

Query  616  P  618
            P
Sbjct  145  P  145



>ref|XP_001755991.1| ERL1d AtERECTA-like receptor S/T protein kinase protein [Physcomitrella 
patens]
 gb|EDQ79276.1| ERL1d AtERECTA-like receptor S/T protein kinase protein, partial 
[Physcomitrella patens]
Length=864

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 57/107 (53%), Positives = 73/107 (68%), Gaps = 1/107 (1%)
 Frame = +1

Query  301  KTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPA  480
            + L+++K  F N    L DWD V ++  C W GV+C N +  VV+LNLS L LGGEISP+
Sbjct  1    RILVNLKAGFVNGEEELHDWD-VESQSPCGWMGVNCNNVTFEVVALNLSELALGGEISPS  59

Query  481  IGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPF  621
            IG L +LQ +DL GN ++GQIP EI NC SL  LDLS N L G+IP+
Sbjct  60   IGLLGSLQILDLSGNNISGQIPVEICNCTSLTHLDLSSNNLGGEIPY  106



>ref|XP_002993357.1| hypothetical protein SELMODRAFT_431458 [Selaginella moellendorffii]
 gb|EFJ05542.1| hypothetical protein SELMODRAFT_431458 [Selaginella moellendorffii]
Length=1153

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 54/88 (61%), Gaps = 1/88 (1%)
 Frame = +1

Query  292  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  471
            DE   L+S K + S   + L DWD+ + + FCSW GV C   + +V  ++L + N  G +
Sbjct  123  DEALVLLSFKRALSLQVDALPDWDEANRQSFCSWTGVRCS-SNNTVTGIHLGSKNFSGSL  181

Query  472  SPAIGDLRNLQSIDLQGNQLTGQIPDEI  555
            SP +GDLR+LQ ++L  N L+G IP E+
Sbjct  182  SPLLGDLRSLQQLNLSDNSLSGNIPGEL  209



>emb|CDY00321.1| BnaA06g22220D [Brassica napus]
Length=584

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 75/134 (56%), Gaps = 4/134 (3%)
 Frame = +1

Query  235  LACVLALILLSFPLTSC---IGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVS  405
            L  VL++I  +    SC   +  +G  L+ +K  F++  N L +W D  +E  CSW GVS
Sbjct  4    LNWVLSVICAATVFVSCSFALTLDGYALLELKSGFNDTRNSLENWRD-SDESPCSWTGVS  62

Query  406  CGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilld  585
            C      VVS+NL  + LGG ISP+IG L  LQ + L  N L G IPDEI NC  L  + 
Sbjct  63   CNPQDQRVVSINLPYMQLGGIISPSIGKLSRLQRLALHQNSLHGTIPDEITNCTELRAMY  122

Query  586  lsdnllYGDIPFSI  627
            L  N L G+IP SI
Sbjct  123  LRGNFLQGEIPPSI  136



>ref|XP_009151389.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FEI 2 [Brassica rapa]
Length=604

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 75/134 (56%), Gaps = 4/134 (3%)
 Frame = +1

Query  235  LACVLALILLSFPLTSC---IGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVS  405
            L  VL++I  +    SC   +  +G  L+ +K  F++  N L +W D  +E  CSW GVS
Sbjct  4    LNWVLSVICAATVFVSCSFALTLDGYALLELKSGFNDTRNSLENWRD-SDESPCSWTGVS  62

Query  406  CGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilld  585
            C      VVS+NL  + LGG ISP+IG L  LQ + L  N L G IPDEI NC  L  + 
Sbjct  63   CNPQDQRVVSINLPYMQLGGIISPSIGKLSRLQRLALHQNSLHGTIPDEITNCTELRAMY  122

Query  586  lsdnllYGDIPFSI  627
            L  N L G+IP SI
Sbjct  123  LRGNFLQGEIPPSI  136



>gb|KHG25582.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Gossypium 
arboreum]
Length=1260

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 52/116 (45%), Positives = 69/116 (59%), Gaps = 8/116 (7%)
 Frame = +1

Query  220  KMEFALACVLALILLSFPLTS--CIGDEGKTLMSIKESF-SNVANVLLDWDDVHNEDFCS  390
            K +F+L   + L L S  L S  C   +   L+ IK SF  +  NVL DW    N +FC+
Sbjct  5    KKDFSLILTI-LFLTSCSLASVFCQNQDLSLLLDIKRSFVQDPQNVLHDWSSQANPNFCA  63

Query  391  WRGVSCGnfsms----vvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIP  546
            W GV+CG  S +    VVSLNLS  +LGG +SP++G L+NL  +DL  N+LTG IP
Sbjct  64   WTGVACGFISPANSFHVVSLNLSGFSLGGSLSPSLGRLQNLLHLDLSSNRLTGPIP  119



>emb|CDX84346.1| BnaC03g51540D [Brassica napus]
Length=584

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 74/134 (55%), Gaps = 4/134 (3%)
 Frame = +1

Query  235  LACVLALILLSFPLTSC---IGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVS  405
            L   L+LI  +    SC   +  +G  L+ +K  F++  N L +W D  +E  CSW GVS
Sbjct  4    LNWALSLISAATVFVSCSFALSLDGYALLELKSGFNDTRNSLENWRD-SDESPCSWTGVS  62

Query  406  CGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilld  585
            C      VVS+NL  + LGG ISP+IG L  LQ + L  N L G IPDEI NC  L  + 
Sbjct  63   CNPQDQRVVSINLPYMQLGGIISPSIGKLSRLQRLALHQNSLHGTIPDEITNCTELRAMY  122

Query  586  lsdnllYGDIPFSI  627
            L  N L G+IP SI
Sbjct  123  LRGNFLQGEIPPSI  136



>ref|XP_010933053.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FEI 1 [Elaeis guineensis]
 ref|XP_010933054.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FEI 1 [Elaeis guineensis]
Length=595

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 62/108 (57%), Gaps = 1/108 (1%)
 Frame = +1

Query  235  LACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGn  414
            L  ++ ++L+  P++S I  +G+ L+S K + S    VLL W    + D C W+GV+C N
Sbjct  13   LPSIMLVLLMVVPISSAISSDGEVLLSFKTAISGSDGVLLQWRQ-EDPDPCDWKGVTCDN  71

Query  415  fsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIG  558
             +  V+ L+L+   L G ISP I  L  L+ + L GN L G +P E+G
Sbjct  72   HTKRVIYLSLAYHKLIGSISPEISKLSYLKRLALHGNSLYGTMPPELG  119



>ref|XP_006439659.1| hypothetical protein CICLE_v10019379mg [Citrus clementina]
 gb|ESR52899.1| hypothetical protein CICLE_v10019379mg [Citrus clementina]
Length=603

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 74/134 (55%), Gaps = 4/134 (3%)
 Frame = +1

Query  235  LACVLALILLSFPLTSC---IGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVS  405
            L  +L +I  +   +SC   + ++G TL+ IK S ++  N+L +W    +E  C W G+S
Sbjct  6    LVLILTVIFAATLFSSCCLALTEDGMTLLEIKSSLNDSRNLLGNWQAT-DESPCKWTGIS  64

Query  406  CGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilld  585
            C      V S+NL  + LGG ISP+IG L  LQ + L  N L G IP+EI NC  L  L 
Sbjct  65   CHTHDQRVRSINLPYMQLGGIISPSIGRLDKLQRLALHQNSLHGSIPNEITNCTELRALY  124

Query  586  lsdnllYGDIPFSI  627
            L  N L G IP +I
Sbjct  125  LRANYLQGGIPANI  138



>ref|XP_007138872.1| hypothetical protein PHAVU_009G244600g [Phaseolus vulgaris]
 gb|ESW10866.1| hypothetical protein PHAVU_009G244600g [Phaseolus vulgaris]
Length=1193

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 73/125 (58%), Gaps = 14/125 (11%)
 Frame = +1

Query  283  CIGDEG--KTLMSIKESFS-NVANVLLDWDDVHNEDFCSWRGVSCGnfsms---------  426
            C G+E   + L+ +K SF+ +  NVL DW + +N D+CSWRGVSCG+             
Sbjct  25   CHGNESTMRVLLEVKSSFTEDPENVLSDWSE-NNTDYCSWRGVSCGSKKRHFLDDDDDSV  83

Query  427  -vvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnll  603
             VV LNLS  +LGG ISP++G L+NL  +DL  N+L G IP  + N  SL  L L  N L
Sbjct  84   QVVGLNLSESSLGGSISPSLGRLQNLLHLDLSSNRLEGPIPPALSNLTSLESLLLHSNQL  143

Query  604  YGDIP  618
             G IP
Sbjct  144  TGQIP  148



>ref|XP_008374516.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FEI 2 [Malus domestica]
Length=604

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 61/104 (59%), Gaps = 1/104 (1%)
 Frame = +1

Query  244  VLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsm  423
            V++  + S   +  +  +G  L+ IK + ++  NVL+DW D  +E  C W G++C    +
Sbjct  12   VISAAIFSSHCSLALSPDGLALLEIKSTLNDSRNVLIDWQD-SDESPCKWTGITCHPQDL  70

Query  424  svvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEI  555
             V+S+NL  + LGG ISP+IG L  LQ + L  N L G IP+EI
Sbjct  71   RVISINLPYMQLGGTISPSIGKLSRLQRLALHQNSLHGNIPNEI  114



>ref|XP_010647299.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g10290 isoform X5 [Vitis vinifera]
Length=243

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 83/137 (61%), Gaps = 7/137 (5%)
 Frame = +1

Query  220  KMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNE-DFCSWR  396
            KMEF LA ++     SF L+   GD    L ++K S +  +  L+DW    NE D CSW 
Sbjct  32   KMEFVLAALILSCFHSFVLSDSQGD---ALYALKNSLNASSKQLMDWHP--NEVDPCSWS  86

Query  397  GVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncisli  576
             V C + S +V+S+ LS + L G +SP IG L  L ++ L+GN +TG+IP+E+GN  +L 
Sbjct  87   NVVC-DSSNNVISVTLSFMQLSGTLSPKIGILNTLSTLTLEGNGITGEIPEELGNLSNLT  145

Query  577  lldlsdnllYGDIPFSI  627
             L+L +N L G+IP S+
Sbjct  146  TLNLGNNRLTGEIPSSL  162



>ref|XP_006476661.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FEI 1-like [Citrus sinensis]
 gb|KDO76035.1| hypothetical protein CISIN_1g007455mg [Citrus sinensis]
Length=603

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 73/134 (54%), Gaps = 4/134 (3%)
 Frame = +1

Query  235  LACVLALILLSFPLTSC---IGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVS  405
            L  +L +I  +   +SC   + ++G TL+ IK S ++  N+L +W     E  C W G+S
Sbjct  6    LVLILTVIFAATLFSSCCLALTEDGMTLLEIKSSLNDSRNLLGNWQAT-EESPCKWTGIS  64

Query  406  CGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilld  585
            C      V S+NL  + LGG ISP+IG L  LQ + L  N L G IP+EI NC  L  L 
Sbjct  65   CHTHDQRVRSINLPYMQLGGIISPSIGRLDKLQRLALHQNSLHGSIPNEITNCTELRALY  124

Query  586  lsdnllYGDIPFSI  627
            L  N L G IP +I
Sbjct  125  LRANYLQGGIPANI  138



>ref|XP_010647298.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g10290 isoform X4 [Vitis vinifera]
Length=265

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 83/137 (61%), Gaps = 7/137 (5%)
 Frame = +1

Query  220  KMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNE-DFCSWR  396
            KMEF LA ++     SF L+   GD    L ++K S +  +  L+DW    NE D CSW 
Sbjct  32   KMEFVLAALILSCFHSFVLSDSQGD---ALYALKNSLNASSKQLMDWHP--NEVDPCSWS  86

Query  397  GVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncisli  576
             V C + S +V+S+ LS + L G +SP IG L  L ++ L+GN +TG+IP+E+GN  +L 
Sbjct  87   NVVC-DSSNNVISVTLSFMQLSGTLSPKIGILNTLSTLTLEGNGITGEIPEELGNLSNLT  145

Query  577  lldlsdnllYGDIPFSI  627
             L+L +N L G+IP S+
Sbjct  146  TLNLGNNRLTGEIPSSL  162



>ref|XP_010533910.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Tarenaya hassleriana]
Length=640

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 71/116 (61%), Gaps = 3/116 (3%)
 Frame = +1

Query  280  SCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnl  459
            S I  E   LM+IK   ++  NVL +WD V++ D CSWR V+C    +S + L   +L  
Sbjct  30   SGINYEVVALMAIKSELNDPYNVLENWD-VNSVDPCSWRMVTCSYGYVSSLGLPSQSL--  86

Query  460  GGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPFSI  627
             G +SP IG+L NLQS+ LQ N ++G IPD IG    L  LDLS+NL  G+IP S+
Sbjct  87   SGTLSPRIGNLTNLQSVLLQNNAISGPIPDTIGRLEKLQTLDLSNNLFTGEIPSSL  142



>ref|XP_008381992.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g10290 [Malus domestica]
Length=611

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 76/136 (56%), Gaps = 5/136 (4%)
 Frame = +1

Query  220  KMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRG  399
            KME  LA ++   L SF L    GD    L S++ S ++  N L DW+  +  + C+W  
Sbjct  5    KMELVLAVLVLACLQSFVLPDSQGD---ALFSLRTSLNSSPNQLKDWNP-NQVNPCTWSN  60

Query  400  VSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislil  579
            V+C      +  +  +     G +SP +G L+NLQ++ LQGN +TG+IP E GN  SL  
Sbjct  61   VNCDPNYNVISVILSNIGF-SGILSPKLGALKNLQTLSLQGNGITGEIPKEFGNLTSLST  119

Query  580  ldlsdnllYGDIPFSI  627
            L+L +N L G+IP S+
Sbjct  120  LNLENNNLTGEIPASL  135



>ref|XP_002972743.1| hypothetical protein SELMODRAFT_413321 [Selaginella moellendorffii]
 gb|EFJ25964.1| hypothetical protein SELMODRAFT_413321 [Selaginella moellendorffii]
Length=1183

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 58/106 (55%), Gaps = 1/106 (1%)
 Frame = +1

Query  238  ACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnf  417
            AC   L L      +   DE   L+S K + S   + L DWD+ + + FCSW GV C   
Sbjct  106  ACCYGLNLQQQNRKALETDEALVLLSFKRALSLQVDTLPDWDEANRQSFCSWTGVRCS-S  164

Query  418  smsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEI  555
            + +V  ++L + N  G +SP +GDL +LQ ++L  N L+G IP E+
Sbjct  165  NNTVTGIHLGSKNFSGSLSPLLGDLHSLQQLNLSDNSLSGNIPGEL  210



>ref|XP_007040985.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
 gb|EOX96816.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
Length=1257

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 71/122 (58%), Gaps = 10/122 (8%)
 Frame = +1

Query  220  KMEFALACVLALILL----SFPLTSCIGDEGKTLMSIKESFS-NVANVLLDWDDVHNEDF  384
            K +F++    ++IL     +F    C   E   L+ +K SF  +  NVL DW    N +F
Sbjct  5    KKDFSILLNTSIILFLTCCAFVSVFCQNQELSILLEVKSSFEEDPQNVLHDWSSKTNPNF  64

Query  385  CSWRGVSCG-----nfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPD  549
            C+W GV+CG     + S+ VVSLNLS  +LGG ISP++G L+NL  +DL  N+LTG IP 
Sbjct  65   CTWTGVTCGFSSFDSSSVHVVSLNLSGFSLGGSISPSLGRLQNLLHLDLSSNRLTGPIPT  124

Query  550  EI  555
             +
Sbjct  125  TL  126



>ref|XP_010647297.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g10290 isoform X3 [Vitis vinifera]
Length=268

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 83/137 (61%), Gaps = 7/137 (5%)
 Frame = +1

Query  220  KMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNE-DFCSWR  396
            KMEF LA ++     SF L+   GD    L ++K S +  +  L+DW    NE D CSW 
Sbjct  32   KMEFVLAALILSCFHSFVLSDSQGD---ALYALKNSLNASSKQLMDWHP--NEVDPCSWS  86

Query  397  GVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncisli  576
             V C + S +V+S+ LS + L G +SP IG L  L ++ L+GN +TG+IP+E+GN  +L 
Sbjct  87   NVVC-DSSNNVISVTLSFMQLSGTLSPKIGILNTLSTLTLEGNGITGEIPEELGNLSNLT  145

Query  577  lldlsdnllYGDIPFSI  627
             L+L +N L G+IP S+
Sbjct  146  TLNLGNNRLTGEIPSSL  162



>ref|XP_002312685.1| leucine-rich repeat family protein [Populus trichocarpa]
 gb|EEE90052.1| leucine-rich repeat family protein [Populus trichocarpa]
Length=625

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 72/128 (56%), Gaps = 2/128 (2%)
 Frame = +1

Query  244  VLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsm  423
            VLAL+ +S    S  G   + L++IK +  +  NVL +WD +++ D CSWR V+C     
Sbjct  16   VLALMEISSATLSPTGINFEALVAIKTALLDPYNVLENWD-INSVDPCSWRMVTCSPDGY  74

Query  424  svvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnll  603
                   S     G +SP+IG+L NLQS+ LQ N ++G IP  IG    L  LDLS+N  
Sbjct  75   VSALGLPSQSL-SGTLSPSIGNLTNLQSVLLQNNAISGPIPVAIGKLEKLQTLDLSNNTF  133

Query  604  YGDIPFSI  627
             GD+P S+
Sbjct  134  SGDMPTSL  141



>ref|XP_010647293.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g10290 isoform X1 [Vitis vinifera]
 ref|XP_010647294.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g10290 isoform X1 [Vitis vinifera]
Length=290

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 83/137 (61%), Gaps = 7/137 (5%)
 Frame = +1

Query  220  KMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNE-DFCSWR  396
            KMEF LA ++     SF L+   GD    L ++K S +  +  L+DW    NE D CSW 
Sbjct  32   KMEFVLAALILSCFHSFVLSDSQGD---ALYALKNSLNASSKQLMDWHP--NEVDPCSWS  86

Query  397  GVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncisli  576
             V C + S +V+S+ LS + L G +SP IG L  L ++ L+GN +TG+IP+E+GN  +L 
Sbjct  87   NVVC-DSSNNVISVTLSFMQLSGTLSPKIGILNTLSTLTLEGNGITGEIPEELGNLSNLT  145

Query  577  lldlsdnllYGDIPFSI  627
             L+L +N L G+IP S+
Sbjct  146  TLNLGNNRLTGEIPSSL  162



>ref|XP_010647295.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g10290 isoform X2 [Vitis vinifera]
 ref|XP_010647296.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g10290 isoform X2 [Vitis vinifera]
Length=283

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 83/137 (61%), Gaps = 7/137 (5%)
 Frame = +1

Query  220  KMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNE-DFCSWR  396
            KMEF LA ++     SF L+   GD    L ++K S +  +  L+DW    NE D CSW 
Sbjct  25   KMEFVLAALILSCFHSFVLSDSQGD---ALYALKNSLNASSKQLMDWHP--NEVDPCSWS  79

Query  397  GVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncisli  576
             V C + S +V+S+ LS + L G +SP IG L  L ++ L+GN +TG+IP+E+GN  +L 
Sbjct  80   NVVC-DSSNNVISVTLSFMQLSGTLSPKIGILNTLSTLTLEGNGITGEIPEELGNLSNLT  138

Query  577  lldlsdnllYGDIPFSI  627
             L+L +N L G+IP S+
Sbjct  139  TLNLGNNRLTGEIPSSL  155



>ref|XP_006380012.1| hypothetical protein POPTR_0008s19310g [Populus trichocarpa]
 gb|ERP57809.1| hypothetical protein POPTR_0008s19310g [Populus trichocarpa]
Length=622

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 72/128 (56%), Gaps = 2/128 (2%)
 Frame = +1

Query  244  VLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsm  423
            VLAL+ +S    S  G   + L++IK +  +  NVL +WD +++ D CSWR V+C     
Sbjct  16   VLALMEISSATLSPTGINFEALVAIKTALLDPYNVLENWD-INSVDPCSWRMVTCSPDGY  74

Query  424  svvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnll  603
                   S     G +SP+IG+L NLQS+ LQ N ++G IP  IG    L  LDLS+N  
Sbjct  75   VSALGLPSQSL-SGTLSPSIGNLTNLQSVLLQNNAISGPIPVAIGKLEKLQTLDLSNNTF  133

Query  604  YGDIPFSI  627
             GD+P S+
Sbjct  134  SGDMPTSL  141



>ref|XP_009390528.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FEI 1 [Musa acuminata subsp. malaccensis]
 ref|XP_009390530.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FEI 1 [Musa acuminata subsp. malaccensis]
 ref|XP_009390531.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FEI 1 [Musa acuminata subsp. malaccensis]
 ref|XP_009390532.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FEI 1 [Musa acuminata subsp. malaccensis]
Length=593

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 63/115 (55%), Gaps = 5/115 (4%)
 Frame = +1

Query  226  EFALACVLALILLSFPL----TSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSW  393
            +F + C   L ++  PL    T+ I  +G+ L+SIK +      V L+W    + D CSW
Sbjct  3    QFLMKCQRLLFVVIVPLLMSLTNAISPDGEVLLSIKTAIVGSDGVFLNWRQ-EDPDPCSW  61

Query  394  RGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIG  558
            RGV+C + +  ++ L L+   L G ISP IG L  L+ + L GN L G IP E+G
Sbjct  62   RGVTCDSSTKRIIHLRLAYHKLIGSISPEIGKLNYLRLLALHGNSLYGVIPPELG  116



>ref|XP_001763775.1| ERL2a AtERECTA-like receptor S/T protein kinase protein [Physcomitrella 
patens]
 gb|EDQ71417.1| ERL2a AtERECTA-like receptor S/T protein kinase protein, partial 
[Physcomitrella patens]
Length=948

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 51/105 (49%), Positives = 70/105 (67%), Gaps = 1/105 (1%)
 Frame = +1

Query  307  LMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIG  486
            L+ +K  F N    L DW +  ++  C WRGV+C N +  V +LN+S L L GEISPAIG
Sbjct  2    LIELKRVFENGELELYDWSE-GSQSPCHWRGVTCDNTTFLVTNLNISVLALSGEISPAIG  60

Query  487  DLRNLQSIDLQGNQLTGQIPDEIGncislilldlsdnllYGDIPF  621
            +L +LQ +D+  N ++GQIP EI NCISL+ L+L  N L G+IP+
Sbjct  61   NLHSLQYLDMSENNISGQIPTEISNCISLVYLNLQYNNLTGEIPY  105



>emb|CBI29551.3| unnamed protein product [Vitis vinifera]
Length=326

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 83/137 (61%), Gaps = 7/137 (5%)
 Frame = +1

Query  220  KMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNE-DFCSWR  396
            KMEF LA ++     SF L+   GD    L ++K S +  +  L+DW    NE D CSW 
Sbjct  68   KMEFVLAALILSCFHSFVLSDSQGD---ALYALKNSLNASSKQLMDWHP--NEVDPCSWS  122

Query  397  GVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncisli  576
             V C + S +V+S+ LS + L G +SP IG L  L ++ L+GN +TG+IP+E+GN  +L 
Sbjct  123  NVVC-DSSNNVISVTLSFMQLSGTLSPKIGILNTLSTLTLEGNGITGEIPEELGNLSNLT  181

Query  577  lldlsdnllYGDIPFSI  627
             L+L +N L G+IP S+
Sbjct  182  TLNLGNNRLTGEIPSSL  198



>ref|XP_008802949.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FEI 1 [Phoenix dactylifera]
Length=595

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 60/105 (57%), Gaps = 1/105 (1%)
 Frame = +1

Query  244  VLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsm  423
            ++ ++L+  P++S I  +G  L+S K + S+   V L W    + D C W+GV+C + + 
Sbjct  16   IMLILLMVVPISSAISSDGDALLSFKTAISSSDGVFLHWRQ-EDPDPCKWKGVTCDDHTK  74

Query  424  svvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIG  558
             V+ L+L+   L G ISP I  L  L+ + L GN L G IP E+G
Sbjct  75   RVIYLSLAYHKLIGSISPEISKLSYLKRLALHGNSLYGTIPPELG  119



>gb|KJB08256.1| hypothetical protein B456_001G074000 [Gossypium raimondii]
Length=531

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 65/114 (57%), Gaps = 4/114 (4%)
 Frame = +1

Query  223  MEFALACVLALILLSFPLT---SCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSW  393
            M   L+C+ + I  S   +   S +  +G TL+ IK + ++  N L +W    +E+ C+W
Sbjct  1    MRVLLSCLFSFIFASTLWSIGSSALTLDGLTLLEIKSTLNDSKNFLGNWQAT-DENPCNW  59

Query  394  RGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEI  555
             G+SC      V S+NL  + LGG ISP+IG L+ LQ + L  N L GQIP+E+
Sbjct  60   TGISCYPNDHRVRSINLPYMQLGGIISPSIGKLKGLQRLALHQNNLHGQIPNEL  113



>ref|XP_007138218.1| hypothetical protein PHAVU_009G190400g [Phaseolus vulgaris]
 gb|ESW10212.1| hypothetical protein PHAVU_009G190400g [Phaseolus vulgaris]
Length=604

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 74/138 (54%), Gaps = 4/138 (3%)
 Frame = +1

Query  223  MEFALACVLAL---ILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSW  393
            ME   A ++ L    ++ +P +  +  +G TL+ IK + ++  N L +W    +E  C+W
Sbjct  1    MEMGRAVLMLLFFSTIVLYPSSLALPQDGHTLLEIKSTLNDTRNFLSNWRK-SDESHCTW  59

Query  394  RGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGncisl  573
             G++C      V S+NL  + LGG ISP+IG L  L  + L  N L G IP+EIGNC  L
Sbjct  60   TGITCHPGEQRVRSINLPYMQLGGIISPSIGKLSRLHRLALHQNGLHGVIPNEIGNCTEL  119

Query  574  illdlsdnllYGDIPFSI  627
              L L  N L G IP  I
Sbjct  120  RALYLRANYLQGGIPSDI  137



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250