BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS079H10

Length=532
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AIU34464.1|  putative beta-galactosidase 1 precursor                 247   1e-76   Taraxacum brevicorniculatum
ref|XP_003550633.1|  PREDICTED: beta-galactosidase-like                 255   2e-76   Glycine max [soybeans]
gb|KJB65165.1|  hypothetical protein B456_010G082900                    250   5e-76   Gossypium raimondii
ref|NP_001265889.1|  beta-galactosidase-like precursor                  252   7e-76   Cicer arietinum [garbanzo]
ref|XP_004174126.1|  PREDICTED: beta-galactosidase-like                 236   8e-76   
gb|AAF67341.1|  beta galactosidase                                      251   1e-75   Vigna radiata [mung bean]
ref|XP_006587007.1|  PREDICTED: beta-galactosidase-like                 248   2e-75   
ref|XP_010049745.1|  PREDICTED: beta-galactosidase-like                 251   2e-75   Eucalyptus grandis [rose gum]
ref|XP_010448319.1|  PREDICTED: beta-galactosidase 12-like isofor...    251   3e-75   Camelina sativa [gold-of-pleasure]
ref|XP_009352652.1|  PREDICTED: beta-galactosidase                      251   3e-75   Pyrus x bretschneideri [bai li]
dbj|BAE72073.1|  pear beta-galactosidase1                               251   3e-75   Pyrus communis
dbj|BAB21492.1|  beta-D-galactosidase                                   251   3e-75   Pyrus pyrifolia [sha li]
gb|KJB65166.1|  hypothetical protein B456_010G082900                    250   3e-75   Gossypium raimondii
ref|XP_010448320.1|  PREDICTED: beta-galactosidase 12-like isofor...    250   3e-75   Camelina sativa [gold-of-pleasure]
gb|EYU45189.1|  hypothetical protein MIMGU_mgv1a003101mg                248   3e-75   Erythranthe guttata [common monkey flower]
emb|CAH18936.1|  beta-galactosidase                                     250   3e-75   Pyrus communis
ref|XP_008391326.1|  PREDICTED: beta-galactosidase 1                    252   3e-75   Malus domestica [apple tree]
ref|NP_194344.2|  beta-galactosidase 12                                 248   4e-75   Arabidopsis thaliana [mouse-ear cress]
gb|KCW79522.1|  hypothetical protein EUGRSUZ_C00898                     248   4e-75   Eucalyptus grandis [rose gum]
ref|XP_004135820.1|  PREDICTED: beta-galactosidase-like                 244   5e-75   
gb|AES59331.2|  beta-like galactosidase                                 250   5e-75   Medicago truncatula
gb|KJB07253.1|  hypothetical protein B456_001G011600                    248   5e-75   Gossypium raimondii
ref|XP_010433545.1|  PREDICTED: beta-galactosidase 12-like isofor...    249   5e-75   Camelina sativa [gold-of-pleasure]
ref|XP_010433544.1|  PREDICTED: beta-galactosidase 12-like isofor...    249   6e-75   Camelina sativa [gold-of-pleasure]
emb|CDX88594.1|  BnaA03g10550D                                          239   7e-75   
ref|XP_006413222.1|  hypothetical protein EUTSA_v10024511mg             249   7e-75   Eutrema salsugineum [saltwater cress]
ref|XP_006357461.1|  PREDICTED: beta-galactosidase-like                 251   8e-75   
ref|XP_009627536.1|  PREDICTED: beta-galactosidase                      251   9e-75   Nicotiana tomentosiformis
gb|KCW69753.1|  hypothetical protein EUGRSUZ_F031302                    244   9e-75   Eucalyptus grandis [rose gum]
emb|CAC44502.1|  beta-galactosidase                                     249   1e-74   Fragaria x ananassa
ref|XP_010438795.1|  PREDICTED: beta-galactosidase 12 isoform X1        249   1e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010438797.1|  PREDICTED: beta-galactosidase 12 isoform X2        249   1e-74   Camelina sativa [gold-of-pleasure]
ref|XP_006366152.1|  PREDICTED: beta-galactosidase-like                 251   1e-74   Solanum tuberosum [potatoes]
ref|NP_001280755.1|  beta-galactosidase precursor                       249   1e-74   Malus domestica [apple tree]
gb|KCW69752.1|  hypothetical protein EUGRSUZ_F031302                    244   1e-74   Eucalyptus grandis [rose gum]
gb|AHG94611.1|  beta-galactosidase                                      250   2e-74   Camellia sinensis [black tea]
gb|KJB07254.1|  hypothetical protein B456_001G011600                    248   2e-74   Gossypium raimondii
ref|XP_004287559.1|  PREDICTED: beta-galactosidase isoform X5           248   2e-74   Fragaria vesca subsp. vesca
ref|XP_009137581.1|  PREDICTED: beta-galactosidase 12-like              248   2e-74   Brassica rapa
emb|CAB39679.1|  putative beta-galactosidase                            248   2e-74   Arabidopsis thaliana [mouse-ear cress]
gb|KHN24609.1|  Beta-galactosidase                                      248   2e-74   Glycine soja [wild soybean]
gb|KJB65169.1|  hypothetical protein B456_010G082900                    249   2e-74   Gossypium raimondii
ref|NP_849553.1|  beta-galactosidase 12                                 248   2e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004241849.1|  PREDICTED: beta-galactosidase-like                 250   2e-74   Solanum lycopersicum
ref|XP_008450855.1|  PREDICTED: beta-galactosidase-like                 248   2e-74   Cucumis melo [Oriental melon]
ref|XP_009367552.1|  PREDICTED: beta-galactosidase 1                    249   3e-74   Pyrus x bretschneideri [bai li]
ref|XP_003546457.1|  PREDICTED: beta-galactosidase-like isoform X1      248   3e-74   Glycine max [soybeans]
ref|XP_011460037.1|  PREDICTED: beta-galactosidase isoform X4           248   3e-74   Fragaria vesca subsp. vesca
gb|ACF22882.1|  beta-galactosidase                                      248   3e-74   Glycine max [soybeans]
gb|KJB65167.1|  hypothetical protein B456_010G082900                    249   3e-74   Gossypium raimondii
gb|KJB65170.1|  hypothetical protein B456_010G082900                    249   3e-74   Gossypium raimondii
gb|KJB07252.1|  hypothetical protein B456_001G011600                    248   3e-74   Gossypium raimondii
ref|XP_010536861.1|  PREDICTED: beta-galactosidase 12                   247   4e-74   Tarenaya hassleriana [spider flower]
gb|ACC78255.1|  beta-galactosidase                                      247   6e-74   Carica papaya [mamon]
ref|XP_008451151.1|  PREDICTED: beta-galactosidase-like                 244   6e-74   
ref|XP_006285652.1|  hypothetical protein CARUB_v10007108mg             247   7e-74   Capsella rubella
ref|XP_011072510.1|  PREDICTED: beta-galactosidase-like                 248   7e-74   Sesamum indicum [beniseed]
gb|AFW61988.1|  hypothetical protein ZEAMMB73_453254                    236   8e-74   
ref|XP_002867577.1|  beta-galactosidase 12                              246   8e-74   
ref|XP_007138730.1|  hypothetical protein PHAVU_009G232500g             246   9e-74   Phaseolus vulgaris [French bean]
ref|XP_010049746.1|  PREDICTED: beta-galactosidase-like                 246   9e-74   Eucalyptus grandis [rose gum]
ref|NP_001234465.1|  beta-galactosidase precursor                       248   9e-74   Solanum lycopersicum
ref|XP_007154660.1|  hypothetical protein PHAVU_003G137000g             248   1e-73   Phaseolus vulgaris [French bean]
ref|XP_002308268.2|  hypothetical protein POPTR_0006s14680g             248   1e-73   Populus trichocarpa [western balsam poplar]
ref|XP_011045966.1|  PREDICTED: beta-galactosidase-like isoform X2      248   1e-73   Populus euphratica
dbj|BAE72074.1|  pear beta-galactosidase2                               246   2e-73   Pyrus communis
gb|KGN66239.1|  hypothetical protein Csa_1G587990                       243   2e-73   
emb|CAC44500.1|  beta-galactosidase                                     247   2e-73   Fragaria x ananassa
ref|NP_001289260.1|  beta-galactosidase precursor                       246   2e-73   Pyrus x bretschneideri [bai li]
ref|XP_010047575.1|  PREDICTED: beta-galactosidase-like                 248   2e-73   Eucalyptus grandis [rose gum]
ref|XP_007217146.1|  hypothetical protein PRUPE_ppa001382mg             247   2e-73   Prunus persica
gb|ABV32545.1|  beta-galactosidase protein 2                            247   2e-73   Prunus persica
sp|P48981.1|BGAL_MALDO  RecName: Full=Beta-galactosidase; AltName...    245   3e-73   Malus domestica [apple tree]
emb|CDX94367.1|  BnaC01g18170D                                          245   3e-73   
ref|XP_011463326.1|  PREDICTED: beta-galactosidase 1                    247   3e-73   Fragaria vesca subsp. vesca
gb|KCW82506.1|  hypothetical protein EUGRSUZ_C03898                     244   3e-73   Eucalyptus grandis [rose gum]
gb|KEH39519.1|  beta-galactosidase                                      242   3e-73   Medicago truncatula
gb|AAB61470.1|  beta-D-galactosidase                                    244   3e-73   Mangifera indica
ref|XP_010049744.1|  PREDICTED: beta-galactosidase-like                 244   3e-73   
ref|XP_008230925.1|  PREDICTED: beta-galactosidase-like                 246   3e-73   Prunus mume [ume]
gb|AAC77377.1|  beta-galactosidase precursor                            244   4e-73   Carica papaya [mamon]
gb|ABY71826.1|  beta-galactosidase                                      246   4e-73   Prunus salicina [Japanese plum]
gb|AEG76892.1|  putative beta-galactosidase                             244   4e-73   Linum usitatissimum
ref|XP_010242207.1|  PREDICTED: beta-galactosidase                      246   5e-73   Nelumbo nucifera [Indian lotus]
emb|CDX89360.1|  BnaA01g15330D                                          244   5e-73   
ref|XP_008228300.1|  PREDICTED: beta-galactosidase 1                    246   6e-73   Prunus mume [ume]
gb|KDP40776.1|  hypothetical protein JCGZ_24775                         240   6e-73   Jatropha curcas
ref|XP_010262132.1|  PREDICTED: beta-galactosidase isoform X2           246   7e-73   Nelumbo nucifera [Indian lotus]
ref|XP_009789773.1|  PREDICTED: beta-galactosidase-like                 246   7e-73   Nicotiana sylvestris
gb|KDP33829.1|  hypothetical protein JCGZ_07400                         246   7e-73   Jatropha curcas
ref|XP_010262131.1|  PREDICTED: beta-galactosidase isoform X1           246   8e-73   Nelumbo nucifera [Indian lotus]
ref|XP_002514108.1|  beta-galactosidase, putative                       246   8e-73   
gb|KFK27244.1|  hypothetical protein AALP_AA8G356800                    244   8e-73   Arabis alpina [alpine rockcress]
ref|XP_009606115.1|  PREDICTED: beta-galactosidase-like                 245   9e-73   
ref|XP_008450854.1|  PREDICTED: beta-galactosidase-like                 244   9e-73   Cucumis melo [Oriental melon]
ref|XP_007217046.1|  hypothetical protein PRUPE_ppa001415mg             245   1e-72   Prunus persica
gb|KCW82245.1|  hypothetical protein EUGRSUZ_C03662                     244   1e-72   Eucalyptus grandis [rose gum]
ref|XP_003595163.1|  Beta-galactosidase                                 241   1e-72   
gb|ACC60981.1|  beta-galactosidase 1 precursor                          245   1e-72   Petunia x hybrida [garden petunia]
emb|CAA09467.1|  exo galactanase                                        243   1e-72   Lupinus angustifolius
emb|CDP11590.1|  unnamed protein product                                228   1e-72   Coffea canephora [robusta coffee]
ref|XP_002437187.1|  hypothetical protein SORBIDRAFT_10g022620          243   2e-72   Sorghum bicolor [broomcorn]
ref|XP_010051543.1|  PREDICTED: beta-galactosidase                      244   2e-72   
ref|XP_008242341.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    244   2e-72   
ref|NP_001266133.1|  beta-galactosidase-like                            243   2e-72   Cicer arietinum [garbanzo]
ref|XP_007204656.1|  hypothetical protein PRUPE_ppa001412mg             244   2e-72   Prunus persica
gb|ABV32546.1|  beta-galactosidase protein 1                            244   2e-72   Prunus persica
gb|KDP33831.1|  hypothetical protein JCGZ_07402                         244   2e-72   Jatropha curcas
gb|AGW47883.1|  beta-galactosidase precursor                            244   2e-72   Nicotiana tabacum [American tobacco]
gb|EPS72701.1|  beta-galactosidase                                      233   2e-72   Genlisea aurea
ref|XP_010062625.1|  PREDICTED: beta-galactosidase 1                    244   2e-72   
emb|CDY32919.1|  BnaC02g12030D                                          243   2e-72   Brassica napus [oilseed rape]
ref|XP_010686091.1|  PREDICTED: beta-galactosidase 1                    244   2e-72   Beta vulgaris subsp. vulgaris [field beet]
emb|CDO97918.1|  unnamed protein product                                244   2e-72   Coffea canephora [robusta coffee]
ref|XP_003543598.1|  PREDICTED: beta-galactosidase 1-like               244   2e-72   Glycine max [soybeans]
ref|XP_009783993.1|  PREDICTED: beta-galactosidase                      244   2e-72   Nicotiana sylvestris
gb|KEH37473.1|  beta-like galactosidase                                 241   3e-72   Medicago truncatula
ref|XP_009126921.1|  PREDICTED: beta-galactosidase 4-like               243   3e-72   Brassica rapa
emb|CDY20708.1|  BnaA02g08480D                                          242   3e-72   Brassica napus [oilseed rape]
ref|XP_006280080.1|  hypothetical protein CARUB_v10025963mg             242   3e-72   Capsella rubella
ref|XP_008450853.1|  PREDICTED: beta-galactosidase-like                 242   3e-72   Cucumis melo [Oriental melon]
ref|XP_004135712.1|  PREDICTED: beta-galactosidase-like                 242   3e-72   Cucumis sativus [cucumbers]
ref|XP_003546676.1|  PREDICTED: beta-galactosidase 1-like               244   3e-72   Glycine max [soybeans]
gb|KHN32687.1|  Beta-galactosidase 1                                    244   3e-72   Glycine soja [wild soybean]
ref|XP_011080179.1|  PREDICTED: beta-galactosidase-like                 244   4e-72   Sesamum indicum [beniseed]
ref|XP_009388558.1|  PREDICTED: beta-galactosidase-like                 242   4e-72   Musa acuminata subsp. malaccensis [pisang utan]
gb|AES65414.2|  beta-like galactosidase                                 241   4e-72   Medicago truncatula
ref|XP_010483173.1|  PREDICTED: beta-galactosidase 4                    242   4e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010106660.1|  Beta-galactosidase 1                               244   4e-72   Morus notabilis
ref|XP_011093727.1|  PREDICTED: beta-galactosidase-like                 242   4e-72   Sesamum indicum [beniseed]
ref|XP_010451557.1|  PREDICTED: beta-galactosidase 4-like               242   4e-72   Camelina sativa [gold-of-pleasure]
ref|XP_007024475.1|  Beta galactosidase 1                               243   5e-72   
ref|XP_009409593.1|  PREDICTED: beta-galactosidase-like                 241   5e-72   
ref|XP_011077976.1|  PREDICTED: beta-galactosidase-like                 242   5e-72   Sesamum indicum [beniseed]
ref|XP_010443345.1|  PREDICTED: beta-galactosidase 4-like               241   6e-72   Camelina sativa [gold-of-pleasure]
gb|KDO57768.1|  hypothetical protein CISIN_1g004219mg                   239   6e-72   Citrus sinensis [apfelsine]
ref|XP_009139949.1|  PREDICTED: beta-galactosidase 12 isoform X2        242   6e-72   Brassica rapa
ref|XP_009139943.1|  PREDICTED: beta-galactosidase 12 isoform X1        242   6e-72   Brassica rapa
dbj|BAF31233.1|  beta-D-galactosidase                                   243   6e-72   Persea americana
ref|XP_004144120.1|  PREDICTED: beta-galactosidase-like                 242   7e-72   
ref|XP_009402923.1|  PREDICTED: beta-galactosidase-like                 241   7e-72   Musa acuminata subsp. malaccensis [pisang utan]
gb|KGN66238.1|  hypothetical protein Csa_1G587980                       240   7e-72   
ref|XP_010911412.1|  PREDICTED: beta-galactosidase-like                 238   7e-72   Elaeis guineensis
ref|XP_010545349.1|  PREDICTED: beta-galactosidase 12-like isofor...    238   8e-72   Tarenaya hassleriana [spider flower]
gb|AAK96780.1|  beta-galactosidase                                      241   8e-72   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001234303.1|  beta-galactosidase precursor                       243   8e-72   Solanum lycopersicum
gb|ADO34788.1|  beta-galactosidase STBG3                                243   8e-72   Solanum lycopersicum
ref|XP_003595162.1|  Beta-galactosidase                                 241   8e-72   Medicago truncatula
ref|NP_200498.1|  beta-galactosidase 4                                  241   8e-72   Arabidopsis thaliana [mouse-ear cress]
gb|KDO57767.1|  hypothetical protein CISIN_1g004219mg                   239   9e-72   Citrus sinensis [apfelsine]
ref|XP_011460033.1|  PREDICTED: beta-galactosidase isoform X3           241   9e-72   Fragaria vesca subsp. vesca
emb|CBI27912.3|  unnamed protein product                                243   1e-71   Vitis vinifera
gb|KFK34528.1|  hypothetical protein AALP_AA5G157800                    241   1e-71   Arabis alpina [alpine rockcress]
ref|XP_002282132.1|  PREDICTED: beta-galactosidase                      243   1e-71   Vitis vinifera
gb|KDO57766.1|  hypothetical protein CISIN_1g004219mg                   239   1e-71   Citrus sinensis [apfelsine]
emb|CDY11899.1|  BnaC03g13250D                                          241   1e-71   Brassica napus [oilseed rape]
ref|XP_009132166.1|  PREDICTED: beta-galactosidase 4                    241   1e-71   Brassica rapa
ref|XP_006401275.1|  hypothetical protein EUTSA_v10012847mg             240   1e-71   
ref|XP_002864484.1|  predicted protein                                  241   1e-71   
ref|XP_011460028.1|  PREDICTED: beta-galactosidase isoform X2           241   1e-71   Fragaria vesca subsp. vesca
ref|XP_003597608.1|  Beta-galactosidase                                 242   1e-71   Medicago truncatula
ref|XP_004287560.2|  PREDICTED: beta-galactosidase isoform X1           241   1e-71   Fragaria vesca subsp. vesca
ref|XP_004486826.1|  PREDICTED: beta-galactosidase 1-like               242   2e-71   Cicer arietinum [garbanzo]
ref|XP_003563718.1|  PREDICTED: beta-galactosidase 9                    240   2e-71   Brachypodium distachyon [annual false brome]
gb|KHN30042.1|  Beta-galactosidase 1                                    242   2e-71   Glycine soja [wild soybean]
gb|AAN60229.1|  unknown                                                 237   2e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006342989.1|  PREDICTED: beta-galactosidase-like                 241   2e-71   Solanum tuberosum [potatoes]
ref|XP_007150529.1|  hypothetical protein PHAVU_005G160000g             241   3e-71   Phaseolus vulgaris [French bean]
ref|XP_004170887.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    239   3e-71   
ref|XP_004158444.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    239   3e-71   
ref|XP_009762312.1|  PREDICTED: beta-galactosidase-like                 239   3e-71   Nicotiana sylvestris
ref|XP_010090040.1|  hypothetical protein L484_027271                   241   4e-71   Morus notabilis
ref|XP_010418820.1|  PREDICTED: beta-galactosidase 8-like               226   4e-71   
gb|KGN59822.1|  hypothetical protein Csa_3G848310                       239   4e-71   
gb|KDO57765.1|  hypothetical protein CISIN_1g004219mg                   239   4e-71   Citrus sinensis [apfelsine]
ref|XP_006385360.1|  beta-galactosidase 1 family protein                241   5e-71   
gb|KDO57764.1|  hypothetical protein CISIN_1g004219mg                   239   5e-71   Citrus sinensis [apfelsine]
gb|ABK96254.1|  unknown                                                 241   5e-71   Populus trichocarpa x Populus deltoides
ref|XP_006451459.1|  hypothetical protein CICLE_v10007531mg             239   5e-71   
ref|XP_007012844.1|  Beta-galactosidase                                 241   5e-71   
ref|NP_001130532.1|  beta-galactosidase isoform 1 precursor             239   6e-71   Zea mays [maize]
gb|KCW53602.1|  hypothetical protein EUGRSUZ_J02867                     238   6e-71   Eucalyptus grandis [rose gum]
ref|XP_009599425.1|  PREDICTED: beta-galactosidase-like                 239   6e-71   Nicotiana tomentosiformis
ref|XP_010090042.1|  Beta-galactosidase 1                               239   7e-71   
ref|XP_009407297.1|  PREDICTED: beta-galactosidase 2                    240   7e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010545348.1|  PREDICTED: beta-galactosidase 12-like isofor...    239   7e-71   Tarenaya hassleriana [spider flower]
gb|ACG30563.1|  beta-galactosidase precursor                            238   8e-71   Zea mays [maize]
ref|XP_006353531.1|  PREDICTED: beta-galactosidase-like                 238   9e-71   Solanum tuberosum [potatoes]
ref|XP_009408846.1|  PREDICTED: beta-galactosidase-like                 238   1e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001275845.1|  beta-galactosidase                                 238   1e-70   Citrus sinensis [apfelsine]
gb|KDO57763.1|  hypothetical protein CISIN_1g004219mg                   238   1e-70   Citrus sinensis [apfelsine]
gb|EPS62826.1|  beta-galactosidase                                      236   1e-70   Genlisea aurea
gb|KCW53601.1|  hypothetical protein EUGRSUZ_J02867                     238   1e-70   Eucalyptus grandis [rose gum]
ref|XP_006451461.1|  hypothetical protein CICLE_v10007531mg             238   1e-70   Citrus clementina [clementine]
gb|ADV41669.1|  beta-D-galactosidase                                    238   1e-70   Actinidia deliciosa var. deliciosa
ref|NP_001266102.1|  beta-galactosidase 1-like precursor                239   1e-70   Cicer arietinum [garbanzo]
ref|XP_004158465.1|  PREDICTED: beta-galactosidase-like                 242   1e-70   
ref|XP_004146823.1|  PREDICTED: beta-galactosidase 1-like               239   2e-70   Cucumis sativus [cucumbers]
gb|KDO57762.1|  hypothetical protein CISIN_1g004219mg                   238   2e-70   Citrus sinensis [apfelsine]
ref|XP_009409594.1|  PREDICTED: beta-galactosidase-like                 238   2e-70   
ref|XP_006451460.1|  hypothetical protein CICLE_v10007531mg             238   2e-70   Citrus clementina [clementine]
gb|KGN66240.1|  hypothetical protein Csa_1G588000                       238   2e-70   
gb|KJB56892.1|  hypothetical protein B456_009G140800                    239   2e-70   Gossypium raimondii
gb|KHG25378.1|  Beta-galactosidase 1 -like protein                      239   2e-70   Gossypium arboreum [tree cotton]
ref|XP_009622143.1|  PREDICTED: beta-galactosidase-like                 239   2e-70   Nicotiana tomentosiformis
gb|AAC25984.1|  beta-galactosidase                                      237   2e-70   Solanum lycopersicum
ref|XP_009769408.1|  PREDICTED: beta-galactosidase-like                 239   2e-70   Nicotiana sylvestris
gb|ADO34789.1|  beta-galactosidase STBG4                                237   3e-70   Solanum lycopersicum
gb|KHG01120.1|  Beta-galactosidase                                      239   3e-70   Gossypium arboreum [tree cotton]
ref|XP_010915229.1|  PREDICTED: beta-galactosidase isoform X2           238   3e-70   Elaeis guineensis
gb|KEH18344.1|  beta-galactosidase                                      238   3e-70   Medicago truncatula
ref|XP_010915228.1|  PREDICTED: beta-galactosidase isoform X1           238   3e-70   Elaeis guineensis
gb|AAM13196.1|  galactosidase, putative                                 238   4e-70   Arabidopsis thaliana [mouse-ear cress]
ref|NP_187988.1|  beta galactosidase 1                                  238   4e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009117469.1|  PREDICTED: beta-galactosidase 1-like               238   5e-70   Brassica rapa
ref|XP_009409595.1|  PREDICTED: beta-galactosidase-like                 236   5e-70   
emb|CDY51738.1|  BnaA01g37210D                                          238   5e-70   Brassica napus [oilseed rape]
ref|XP_006403764.1|  hypothetical protein EUTSA_v10010152mg             236   6e-70   Eutrema salsugineum [saltwater cress]
ref|XP_004966041.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    236   6e-70   
gb|EYU28411.1|  hypothetical protein MIMGU_mgv1a024117mg                236   6e-70   Erythranthe guttata [common monkey flower]
ref|NP_190852.2|  beta-galactosidase 2                                  236   7e-70   Arabidopsis thaliana [mouse-ear cress]
emb|CAB86888.1|  beta-galactosidase precursor-like protein              236   7e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002882842.1|  hypothetical protein ARALYDRAFT_897617             238   7e-70   Arabidopsis lyrata subsp. lyrata
ref|XP_010033786.1|  PREDICTED: beta-galactosidase 1-like               237   8e-70   Eucalyptus grandis [rose gum]
ref|XP_002514109.1|  beta-galactosidase, putative                       237   8e-70   Ricinus communis
ref|XP_002876169.1|  AT3g52840/F8J2_10                                  236   8e-70   
ref|XP_010465236.1|  PREDICTED: beta-galactosidase 1                    237   1e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010501131.1|  PREDICTED: beta-galactosidase 1-like               237   1e-69   Camelina sativa [gold-of-pleasure]
ref|XP_009768469.1|  PREDICTED: beta-galactosidase-like                 237   1e-69   Nicotiana sylvestris
ref|XP_006300095.1|  hypothetical protein CARUB_v10016323mg             237   1e-69   Capsella rubella
ref|XP_008447606.1|  PREDICTED: beta-galactosidase 1                    236   2e-69   Cucumis melo [Oriental melon]
ref|XP_008775429.1|  PREDICTED: beta-galactosidase 2-like               236   2e-69   Phoenix dactylifera
ref|XP_010426910.1|  PREDICTED: beta-galactosidase 2-like               235   2e-69   
gb|AFD54987.1|  beta-galactosidase                                      234   2e-69   Momordica charantia [balsam pear]
ref|XP_010515757.1|  PREDICTED: beta-galactosidase 2 isoform X1         234   2e-69   Camelina sativa [gold-of-pleasure]
emb|CDY37486.1|  BnaC01g37460D                                          236   2e-69   Brassica napus [oilseed rape]
gb|ACP18874.1|  beta-galactosidase pBG(b)                               230   2e-69   Carica papaya [mamon]
ref|XP_010234045.1|  PREDICTED: beta-galactosidase 4                    234   2e-69   Brachypodium distachyon [annual false brome]
sp|Q6Z6K4.1|BGAL4_ORYSJ  RecName: Full=Beta-galactosidase 4; Shor...    234   2e-69   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010487145.1|  PREDICTED: beta-galactosidase 1-like               236   3e-69   Camelina sativa [gold-of-pleasure]
sp|A2X2H7.1|BGAL4_ORYSI  RecName: Full=Beta-galactosidase 4; Shor...    234   3e-69   Oryza sativa Indica Group [Indian rice]
ref|XP_006648459.1|  PREDICTED: beta-galactosidase 4-like               234   3e-69   
ref|XP_011010891.1|  PREDICTED: beta-galactosidase 1-like               236   4e-69   Populus euphratica
gb|EAZ22260.1|  hypothetical protein OsJ_05915                          234   4e-69   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009148743.1|  PREDICTED: beta-galactosidase 2 isoform X1         234   4e-69   Brassica rapa
ref|XP_010504030.1|  PREDICTED: beta-galactosidase 2-like               234   4e-69   Camelina sativa [gold-of-pleasure]
dbj|BAB83260.1|  beta-D-galactosidase                                   234   5e-69   Persea americana
gb|AHG94613.1|  beta-galactosidase                                      234   5e-69   Camellia sinensis [black tea]
gb|KJB70253.1|  hypothetical protein B456_011G065300                    234   7e-69   Gossypium raimondii
gb|KHN06610.1|  Beta-galactosidase                                      234   7e-69   Glycine soja [wild soybean]
ref|XP_008793242.1|  PREDICTED: beta-galactosidase                      234   9e-69   Phoenix dactylifera
ref|NP_001234842.1|  ss-galactosidase precursor                         233   1e-68   
emb|CDX95380.1|  BnaC04g27780D                                          233   1e-68   
ref|XP_003531618.1|  PREDICTED: beta-galactosidase 1-like               234   1e-68   Glycine max [soybeans]
sp|P45582.1|BGAL_ASPOF  RecName: Full=Beta-galactosidase; Short=L...    234   1e-68   Asparagus officinalis
ref|XP_011000791.1|  PREDICTED: beta-galactosidase 1-like               234   1e-68   Populus euphratica
ref|XP_008805772.1|  PREDICTED: beta-galactosidase-like isoform X1      234   2e-68   Phoenix dactylifera
gb|KJB70252.1|  hypothetical protein B456_011G065300                    234   2e-68   Gossypium raimondii
ref|XP_008805774.1|  PREDICTED: beta-galactosidase-like isoform X2      234   2e-68   Phoenix dactylifera
ref|XP_010275526.1|  PREDICTED: beta-galactosidase 3-like               234   2e-68   Nelumbo nucifera [Indian lotus]
ref|XP_006646030.1|  PREDICTED: beta-galactosidase 2-like               233   2e-68   Oryza brachyantha
gb|KJB70251.1|  hypothetical protein B456_011G065300                    233   2e-68   Gossypium raimondii
gb|KHF98342.1|  Beta-galactosidase 1 -like protein                      233   2e-68   Gossypium arboreum [tree cotton]
gb|KDO65278.1|  hypothetical protein CISIN_1g002867mg                   231   2e-68   Citrus sinensis [apfelsine]
ref|NP_001140495.1|  hypothetical protein precursor                     223   3e-68   
ref|XP_009103690.1|  PREDICTED: beta-galactosidase 8                    233   3e-68   Brassica rapa
ref|XP_003566806.1|  PREDICTED: beta-galactosidase 2                    233   3e-68   Brachypodium distachyon [annual false brome]
emb|CDY15749.1|  BnaC04g15750D                                          233   4e-68   Brassica napus [oilseed rape]
gb|EEC70952.1|  hypothetical protein OsI_02561                          233   4e-68   Oryza sativa Indica Group [Indian rice]
gb|EMT13456.1|  Beta-galactosidase 9                                    231   4e-68   
ref|XP_010254673.1|  PREDICTED: beta-galactosidase 3-like               233   4e-68   Nelumbo nucifera [Indian lotus]
dbj|BAK05933.1|  predicted protein                                      231   4e-68   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010654522.1|  PREDICTED: beta-galactosidase 1                    233   4e-68   Vitis vinifera
ref|XP_002527409.1|  beta-galactosidase, putative                       233   4e-68   
dbj|BAJ96054.1|  predicted protein                                      233   5e-68   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK07157.1|  predicted protein                                      233   5e-68   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB58183.1|  hypothetical protein B456_009G198100                    228   5e-68   Gossypium raimondii
emb|CBI35944.3|  unnamed protein product                                232   5e-68   Vitis vinifera
ref|NP_001043405.1|  Os01g0580200                                       232   6e-68   
ref|XP_004969419.1|  PREDICTED: beta-galactosidase 2-like               232   6e-68   
ref|XP_003529875.1|  PREDICTED: beta-galactosidase 1-like               232   7e-68   
ref|XP_003558743.1|  PREDICTED: beta-galactosidase 5                    232   8e-68   
ref|XP_010939579.1|  PREDICTED: beta-galactosidase 2-like               232   8e-68   
ref|XP_004287850.1|  PREDICTED: beta-galactosidase 3                    232   8e-68   
gb|KDO65274.1|  hypothetical protein CISIN_1g002867mg                   232   1e-67   
ref|XP_006466038.1|  PREDICTED: beta-galactosidase 1-like               232   1e-67   
gb|KDO65277.1|  hypothetical protein CISIN_1g002867mg                   231   1e-67   
gb|KDO65275.1|  hypothetical protein CISIN_1g002867mg                   232   1e-67   
dbj|BAD20774.2|  beta-galactosidase                                     231   1e-67   
ref|XP_010542431.1|  PREDICTED: beta-galactosidase 1-like               231   1e-67   
emb|CDX97513.1|  BnaA05g25660D                                          231   1e-67   
emb|CDY04567.1|  BnaA07g13930D                                          231   1e-67   
ref|XP_008660537.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    231   1e-67   
gb|ACR35908.1|  unknown                                                 221   1e-67   
ref|XP_009146456.1|  PREDICTED: beta-galactosidase 1                    231   2e-67   
gb|KFK36177.1|  hypothetical protein AALP_AA4G088200                    229   2e-67   
emb|CDY36028.1|  BnaA08g04330D                                          229   2e-67   
gb|EEE65914.1|  hypothetical protein OsJ_21762                          226   2e-67   
ref|XP_009107461.1|  PREDICTED: beta-galactosidase 5-like isoform X1    229   2e-67   
gb|ACP18875.1|  beta-galactosidase pBG(a)                               230   3e-67   
ref|XP_009760186.1|  PREDICTED: beta-galactosidase-like isoform X3      230   3e-67   
ref|XP_009760187.1|  PREDICTED: beta-galactosidase-like isoform X4      230   3e-67   
ref|XP_009760185.1|  PREDICTED: beta-galactosidase-like isoform X2      230   3e-67   
gb|AAQ21369.1|  beta-galactosidase                                      230   3e-67   
ref|XP_009760184.1|  PREDICTED: beta-galactosidase-like isoform X1      230   3e-67   
ref|XP_006393673.1|  hypothetical protein EUTSA_v10011265mg             229   3e-67   
pdb|3W5F|A  Chain A, Crystal Structure Of Tomato Beta-galactosida...    229   4e-67   
ref|XP_006656180.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    228   4e-67   
gb|KHG23756.1|  Beta-galactosidase 5 -like protein                      229   4e-67   
gb|KJB58182.1|  hypothetical protein B456_009G198100                    228   5e-67   
ref|XP_006426535.1|  hypothetical protein CICLE_v10024886mg             229   5e-67   
ref|XP_006426534.1|  hypothetical protein CICLE_v10024886mg             229   5e-67   
gb|KHF97862.1|  Beta-galactosidase 3                                    224   6e-67   
gb|ABR16628.1|  unknown                                                 229   6e-67   
ref|XP_002305449.1|  beta-galactosidase family protein                  228   6e-67   
gb|EMS68743.1|  Beta-galactosidase 4                                    227   6e-67   
ref|XP_010061261.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    228   7e-67   
ref|XP_009133878.1|  PREDICTED: beta-galactosidase 8-like               229   7e-67   
ref|XP_004951447.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    228   7e-67   
emb|CDY31204.1|  BnaC03g46870D                                          229   8e-67   
gb|KJB63588.1|  hypothetical protein B456_010G007300                    225   8e-67   
ref|XP_004985588.1|  PREDICTED: beta-galactosidase 5-like isoform X1    229   8e-67   
gb|AFW66042.1|  hypothetical protein ZEAMMB73_706783                    227   8e-67   
ref|XP_006838689.1|  hypothetical protein AMTR_s00002p00246870          229   9e-67   
gb|AHL69742.1|  beta-galactosidase                                      229   9e-67   
ref|XP_008679838.1|  PREDICTED: beta-galactosidase 4                    228   9e-67   
dbj|BAC10578.2|  beta-galactosidase                                     228   1e-66   
dbj|BAF31234.1|  beta-D-galactosidase                                   229   1e-66   
ref|XP_010534899.1|  PREDICTED: beta-galactosidase 1                    229   1e-66   
ref|XP_009611026.1|  PREDICTED: beta-galactosidase-like isoform X1      229   1e-66   
ref|XP_006409871.1|  hypothetical protein EUTSA_v10016234mg             229   1e-66   
ref|XP_009611028.1|  PREDICTED: beta-galactosidase-like isoform X2      229   1e-66   
ref|XP_010110010.1|  Beta-galactosidase 3                               228   1e-66   
gb|KDO71054.1|  hypothetical protein CISIN_1g003044mg                   226   1e-66   
ref|XP_002465807.1|  hypothetical protein SORBIDRAFT_01g046160          228   1e-66   
ref|XP_006407174.1|  hypothetical protein EUTSA_v10020056mg             228   1e-66   
gb|AAL24206.1|  At1g45130/F27F5_20                                      227   1e-66   
ref|XP_008377189.1|  PREDICTED: beta-galactosidase 5-like               228   1e-66   
gb|KHN39301.1|  Beta-galactosidase 1                                    228   1e-66   
ref|NP_175127.1|  beta-galactosidase 5                                  227   1e-66   
emb|CAB64741.1|  putative beta-galactosidase                            227   2e-66   
ref|XP_006296187.1|  hypothetical protein CARUB_v10025350mg             228   2e-66   
ref|XP_010510620.1|  PREDICTED: beta-galactosidase 8-like               228   2e-66   
ref|XP_009757670.1|  PREDICTED: beta-galactosidase-like isoform X1      228   2e-66   
ref|NP_001057920.1|  Os06g0573600                                       227   2e-66   
ref|XP_007135555.1|  hypothetical protein PHAVU_010G139300g             228   2e-66   
ref|XP_009129554.1|  PREDICTED: beta-galactosidase 5                    227   2e-66   
ref|XP_011100972.1|  PREDICTED: beta-galactosidase 3-like               228   2e-66   
ref|XP_009757671.1|  PREDICTED: beta-galactosidase-like isoform X2      228   2e-66   
gb|AFW66041.1|  hypothetical protein ZEAMMB73_706783                    228   2e-66   
gb|EAZ01416.1|  hypothetical protein OsI_23450                          227   2e-66   
gb|KJB17716.1|  hypothetical protein B456_003G011900                    228   2e-66   
ref|XP_010470077.1|  PREDICTED: beta-galactosidase 8-like               228   2e-66   
gb|KJB63586.1|  hypothetical protein B456_010G007300                    223   2e-66   
ref|XP_004291830.1|  PREDICTED: beta-galactosidase 5                    227   2e-66   
ref|XP_009396354.1|  PREDICTED: beta-galactosidase 5-like               228   2e-66   
ref|XP_007158612.1|  hypothetical protein PHAVU_002G1672000g            218   2e-66   
ref|XP_008643999.1|  PREDICTED: uncharacterized protein LOC100382...    228   2e-66   
emb|CDY53959.1|  BnaCnng25850D                                          226   2e-66   
ref|XP_007204246.1|  hypothetical protein PRUPE_ppa002271mg             226   2e-66   
emb|CDY47949.1|  BnaA10g28210D                                          226   3e-66   
gb|AAK40304.1|  beta-galactosidase                                      226   3e-66   
ref|XP_006380782.1|  hypothetical protein POPTR_0007s13540g             224   3e-66   
ref|XP_011077977.1|  PREDICTED: beta-galactosidase-like                 226   3e-66   
ref|XP_002263382.2|  PREDICTED: beta-galactosidase 3                    227   3e-66   
ref|XP_002891311.1|  hypothetical protein ARALYDRAFT_473836             226   3e-66   
dbj|BAD91082.1|  beta-D-galactosidase                                   227   4e-66   
gb|KGN59998.1|  hypothetical protein Csa_3G865330                       226   5e-66   
ref|XP_010932916.1|  PREDICTED: beta-galactosidase 5-like               227   5e-66   
tpg|DAA58690.1|  TPA: hypothetical protein ZEAMMB73_223728              217   6e-66   
ref|XP_009395554.1|  PREDICTED: beta-galactosidase 5                    227   6e-66   
ref|XP_007042084.1|  Beta-galactosidase 3 isoform 2                     224   6e-66   
emb|CDY23637.1|  BnaC05g39570D                                          226   7e-66   
gb|KHG11061.1|  Beta-galactosidase 5 -like protein                      225   8e-66   
ref|XP_010113483.1|  Beta-galactosidase 3                               226   8e-66   
ref|XP_008809207.1|  PREDICTED: beta-galactosidase 5-like               226   8e-66   
gb|AAW47739.1|  beta-galactosidase                                      226   9e-66   
gb|EPS70273.1|  beta-galactosidase                                      223   9e-66   
gb|KJB63587.1|  hypothetical protein B456_010G007300                    225   1e-65   
gb|KJB63585.1|  hypothetical protein B456_010G007300                    225   1e-65   
ref|XP_011083163.1|  PREDICTED: beta-galactosidase 3                    226   1e-65   
ref|XP_003589339.1|  Beta-galactosidase                                 225   1e-65   
emb|CAN78072.1|  hypothetical protein VITISV_013292                     226   1e-65   
emb|CBI19767.3|  unnamed protein product                                226   1e-65   
ref|NP_001268162.1|  beta-galactosidase BG1-like precursor              226   1e-65   
ref|XP_002453540.1|  hypothetical protein SORBIDRAFT_04g007660          224   1e-65   
ref|XP_010917686.1|  PREDICTED: beta-galactosidase 5-like               226   1e-65   
ref|XP_011037170.1|  PREDICTED: beta-galactosidase 5-like               225   1e-65   
gb|EMT10014.1|  Beta-galactosidase 5                                    226   1e-65   
ref|XP_008799994.1|  PREDICTED: beta-galactosidase 5-like               226   1e-65   
gb|AGR44466.1|  beta-D-galactosidase 7                                  226   1e-65   
ref|XP_004509327.1|  PREDICTED: beta-galactosidase 3-like               226   1e-65   
emb|CAB64744.1|  putative beta-galactosidase                            226   2e-65   
dbj|BAD91084.1|  beta-D-galactosidase                                   226   2e-65   
ref|XP_004147848.1|  PREDICTED: beta-galactosidase 3-like               226   2e-65   
ref|NP_001189624.1|  beta-galactosidase 8                               226   2e-65   
ref|NP_850121.1|  beta-galactosidase 8                                  226   2e-65   
ref|XP_009603021.1|  PREDICTED: beta-galactosidase 5                    224   2e-65   
gb|EEC74580.1|  hypothetical protein OsI_10152                          225   2e-65   
gb|EEE58382.1|  hypothetical protein OsJ_09539                          225   2e-65   
ref|XP_006306871.1|  hypothetical protein CARUB_v10008424mg             224   2e-65   
gb|KJB43420.1|  hypothetical protein B456_007G198900                    222   2e-65   
gb|KDO49473.1|  hypothetical protein CISIN_1g0051602mg                  218   2e-65   
ref|XP_010649088.1|  PREDICTED: beta-galactosidase 3                    225   2e-65   
ref|XP_010552493.1|  PREDICTED: beta-galactosidase 5                    224   2e-65   
gb|KDO71053.1|  hypothetical protein CISIN_1g003044mg                   225   2e-65   
ref|NP_001049068.1|  Os03g0165400                                       225   2e-65   
gb|AAM22973.1|AF499737_1  beta-galactosidase                            225   2e-65   
gb|AAD21482.1|  putative beta-galactosidase                             225   2e-65   
ref|XP_007225291.1|  hypothetical protein PRUPE_ppa001334mg             225   2e-65   
gb|KDO71052.1|  hypothetical protein CISIN_1g003044mg                   225   2e-65   
gb|KHN12675.1|  Beta-galactosidase 5                                    224   2e-65   
ref|XP_008337843.1|  PREDICTED: beta-galactosidase 3                    225   2e-65   
ref|XP_008241765.1|  PREDICTED: beta-galactosidase 3                    225   2e-65   
ref|XP_008466519.1|  PREDICTED: beta-galactosidase 5-like               225   2e-65   
ref|XP_008672351.1|  PREDICTED: hypothetical protein isoform X1         225   2e-65   
ref|XP_011457728.1|  PREDICTED: beta-galactosidase 3-like               225   2e-65   
ref|XP_007042083.1|  Beta-galactosidase 3 isoform 1                     224   3e-65   
emb|CDX83288.1|  BnaA03g22180D                                          225   3e-65   
gb|KFK32294.1|  hypothetical protein AALP_AA6G223900                    225   3e-65   
gb|ABF94150.1|  Beta-galactosidase precursor, putative, expressed       224   3e-65   
gb|KJB32548.1|  hypothetical protein B456_005G246600                    221   3e-65   
ref|XP_002310279.2|  beta-galactosidase family protein                  224   3e-65   
ref|XP_007046795.1|  Beta-galactosidase 3 isoform 2                     223   4e-65   
gb|KHN27041.1|  Beta-galactosidase 3                                    224   4e-65   
ref|XP_003548865.1|  PREDICTED: beta-galactosidase 3-like               224   4e-65   
gb|KDP38567.1|  hypothetical protein JCGZ_04492                         224   4e-65   
ref|XP_009761050.1|  PREDICTED: beta-galactosidase 5                    223   4e-65   
ref|XP_008338023.1|  PREDICTED: beta-galactosidase 3-like               224   5e-65   
emb|CDP07463.1|  unnamed protein product                                224   6e-65   
gb|KDO84692.1|  hypothetical protein CISIN_1g003076mg                   221   7e-65   
emb|CDP01954.1|  unnamed protein product                                224   8e-65   
ref|XP_008388000.1|  PREDICTED: beta-galactosidase 5                    224   8e-65   
ref|NP_001265904.1|  beta-galactosidase 5-like precursor                223   8e-65   
ref|XP_010672619.1|  PREDICTED: beta-galactosidase 5                    223   8e-65   
gb|EEE54862.1|  hypothetical protein OsJ_02342                          223   9e-65   
ref|XP_008221339.1|  PREDICTED: beta-galactosidase 5                    223   9e-65   
ref|XP_002510455.1|  beta-galactosidase, putative                       223   9e-65   
ref|XP_006425593.1|  hypothetical protein CICLE_v10024881mg             223   9e-65   
ref|XP_004238611.1|  PREDICTED: beta-galactosidase 5                    222   1e-64   
gb|EPS64494.1|  beta-galactosidase                                      222   1e-64   
ref|XP_007046794.1|  Beta-galactosidase 3 isoform 1                     223   1e-64   
gb|KJB43418.1|  hypothetical protein B456_007G198900                    221   1e-64   
gb|KHN20946.1|  Beta-galactosidase 5                                    222   1e-64   
ref|XP_006451463.1|  hypothetical protein CICLE_v10010258mg             222   1e-64   
ref|XP_010029731.1|  PREDICTED: beta-galactosidase 3                    223   1e-64   
ref|XP_011025878.1|  PREDICTED: beta-galactosidase 3                    223   1e-64   
ref|XP_006475426.1|  PREDICTED: beta-galactosidase-like                 222   1e-64   
gb|KGN48881.1|  hypothetical protein Csa_6G504610                       222   1e-64   
emb|CDO97013.1|  unnamed protein product                                222   1e-64   
ref|XP_009418404.1|  PREDICTED: beta-galactosidase 5-like isoform X1    223   1e-64   
ref|XP_009335672.1|  PREDICTED: beta-galactosidase 5                    223   2e-64   
ref|XP_009777047.1|  PREDICTED: beta-galactosidase 3-like               221   2e-64   
ref|XP_009614464.1|  PREDICTED: beta-galactosidase 3-like               221   2e-64   
ref|XP_009418405.1|  PREDICTED: beta-galactosidase 5-like isoform X2    223   2e-64   
ref|XP_007160714.1|  hypothetical protein PHAVU_001G010900g             221   2e-64   
ref|XP_011048837.1|  PREDICTED: beta-galactosidase 5                    223   2e-64   
ref|XP_002306893.1|  beta-galactosidase family protein                  223   2e-64   
ref|XP_004512085.1|  PREDICTED: beta-galactosidase 3-like               223   2e-64   
ref|XP_011083609.1|  PREDICTED: beta-galactosidase 3-like               222   2e-64   
ref|XP_006362025.1|  PREDICTED: beta-galactosidase 3-like               221   2e-64   
gb|AAF67342.1|  beta galactosidase                                      221   3e-64   
gb|KJB43422.1|  hypothetical protein B456_007G198900                    222   3e-64   
gb|KJB43419.1|  hypothetical protein B456_007G198900                    222   3e-64   
gb|EYU24087.1|  hypothetical protein MIMGU_mgv1a001258mg                222   3e-64   
ref|XP_002879094.1|  beta-glactosidase 8                                222   3e-64   
ref|XP_003520277.1|  PREDICTED: beta-galactosidase 3-like               222   3e-64   
gb|KJB43424.1|  hypothetical protein B456_007G198900                    222   3e-64   
ref|XP_006649450.1|  PREDICTED: beta-galactosidase 5-like               222   3e-64   
gb|KDO84691.1|  hypothetical protein CISIN_1g003076mg                   221   4e-64   
gb|ABK24373.1|  unknown                                                 222   4e-64   
ref|XP_004149980.1|  PREDICTED: beta-galactosidase 3-like               222   4e-64   
gb|KDO84688.1|  hypothetical protein CISIN_1g003076mg                   222   4e-64   
gb|KJB43423.1|  hypothetical protein B456_007G198900                    221   4e-64   
ref|XP_006473573.1|  PREDICTED: beta-galactosidase 3-like               222   4e-64   
gb|KDO73223.1|  hypothetical protein CISIN_1g003095mg                   217   4e-64   
ref|XP_008440778.1|  PREDICTED: beta-galactosidase 3                    222   4e-64   
ref|XP_006435076.1|  hypothetical protein CICLE_v10000260mg             221   4e-64   
ref|XP_011092826.1|  PREDICTED: beta-galactosidase 3                    220   5e-64   
gb|KDO84689.1|  hypothetical protein CISIN_1g003076mg                   221   5e-64   
gb|KDO84690.1|  hypothetical protein CISIN_1g003076mg                   221   5e-64   
ref|XP_010315322.1|  PREDICTED: beta-galactosidase 3-like               220   6e-64   
gb|KJB32549.1|  hypothetical protein B456_005G246600                    219   6e-64   
ref|XP_006342225.1|  PREDICTED: beta-galactosidase 3-like               220   6e-64   
ref|XP_010667155.1|  PREDICTED: putative beta-galactosidase             220   6e-64   
ref|XP_010679814.1|  PREDICTED: beta-galactosidase 3                    221   6e-64   
gb|KJB32547.1|  hypothetical protein B456_005G246600                    220   6e-64   
ref|XP_007156097.1|  hypothetical protein PHAVU_003G258300g             221   7e-64   
gb|EYU32887.1|  hypothetical protein MIMGU_mgv1a001295mg                221   7e-64   
gb|KHN41933.1|  Beta-galactosidase 3                                    221   1e-63   
gb|EYU31167.1|  hypothetical protein MIMGU_mgv1a001956mg                219   1e-63   
ref|XP_003538867.1|  PREDICTED: beta-galactosidase 3-like               221   1e-63   
ref|XP_004158882.1|  PREDICTED: beta-galactosidase 3-like               220   1e-63   
gb|KCW64027.1|  hypothetical protein EUGRSUZ_G01704                     216   2e-63   
ref|XP_006423393.1|  hypothetical protein CICLE_v10030257mg             218   3e-63   
ref|XP_007199661.1|  hypothetical protein PRUPE_ppa001363mg             219   3e-63   
gb|KDO73222.1|  hypothetical protein CISIN_1g003095mg                   217   3e-63   
ref|XP_008236954.1|  PREDICTED: beta-galactosidase 3-like               219   3e-63   
ref|XP_006487343.1|  PREDICTED: beta-galactosidase 3-like               218   3e-63   
gb|KHN00504.1|  Beta-galactosidase 3                                    219   4e-63   



>gb|AIU34464.1| putative beta-galactosidase 1 precursor, partial [Taraxacum brevicorniculatum]
Length=450

 Score =   247 bits (631),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 122/136 (90%), Gaps = 0/136 (0%)
 Frame = +3

Query  123  WFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIF  302
            W     ASVSYD  A  ING R+ILISGSIHYPRSTPEMWPDL+QKAKEGGLDVIQTY+F
Sbjct  12   WGCFCTASVSYDHRAISINGERRILISGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYVF  71

Query  303  WNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGI  482
            WNGHEPQPGKYYFEDRYD+VKFIKL ++AGLY HLRIGPYAC EWNFGGFPVWLK+VPGI
Sbjct  72   WNGHEPQPGKYYFEDRYDLVKFIKLIKEAGLYAHLRIGPYACAEWNFGGFPVWLKYVPGI  131

Query  483  SFRTDNEPFKSAMQKF  530
            SFRTDN PFK+AM+KF
Sbjct  132  SFRTDNAPFKAAMEKF  147



>ref|XP_003550633.1| PREDICTED: beta-galactosidase-like [Glycine max]
Length=839

 Score =   255 bits (652),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +3

Query  123  WFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIF  302
            W  +V ASV+YD  A ++NG R+ILISGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+F
Sbjct  23   WVCAVTASVTYDHKAIVVNGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVF  82

Query  303  WNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGI  482
            WNGHEP PGKYYFEDRYD+VKFIKL QQAGLYVHLRIGPY C EWNFGGFPVWLK+VPGI
Sbjct  83   WNGHEPSPGKYYFEDRYDLVKFIKLVQQAGLYVHLRIGPYICAEWNFGGFPVWLKYVPGI  142

Query  483  SFRTDNEPFKSAMQKF  530
            +FRTDNEPFK+AMQKF
Sbjct  143  AFRTDNEPFKAAMQKF  158



>gb|KJB65165.1| hypothetical protein B456_010G082900 [Gossypium raimondii]
 gb|KJB65168.1| hypothetical protein B456_010G082900 [Gossypium raimondii]
Length=634

 Score =   250 bits (639),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
            FS V+A+VSYD  A IING R+IL+SGSIHYPRSTP+MWPDL+ KAKEGGLDVIQTY+FW
Sbjct  26   FSLVSATVSYDSKAIIINGRRRILLSGSIHYPRSTPQMWPDLIAKAKEGGLDVIQTYVFW  85

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PG YYFEDRYD+V+FIKL QQAGLYVHLRIGPY C EWNFGGFPVWLK+VPGI+
Sbjct  86   NGHEPSPGNYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYICAEWNFGGFPVWLKYVPGIA  145

Query  486  FRTDNEPFKSAMQKF  530
            FRTDNEPFK+AMQKF
Sbjct  146  FRTDNEPFKAAMQKF  160



>ref|NP_001265889.1| beta-galactosidase-like precursor [Cicer arietinum]
 emb|CAA09457.1| beta-galactosidase [Cicer arietinum]
Length=723

 Score =   252 bits (643),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 123/136 (90%), Gaps = 0/136 (0%)
 Frame = +3

Query  123  WFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIF  302
            W  +V ASV+YD    +I+G R+ILISGSIHYPRSTPEMWP L QKAKEGGLDVIQTY+F
Sbjct  17   WVCAVTASVTYDHKTIVIDGQRRILISGSIHYPRSTPEMWPALFQKAKEGGLDVIQTYVF  76

Query  303  WNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGI  482
            WNGHEP PGKYYFEDR+D+VKFIKLAQQAGLYVHLRIGPY C EWNFGGFPVWLK+VPGI
Sbjct  77   WNGHEPSPGKYYFEDRFDLVKFIKLAQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGI  136

Query  483  SFRTDNEPFKSAMQKF  530
            SFRTDNEPFK+AMQKF
Sbjct  137  SFRTDNEPFKAAMQKF  152



>ref|XP_004174126.1| PREDICTED: beta-galactosidase-like, partial [Cucumis sativus]
Length=154

 Score =   236 bits (601),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = +3

Query  144  SVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNGHEPQ  323
            SV+YD  A IING R+ILISGSIHYPRSTP+MWPDL+QKAK+GGLD+I+TY+FWNGHEP 
Sbjct  1    SVTYDHKAIIINGQRRILISGSIHYPRSTPQMWPDLIQKAKDGGLDIIETYVFWNGHEPS  60

Query  324  PGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFRTDNE  503
            P KYYFE+RYD+V+FIKL QQAGLYVHLRIGPY C EWN+GGFP+WLKFVPGI+FRTDN 
Sbjct  61   PDKYYFEERYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNYGGFPLWLKFVPGIAFRTDNA  120

Query  504  PFKSAMQKF  530
            PFK+AMQKF
Sbjct  121  PFKAAMQKF  129



>gb|AAF67341.1| beta galactosidase [Vigna radiata]
Length=721

 Score =   251 bits (641),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +3

Query  123  WFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIF  302
            W   V ASV+YD  A +I+G R+ILISGSIHYPRSTP+MWPDL+QKAK+GGLDVIQTY+F
Sbjct  17   WVCGVTASVTYDHKAIVIDGKRRILISGSIHYPRSTPQMWPDLIQKAKDGGLDVIQTYVF  76

Query  303  WNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGI  482
            WNGHEP PGKYYFEDRYD+V+F+KLAQQAGLYVHLRIGPY C EWNFGGFPVWLK+VPGI
Sbjct  77   WNGHEPSPGKYYFEDRYDLVRFVKLAQQAGLYVHLRIGPYICAEWNFGGFPVWLKYVPGI  136

Query  483  SFRTDNEPFKSAMQKF  530
            +FRTDNEPFK+AMQKF
Sbjct  137  AFRTDNEPFKAAMQKF  152



>ref|XP_006587007.1| PREDICTED: beta-galactosidase-like [Glycine max]
Length=615

 Score =   248 bits (634),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +3

Query  123  WFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIF  302
            W   V ASV+YD  A +++G R+ILISGSIHYPRSTP+MWPDL+QKAK+GGLDVIQTY+F
Sbjct  17   WVCGVTASVTYDHKAIVVDGKRRILISGSIHYPRSTPQMWPDLIQKAKDGGLDVIQTYVF  76

Query  303  WNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGI  482
            WNGHEP PG+YYFEDR+D+VKF+KLAQQAGLYVHLRIGPY C EWN GGFPVWLK+VPGI
Sbjct  77   WNGHEPSPGQYYFEDRFDLVKFVKLAQQAGLYVHLRIGPYICAEWNLGGFPVWLKYVPGI  136

Query  483  SFRTDNEPFKSAMQKF  530
            +FRTDNEPFK+AMQKF
Sbjct  137  AFRTDNEPFKAAMQKF  152



>ref|XP_010049745.1| PREDICTED: beta-galactosidase-like [Eucalyptus grandis]
 gb|KCW82505.1| hypothetical protein EUGRSUZ_C03897 [Eucalyptus grandis]
Length=722

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            +W SSV+ SVSYD+ A II+G R+ILISGSIHYPRSTPEMWPDL++KAKEGGLDVIQTY+
Sbjct  14   SWASSVSCSVSYDRKAIIIDGKRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYV  73

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEP PG YYFEDRYD+V+FIKL QQAGLYVHLRIGPY C EWNFGGFPVWLKFVPG
Sbjct  74   FWNGHEPSPGNYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKFVPG  133

Query  480  ISFRTDNEPFKSAMQKF  530
            I+FRT+N+PF+ AMQ+F
Sbjct  134  IAFRTNNKPFQDAMQRF  150



>ref|XP_010448319.1| PREDICTED: beta-galactosidase 12-like isoform X1 [Camelina sativa]
Length=728

 Score =   251 bits (640),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
              SV A+V+YD+ A IING R+IL+SGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FW
Sbjct  22   ICSVKATVTYDRKAVIINGQRRILLSGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFW  81

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PG+YYFEDRYD+VKFIKL QQAGLYVHLRIGPY C EWNFGGFPVWLK+VPG+ 
Sbjct  82   NGHEPSPGQYYFEDRYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGMV  141

Query  486  FRTDNEPFKSAMQKF  530
            FRTDNEPFK+AMQKF
Sbjct  142  FRTDNEPFKAAMQKF  156



>ref|XP_009352652.1| PREDICTED: beta-galactosidase [Pyrus x bretschneideri]
Length=731

 Score =   251 bits (640),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
            FS+ +ASVSYD  A IING ++ILISGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FW
Sbjct  19   FSAASASVSYDHKAIIINGQKRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFW  78

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PGKYYFEDRYD+VKFIKL QQAGL+V+LRIGPY C EWNFGGFPVWLK+VPGI+
Sbjct  79   NGHEPSPGKYYFEDRYDLVKFIKLVQQAGLFVNLRIGPYVCAEWNFGGFPVWLKYVPGIA  138

Query  486  FRTDNEPFKSAMQKF  530
            FRTDNEPFK+AMQKF
Sbjct  139  FRTDNEPFKAAMQKF  153



>dbj|BAE72073.1| pear beta-galactosidase1 [Pyrus communis]
Length=731

 Score =   251 bits (640),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
            FS+ +ASVSYD  A IING ++ILISGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FW
Sbjct  19   FSAASASVSYDHKAIIINGQKRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFW  78

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PGKYYFEDRYD+VKFIKL QQAGL+V+LRIGPY C EWNFGGFPVWLK+VPGI+
Sbjct  79   NGHEPSPGKYYFEDRYDLVKFIKLVQQAGLFVNLRIGPYVCAEWNFGGFPVWLKYVPGIA  138

Query  486  FRTDNEPFKSAMQKF  530
            FRTDNEPFK+AMQKF
Sbjct  139  FRTDNEPFKAAMQKF  153



>dbj|BAB21492.1| beta-D-galactosidase [Pyrus pyrifolia]
Length=731

 Score =   251 bits (640),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
            FS+ +ASVSYD  A IING ++ILISGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FW
Sbjct  19   FSAASASVSYDHKAIIINGQKRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFW  78

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PGKYYFEDRYD+VKFIKL QQAGL+V+LRIGPY C EWNFGGFPVWLK+VPGI+
Sbjct  79   NGHEPSPGKYYFEDRYDLVKFIKLVQQAGLFVNLRIGPYVCAEWNFGGFPVWLKYVPGIA  138

Query  486  FRTDNEPFKSAMQKF  530
            FRTDNEPFK+AMQKF
Sbjct  139  FRTDNEPFKAAMQKF  153



>gb|KJB65166.1| hypothetical protein B456_010G082900 [Gossypium raimondii]
Length=697

 Score =   250 bits (638),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
            FS V+A+VSYD  A IING R+IL+SGSIHYPRSTP+MWPDL+ KAKEGGLDVIQTY+FW
Sbjct  26   FSLVSATVSYDSKAIIINGRRRILLSGSIHYPRSTPQMWPDLIAKAKEGGLDVIQTYVFW  85

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PG YYFEDRYD+V+FIKL QQAGLYVHLRIGPY C EWNFGGFPVWLK+VPGI+
Sbjct  86   NGHEPSPGNYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYICAEWNFGGFPVWLKYVPGIA  145

Query  486  FRTDNEPFKSAMQKF  530
            FRTDNEPFK+AMQKF
Sbjct  146  FRTDNEPFKAAMQKF  160



>ref|XP_010448320.1| PREDICTED: beta-galactosidase 12-like isoform X2 [Camelina sativa]
Length=726

 Score =   250 bits (639),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
              SV A+V+YD+ A IING R+IL+SGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FW
Sbjct  22   ICSVKATVTYDRKAVIINGQRRILLSGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFW  81

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PG+YYFEDRYD+VKFIKL QQAGLYVHLRIGPY C EWNFGGFPVWLK+VPG+ 
Sbjct  82   NGHEPSPGQYYFEDRYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGMV  141

Query  486  FRTDNEPFKSAMQKF  530
            FRTDNEPFK+AMQKF
Sbjct  142  FRTDNEPFKAAMQKF  156



>gb|EYU45189.1| hypothetical protein MIMGU_mgv1a003101mg [Erythranthe guttata]
Length=608

 Score =   248 bits (633),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = +3

Query  129  SSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWN  308
            SSV A+VSYD  AFIING RKILISGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FWN
Sbjct  18   SSVRATVSYDDKAFIINGQRKILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWN  77

Query  309  GHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISF  488
            GHEP PG Y FE R+D+VKFIKLA QAGLYVHLRIGPY CGEWNFGGFPVWLK+VPGI F
Sbjct  78   GHEPSPGNYNFEGRFDLVKFIKLAHQAGLYVHLRIGPYVCGEWNFGGFPVWLKYVPGIEF  137

Query  489  RTDNEPFKSAMQKF  530
            RTDN+PFK AMQ+F
Sbjct  138  RTDNQPFKVAMQRF  151



>emb|CAH18936.1| beta-galactosidase [Pyrus communis]
Length=724

 Score =   250 bits (639),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
            FS+ +ASVSYD  A IING ++ILISGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FW
Sbjct  12   FSAASASVSYDHKAIIINGQKRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFW  71

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PGKYYFEDRYD+VKFIKL QQAGL+V+LRIGPY C EWNFGGFPVWLK+VPGI+
Sbjct  72   NGHEPSPGKYYFEDRYDLVKFIKLVQQAGLFVNLRIGPYVCAEWNFGGFPVWLKYVPGIA  131

Query  486  FRTDNEPFKSAMQKF  530
            FRTDNEPFK+AMQKF
Sbjct  132  FRTDNEPFKAAMQKF  146



>ref|XP_008391326.1| PREDICTED: beta-galactosidase 1 [Malus domestica]
Length=843

 Score =   252 bits (643),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            +W  SV ASVSYD  A +INGHRKILISGSIHYPRS+PEMWPDL+QKAKEGGLDVIQTY+
Sbjct  21   SWVGSVRASVSYDSKAIVINGHRKILISGSIHYPRSSPEMWPDLIQKAKEGGLDVIQTYV  80

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEP PGKYYFED YD+VKFIKL QQAGLYVHLRIGPY C EWNFGGFPVWLK++PG
Sbjct  81   FWNGHEPSPGKYYFEDNYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPG  140

Query  480  ISFRTDNEPFKSAMQKF  530
            I FRTDN PFK+ MQ+F
Sbjct  141  IQFRTDNGPFKNQMQRF  157



>ref|NP_194344.2| beta-galactosidase 12 [Arabidopsis thaliana]
 gb|AAM20463.1| putative beta-galactosidase [Arabidopsis thaliana]
 gb|AAN15586.1| putative beta-galactosidase [Arabidopsis thaliana]
 gb|AEE85163.1| beta-galactosidase 12 [Arabidopsis thaliana]
Length=636

 Score =   248 bits (634),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
              SV A V+YD+ A IING R+IL+SGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FW
Sbjct  22   ICSVKAIVTYDRKAVIINGQRRILLSGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFW  81

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PG+YYFEDRYD+VKFIK+ QQAGLYVHLRIGPY C EWNFGGFPVWLK+VPG+ 
Sbjct  82   NGHEPSPGQYYFEDRYDLVKFIKVVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGMV  141

Query  486  FRTDNEPFKSAMQKF  530
            FRTDNEPFK+AMQKF
Sbjct  142  FRTDNEPFKAAMQKF  156



>gb|KCW79522.1| hypothetical protein EUGRSUZ_C00898 [Eucalyptus grandis]
Length=615

 Score =   248 bits (632),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  135  VNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNGH  314
            V ASV+YD  A I+NG R+ILISGSIHYPRSTP MWPDL+QKAK+GGLDVIQTY+FWNGH
Sbjct  40   VAASVTYDHRALIVNGKRRILISGSIHYPRSTPGMWPDLIQKAKDGGLDVIQTYVFWNGH  99

Query  315  EPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFRT  494
            EP PGKYYFEDRYD+V+FIKL QQAGLYVHLRIGPY C EWNFGGFPVWLKFVPGI FRT
Sbjct  100  EPSPGKYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKFVPGIVFRT  159

Query  495  DNEPFKSAMQKF  530
            DNEPFK+AMQ+F
Sbjct  160  DNEPFKAAMQRF  171



>ref|XP_004135820.1| PREDICTED: beta-galactosidase-like [Cucumis sativus]
Length=486

 Score =   244 bits (623),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            TW  S   SV+YD  A IING R+ILISGSIHYPRSTP+MWPDL+QKAK+GGLD+I+TY+
Sbjct  13   TWVCSTIGSVTYDHKAIIINGRRRILISGSIHYPRSTPQMWPDLIQKAKDGGLDIIETYV  72

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEP PGKYYFE+RYD+V+FIKL QQAGLYVHLRIGPY C EWN+GGFP+WLKFVPG
Sbjct  73   FWNGHEPSPGKYYFEERYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNYGGFPIWLKFVPG  132

Query  480  ISFRTDNEPFKSAMQKF  530
            I+FRTDN PFK+AMQKF
Sbjct  133  IAFRTDNAPFKAAMQKF  149



>gb|AES59331.2| beta-like galactosidase [Medicago truncatula]
Length=730

 Score =   250 bits (638),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 110/136 (81%), Positives = 123/136 (90%), Gaps = 0/136 (0%)
 Frame = +3

Query  123  WFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIF  302
            W   V ASVSYD  A +I+G R+ILISGSIHYPRSTPEMWPDL QKAK+GGLDVIQTY+F
Sbjct  23   WVCGVTASVSYDHKALVIDGQRRILISGSIHYPRSTPEMWPDLFQKAKDGGLDVIQTYVF  82

Query  303  WNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGI  482
            WNGHEP PG YYFEDR+D+VKF+KLAQQAGLYVHLRIGPY C EWN+GGFPVWLK+VPG+
Sbjct  83   WNGHEPSPGNYYFEDRFDLVKFVKLAQQAGLYVHLRIGPYVCAEWNYGGFPVWLKYVPGM  142

Query  483  SFRTDNEPFKSAMQKF  530
            +FRTDNEPFK+AMQKF
Sbjct  143  AFRTDNEPFKAAMQKF  158



>gb|KJB07253.1| hypothetical protein B456_001G011600 [Gossypium raimondii]
Length=642

 Score =   248 bits (633),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
            FS V+A+VSYD  A IING R+IL+SGSIHYPRSTPEMWPDL+ KAKEGGLDVIQTY+FW
Sbjct  30   FSLVSATVSYDSKAIIINGRRRILLSGSIHYPRSTPEMWPDLIAKAKEGGLDVIQTYVFW  89

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PGKYYFEDRYD+V+F+KL QQAGLYV+LRIGPY C EWNFGGFPVWLK+VPGI+
Sbjct  90   NGHEPSPGKYYFEDRYDLVRFVKLVQQAGLYVNLRIGPYVCAEWNFGGFPVWLKYVPGIA  149

Query  486  FRTDNEPFKSAMQKF  530
            FRTDN PFK+AMQKF
Sbjct  150  FRTDNGPFKAAMQKF  164



>ref|XP_010433545.1| PREDICTED: beta-galactosidase 12-like isoform X2 [Camelina sativa]
Length=726

 Score =   249 bits (637),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
              SVNA+V+YD+ A IING R+IL+SGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FW
Sbjct  22   ICSVNATVTYDRKAVIINGQRRILLSGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFW  81

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PG YYFEDRY++VKFIKL QQAGLYVHLRIGPY C EWNFGGFPVWLK+VPG+ 
Sbjct  82   NGHEPSPGLYYFEDRYNLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGMV  141

Query  486  FRTDNEPFKSAMQKF  530
            FRTDNEPFK+AMQKF
Sbjct  142  FRTDNEPFKAAMQKF  156



>ref|XP_010433544.1| PREDICTED: beta-galactosidase 12-like isoform X1 [Camelina sativa]
Length=728

 Score =   249 bits (637),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
              SVNA+V+YD+ A IING R+IL+SGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FW
Sbjct  22   ICSVNATVTYDRKAVIINGQRRILLSGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFW  81

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PG YYFEDRY++VKFIKL QQAGLYVHLRIGPY C EWNFGGFPVWLK+VPG+ 
Sbjct  82   NGHEPSPGLYYFEDRYNLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGMV  141

Query  486  FRTDNEPFKSAMQKF  530
            FRTDNEPFK+AMQKF
Sbjct  142  FRTDNEPFKAAMQKF  156



>emb|CDX88594.1| BnaA03g10550D [Brassica napus]
Length=325

 Score =   239 bits (610),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = +3

Query  129  SSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWN  308
             SV A+VSYD+ A IING R+IL+SGSIHYPRSTPEMWP L+QKAKEGGLDVI+TY+FWN
Sbjct  23   CSVKATVSYDRKAVIINGQRRILLSGSIHYPRSTPEMWPGLIQKAKEGGLDVIETYVFWN  82

Query  309  GHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISF  488
            GHEP PG YYF DRYD+VKFIKL  QAGLYV+LRIGPY C EWNFGGFPVWLKFVPG++F
Sbjct  83   GHEPSPGNYYFGDRYDLVKFIKLVHQAGLYVNLRIGPYVCAEWNFGGFPVWLKFVPGMAF  142

Query  489  RTDNEPFKSAMQKF  530
            RTDNEPFK+AM+KF
Sbjct  143  RTDNEPFKAAMKKF  156



>ref|XP_006413222.1| hypothetical protein EUTSA_v10024511mg [Eutrema salsugineum]
 gb|ESQ54675.1| hypothetical protein EUTSA_v10024511mg [Eutrema salsugineum]
Length=737

 Score =   249 bits (637),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
              SV A VSYD  A IING R+IL+SGSIHYPRSTPEMWPDL+QKAKEGGLDVIQTY+FW
Sbjct  22   ICSVKAMVSYDHKAVIINGQRRILVSGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYVFW  81

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PG+YYFEDRYD+VKFIKL QQAGLYVHLRIGPY C EWNFGGFP+WLK+VPG++
Sbjct  82   NGHEPSPGQYYFEDRYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPIWLKYVPGMA  141

Query  486  FRTDNEPFKSAMQKF  530
            FRTDNEPFK+AMQ F
Sbjct  142  FRTDNEPFKAAMQTF  156



>ref|XP_006357461.1| PREDICTED: beta-galactosidase-like, partial [Solanum tuberosum]
Length=866

 Score =   251 bits (642),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            +W  S   SVSYD+NA I+NG R+IL+SGSIHYPRSTPEMWPDL+QKAKEGG+DVIQTY+
Sbjct  46   SWVFSGMCSVSYDRNAIIVNGQRRILVSGSIHYPRSTPEMWPDLIQKAKEGGVDVIQTYV  105

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEP+ GKYYFE+RYD+VKFIK+  QAGLYVHLR+GPYAC EWNFGGFPVWLK+VPG
Sbjct  106  FWNGHEPEQGKYYFEERYDLVKFIKIVHQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPG  165

Query  480  ISFRTDNEPFKSAMQKF  530
            ISFRTDNEPFKSAMQKF
Sbjct  166  ISFRTDNEPFKSAMQKF  182



>ref|XP_009627536.1| PREDICTED: beta-galactosidase [Nicotiana tomentosiformis]
Length=845

 Score =   251 bits (641),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            +W S   ASVSYD  A I+NG RKILISGSIHYPRSTPEMWPDL+QKAKEGG+DVIQTY+
Sbjct  25   SWVSCGTASVSYDHKAIIVNGQRKILISGSIHYPRSTPEMWPDLIQKAKEGGVDVIQTYV  84

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEP+ GKYYFE RYD+VKFIK+ Q+AGLYVHLRIGPYAC EWNFGGFPVWLK+VPG
Sbjct  85   FWNGHEPEEGKYYFEGRYDLVKFIKVVQEAGLYVHLRIGPYACAEWNFGGFPVWLKYVPG  144

Query  480  ISFRTDNEPFKSAMQKF  530
            ISFRTDNEPFK+AMQKF
Sbjct  145  ISFRTDNEPFKAAMQKF  161



>gb|KCW69753.1| hypothetical protein EUGRSUZ_F031302, partial [Eucalyptus grandis]
Length=518

 Score =   244 bits (624),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +3

Query  132  SVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNG  311
            SV ASVSYD  A +ING R+ILISGSIHYPRSTPEMWPDL++KAKEGGLDVIQTY+FWNG
Sbjct  21   SVLASVSYDSKAIVINGQRRILISGSIHYPRSTPEMWPDLIEKAKEGGLDVIQTYVFWNG  80

Query  312  HEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFR  491
            HEP PGKYYFE  YD+VKFIKLA+QAGLYVHLRIGPY C EWNFGGFPVWLK++PGI+FR
Sbjct  81   HEPSPGKYYFEGNYDLVKFIKLAKQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGINFR  140

Query  492  TDNEPFKSAMQKF  530
            TDNEPFK  MQKF
Sbjct  141  TDNEPFKYQMQKF  153



>emb|CAC44502.1| beta-galactosidase [Fragaria x ananassa]
Length=722

 Score =   249 bits (635),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            +W SS  ASV YD  A I+NG R+ILISGSIHYPRSTPEMWPDLLQKAK+GGLDV+QTY+
Sbjct  18   SWLSSALASVGYDHRAIIVNGKRRILISGSIHYPRSTPEMWPDLLQKAKDGGLDVLQTYV  77

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEP PGKYYFEDRYD+VKFIKLAQQ GLYVHLRIGPY C EWNFGGFPVWLK+VPG
Sbjct  78   FWNGHEPSPGKYYFEDRYDLVKFIKLAQQHGLYVHLRIGPYICAEWNFGGFPVWLKYVPG  137

Query  480  ISFRTDNEPFKSAMQKF  530
            I+FRTDN PF +AM+KF
Sbjct  138  IAFRTDNRPFMAAMEKF  154



>ref|XP_010438795.1| PREDICTED: beta-galactosidase 12 isoform X1 [Camelina sativa]
Length=728

 Score =   249 bits (635),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
              SV A+V+YD+ A IING R+IL+SGS+HYPRSTPEMWPDL+QKAK+GGLDVIQTY+FW
Sbjct  22   ICSVKATVTYDRKAVIINGQRRILLSGSVHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFW  81

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PG+YYFEDRYD+VKFIKL QQAGLYVHLRIGPY C EWNFGGFPVWLK+VPG+ 
Sbjct  82   NGHEPSPGQYYFEDRYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGMV  141

Query  486  FRTDNEPFKSAMQKF  530
            FRTDNEPF++AMQKF
Sbjct  142  FRTDNEPFQAAMQKF  156



>ref|XP_010438797.1| PREDICTED: beta-galactosidase 12 isoform X2 [Camelina sativa]
Length=726

 Score =   249 bits (635),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
              SV A+V+YD+ A IING R+IL+SGS+HYPRSTPEMWPDL+QKAK+GGLDVIQTY+FW
Sbjct  22   ICSVKATVTYDRKAVIINGQRRILLSGSVHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFW  81

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PG+YYFEDRYD+VKFIKL QQAGLYVHLRIGPY C EWNFGGFPVWLK+VPG+ 
Sbjct  82   NGHEPSPGQYYFEDRYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGMV  141

Query  486  FRTDNEPFKSAMQKF  530
            FRTDNEPF++AMQKF
Sbjct  142  FRTDNEPFQAAMQKF  156



>ref|XP_006366152.1| PREDICTED: beta-galactosidase-like [Solanum tuberosum]
Length=839

 Score =   251 bits (640),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +3

Query  123  WFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIF  302
            W S   ASVSYD  A IING RKILISGSIHYPRSTPEMWPDL+QKAKEGG+DVIQTY+F
Sbjct  20   WVSCGIASVSYDHKAIIINGQRKILISGSIHYPRSTPEMWPDLIQKAKEGGVDVIQTYVF  79

Query  303  WNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGI  482
            WNGHEP+ GKYYFE+RYD+VKFIK+ Q+AGLYVHLRIGPYAC EWNFGGFPVWLK+VPGI
Sbjct  80   WNGHEPEEGKYYFEERYDLVKFIKVVQEAGLYVHLRIGPYACAEWNFGGFPVWLKYVPGI  139

Query  483  SFRTDNEPFKSAMQKF  530
            SFRTDNEPFK+AMQKF
Sbjct  140  SFRTDNEPFKAAMQKF  155



>ref|NP_001280755.1| beta-galactosidase precursor [Malus domestica]
 gb|AGE44111.1| beta-galactosidase 101 [Malus domestica]
Length=725

 Score =   249 bits (635),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
            FS+ +ASV YD  A IING R+ILISGSIHYPRSTPEMWPDL+QKAK GGLDVIQTY+FW
Sbjct  19   FSAASASVGYDHKAIIINGQRRILISGSIHYPRSTPEMWPDLIQKAKAGGLDVIQTYVFW  78

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PGKYYFEDRYD+VKFIKL QQAGL+V+LRIGPY C EWNFGGFP+WLK+VPGI+
Sbjct  79   NGHEPSPGKYYFEDRYDLVKFIKLVQQAGLFVNLRIGPYVCAEWNFGGFPIWLKYVPGIA  138

Query  486  FRTDNEPFKSAMQKF  530
            FRTDNEPFK+AMQKF
Sbjct  139  FRTDNEPFKAAMQKF  153



>gb|KCW69752.1| hypothetical protein EUGRSUZ_F031302 [Eucalyptus grandis]
Length=546

 Score =   244 bits (624),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +3

Query  132  SVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNG  311
            SV ASVSYD  A +ING R+ILISGSIHYPRSTPEMWPDL++KAKEGGLDVIQTY+FWNG
Sbjct  21   SVLASVSYDSKAIVINGQRRILISGSIHYPRSTPEMWPDLIEKAKEGGLDVIQTYVFWNG  80

Query  312  HEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFR  491
            HEP PGKYYFE  YD+VKFIKLA+QAGLYVHLRIGPY C EWNFGGFPVWLK++PGI+FR
Sbjct  81   HEPSPGKYYFEGNYDLVKFIKLAKQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGINFR  140

Query  492  TDNEPFKSAMQKF  530
            TDNEPFK  MQKF
Sbjct  141  TDNEPFKYQMQKF  153



>gb|AHG94611.1| beta-galactosidase [Camellia sinensis]
Length=843

 Score =   250 bits (639),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            +W SS  ASVSY+  A +ING R+ILISGSIHYPRSTPEMWPDL+QKAKEGGLDVIQTY+
Sbjct  21   SWVSSCTASVSYNSKAIVINGQRRILISGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYV  80

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEPQPGKYYFE R+D+V FIKL +QAGLY HLRIGPYAC EWNFGGFPVWLK+VPG
Sbjct  81   FWNGHEPQPGKYYFEGRFDLVNFIKLVKQAGLYXHLRIGPYACAEWNFGGFPVWLKYVPG  140

Query  480  ISFRTDNEPFKSAMQKF  530
            ISFRTDN PFK+AMQKF
Sbjct  141  ISFRTDNGPFKAAMQKF  157



>gb|KJB07254.1| hypothetical protein B456_001G011600 [Gossypium raimondii]
Length=701

 Score =   248 bits (632),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
            FS V+A+VSYD  A IING R+IL+SGSIHYPRSTPEMWPDL+ KAKEGGLDVIQTY+FW
Sbjct  30   FSLVSATVSYDSKAIIINGRRRILLSGSIHYPRSTPEMWPDLIAKAKEGGLDVIQTYVFW  89

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PGKYYFEDRYD+V+F+KL QQAGLYV+LRIGPY C EWNFGGFPVWLK+VPGI+
Sbjct  90   NGHEPSPGKYYFEDRYDLVRFVKLVQQAGLYVNLRIGPYVCAEWNFGGFPVWLKYVPGIA  149

Query  486  FRTDNEPFKSAMQKF  530
            FRTDN PFK+AMQKF
Sbjct  150  FRTDNGPFKAAMQKF  164



>ref|XP_004287559.1| PREDICTED: beta-galactosidase isoform X5 [Fragaria vesca subsp. 
vesca]
Length=722

 Score =   248 bits (633),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            +W SS  ASV YD  A I+NG R+ILISGSIHYPRSTPEMWPDLLQKAK+GGLDVIQTY+
Sbjct  18   SWLSSALASVGYDHRAIIVNGKRRILISGSIHYPRSTPEMWPDLLQKAKDGGLDVIQTYV  77

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEP PGKYYFEDRYD+VKFIKLAQQ GL+VHLRIGPY C EWNFGGFPVWLK+VPG
Sbjct  78   FWNGHEPSPGKYYFEDRYDLVKFIKLAQQHGLFVHLRIGPYICAEWNFGGFPVWLKYVPG  137

Query  480  ISFRTDNEPFKSAMQKF  530
            I+FRTDN PF +AM+KF
Sbjct  138  IAFRTDNRPFMAAMEKF  154



>ref|XP_009137581.1| PREDICTED: beta-galactosidase 12-like [Brassica rapa]
Length=729

 Score =   248 bits (634),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
              SV A+V+YD  A IING R+IL+SGSIHYPRSTPEMWPDL+QKAKEGGLDVIQTY+FW
Sbjct  22   ICSVKATVTYDHKAVIINGQRRILLSGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYVFW  81

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PG+YYFE+RYD+VKFIKL QQAGLYVHLRIGPY C EWNFGGFPVWLKFVP ++
Sbjct  82   NGHEPSPGQYYFEERYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKFVPDMA  141

Query  486  FRTDNEPFKSAMQKF  530
            FRTDNEPFK+AMQKF
Sbjct  142  FRTDNEPFKAAMQKF  156



>emb|CAB39679.1| putative beta-galactosidase [Arabidopsis thaliana]
 emb|CAB79469.1| putative beta-galactosidase [Arabidopsis thaliana]
Length=729

 Score =   248 bits (633),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
              SV A V+YD+ A IING R+IL+SGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FW
Sbjct  22   ICSVKAIVTYDRKAVIINGQRRILLSGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFW  81

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PG+YYFEDRYD+VKFIK+ QQAGLYVHLRIGPY C EWNFGGFPVWLK+VPG+ 
Sbjct  82   NGHEPSPGQYYFEDRYDLVKFIKVVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGMV  141

Query  486  FRTDNEPFKSAMQKF  530
            FRTDNEPFK+AMQKF
Sbjct  142  FRTDNEPFKAAMQKF  156



>gb|KHN24609.1| Beta-galactosidase [Glycine soja]
Length=710

 Score =   248 bits (632),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +3

Query  123  WFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIF  302
            W   V ASV+YD  A +++G R+ILISGSIHYPRSTP+MWPDL+QKAK+GGLDVIQTY+F
Sbjct  6    WVCGVTASVTYDHKAIVVDGKRRILISGSIHYPRSTPQMWPDLIQKAKDGGLDVIQTYVF  65

Query  303  WNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGI  482
            WNGHEP PG+YYFEDR+D+VKF+KL QQAGLYVHLRIGPY C EWNFGGFPVWLK+VPGI
Sbjct  66   WNGHEPSPGQYYFEDRFDLVKFVKLVQQAGLYVHLRIGPYICAEWNFGGFPVWLKYVPGI  125

Query  483  SFRTDNEPFKSAMQKF  530
            +FRTDNEPFK+AMQKF
Sbjct  126  AFRTDNEPFKAAMQKF  141



>gb|KJB65169.1| hypothetical protein B456_010G082900 [Gossypium raimondii]
Length=811

 Score =   249 bits (637),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
            FS V+A+VSYD  A IING R+IL+SGSIHYPRSTP+MWPDL+ KAKEGGLDVIQTY+FW
Sbjct  26   FSLVSATVSYDSKAIIINGRRRILLSGSIHYPRSTPQMWPDLIAKAKEGGLDVIQTYVFW  85

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PG YYFEDRYD+V+FIKL QQAGLYVHLRIGPY C EWNFGGFPVWLK+VPGI+
Sbjct  86   NGHEPSPGNYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYICAEWNFGGFPVWLKYVPGIA  145

Query  486  FRTDNEPFKSAMQKF  530
            FRTDNEPFK+AMQKF
Sbjct  146  FRTDNEPFKAAMQKF  160



>ref|NP_849553.1| beta-galactosidase 12 [Arabidopsis thaliana]
 sp|Q9SCV0.1|BGA12_ARATH RecName: Full=Beta-galactosidase 12; Short=Lactase 12; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB64748.1| putative beta-galactosidase [Arabidopsis thaliana]
 gb|AEE85162.1| beta-galactosidase 12 [Arabidopsis thaliana]
Length=728

 Score =   248 bits (633),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
              SV A V+YD+ A IING R+IL+SGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FW
Sbjct  22   ICSVKAIVTYDRKAVIINGQRRILLSGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFW  81

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PG+YYFEDRYD+VKFIK+ QQAGLYVHLRIGPY C EWNFGGFPVWLK+VPG+ 
Sbjct  82   NGHEPSPGQYYFEDRYDLVKFIKVVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGMV  141

Query  486  FRTDNEPFKSAMQKF  530
            FRTDNEPFK+AMQKF
Sbjct  142  FRTDNEPFKAAMQKF  156



>ref|XP_004241849.1| PREDICTED: beta-galactosidase-like [Solanum lycopersicum]
Length=841

 Score =   250 bits (638),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            +W  S   SVSYD+NA I+NG R+IL+SGSIHYPRSTPEMWPDL+QKAKEGG+DVIQTY+
Sbjct  21   SWVLSGMCSVSYDRNAIIVNGQRRILVSGSIHYPRSTPEMWPDLIQKAKEGGVDVIQTYV  80

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEP+ GKYYFE+RYD+VKFIK+  QAGLYVHLRIGPYAC EWNFGGFPVWLK+VPG
Sbjct  81   FWNGHEPEQGKYYFEERYDLVKFIKIVHQAGLYVHLRIGPYACAEWNFGGFPVWLKYVPG  140

Query  480  ISFRTDNEPFKSAMQKF  530
            ISFRTDN PFKSAMQKF
Sbjct  141  ISFRTDNAPFKSAMQKF  157



>ref|XP_008450855.1| PREDICTED: beta-galactosidase-like [Cucumis melo]
Length=719

 Score =   248 bits (632),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            TW  S   SV+YD+ A IING R+ILISGSIHYPRSTP+MWPDL+Q AK+GGLD+I+TY+
Sbjct  13   TWVCSTIGSVTYDQKAIIINGQRRILISGSIHYPRSTPQMWPDLIQNAKDGGLDIIETYV  72

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEP PGKYYFE+RYD+V+FIKL QQAGLYVHLRIGPY C EWN+GGFP+WLKFVPG
Sbjct  73   FWNGHEPSPGKYYFEERYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNYGGFPIWLKFVPG  132

Query  480  ISFRTDNEPFKSAMQKF  530
            I+FRTDNEPFK+AMQKF
Sbjct  133  IAFRTDNEPFKAAMQKF  149



>ref|XP_009367552.1| PREDICTED: beta-galactosidase 1 [Pyrus x bretschneideri]
Length=843

 Score =   249 bits (637),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            +W  SV ASVSYD  A +ING RKILISGSIHYPRS+PEMWPDL+QKAKEGGLDVIQTY+
Sbjct  21   SWVGSVRASVSYDSKAIVINGQRKILISGSIHYPRSSPEMWPDLIQKAKEGGLDVIQTYV  80

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEP PGKYYFED YD+VKFIKL QQAGLYVHLRIGPY C EWNFGGFPVWLK++PG
Sbjct  81   FWNGHEPSPGKYYFEDNYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPG  140

Query  480  ISFRTDNEPFKSAMQKF  530
            I FRTDN PFK+ MQ+F
Sbjct  141  IQFRTDNGPFKNQMQRF  157



>ref|XP_003546457.1| PREDICTED: beta-galactosidase-like isoform X1 [Glycine max]
 ref|XP_006597816.1| PREDICTED: beta-galactosidase-like isoform X2 [Glycine max]
Length=721

 Score =   248 bits (632),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +3

Query  123  WFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIF  302
            W   V ASV+YD  A +++G R+ILISGSIHYPRSTP+MWPDL+QKAK+GGLDVIQTY+F
Sbjct  17   WVCGVTASVTYDHKAIVVDGKRRILISGSIHYPRSTPQMWPDLIQKAKDGGLDVIQTYVF  76

Query  303  WNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGI  482
            WNGHEP PG+YYFEDR+D+VKF+KL QQAGLYVHLRIGPY C EWNFGGFPVWLK+VPGI
Sbjct  77   WNGHEPSPGQYYFEDRFDLVKFVKLVQQAGLYVHLRIGPYICAEWNFGGFPVWLKYVPGI  136

Query  483  SFRTDNEPFKSAMQKF  530
            +FRTDNEPFK+AMQKF
Sbjct  137  AFRTDNEPFKAAMQKF  152



>ref|XP_011460037.1| PREDICTED: beta-galactosidase isoform X4 [Fragaria vesca subsp. 
vesca]
Length=743

 Score =   248 bits (633),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            +W SS  ASV YD  A I+NG R+ILISGSIHYPRSTPEMWPDLLQKAK+GGLDVIQTY+
Sbjct  18   SWLSSALASVGYDHRAIIVNGKRRILISGSIHYPRSTPEMWPDLLQKAKDGGLDVIQTYV  77

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEP PGKYYFEDRYD+VKFIKLAQQ GL+VHLRIGPY C EWNFGGFPVWLK+VPG
Sbjct  78   FWNGHEPSPGKYYFEDRYDLVKFIKLAQQHGLFVHLRIGPYICAEWNFGGFPVWLKYVPG  137

Query  480  ISFRTDNEPFKSAMQKF  530
            I+FRTDN PF +AM+KF
Sbjct  138  IAFRTDNRPFMAAMEKF  154



>gb|ACF22882.1| beta-galactosidase [Glycine max]
 gb|KHN35842.1| Beta-galactosidase [Glycine soja]
Length=721

 Score =   248 bits (632),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +3

Query  123  WFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIF  302
            W   V ASV+YD  A +++G R+ILISGSIHYPRSTP+MWPDL+QKAK+GGLDVIQTY+F
Sbjct  17   WVCGVTASVTYDHKAIVVDGKRRILISGSIHYPRSTPQMWPDLIQKAKDGGLDVIQTYVF  76

Query  303  WNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGI  482
            WNGHEP PG+YYFEDR+D+VKF+KLAQQAGLYVHLRIGPY C EWN GGFPVWLK+VPGI
Sbjct  77   WNGHEPSPGQYYFEDRFDLVKFVKLAQQAGLYVHLRIGPYICAEWNLGGFPVWLKYVPGI  136

Query  483  SFRTDNEPFKSAMQKF  530
            +FRTDNEPFK+AMQKF
Sbjct  137  AFRTDNEPFKAAMQKF  152



>gb|KJB65167.1| hypothetical protein B456_010G082900 [Gossypium raimondii]
Length=843

 Score =   249 bits (637),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
            FS V+A+VSYD  A IING R+IL+SGSIHYPRSTP+MWPDL+ KAKEGGLDVIQTY+FW
Sbjct  26   FSLVSATVSYDSKAIIINGRRRILLSGSIHYPRSTPQMWPDLIAKAKEGGLDVIQTYVFW  85

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PG YYFEDRYD+V+FIKL QQAGLYVHLRIGPY C EWNFGGFPVWLK+VPGI+
Sbjct  86   NGHEPSPGNYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYICAEWNFGGFPVWLKYVPGIA  145

Query  486  FRTDNEPFKSAMQKF  530
            FRTDNEPFK+AMQKF
Sbjct  146  FRTDNEPFKAAMQKF  160



>gb|KJB65170.1| hypothetical protein B456_010G082900 [Gossypium raimondii]
 gb|KJB65171.1| hypothetical protein B456_010G082900 [Gossypium raimondii]
Length=842

 Score =   249 bits (637),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
            FS V+A+VSYD  A IING R+IL+SGSIHYPRSTP+MWPDL+ KAKEGGLDVIQTY+FW
Sbjct  26   FSLVSATVSYDSKAIIINGRRRILLSGSIHYPRSTPQMWPDLIAKAKEGGLDVIQTYVFW  85

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PG YYFEDRYD+V+FIKL QQAGLYVHLRIGPY C EWNFGGFPVWLK+VPGI+
Sbjct  86   NGHEPSPGNYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYICAEWNFGGFPVWLKYVPGIA  145

Query  486  FRTDNEPFKSAMQKF  530
            FRTDNEPFK+AMQKF
Sbjct  146  FRTDNEPFKAAMQKF  160



>gb|KJB07252.1| hypothetical protein B456_001G011600 [Gossypium raimondii]
Length=738

 Score =   248 bits (632),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
            FS V+A+VSYD  A IING R+IL+SGSIHYPRSTPEMWPDL+ KAKEGGLDVIQTY+FW
Sbjct  30   FSLVSATVSYDSKAIIINGRRRILLSGSIHYPRSTPEMWPDLIAKAKEGGLDVIQTYVFW  89

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PGKYYFEDRYD+V+F+KL QQAGLYV+LRIGPY C EWNFGGFPVWLK+VPGI+
Sbjct  90   NGHEPSPGKYYFEDRYDLVRFVKLVQQAGLYVNLRIGPYVCAEWNFGGFPVWLKYVPGIA  149

Query  486  FRTDNEPFKSAMQKF  530
            FRTDN PFK+AMQKF
Sbjct  150  FRTDNGPFKAAMQKF  164



>ref|XP_010536861.1| PREDICTED: beta-galactosidase 12 [Tarenaya hassleriana]
Length=726

 Score =   247 bits (631),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
             SS  A+VSYD  A IING R+IL+SGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FW
Sbjct  21   ISSAKAAVSYDHKAVIINGQRRILLSGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFW  80

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PGKYYFEDRYD+V+F+KL QQAGLYVHLRIGPY C EWNFGGFPVWLK++PGI+
Sbjct  81   NGHEPSPGKYYFEDRYDLVRFVKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGIA  140

Query  486  FRTDNEPFKSAMQKF  530
            FRTDN PFK+AMQKF
Sbjct  141  FRTDNGPFKAAMQKF  155



>gb|ACC78255.1| beta-galactosidase [Carica papaya]
Length=721

 Score =   247 bits (630),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            +W  SV A+VSYD  A IING R+ILISGSIHYPRSTP+MWPDL+Q AKEGGLDVIQTY+
Sbjct  14   SWLWSVEATVSYDHKAIIINGRRRILISGSIHYPRSTPQMWPDLIQNAKEGGLDVIQTYV  73

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEP PG YYFEDRYD+VKFIKL  QAGLYVHLRIGPY CGEWNFGGFPVWLK+VPG
Sbjct  74   FWNGHEPSPGNYYFEDRYDLVKFIKLVHQAGLYVHLRIGPYICGEWNFGGFPVWLKYVPG  133

Query  480  ISFRTDNEPFKSAMQKF  530
            I FRTDN PFK+ MQKF
Sbjct  134  IQFRTDNGPFKAQMQKF  150



>ref|XP_008451151.1| PREDICTED: beta-galactosidase-like, partial [Cucumis melo]
Length=589

 Score =   244 bits (623),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            TW  S   SV+YD  A IING R+ILISGSIHYPRSTP+MWPDL+QKAK GGLD+I+TY+
Sbjct  13   TWVCSTIGSVTYDHKAIIINGQRRILISGSIHYPRSTPQMWPDLIQKAKNGGLDIIETYV  72

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEP PGKYYFE+RYD+V+FIKL  QAGLYVHLRIGPY C EWN+GGFPVWLKFVPG
Sbjct  73   FWNGHEPSPGKYYFEERYDLVRFIKLVHQAGLYVHLRIGPYVCAEWNYGGFPVWLKFVPG  132

Query  480  ISFRTDNEPFKSAMQKF  530
            I+FRTDN+PFK+AMQKF
Sbjct  133  IAFRTDNKPFKAAMQKF  149



>ref|XP_006285652.1| hypothetical protein CARUB_v10007108mg [Capsella rubella]
 gb|EOA18550.1| hypothetical protein CARUB_v10007108mg [Capsella rubella]
Length=730

 Score =   247 bits (630),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
              SV A V+YD  A IING R+IL+SGSIHYPRSTP+MWPDL+QKAK+GGLDVIQTY+FW
Sbjct  23   ICSVKAMVTYDHKAVIINGQRRILLSGSIHYPRSTPQMWPDLIQKAKDGGLDVIQTYVFW  82

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PG+YYFEDRYD+VKFIKL QQAGLYVHLRIGPY C EWNFGGFPVWLK+VPG+ 
Sbjct  83   NGHEPSPGQYYFEDRYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGMV  142

Query  486  FRTDNEPFKSAMQKF  530
            FRTDNEPFK+AMQKF
Sbjct  143  FRTDNEPFKAAMQKF  157



>ref|XP_011072510.1| PREDICTED: beta-galactosidase-like [Sesamum indicum]
Length=842

 Score =   248 bits (634),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            +W S    SVSYD  +  ING RKILISGSIHYPRSTPEMWPDL+QKAKEGG+DVIQTY+
Sbjct  22   SWISCGEGSVSYDSKSISINGRRKILISGSIHYPRSTPEMWPDLIQKAKEGGVDVIQTYV  81

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEP+PGKYYFE RYD+VKFIKL Q+AGLYVHLRIGPYAC EWNFGGFPVWLK+VPG
Sbjct  82   FWNGHEPEPGKYYFEGRYDLVKFIKLVQEAGLYVHLRIGPYACAEWNFGGFPVWLKYVPG  141

Query  480  ISFRTDNEPFKSAMQKF  530
            ISFRTDN PFK+AMQKF
Sbjct  142  ISFRTDNGPFKAAMQKF  158



>gb|AFW61988.1| hypothetical protein ZEAMMB73_453254 [Zea mays]
Length=326

 Score =   236 bits (603),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +3

Query  129  SSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWN  308
            S  NA+VSYD  A +ING R+ILISGSIHYPRSTPEMWP LLQKAK+GGLDV+QTY+FWN
Sbjct  22   SPANAAVSYDHRAVVINGQRRILISGSIHYPRSTPEMWPGLLQKAKDGGLDVVQTYVFWN  81

Query  309  GHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISF  488
            GHEP  G+YYF DRYD+V+F+KLA+QAGLYVHLRIGPY C EWNFGGFPVWLK+VPGISF
Sbjct  82   GHEPVRGQYYFGDRYDLVRFVKLAKQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISF  141

Query  489  RTDNEPFKSAMQKF  530
            RTDN PFK+AMQ F
Sbjct  142  RTDNGPFKAAMQAF  155



>ref|XP_002867577.1| beta-galactosidase 12 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43836.1| beta-galactosidase 12 [Arabidopsis lyrata subsp. lyrata]
Length=728

 Score =   246 bits (629),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  132  SVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNG  311
            SV A V+YD+ A IING R+IL+SGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FWNG
Sbjct  24   SVKAMVTYDRKAVIINGQRRILLSGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNG  83

Query  312  HEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFR  491
            HEP PG+YYFEDRYD+VKFIKL QQAGLYVHLRIGPY C EWNFGGFPVWLK+VP + FR
Sbjct  84   HEPSPGQYYFEDRYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPDMVFR  143

Query  492  TDNEPFKSAMQKF  530
            TDNEPFK+AMQKF
Sbjct  144  TDNEPFKAAMQKF  156



>ref|XP_007138730.1| hypothetical protein PHAVU_009G232500g [Phaseolus vulgaris]
 gb|ESW10724.1| hypothetical protein PHAVU_009G232500g [Phaseolus vulgaris]
Length=722

 Score =   246 bits (629),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +3

Query  123  WFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIF  302
            W   V ASV+YD  A +I+G R+ILISGSIHYPRSTP+MWPDL+QKAK+GG+DVIQTY+F
Sbjct  17   WVCGVTASVTYDHKAIVIDGKRRILISGSIHYPRSTPQMWPDLIQKAKDGGVDVIQTYVF  76

Query  303  WNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGI  482
            WNGHEP PGKYYFEDRYD+V+F+K+ QQAGLYVHLRIGPY C EWNFGGFPVWLK+VPG+
Sbjct  77   WNGHEPSPGKYYFEDRYDLVRFVKVVQQAGLYVHLRIGPYICAEWNFGGFPVWLKYVPGM  136

Query  483  SFRTDNEPFKSAMQKF  530
            +FRTDNEPFK+AMQKF
Sbjct  137  AFRTDNEPFKAAMQKF  152



>ref|XP_010049746.1| PREDICTED: beta-galactosidase-like [Eucalyptus grandis]
 gb|KCW82504.1| hypothetical protein EUGRSUZ_C03896 [Eucalyptus grandis]
Length=722

 Score =   246 bits (629),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            +W SSV+ SVSYD+ A II+G R+ILISGSIHYPRSTPEMWPDL+ KAK+GGLDVIQTY+
Sbjct  14   SWASSVSCSVSYDRKAIIIDGKRRILISGSIHYPRSTPEMWPDLIWKAKQGGLDVIQTYV  73

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEP PG YYF+DRYD+VKFIKL QQAGLYVHLRIGPY C EWNFGGFPVWLK+VPG
Sbjct  74   FWNGHEPSPGNYYFQDRYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPG  133

Query  480  ISFRTDNEPFKSAMQKF  530
            I+FRT+N+PF+ AMQKF
Sbjct  134  IAFRTNNKPFEDAMQKF  150



>ref|NP_001234465.1| beta-galactosidase precursor [Solanum lycopersicum]
 sp|P48980.1|BGAL_SOLLC RecName: Full=Beta-galactosidase; AltName: Full=Acid beta-galactosidase; 
Short=Lactase; AltName: Full=Exo-(1-->4)-beta-D-galactanase; 
Flags: Precursor [Solanum lycopersicum]
 gb|AAF21626.1|AF023847_1 beta-galactosidase precursor [Solanum lycopersicum]
 emb|CAA58734.1| putative beta-galactosidase/galactanase [Solanum lycopersicum]
 emb|CAA10174.1| ss-galactosidase [Solanum lycopersicum]
Length=835

 Score =   248 bits (633),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +3

Query  123  WFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIF  302
            W S   ASVSYD  A I+NG RKILISGSIHYPRSTPEMWPDL+QKAKEGG+DVIQTY+F
Sbjct  16   WVSCGIASVSYDHKAIIVNGQRKILISGSIHYPRSTPEMWPDLIQKAKEGGVDVIQTYVF  75

Query  303  WNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGI  482
            WNGHEP+ GKYYFE+RYD+VKFIK+ Q+AGLYVHLRIGPYAC EWNFGGFPVWLK+VPGI
Sbjct  76   WNGHEPEEGKYYFEERYDLVKFIKVVQEAGLYVHLRIGPYACAEWNFGGFPVWLKYVPGI  135

Query  483  SFRTDNEPFKSAMQKF  530
            SFRT+NEPFK+AMQKF
Sbjct  136  SFRTNNEPFKAAMQKF  151



>ref|XP_007154660.1| hypothetical protein PHAVU_003G137000g [Phaseolus vulgaris]
 gb|ESW26654.1| hypothetical protein PHAVU_003G137000g [Phaseolus vulgaris]
Length=833

 Score =   248 bits (633),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +3

Query  123  WFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIF  302
            W  +V ASV+YD  A ++NG R+IL+SGSIHYPRSTPEMWPDL+QKAK+GGLDVI+TY+F
Sbjct  17   WVCAVTASVTYDHKAILVNGQRRILVSGSIHYPRSTPEMWPDLIQKAKDGGLDVIETYVF  76

Query  303  WNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGI  482
            WNGHEP PGKYYFEDRYD+VKFIK+ QQAGLY+HLRIGP+ C EWNFGGFPVWLK+VPGI
Sbjct  77   WNGHEPSPGKYYFEDRYDLVKFIKVVQQAGLYLHLRIGPFVCAEWNFGGFPVWLKYVPGI  136

Query  483  SFRTDNEPFKSAMQKF  530
            +FRTDNEPFK+AMQ F
Sbjct  137  AFRTDNEPFKAAMQNF  152



>ref|XP_002308268.2| hypothetical protein POPTR_0006s14680g [Populus trichocarpa]
 gb|EEE91791.2| hypothetical protein POPTR_0006s14680g [Populus trichocarpa]
Length=837

 Score =   248 bits (633),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
             S+V ASVSYD  A IING R+ILISGSIHYPRSTPEMWPDL+QKAK+GG+DVIQTY+FW
Sbjct  20   ISTVTASVSYDHKAVIINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGVDVIQTYVFW  79

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PG YYFEDRYD+VKFIKL QQAGLY+HLRIGPY C EWNFGGFPVWLK+VPGI 
Sbjct  80   NGHEPSPGNYYFEDRYDLVKFIKLVQQAGLYLHLRIGPYICAEWNFGGFPVWLKYVPGIE  139

Query  486  FRTDNEPFKSAMQKF  530
            FRTDN PFK+AMQKF
Sbjct  140  FRTDNGPFKAAMQKF  154



>ref|XP_011045966.1| PREDICTED: beta-galactosidase-like isoform X2 [Populus euphratica]
Length=838

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
             S+V ASVSYD  A IING R+ILISGSIHYPRSTPEMWPDL+QKAK+GG+DVIQTY+FW
Sbjct  21   ISTVTASVSYDHKAVIINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGVDVIQTYVFW  80

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PG YYFEDRYD+VKFIKL QQAGLY+HLRIGPY C EWNFGGFPVWLK+VPGI 
Sbjct  81   NGHEPSPGNYYFEDRYDLVKFIKLVQQAGLYLHLRIGPYICAEWNFGGFPVWLKYVPGIE  140

Query  486  FRTDNEPFKSAMQKF  530
            FRTDN PFK+AMQKF
Sbjct  141  FRTDNGPFKAAMQKF  155



>dbj|BAE72074.1| pear beta-galactosidase2 [Pyrus communis]
Length=725

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
            FS+ +ASV YD  A IING R+ILISGSIHYPRSTP MWPDL+QKAK GGLDVIQTY+FW
Sbjct  19   FSAASASVGYDHKAIIINGQRRILISGSIHYPRSTPGMWPDLIQKAKAGGLDVIQTYVFW  78

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PGKYYFEDRYD+VKFIKL QQAGL+V+LRIGPY C EWNFGGFP+WLK+VPGI+
Sbjct  79   NGHEPSPGKYYFEDRYDLVKFIKLVQQAGLFVNLRIGPYVCAEWNFGGFPIWLKYVPGIA  138

Query  486  FRTDNEPFKSAMQKF  530
            FRTDNEPFK+AMQKF
Sbjct  139  FRTDNEPFKAAMQKF  153



>gb|KGN66239.1| hypothetical protein Csa_1G587990 [Cucumis sativus]
Length=621

 Score =   243 bits (621),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +3

Query  129  SSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWN  308
            SSV ASV+YD  A +I+G R+ILISGSIHYPRSTP+MWPDL+QKAK+GGLDVI+TY+FWN
Sbjct  20   SSVMASVTYDHKALVIDGKRRILISGSIHYPRSTPQMWPDLIQKAKDGGLDVIETYVFWN  79

Query  309  GHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISF  488
            GHEP PG+YYFEDRY++V+F+KL QQAGLYVHLRIGPY C EWNFGGFPVWLK+VPGI+F
Sbjct  80   GHEPSPGQYYFEDRYELVRFVKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIAF  139

Query  489  RTDNEPFKSAMQKF  530
            RTDN PFK+AMQKF
Sbjct  140  RTDNGPFKAAMQKF  153



>emb|CAC44500.1| beta-galactosidase [Fragaria x ananassa]
Length=843

 Score =   247 bits (631),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
            F+SV ASVSYD  A +ING R+ILISGSIHYPRSTPEMWPDL+Q+AK+GGLDVIQTY+FW
Sbjct  23   FASVRASVSYDSKAIVINGQRRILISGSIHYPRSTPEMWPDLIQRAKDGGLDVIQTYVFW  82

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PGKYYFED YD+VKFIKL QQAGLYVHLRIGPY C EWNFGGFPVWLK+VPGI 
Sbjct  83   NGHEPSPGKYYFEDNYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIQ  142

Query  486  FRTDNEPFKSAMQKF  530
            FRTDN PFK  MQ+F
Sbjct  143  FRTDNGPFKDQMQRF  157



>ref|NP_001289260.1| beta-galactosidase precursor [Pyrus x bretschneideri]
 dbj|BAD91081.1| beta-D-galactosidase [Pyrus pyrifolia]
 gb|AGR44463.1| beta-D-galactosidase 4 [Pyrus x bretschneideri]
Length=725

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
            FS+ +ASV YD  A IING R+ILISGSIHYPRSTP MWPDL+QKAK GGLDVIQTY+FW
Sbjct  19   FSAASASVGYDHKAIIINGQRRILISGSIHYPRSTPGMWPDLIQKAKAGGLDVIQTYVFW  78

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PGKYYFEDRYD+VKFIKL QQAGL+V+LRIGPY C EWNFGGFP+WLK+VPGI+
Sbjct  79   NGHEPSPGKYYFEDRYDLVKFIKLVQQAGLFVNLRIGPYVCAEWNFGGFPIWLKYVPGIA  138

Query  486  FRTDNEPFKSAMQKF  530
            FRTDNEPFK+AMQKF
Sbjct  139  FRTDNEPFKAAMQKF  153



>ref|XP_010047575.1| PREDICTED: beta-galactosidase-like [Eucalyptus grandis]
 gb|KCW79521.1| hypothetical protein EUGRSUZ_C00898 [Eucalyptus grandis]
Length=874

 Score =   248 bits (632),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  135  VNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNGH  314
            V ASV+YD  A I+NG R+ILISGSIHYPRSTP MWPDL+QKAK+GGLDVIQTY+FWNGH
Sbjct  40   VAASVTYDHRALIVNGKRRILISGSIHYPRSTPGMWPDLIQKAKDGGLDVIQTYVFWNGH  99

Query  315  EPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFRT  494
            EP PGKYYFEDRYD+V+FIKL QQAGLYVHLRIGPY C EWNFGGFPVWLKFVPGI FRT
Sbjct  100  EPSPGKYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKFVPGIVFRT  159

Query  495  DNEPFKSAMQKF  530
            DNEPFK+AMQ+F
Sbjct  160  DNEPFKAAMQRF  171



>ref|XP_007217146.1| hypothetical protein PRUPE_ppa001382mg [Prunus persica]
 gb|EMJ18345.1| hypothetical protein PRUPE_ppa001382mg [Prunus persica]
Length=841

 Score =   247 bits (631),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            +W  S  ASVSYD  A +ING R+ILISGSIHYPRS+PEMWPDL+QKAKEGGLDVIQTY+
Sbjct  19   SWVGSAKASVSYDSKAIVINGQRRILISGSIHYPRSSPEMWPDLIQKAKEGGLDVIQTYV  78

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEP PGKYYFED YD+VKFIKL QQAGLYVHLRIGPY C EWNFGGFPVWLK++PG
Sbjct  79   FWNGHEPSPGKYYFEDNYDLVKFIKLIQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPG  138

Query  480  ISFRTDNEPFKSAMQKF  530
            I FRTDN PFK+ MQ+F
Sbjct  139  IQFRTDNGPFKAQMQRF  155



>gb|ABV32545.1| beta-galactosidase protein 2 [Prunus persica]
Length=841

 Score =   247 bits (630),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            +W  S  ASVSYD  A +ING R+ILISGSIHYPRS+PEMWPDL+QKAKEGGLDVIQTY+
Sbjct  19   SWVGSAKASVSYDSKAIVINGQRRILISGSIHYPRSSPEMWPDLIQKAKEGGLDVIQTYV  78

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEP PGKYYFED YD+VKFIKL QQAGLYVHLRIGPY C EWNFGGFPVWLK++PG
Sbjct  79   FWNGHEPSPGKYYFEDNYDLVKFIKLIQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPG  138

Query  480  ISFRTDNEPFKSAMQKF  530
            I FRTDN PFK+ MQ+F
Sbjct  139  IQFRTDNGPFKAQMQRF  155



>sp|P48981.1|BGAL_MALDO RecName: Full=Beta-galactosidase; AltName: Full=Acid beta-galactosidase; 
Short=Lactase; AltName: Full=Exo-(1-->4)-beta-D-galactanase; 
Flags: Precursor [Malus domestica]
 gb|AAA62324.1| b-galactosidase-related protein; putative [Malus domestica]
Length=731

 Score =   245 bits (626),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
            FS+ +ASVSYD  A IING ++ILISGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FW
Sbjct  19   FSAASASVSYDHKAIIINGQKRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFW  78

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PG YYFE+RYD+VKFIKL QQ GL+V+LRIGPY C EWNFGGFPVWLK+VPGI+
Sbjct  79   NGHEPSPGNYYFEERYDLVKFIKLVQQEGLFVNLRIGPYVCAEWNFGGFPVWLKYVPGIA  138

Query  486  FRTDNEPFKSAMQKF  530
            FRTDNEPFK+AMQKF
Sbjct  139  FRTDNEPFKAAMQKF  153



>emb|CDX94367.1| BnaC01g18170D [Brassica napus]
Length=712

 Score =   245 bits (625),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = +3

Query  147  VSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNGHEPQP  326
            V+YD  A IING R+IL+SGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FWNGHEP P
Sbjct  2    VTYDHKAVIINGQRRILLSGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPSP  61

Query  327  GKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFRTDNEP  506
            G+YYFEDRYD+VKF+KL QQAGLYVHLRIGPY C EWNFGGFPVWLK+VPG++FRTDNEP
Sbjct  62   GQYYFEDRYDLVKFVKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGMAFRTDNEP  121

Query  507  FKSAMQKF  530
            FK+AMQKF
Sbjct  122  FKAAMQKF  129



>ref|XP_011463326.1| PREDICTED: beta-galactosidase 1 [Fragaria vesca subsp. vesca]
Length=843

 Score =   247 bits (630),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
            F+SV ASVSYD  A +ING R+ILISGSIHYPRSTPEMWPDL+Q+AK+GGLDVIQTY+FW
Sbjct  23   FASVRASVSYDSKAIVINGQRRILISGSIHYPRSTPEMWPDLIQRAKDGGLDVIQTYVFW  82

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PGKYYFED YD+VKFIKL QQAGLYVHLRIGPY C EWNFGGFPVWLK++PGI 
Sbjct  83   NGHEPSPGKYYFEDNYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGIQ  142

Query  486  FRTDNEPFKSAMQKF  530
            FRTDN PFK  MQ+F
Sbjct  143  FRTDNGPFKDQMQRF  157



>gb|KCW82506.1| hypothetical protein EUGRSUZ_C03898, partial [Eucalyptus grandis]
Length=700

 Score =   244 bits (624),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            +W SSV+ SVSYD+ A +I+G R+ILISGSIHYPRSTPEMWPDL+ KAK GG+DVIQ+Y+
Sbjct  8    SWASSVSCSVSYDRKAIVIDGKRRILISGSIHYPRSTPEMWPDLIWKAKRGGVDVIQSYV  67

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEP PG+YYFEDRYD+V+FIKL QQAGLYVHLRIGPY C EWNFGGFPVWLKFVPG
Sbjct  68   FWNGHEPSPGQYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYICAEWNFGGFPVWLKFVPG  127

Query  480  ISFRTDNEPFKSAMQKF  530
            ISFRTDN+ FK AMQ+F
Sbjct  128  ISFRTDNKAFKDAMQRF  144



>gb|KEH39519.1| beta-galactosidase [Medicago truncatula]
Length=590

 Score =   242 bits (618),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
              SV ASVSYD  A  ING  +ILISGSIHYPRSTPEMWPDL+QKAKEGGLDVIQTY+FW
Sbjct  21   ICSVIASVSYDSKAITINGQSRILISGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYVFW  80

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PGKYYFE  YD+VKFIKL QQAGLYVHLRIGPY C EWNFGGFPVWLK++PGIS
Sbjct  81   NGHEPSPGKYYFEGNYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGIS  140

Query  486  FRTDNEPFKSAMQKF  530
            FRTDNEPFK  MQKF
Sbjct  141  FRTDNEPFKFQMQKF  155



>gb|AAB61470.1| beta-D-galactosidase [Mangifera indica]
Length=663

 Score =   244 bits (622),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            +W   V A+VSYD  A II+G R+ILISGSIHYPRSTP+MWPDL+QKAK+G +DVIQTY+
Sbjct  25   SWVCFVEATVSYDHKAIIIDGQRRILISGSIHYPRSTPQMWPDLIQKAKDG-VDVIQTYV  83

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEP PGKYYFEDRYD+V+FIKL QQAGLYVHLRIGPY C EWNFGGFPVWLK+VPG
Sbjct  84   FWNGHEPSPGKYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPG  143

Query  480  ISFRTDNEPFKSAMQKF  530
            I FRTDNEPFK+AMQKF
Sbjct  144  IEFRTDNEPFKAAMQKF  160



>ref|XP_010049744.1| PREDICTED: beta-galactosidase-like [Eucalyptus grandis]
Length=703

 Score =   244 bits (624),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            +W SSV+ SVSYD+ A +I+G R+ILISGSIHYPRSTPEMWPDL+ KAK GG+DVIQ+Y+
Sbjct  8    SWASSVSCSVSYDRKAIVIDGKRRILISGSIHYPRSTPEMWPDLIWKAKRGGVDVIQSYV  67

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEP PG+YYFEDRYD+V+FIKL QQAGLYVHLRIGPY C EWNFGGFPVWLKFVPG
Sbjct  68   FWNGHEPSPGQYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYICAEWNFGGFPVWLKFVPG  127

Query  480  ISFRTDNEPFKSAMQKF  530
            ISFRTDN+ FK AMQ+F
Sbjct  128  ISFRTDNKAFKDAMQRF  144



>ref|XP_008230925.1| PREDICTED: beta-galactosidase-like [Prunus mume]
Length=808

 Score =   246 bits (628),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = +3

Query  129  SSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWN  308
            S+  ASVSYD  + IING ++ILISGSIHYPRSTPEMWPDL+QKAKEGGLDVIQTY+FWN
Sbjct  21   SACTASVSYDHRSIIINGRKRILISGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYVFWN  80

Query  309  GHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISF  488
            GHEP PG+YYFEDRYD+VKFIKL  QAGLYV+LRIGPY C EWNFGGFPVWLKFVPGI+F
Sbjct  81   GHEPSPGQYYFEDRYDLVKFIKLVHQAGLYVNLRIGPYVCAEWNFGGFPVWLKFVPGIAF  140

Query  489  RTDNEPFKSAMQKF  530
            RTDNEPFK+AMQ F
Sbjct  141  RTDNEPFKAAMQTF  154



>gb|AAC77377.1| beta-galactosidase precursor [Carica papaya]
Length=721

 Score =   244 bits (624),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            +W  SV A+VSYD  A IING R+ILISGSIHYPRSTP+MWPDL+Q AKEGGLDVIQTY+
Sbjct  14   SWLWSVEATVSYDHKAIIINGRRRILISGSIHYPRSTPQMWPDLIQNAKEGGLDVIQTYV  73

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEP PG YYFEDRYD+VKFIKL  QAGLYVHLRI PY CGEWNFGGFPVWLK+VPG
Sbjct  74   FWNGHEPSPGNYYFEDRYDLVKFIKLVHQAGLYVHLRISPYICGEWNFGGFPVWLKYVPG  133

Query  480  ISFRTDNEPFKSAMQKF  530
            I FRTDN PFK+ MQKF
Sbjct  134  IQFRTDNGPFKAQMQKF  150



>gb|ABY71826.1| beta-galactosidase [Prunus salicina]
Length=836

 Score =   246 bits (629),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = +3

Query  129  SSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWN  308
            S+  ASVSYD  A IING ++ILISGSIHYPRSTPEMWPDL+QK+K+GGLDVIQTY+FWN
Sbjct  22   SAATASVSYDHKAIIINGQKRILISGSIHYPRSTPEMWPDLIQKSKDGGLDVIQTYVFWN  81

Query  309  GHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISF  488
            GHEP PGKYYFEDRYD+VKFIKL  QAGLYV+LRIGPY C EWNFGGFPVWLK+VPGI F
Sbjct  82   GHEPSPGKYYFEDRYDLVKFIKLVHQAGLYVNLRIGPYVCAEWNFGGFPVWLKYVPGIVF  141

Query  489  RTDNEPFKSAMQKF  530
            RTDNEPFK+AMQKF
Sbjct  142  RTDNEPFKAAMQKF  155



>gb|AEG76892.1| putative beta-galactosidase [Linum usitatissimum]
 gb|AEG76893.1| putative beta-galactosidase [Linum usitatissimum]
Length=731

 Score =   244 bits (624),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +3

Query  135  VNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNGH  314
            V A+V+YD  A I+NG R+ILI+GSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FWNGH
Sbjct  27   VTATVTYDGKAIIVNGQRRILIAGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGH  86

Query  315  EPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFRT  494
            EP PG YYFEDR+D+VKF+K+ QQAGLYV+LRIGPYAC EWNFGGFPVWLK+VPG+SFRT
Sbjct  87   EPSPGNYYFEDRFDLVKFVKVVQQAGLYVNLRIGPYACAEWNFGGFPVWLKYVPGMSFRT  146

Query  495  DNEPFKSAMQKF  530
            DNEPFK+AMQKF
Sbjct  147  DNEPFKAAMQKF  158



>ref|XP_010242207.1| PREDICTED: beta-galactosidase [Nelumbo nucifera]
Length=846

 Score =   246 bits (628),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
             W SSV ASVSYD+ A IING R+IL SGSIHYPRSTPEMWPDL+QKAK+GGLD IQTY+
Sbjct  32   VWVSSVKASVSYDQKAIIINGQRRILFSGSIHYPRSTPEMWPDLIQKAKDGGLDAIQTYV  91

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEP PG+YYFE RYD+V+FIKL QQAGLYVHLRIGPY C EWNFGGFPVWLK+VPG
Sbjct  92   FWNGHEPSPGQYYFEGRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPG  151

Query  480  ISFRTDNEPFKSAMQKF  530
            I FRTDNEPFK  MQ F
Sbjct  152  IEFRTDNEPFKVTMQGF  168



>emb|CDX89360.1| BnaA01g15330D [Brassica napus]
Length=699

 Score =   244 bits (622),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = +3

Query  147  VSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNGHEPQP  326
            V+YD  A IING R+IL+SGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FWNGHEP P
Sbjct  2    VTYDHKAVIINGQRRILLSGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPSP  61

Query  327  GKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFRTDNEP  506
            G+YYFEDRYD+VKF+KL QQAGLYVH+RIGPY C EWNFGGFPVWLK+VPG++FRTDNEP
Sbjct  62   GQYYFEDRYDLVKFVKLVQQAGLYVHIRIGPYVCAEWNFGGFPVWLKYVPGMAFRTDNEP  121

Query  507  FKSAMQKF  530
            FK+AMQKF
Sbjct  122  FKAAMQKF  129



>ref|XP_008228300.1| PREDICTED: beta-galactosidase 1 [Prunus mume]
Length=841

 Score =   246 bits (628),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            +W  S  ASVSYD  A +ING R+ILISGSIHYPRS+PEMWPDL+QKAKEGGLDVIQTY+
Sbjct  19   SWVGSAKASVSYDSKAIVINGQRRILISGSIHYPRSSPEMWPDLIQKAKEGGLDVIQTYV  78

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEP PGKYYFED YD+VK+IKL QQAGLYVHLRIGPY C EWNFGGFPVWLK++PG
Sbjct  79   FWNGHEPSPGKYYFEDNYDLVKYIKLIQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPG  138

Query  480  ISFRTDNEPFKSAMQKF  530
            I FRTDN PFK+ MQ+F
Sbjct  139  IQFRTDNGPFKAQMQRF  155



>gb|KDP40776.1| hypothetical protein JCGZ_24775 [Jatropha curcas]
Length=530

 Score =   240 bits (612),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +3

Query  129  SSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWN  308
             SV ASVSYD  A  ING R+ILISGSIHYPRS+PEMWPDL+QKAKEGGLDVIQTY+FWN
Sbjct  28   CSVTASVSYDSRAITINGQRRILISGSIHYPRSSPEMWPDLIQKAKEGGLDVIQTYVFWN  87

Query  309  GHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISF  488
            GHEP PGKYYFE  YD+VKFIKL +QAGLY HLRIGPY C EWNFGGFPVWLK++PGI+F
Sbjct  88   GHEPSPGKYYFEGNYDLVKFIKLVKQAGLYAHLRIGPYVCAEWNFGGFPVWLKYIPGINF  147

Query  489  RTDNEPFKSAMQKF  530
            RTDN PFK+ MQKF
Sbjct  148  RTDNGPFKAEMQKF  161



>ref|XP_010262132.1| PREDICTED: beta-galactosidase isoform X2 [Nelumbo nucifera]
Length=842

 Score =   246 bits (627),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  135  VNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNGH  314
            V ASV+YD+ A +ING R+ILISGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FWNGH
Sbjct  28   VTASVTYDQKAIVINGKRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGH  87

Query  315  EPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFRT  494
            EP PGKYYFE RYD+V+FIKL QQAGLYVHLRIGPY C EWNFGGFPVWLK+VPGISFRT
Sbjct  88   EPSPGKYYFEGRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISFRT  147

Query  495  DNEPFKSAMQKF  530
            DN+PFK+AMQ F
Sbjct  148  DNQPFKAAMQGF  159



>ref|XP_009789773.1| PREDICTED: beta-galactosidase-like [Nicotiana sylvestris]
Length=842

 Score =   246 bits (627),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            +W  S  ASVSYD+N+ I+NG ++ILISGSIHYPRSTPEMWPDL+QKAK+GG+DVIQTY+
Sbjct  22   SWVFSGLASVSYDRNSIIVNGQKRILISGSIHYPRSTPEMWPDLIQKAKKGGIDVIQTYV  81

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEP+ GKYYFE+RYD+VKFIKL  QAGLYVHLR+GPYAC EWNFGGFPVWLK+VPG
Sbjct  82   FWNGHEPEQGKYYFEERYDLVKFIKLVHQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPG  141

Query  480  ISFRTDNEPFKSAMQKF  530
            ISFRTDN PFK+AMQKF
Sbjct  142  ISFRTDNGPFKAAMQKF  158



>gb|KDP33829.1| hypothetical protein JCGZ_07400 [Jatropha curcas]
Length=838

 Score =   246 bits (627),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            +W   V ASVSYD  A  ING R+ILISGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+
Sbjct  19   SWVCFVTASVSYDHKAITINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYV  78

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEP PG YYFEDRYD+VKFIKL QQAGLYVHLRIGPY C EWNFGGFPVWLK+VPG
Sbjct  79   FWNGHEPSPGNYYFEDRYDLVKFIKLVQQAGLYVHLRIGPYICAEWNFGGFPVWLKYVPG  138

Query  480  ISFRTDNEPFKSAMQKF  530
            I FRT+N PFK AMQKF
Sbjct  139  IEFRTNNGPFKVAMQKF  155



>ref|XP_010262131.1| PREDICTED: beta-galactosidase isoform X1 [Nelumbo nucifera]
Length=847

 Score =   246 bits (627),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  135  VNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNGH  314
            V ASV+YD+ A +ING R+ILISGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FWNGH
Sbjct  28   VTASVTYDQKAIVINGKRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGH  87

Query  315  EPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFRT  494
            EP PGKYYFE RYD+V+FIKL QQAGLYVHLRIGPY C EWNFGGFPVWLK+VPGISFRT
Sbjct  88   EPSPGKYYFEGRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISFRT  147

Query  495  DNEPFKSAMQKF  530
            DN+PFK+AMQ F
Sbjct  148  DNQPFKAAMQGF  159



>ref|XP_002514108.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF48062.1| beta-galactosidase, putative [Ricinus communis]
Length=840

 Score =   246 bits (627),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 110/136 (81%), Positives = 120/136 (88%), Gaps = 0/136 (0%)
 Frame = +3

Query  123  WFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIF  302
            W  S+ A+VSYD  A  ING R+ILISGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+F
Sbjct  22   WVCSILATVSYDHRAITINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVF  81

Query  303  WNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGI  482
            WNGHEP PG YYFEDRYD+VKFIK+ Q AGLYVHLRIGPY C EWNFGGFPVWLK+VPGI
Sbjct  82   WNGHEPSPGNYYFEDRYDLVKFIKVVQAAGLYVHLRIGPYICAEWNFGGFPVWLKYVPGI  141

Query  483  SFRTDNEPFKSAMQKF  530
             FRTDN PFK+AMQKF
Sbjct  142  EFRTDNGPFKAAMQKF  157



>gb|KFK27244.1| hypothetical protein AALP_AA8G356800 [Arabis alpina]
Length=722

 Score =   244 bits (622),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
              SV ASVSYD+ A +ING R+IL+SGSIHYPRSTPEMWP L+QKAKEGGLDVI+TY+FW
Sbjct  22   ICSVKASVSYDRKALVINGQRRILLSGSIHYPRSTPEMWPGLIQKAKEGGLDVIETYVFW  81

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PG YYF+DRYD+VKFIKL QQAGLYV+LRIGP+ C EWNFGGFPVWLKFVPGI 
Sbjct  82   NGHEPTPGNYYFQDRYDLVKFIKLVQQAGLYVNLRIGPFVCAEWNFGGFPVWLKFVPGIV  141

Query  486  FRTDNEPFKSAMQKF  530
            FRTDNEPFK+AM+KF
Sbjct  142  FRTDNEPFKAAMKKF  156



>ref|XP_009606115.1| PREDICTED: beta-galactosidase-like [Nicotiana tomentosiformis]
Length=844

 Score =   245 bits (626),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +3

Query  141  ASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNGHEP  320
            ASVSYD+NA I+NG ++ILISGSIHYPRSTPEMWPDL+QKAK+GG+DVIQTY+FWNGHEP
Sbjct  31   ASVSYDRNAIIVNGQKRILISGSIHYPRSTPEMWPDLIQKAKKGGIDVIQTYVFWNGHEP  90

Query  321  QPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFRTDN  500
            + GKYYFE+RYD+VKFIKL  QAGLYVHLR+GPYAC EWNFGGFPVWLK+VPGISFRTDN
Sbjct  91   EQGKYYFEERYDLVKFIKLVHQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGISFRTDN  150

Query  501  EPFKSAMQKF  530
             PFK+AMQKF
Sbjct  151  GPFKAAMQKF  160



>ref|XP_008450854.1| PREDICTED: beta-galactosidase-like [Cucumis melo]
Length=723

 Score =   244 bits (622),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +3

Query  129  SSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWN  308
            SSV ASV+YD  A +I+G R+ILISGSIHYPRSTP+MWPDL+QKAK+GGLDVI+TY+FWN
Sbjct  20   SSVMASVTYDHKALVIDGKRRILISGSIHYPRSTPQMWPDLIQKAKDGGLDVIETYVFWN  79

Query  309  GHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISF  488
            GHEP PG+YYFEDRYD+V+F+KL QQAGLYVHLRIGPY C EWNFGGFPVWLK+VPGI+F
Sbjct  80   GHEPSPGQYYFEDRYDLVRFVKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIAF  139

Query  489  RTDNEPFKSAMQKF  530
            RTDN PFK+AMQKF
Sbjct  140  RTDNGPFKAAMQKF  153



>ref|XP_007217046.1| hypothetical protein PRUPE_ppa001415mg [Prunus persica]
 gb|EMJ18245.1| hypothetical protein PRUPE_ppa001415mg [Prunus persica]
Length=835

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = +3

Query  129  SSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWN  308
            S+  ASVSYD  + IING ++ILISGSIHYPRSTPEMWPDL+QKAKEGG+DVIQTY+FWN
Sbjct  21   SACTASVSYDHRSIIINGRKRILISGSIHYPRSTPEMWPDLIQKAKEGGVDVIQTYVFWN  80

Query  309  GHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISF  488
            GHEP PGKYYFEDRYD+VKFIKL  QAGLYV+LRIGPY C EWNFGGFPVWLK+VPGI+F
Sbjct  81   GHEPSPGKYYFEDRYDLVKFIKLVHQAGLYVNLRIGPYVCAEWNFGGFPVWLKYVPGIAF  140

Query  489  RTDNEPFKSAMQKF  530
            RTDNEPFK+AMQ F
Sbjct  141  RTDNEPFKAAMQTF  154



>gb|KCW82245.1| hypothetical protein EUGRSUZ_C03662 [Eucalyptus grandis]
Length=763

 Score =   244 bits (622),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            +W  SV+ SVSYD+ A +I+G R+ILISGSIHYPRSTPEMWPDLLQKAK GGLDVIQTY+
Sbjct  24   SWSRSVSCSVSYDRKAIVIDGQRRILISGSIHYPRSTPEMWPDLLQKAKAGGLDVIQTYV  83

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEP  GKYYFEDR+D+V+FIKL Q AGLYVHLRIGPY C EWNFGGFPVWLK+VPG
Sbjct  84   FWNGHEPSRGKYYFEDRFDLVRFIKLVQHAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPG  143

Query  480  ISFRTDNEPFKSAMQKF  530
            I+FRTDN+PFK AMQ F
Sbjct  144  IAFRTDNQPFKDAMQGF  160



>ref|XP_003595163.1| Beta-galactosidase [Medicago truncatula]
 gb|KEH37472.1| beta-like galactosidase [Medicago truncatula]
Length=607

 Score =   241 bits (615),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  135  VNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNGH  314
            V ASV+YD  A +ING R+ILISGSIHYPRSTP+MWPDL+QKAK+GG+DVI+TY+FWNGH
Sbjct  24   VTASVTYDHKAIVINGKRRILISGSIHYPRSTPQMWPDLIQKAKDGGVDVIETYVFWNGH  83

Query  315  EPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFRT  494
            EP  GKYYFEDR+D+VKFIK+ QQAGLYVHLRIGPY C EWNFGGFPVWLK+VPG++FRT
Sbjct  84   EPSQGKYYFEDRFDLVKFIKVVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGVAFRT  143

Query  495  DNEPFKSAMQKF  530
            DNEPFK+AMQKF
Sbjct  144  DNEPFKAAMQKF  155



>gb|ACC60981.1| beta-galactosidase 1 precursor [Petunia x hybrida]
Length=842

 Score =   245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +3

Query  141  ASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNGHEP  320
            ASVSYD  A I+NG R+ILISGSIHYPRSTPEMWPDL+QKAKEGG+DVIQTY+FWNGHEP
Sbjct  29   ASVSYDHKAIIVNGQRRILISGSIHYPRSTPEMWPDLIQKAKEGGVDVIQTYVFWNGHEP  88

Query  321  QPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFRTDN  500
            + GKYYFE+RYD+VKFIKL  QAGLYV+LR+GPYAC EWNFGGFPVWLK+VPGISFRTDN
Sbjct  89   EQGKYYFEERYDLVKFIKLVHQAGLYVNLRVGPYACAEWNFGGFPVWLKYVPGISFRTDN  148

Query  501  EPFKSAMQKF  530
            EPFK+AMQKF
Sbjct  149  EPFKAAMQKF  158



>emb|CAA09467.1| exo galactanase [Lupinus angustifolius]
Length=730

 Score =   243 bits (621),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 122/136 (90%), Gaps = 0/136 (0%)
 Frame = +3

Query  123  WFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIF  302
            W   V ASV+YD  A +ING R+ILISGSIHYPRSTP+MWPDL+QKAK+GGLDVI+TY+F
Sbjct  27   WVCYVTASVTYDHKAIMINGQRRILISGSIHYPRSTPQMWPDLIQKAKDGGLDVIETYVF  86

Query  303  WNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGI  482
            WNGHEP PGKYYFEDR+D+V FIKL QQAGL+VHLRIGP+ C EWNFGGFPVWLK+VPGI
Sbjct  87   WNGHEPSPGKYYFEDRFDLVGFIKLVQQAGLFVHLRIGPFICAEWNFGGFPVWLKYVPGI  146

Query  483  SFRTDNEPFKSAMQKF  530
            +FRTDNEPFK AMQKF
Sbjct  147  AFRTDNEPFKEAMQKF  162



>emb|CDP11590.1| unnamed protein product [Coffea canephora]
 emb|CDP03164.1| unnamed protein product [Coffea canephora]
Length=180

 Score =   228 bits (582),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = +3

Query  129  SSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWN  308
             +V A VSYD  +FIING RKILISGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FWN
Sbjct  19   CTVRAKVSYDGRSFIINGQRKILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWN  78

Query  309  GHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISF  488
             HEP PGKY FE R D+V+F+KL + AGLY HLRIGPY C EWNFGGFPVWLK+VPG+ F
Sbjct  79   VHEPSPGKYNFEGRGDIVRFLKLVKAAGLYAHLRIGPYICAEWNFGGFPVWLKYVPGMEF  138

Query  489  RTDNEPFKSAMQKF  530
            RTDN PFK+AMQ F
Sbjct  139  RTDNGPFKAAMQGF  152



>ref|XP_002437187.1| hypothetical protein SORBIDRAFT_10g022620 [Sorghum bicolor]
 gb|EER88554.1| hypothetical protein SORBIDRAFT_10g022620 [Sorghum bicolor]
Length=725

 Score =   243 bits (620),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = +3

Query  129  SSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWN  308
            S  NA+VSYD  A +ING R+ILISGSIHYPRSTPEMWPDLLQKAK+GGLDV+QTY+FWN
Sbjct  25   SPANAAVSYDHRAVVINGQRRILISGSIHYPRSTPEMWPDLLQKAKDGGLDVVQTYVFWN  84

Query  309  GHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISF  488
            GHEPQ G+YYF DRYD+V+F+KLA+QAGL+VHLRIGPY C EWNFGGFPVWLK+VPG+SF
Sbjct  85   GHEPQQGQYYFGDRYDLVRFVKLAKQAGLFVHLRIGPYVCAEWNFGGFPVWLKYVPGVSF  144

Query  489  RTDNEPFKSAMQKF  530
            RTDN PFK+AMQ F
Sbjct  145  RTDNAPFKAAMQAF  158



>ref|XP_010051543.1| PREDICTED: beta-galactosidase [Eucalyptus grandis]
Length=790

 Score =   244 bits (623),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            +W  SV+ SVSYD+ A +I+G R+ILISGSIHYPRSTPEMWPDLLQKAK GGLDVIQTY+
Sbjct  51   SWSRSVSCSVSYDRKAIVIDGQRRILISGSIHYPRSTPEMWPDLLQKAKAGGLDVIQTYV  110

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEP  GKYYFEDR+D+V+FIKL Q AGLYVHLRIGPY C EWNFGGFPVWLK+VPG
Sbjct  111  FWNGHEPSRGKYYFEDRFDLVRFIKLVQHAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPG  170

Query  480  ISFRTDNEPFKSAMQKF  530
            I+FRTDN+PFK AMQ F
Sbjct  171  IAFRTDNQPFKDAMQGF  187



>ref|XP_008242341.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase [Prunus mume]
Length=836

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +3

Query  132  SVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNG  311
            +  ASVSYD  A IING ++ILISGSIHYPRSTPEMWPDL+QK+K+GGLDVIQTY+FWNG
Sbjct  23   AATASVSYDHKAIIINGQKRILISGSIHYPRSTPEMWPDLIQKSKDGGLDVIQTYVFWNG  82

Query  312  HEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFR  491
            HEP PGKYYFEDRYD+VKFIKL  QAGLYV+LRIGPY C EWNFGGFPVWLK+VPGI FR
Sbjct  83   HEPSPGKYYFEDRYDLVKFIKLVHQAGLYVNLRIGPYVCAEWNFGGFPVWLKYVPGIVFR  142

Query  492  TDNEPFKSAMQKF  530
            TDNEPFK+AMQKF
Sbjct  143  TDNEPFKAAMQKF  155



>ref|NP_001266133.1| beta-galactosidase-like [Cicer arietinum]
 emb|CAA06309.1| beta-galactosidase [Cicer arietinum]
Length=730

 Score =   243 bits (620),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  132  SVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNG  311
            SV ASV+YD  A +ING R+ILISGSIHYPRSTP+MWPDL+QKAK+GG+DVIQTY+FWNG
Sbjct  26   SVTASVTYDHKAIVINGQRRILISGSIHYPRSTPQMWPDLIQKAKDGGVDVIQTYVFWNG  85

Query  312  HEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFR  491
            HEP PG YYFEDR+D+VKF+K+ QQAGLYV+LRIGPY C EWNFGGFPVWLK+VPG++FR
Sbjct  86   HEPSPGNYYFEDRFDLVKFVKVVQQAGLYVNLRIGPYVCAEWNFGGFPVWLKYVPGVAFR  145

Query  492  TDNEPFKSAMQKF  530
            TDNEPFK+AMQKF
Sbjct  146  TDNEPFKAAMQKF  158



>ref|XP_007204656.1| hypothetical protein PRUPE_ppa001412mg [Prunus persica]
 gb|EMJ05855.1| hypothetical protein PRUPE_ppa001412mg [Prunus persica]
Length=836

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +3

Query  132  SVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNG  311
            +  ASVSYD  A IING ++ILISGSIHYPRSTPEMWPDL+QK+K+GGLDVIQTY+FWNG
Sbjct  23   AATASVSYDHKAIIINGQKRILISGSIHYPRSTPEMWPDLIQKSKDGGLDVIQTYVFWNG  82

Query  312  HEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFR  491
            HEP PGKYYFEDRYD+VKFIKL  QAGLYV+LRIGPY C EWNFGGFPVWLK+VPGI FR
Sbjct  83   HEPSPGKYYFEDRYDLVKFIKLVHQAGLYVNLRIGPYVCAEWNFGGFPVWLKYVPGIVFR  142

Query  492  TDNEPFKSAMQKF  530
            TDNEPFK+AMQKF
Sbjct  143  TDNEPFKAAMQKF  155



>gb|ABV32546.1| beta-galactosidase protein 1 [Prunus persica]
Length=836

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +3

Query  132  SVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNG  311
            +  ASVSYD  A IING ++ILISGSIHYPRSTPEMWPDL+QK+K+GGLDVIQTY+FWNG
Sbjct  23   AATASVSYDHKAIIINGQKRILISGSIHYPRSTPEMWPDLIQKSKDGGLDVIQTYVFWNG  82

Query  312  HEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFR  491
            HEP PGKYYFEDRYD+VKFIKL  QAGLYV+LRIGPY C EWNFGGFPVWLK+VPGI FR
Sbjct  83   HEPSPGKYYFEDRYDLVKFIKLVHQAGLYVNLRIGPYVCAEWNFGGFPVWLKYVPGIVFR  142

Query  492  TDNEPFKSAMQKF  530
            TDNEPFK+AMQKF
Sbjct  143  TDNEPFKAAMQKF  155



>gb|KDP33831.1| hypothetical protein JCGZ_07402 [Jatropha curcas]
Length=825

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            +W SS  A+V+YD  A IING R+ILISGSIHYPRSTPEMWP L+QKAKEGGLDVIQTY+
Sbjct  12   SWISSATATVTYDHKAVIINGQRRILISGSIHYPRSTPEMWPGLIQKAKEGGLDVIQTYV  71

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FW+GHEP  G+YYFEDRYD+VKFIKL QQAGLYVHLRIGPY C EWNFGGFP+WLK++PG
Sbjct  72   FWDGHEPNQGQYYFEDRYDIVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPLWLKYIPG  131

Query  480  ISFRTDNEPFKSAMQKF  530
            I FRTDN PFK+AMQKF
Sbjct  132  IEFRTDNGPFKAAMQKF  148



>gb|AGW47883.1| beta-galactosidase precursor [Nicotiana tabacum]
Length=841

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            +W S   ASVSYD  A I+NG RKILISGSIHYPRS PEMWPDL+QKAKEGG+DVIQTY+
Sbjct  21   SWVSCGIASVSYDHKAIIVNGQRKILISGSIHYPRSIPEMWPDLIQKAKEGGVDVIQTYV  80

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHE + GKYYFE RYD+VKFIK+ Q+AGLYVHLRIGPYAC EWNFGGFPVWLK+VPG
Sbjct  81   FWNGHESEEGKYYFEGRYDLVKFIKVVQEAGLYVHLRIGPYACAEWNFGGFPVWLKYVPG  140

Query  480  ISFRTDNEPFKSAMQKF  530
            ISFRTDNEPFK+AMQKF
Sbjct  141  ISFRTDNEPFKAAMQKF  157



>gb|EPS72701.1| beta-galactosidase, partial [Genlisea aurea]
Length=339

 Score =   233 bits (595),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  141  ASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNGHEP  320
            A VSYD     ING +KILISGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FWNGHEP
Sbjct  1    AYVSYDGRGISINGQKKILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEP  60

Query  321  QPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFRTDN  500
            +PG YYF+DRYD+V+FIKL QQAGLYV+LRIGPYAC EWNFGGFPVWLK++PGISFRTDN
Sbjct  61   EPGNYYFQDRYDLVRFIKLVQQAGLYVNLRIGPYACAEWNFGGFPVWLKYIPGISFRTDN  120

Query  501  EPFKSAMQKF  530
             PFK AMQ F
Sbjct  121  GPFKDAMQNF  130



>ref|XP_010062625.1| PREDICTED: beta-galactosidase 1 [Eucalyptus grandis]
Length=825

 Score =   244 bits (623),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +3

Query  132  SVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNG  311
            SV ASVSYD  A +ING R+ILISGSIHYPRSTPEMWPDL++KAKEGGLDVIQTY+FWNG
Sbjct  21   SVLASVSYDSKAIVINGQRRILISGSIHYPRSTPEMWPDLIEKAKEGGLDVIQTYVFWNG  80

Query  312  HEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFR  491
            HEP PGKYYFE  YD+VKFIKLA+QAGLYVHLRIGPY C EWNFGGFPVWLK++PGI+FR
Sbjct  81   HEPSPGKYYFEGNYDLVKFIKLAKQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGINFR  140

Query  492  TDNEPFKSAMQKF  530
            TDNEPFK  MQKF
Sbjct  141  TDNEPFKYQMQKF  153



>emb|CDY32919.1| BnaC02g12030D [Brassica napus]
Length=722

 Score =   243 bits (619),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
              SV A+VSYD+ A IING R+IL+SGSIHYPRSTPEMWP L+QKAKEGGLDVI+TY+FW
Sbjct  22   ICSVKATVSYDRKAVIINGQRRILLSGSIHYPRSTPEMWPGLIQKAKEGGLDVIETYVFW  81

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PG YYF DRYD+VKFIKL QQAGLYV+LRIGP+ C EWNFGGFPVWLKFVPGI+
Sbjct  82   NGHEPSPGNYYFGDRYDLVKFIKLVQQAGLYVNLRIGPFVCAEWNFGGFPVWLKFVPGIA  141

Query  486  FRTDNEPFKSAMQKF  530
            FRTDNEPFK+AM+KF
Sbjct  142  FRTDNEPFKAAMKKF  156



>ref|XP_010686091.1| PREDICTED: beta-galactosidase 1 [Beta vulgaris subsp. vulgaris]
Length=841

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = +3

Query  135  VNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNGH  314
            VN SV YD  A  ING R+ILISGSIHYPRSTPEMWPDL+QKAKEGGLDVIQTY+FWNGH
Sbjct  26   VNGSVGYDHKAITINGQRRILISGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYVFWNGH  85

Query  315  EPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFRT  494
            EPQ GKYYFE+RYD+VKFIKL QQAGLY HLRIGPY C EWNFGGFPVWLK+VPGISFRT
Sbjct  86   EPQQGKYYFEERYDLVKFIKLVQQAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRT  145

Query  495  DNEPFKSAMQKF  530
            DN PFK+AMQ+F
Sbjct  146  DNGPFKAAMQRF  157



>emb|CDO97918.1| unnamed protein product [Coffea canephora]
Length=835

 Score =   244 bits (623),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            +W S   ASVSYD  A I+NG R+ILISGSIHYPRSTPEMWPDL+QKAKEGGLDVI+TY+
Sbjct  15   SWVSCGTASVSYDNTAIIVNGQRRILISGSIHYPRSTPEMWPDLIQKAKEGGLDVIETYV  74

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEPQPGKYYFE RYD+VKF+ L ++AGLYV+LRIGPY C EWNFGGFPVWLK+VPG
Sbjct  75   FWNGHEPQPGKYYFEGRYDLVKFVNLVKEAGLYVNLRIGPYVCAEWNFGGFPVWLKYVPG  134

Query  480  ISFRTDNEPFKSAMQKF  530
            ISFRT+N PFK+AMQKF
Sbjct  135  ISFRTNNGPFKAAMQKF  151



>ref|XP_003543598.1| PREDICTED: beta-galactosidase 1-like [Glycine max]
Length=841

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  132  SVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNG  311
            S  ASVSYD  A  ING R+ILISGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FWNG
Sbjct  25   SAKASVSYDSKAITINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNG  84

Query  312  HEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFR  491
            HEP PGKYYFE  YD+VKFIKL QQAGLYVHLRIGPY C EWNFGGFPVWLK++PGISFR
Sbjct  85   HEPSPGKYYFEGNYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGISFR  144

Query  492  TDNEPFKSAMQKF  530
            TDNEPFK  MQKF
Sbjct  145  TDNEPFKVQMQKF  157



>ref|XP_009783993.1| PREDICTED: beta-galactosidase [Nicotiana sylvestris]
Length=844

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            +W S   ASVSYD  A I+NG RKILISGSIHYPRS PEMWPDL+QKAKEGG+DVIQTY+
Sbjct  25   SWVSCGIASVSYDHKAIIVNGQRKILISGSIHYPRSIPEMWPDLIQKAKEGGVDVIQTYV  84

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHE + GKYYFE RYD+VKFIK+ Q+AGLYVHLRIGPYAC EWNFGGFPVWLK+VPG
Sbjct  85   FWNGHESEEGKYYFEGRYDLVKFIKVVQEAGLYVHLRIGPYACAEWNFGGFPVWLKYVPG  144

Query  480  ISFRTDNEPFKSAMQKF  530
            ISFRTDNEPFK+AMQKF
Sbjct  145  ISFRTDNEPFKAAMQKF  161



>gb|KEH37473.1| beta-like galactosidase [Medicago truncatula]
Length=667

 Score =   241 bits (616),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  135  VNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNGH  314
            V ASV+YD  A +ING R+ILISGSIHYPRSTP+MWPDL+QKAK+GG+DVI+TY+FWNGH
Sbjct  24   VTASVTYDHKAIVINGKRRILISGSIHYPRSTPQMWPDLIQKAKDGGVDVIETYVFWNGH  83

Query  315  EPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFRT  494
            EP  GKYYFEDR+D+VKFIK+ QQAGLYVHLRIGPY C EWNFGGFPVWLK+VPG++FRT
Sbjct  84   EPSQGKYYFEDRFDLVKFIKVVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGVAFRT  143

Query  495  DNEPFKSAMQKF  530
            DNEPFK+AMQKF
Sbjct  144  DNEPFKAAMQKF  155



>ref|XP_009126921.1| PREDICTED: beta-galactosidase 4-like [Brassica rapa]
Length=722

 Score =   243 bits (619),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
              SV A+VSYD+ A IING R+IL+SGSIHYPRSTPEMWP L+QKAKEGGLDVI+TY+FW
Sbjct  22   ICSVKATVSYDRKAVIINGQRRILLSGSIHYPRSTPEMWPGLIQKAKEGGLDVIETYVFW  81

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PG YYF DRYD+VKFIKL QQAGLYV+LRIGP+ C EWNFGGFPVWLKFVPGI+
Sbjct  82   NGHEPSPGNYYFGDRYDLVKFIKLVQQAGLYVNLRIGPFVCAEWNFGGFPVWLKFVPGIA  141

Query  486  FRTDNEPFKSAMQKF  530
            FRTDNEPFK+AM+KF
Sbjct  142  FRTDNEPFKAAMKKF  156



>emb|CDY20708.1| BnaA02g08480D [Brassica napus]
Length=722

 Score =   242 bits (618),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
              SV A+VSYD+ A IING R+IL+SGSIHYPRSTPEMWP L+QKAKEGGLDVI+TY+FW
Sbjct  22   ICSVKATVSYDRKAVIINGQRRILLSGSIHYPRSTPEMWPGLIQKAKEGGLDVIETYVFW  81

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PG YYF DRYD+VKFIKL QQAGLYV+LRIGP+ C EWNFGGFPVWLKFVPGI+
Sbjct  82   NGHEPSPGNYYFGDRYDLVKFIKLVQQAGLYVNLRIGPFVCAEWNFGGFPVWLKFVPGIA  141

Query  486  FRTDNEPFKSAMQKF  530
            FRTDNEPFK+AM+KF
Sbjct  142  FRTDNEPFKAAMKKF  156



>ref|XP_006280080.1| hypothetical protein CARUB_v10025963mg [Capsella rubella]
 gb|EOA12978.1| hypothetical protein CARUB_v10025963mg [Capsella rubella]
Length=726

 Score =   242 bits (618),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  135  VNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNGH  314
            V ASVSYD+ A IING R+IL+SGSIHYPRSTPEMWP L+QKAKEGGLDVI+TY+FWNGH
Sbjct  27   VEASVSYDRKAVIINGQRRILLSGSIHYPRSTPEMWPGLIQKAKEGGLDVIETYVFWNGH  86

Query  315  EPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFRT  494
            EP PG+YYF DRYD+VKFIKLA QAGLYV+LRIGPY C EWNFGGFPVWLKFVPG++FRT
Sbjct  87   EPSPGQYYFGDRYDLVKFIKLAHQAGLYVNLRIGPYVCAEWNFGGFPVWLKFVPGMAFRT  146

Query  495  DNEPFKSAMQKF  530
            DNEPFK+AM+KF
Sbjct  147  DNEPFKAAMKKF  158



>ref|XP_008450853.1| PREDICTED: beta-galactosidase-like [Cucumis melo]
Length=721

 Score =   242 bits (618),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = +3

Query  129  SSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWN  308
            SSV ASV+YD  A IING R+ILISGSIHYPRSTP+MWPDL+QKAK+GGLDVI TY+FWN
Sbjct  16   SSVMASVTYDHKAIIINGRRRILISGSIHYPRSTPQMWPDLIQKAKDGGLDVIDTYVFWN  75

Query  309  GHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISF  488
            GHEP PG Y FEDRYD+V+F+KL QQAGLYVHLRIGPY C EWNFGGFPVWLK+VPGI+F
Sbjct  76   GHEPSPGHYNFEDRYDLVRFVKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIAF  135

Query  489  RTDNEPFKSAMQKF  530
            RTDN PFK+AMQKF
Sbjct  136  RTDNGPFKAAMQKF  149



>ref|XP_004135712.1| PREDICTED: beta-galactosidase-like [Cucumis sativus]
Length=723

 Score =   242 bits (618),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +3

Query  129  SSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWN  308
            SSV ASV+YD  A +I+G R+ILISGSIHYPRSTP+MWPDL+QKAK+GGLDVI+TY+FWN
Sbjct  20   SSVMASVTYDHKALVIDGKRRILISGSIHYPRSTPQMWPDLIQKAKDGGLDVIETYVFWN  79

Query  309  GHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISF  488
            GHEP PG+YYFEDRY++V+F+KL QQAGLYVHLRIGPY C EWNFGGFPVWLK+VPGI+F
Sbjct  80   GHEPSPGQYYFEDRYELVRFVKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIAF  139

Query  489  RTDNEPFKSAMQKF  530
            RTDN PFK+AMQKF
Sbjct  140  RTDNGPFKAAMQKF  153



>ref|XP_003546676.1| PREDICTED: beta-galactosidase 1-like [Glycine max]
Length=840

 Score =   244 bits (622),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  132  SVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNG  311
            S  ASVSYD  A  ING R+ILISGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FWNG
Sbjct  24   SAKASVSYDSKAITINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNG  83

Query  312  HEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFR  491
            HEP PGKYYFE  YD+VKFIKL QQAGLYVHLRIGPY C EWNFGGFPVWLK++PGISFR
Sbjct  84   HEPSPGKYYFEGNYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGISFR  143

Query  492  TDNEPFKSAMQKF  530
            TDNEPFK  MQKF
Sbjct  144  TDNEPFKHQMQKF  156



>gb|KHN32687.1| Beta-galactosidase 1 [Glycine soja]
Length=831

 Score =   244 bits (622),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  132  SVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNG  311
            S  ASVSYD  A  ING R+ILISGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FWNG
Sbjct  15   SAKASVSYDSKAITINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNG  74

Query  312  HEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFR  491
            HEP PGKYYFE  YD+VKFIKL QQAGLYVHLRIGPY C EWNFGGFPVWLK++PGISFR
Sbjct  75   HEPSPGKYYFEGNYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGISFR  134

Query  492  TDNEPFKSAMQKF  530
            TDNEPFK  MQKF
Sbjct  135  TDNEPFKHQMQKF  147



>ref|XP_011080179.1| PREDICTED: beta-galactosidase-like [Sesamum indicum]
Length=842

 Score =   244 bits (622),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            +W S   ASVSYD  A  +NG R+ILISGSIHYPRSTPEMWPDL+QKAKEGGLDVIQTY+
Sbjct  22   SWVSWGEASVSYDHKAISVNGQRRILISGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYV  81

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEP+PGKYYFE RYD+VKFIKL  QAGLYV+LRIGPYAC EWNFGGFPVWLK+VPG
Sbjct  82   FWNGHEPEPGKYYFEGRYDLVKFIKLVHQAGLYVNLRIGPYACAEWNFGGFPVWLKYVPG  141

Query  480  ISFRTDNEPFKSAMQKF  530
            ISFRT+N PFK+AMQKF
Sbjct  142  ISFRTNNGPFKAAMQKF  158



>ref|XP_009388558.1| PREDICTED: beta-galactosidase-like [Musa acuminata subsp. malaccensis]
Length=738

 Score =   242 bits (618),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = +3

Query  129  SSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWN  308
            + V+ASVSYD+ A IING R+ILISGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FWN
Sbjct  36   TPVDASVSYDRKALIINGRRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWN  95

Query  309  GHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISF  488
            GHEP PG+YYF   YD+V+F+KL +QAGLYVHLRIGPY C EWNFGGFPVWLK+VPGISF
Sbjct  96   GHEPSPGQYYFGGNYDLVRFVKLVKQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISF  155

Query  489  RTDNEPFKSAMQKF  530
            RTDNEPFK+AM KF
Sbjct  156  RTDNEPFKAAMSKF  169



>gb|AES65414.2| beta-like galactosidase [Medicago truncatula]
Length=692

 Score =   241 bits (616),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  135  VNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNGH  314
            V ASV+YD  A +ING R+ILISGSIHYPRSTP+MWPDL+QKAK+GG+DVI+TY+FWNGH
Sbjct  24   VTASVTYDHKAIVINGKRRILISGSIHYPRSTPQMWPDLIQKAKDGGVDVIETYVFWNGH  83

Query  315  EPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFRT  494
            EP  GKYYFEDR+D+VKFIK+ QQAGLYVHLRIGPY C EWNFGGFPVWLK+VPG++FRT
Sbjct  84   EPSQGKYYFEDRFDLVKFIKVVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGVAFRT  143

Query  495  DNEPFKSAMQKF  530
            DNEPFK+AMQKF
Sbjct  144  DNEPFKAAMQKF  155



>ref|XP_010483173.1| PREDICTED: beta-galactosidase 4 [Camelina sativa]
Length=725

 Score =   242 bits (617),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  135  VNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNGH  314
            V A+VSYD+ A IING R+IL+SGSIHYPRSTPEMWP L+QKAKEGGLDVI+TY+FWNGH
Sbjct  26   VKATVSYDRKAVIINGQRRILLSGSIHYPRSTPEMWPGLIQKAKEGGLDVIETYVFWNGH  85

Query  315  EPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFRT  494
            EP PG+YYF DRYD+VKFIKLA QAGLYV+LRIGPY C EWNFGGFPVWLKFVPG++FRT
Sbjct  86   EPSPGQYYFGDRYDLVKFIKLAHQAGLYVNLRIGPYVCAEWNFGGFPVWLKFVPGMAFRT  145

Query  495  DNEPFKSAMQKF  530
            DNEPFK+AM+KF
Sbjct  146  DNEPFKAAMKKF  157



>ref|XP_010106660.1| Beta-galactosidase 1 [Morus notabilis]
 gb|EXC11109.1| Beta-galactosidase 1 [Morus notabilis]
Length=845

 Score =   244 bits (622),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 121/136 (89%), Gaps = 0/136 (0%)
 Frame = +3

Query  123  WFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIF  302
            W  SV+ASVSYD  A +ING R+ILISGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+F
Sbjct  24   WGCSVSASVSYDSKAIVINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVF  83

Query  303  WNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGI  482
            WNGHEP PGKYYFE  YD+VKF+KL QQAGLY+HLRIGPY C EWNFGGFPVWLK++PGI
Sbjct  84   WNGHEPSPGKYYFEGNYDLVKFVKLVQQAGLYMHLRIGPYVCAEWNFGGFPVWLKYIPGI  143

Query  483  SFRTDNEPFKSAMQKF  530
             FRTDN PFK+ M+KF
Sbjct  144  RFRTDNGPFKAQMEKF  159



>ref|XP_011093727.1| PREDICTED: beta-galactosidase-like [Sesamum indicum]
Length=730

 Score =   242 bits (617),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +3

Query  129  SSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWN  308
            SSV A VSYD  AFIING R+IL+SGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FWN
Sbjct  25   SSVRADVSYDDKAFIINGKRRILVSGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWN  84

Query  309  GHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISF  488
            GHEP PGKY FE R+D+VKFIKL  Q+GLYVHLRIGPY C EWNFGGFPVWLK+VPGI F
Sbjct  85   GHEPSPGKYNFEGRFDLVKFIKLVHQSGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIEF  144

Query  489  RTDNEPFKSAMQKF  530
            RTDN+PFK AMQ+F
Sbjct  145  RTDNQPFKVAMQRF  158



>ref|XP_010451557.1| PREDICTED: beta-galactosidase 4-like [Camelina sativa]
Length=725

 Score =   242 bits (617),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +3

Query  135  VNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNGH  314
            V A+VSYD+ A IING R+IL+SGSIHYPRSTPEMWP L+QKAKEGGLDVI+TY+FWNGH
Sbjct  26   VKATVSYDRKAVIINGQRRILLSGSIHYPRSTPEMWPGLIQKAKEGGLDVIETYVFWNGH  85

Query  315  EPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFRT  494
            EP PG+YYF DRYD+VKFIKLAQQAGLYV+LRIGP+ C EWNFGGFPVWLKFVPGI+FRT
Sbjct  86   EPSPGQYYFGDRYDLVKFIKLAQQAGLYVNLRIGPFVCAEWNFGGFPVWLKFVPGIAFRT  145

Query  495  DNEPFKSAMQKF  530
            +NEPFK+AM+KF
Sbjct  146  NNEPFKAAMKKF  157



>ref|XP_007024475.1| Beta galactosidase 1 [Theobroma cacao]
 gb|EOY27097.1| Beta galactosidase 1 [Theobroma cacao]
Length=843

 Score =   243 bits (621),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            +W  SV+ASVSYD+ A  ING R+ILISGSIHYPRS+PEMWPDL+QKAKEGGLDVIQTY+
Sbjct  21   SWVCSVSASVSYDRKAITINGQRRILISGSIHYPRSSPEMWPDLVQKAKEGGLDVIQTYV  80

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEP PGKYYF+  YD+VKFIKL QQAGLYVHLRIGPY C EWNFGGFPVWLK++PG
Sbjct  81   FWNGHEPAPGKYYFQGNYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPG  140

Query  480  ISFRTDNEPFKSAMQKF  530
            I+FRT+N PFK+ MQ+F
Sbjct  141  INFRTNNGPFKAQMQRF  157



>ref|XP_009409593.1| PREDICTED: beta-galactosidase-like [Musa acuminata subsp. malaccensis]
Length=712

 Score =   241 bits (616),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = +3

Query  123  WFSS-VNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            W SS V+ASVSYD  A I+NG R+ILISGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+
Sbjct  7    WLSSPVDASVSYDHKAIIVNGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYV  66

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEP PG+YYF   YD+V+FIKL +QAGLYVHLRIGPY C EWNFGGFPVWLK+VPG
Sbjct  67   FWNGHEPSPGQYYFGGNYDLVRFIKLVKQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPG  126

Query  480  ISFRTDNEPFKSAMQKF  530
            I+FRTDNEPFK+AM KF
Sbjct  127  ITFRTDNEPFKAAMAKF  143



>ref|XP_011077976.1| PREDICTED: beta-galactosidase-like [Sesamum indicum]
Length=729

 Score =   242 bits (617),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +3

Query  129  SSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWN  308
            SSV A+VSYD  AFIING R+ILISGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FWN
Sbjct  24   SSVRATVSYDDKAFIINGKRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWN  83

Query  309  GHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISF  488
            GHE  PGKY FE R+D+VKFIKL QQAGLYVHLRIGPY C EWNFGGFPVWLK+VPGI F
Sbjct  84   GHEASPGKYNFEGRFDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIEF  143

Query  489  RTDNEPFKSAMQKF  530
            RTDN+PFK AMQ F
Sbjct  144  RTDNQPFKVAMQGF  157



>ref|XP_010443345.1| PREDICTED: beta-galactosidase 4-like [Camelina sativa]
Length=725

 Score =   241 bits (616),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  135  VNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNGH  314
            V A+VSYD+ A IING R+IL+SGSIHYPRSTPEMWP L+QKAKEGGLDVI+TY+FWNGH
Sbjct  26   VKATVSYDRKAVIINGQRRILLSGSIHYPRSTPEMWPGLIQKAKEGGLDVIETYVFWNGH  85

Query  315  EPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFRT  494
            EP PG+YYF DRYD+VKFIKLA QAGLYV+LRIGP+ C EWNFGGFPVWLKFVPGI+FRT
Sbjct  86   EPSPGQYYFGDRYDLVKFIKLAHQAGLYVNLRIGPFVCAEWNFGGFPVWLKFVPGIAFRT  145

Query  495  DNEPFKSAMQKF  530
            DNEPFK+AM+KF
Sbjct  146  DNEPFKAAMKKF  157



>gb|KDO57768.1| hypothetical protein CISIN_1g004219mg [Citrus sinensis]
 gb|KDO57769.1| hypothetical protein CISIN_1g004219mg [Citrus sinensis]
Length=605

 Score =   239 bits (610),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
             S V ASVSYD  A IING ++ILISGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FW
Sbjct  32   ISFVKASVSYDHKAVIINGQKRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFW  91

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP  G YYF+DRYD+V+FIKL QQAGLYVHLRIGPY C EWN+GGFPVWLK+VPGI 
Sbjct  92   NGHEPTQGNYYFQDRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNYGGFPVWLKYVPGIE  151

Query  486  FRTDNEPFKSAMQKF  530
            FRTDN PFK+AM KF
Sbjct  152  FRTDNGPFKAAMHKF  166



>ref|XP_009139949.1| PREDICTED: beta-galactosidase 12 isoform X2 [Brassica rapa]
Length=738

 Score =   242 bits (617),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 122/136 (90%), Gaps = 1/136 (1%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
              SV A V+YD  A  ING R+IL+SGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FW
Sbjct  22   ICSVKAMVTYDHKAVTINGQRRILLSGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFW  81

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQA-GLYVHLRIGPYACGEWNFGGFPVWLKFVPGI  482
            NGHEP PG+YYFEDRYD+VKF+KL QQA GLYVH+RIGPY C EWNFGGFPVWLK+VPG+
Sbjct  82   NGHEPSPGQYYFEDRYDLVKFVKLVQQADGLYVHIRIGPYVCAEWNFGGFPVWLKYVPGM  141

Query  483  SFRTDNEPFKSAMQKF  530
            +FRTDNEPFK+AMQKF
Sbjct  142  AFRTDNEPFKAAMQKF  157



>ref|XP_009139943.1| PREDICTED: beta-galactosidase 12 isoform X1 [Brassica rapa]
Length=740

 Score =   242 bits (617),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 122/136 (90%), Gaps = 1/136 (1%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
              SV A V+YD  A  ING R+IL+SGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FW
Sbjct  22   ICSVKAMVTYDHKAVTINGQRRILLSGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFW  81

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQA-GLYVHLRIGPYACGEWNFGGFPVWLKFVPGI  482
            NGHEP PG+YYFEDRYD+VKF+KL QQA GLYVH+RIGPY C EWNFGGFPVWLK+VPG+
Sbjct  82   NGHEPSPGQYYFEDRYDLVKFVKLVQQADGLYVHIRIGPYVCAEWNFGGFPVWLKYVPGM  141

Query  483  SFRTDNEPFKSAMQKF  530
            +FRTDNEPFK+AMQKF
Sbjct  142  AFRTDNEPFKAAMQKF  157



>dbj|BAF31233.1| beta-D-galactosidase [Persea americana]
Length=849

 Score =   243 bits (621),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 121/136 (89%), Gaps = 0/136 (0%)
 Frame = +3

Query  123  WFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIF  302
            + S    SVSYD  A IING R+ILISGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+F
Sbjct  31   YLSPATCSVSYDHKAIIINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVF  90

Query  303  WNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGI  482
            WNGHEP PG+YYFE RYD+VKFIKL ++AGLYVHLRIGPYAC EWNFGGFPVWLK++PGI
Sbjct  91   WNGHEPSPGEYYFEGRYDLVKFIKLVKEAGLYVHLRIGPYACAEWNFGGFPVWLKYIPGI  150

Query  483  SFRTDNEPFKSAMQKF  530
            SFRTDNEPFK+AM  F
Sbjct  151  SFRTDNEPFKTAMAGF  166



>ref|XP_004144120.1| PREDICTED: beta-galactosidase-like [Cucumis sativus]
Length=782

 Score =   242 bits (618),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
             +S + SV+YD  A IING R+ILISGSIHYPRSTP+MWPDL+QKAK+GGLD+I+TY+FW
Sbjct  77   LASASRSVTYDHKAIIINGQRRILISGSIHYPRSTPQMWPDLIQKAKDGGLDIIETYVFW  136

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PGKYYFE+RYD+V+FIKL QQAGLYVHLRIGPY C EWN+GGFP+WLKFVPGI+
Sbjct  137  NGHEPSPGKYYFEERYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNYGGFPLWLKFVPGIA  196

Query  486  FRTDNEPFKSAMQKF  530
            FRTDN PFK+AMQKF
Sbjct  197  FRTDNAPFKAAMQKF  211



>ref|XP_009402923.1| PREDICTED: beta-galactosidase-like [Musa acuminata subsp. malaccensis]
Length=733

 Score =   241 bits (616),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
            F+ V+ASVSYD+ A IINGHR+IL SGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FW
Sbjct  30   FTPVDASVSYDRKAVIINGHRRILFSGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFW  89

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PG+YYF   YD+V+F+KL +QAGLYVHLRIGPY C EWNFGGFPVWLK+VPGIS
Sbjct  90   NGHEPSPGQYYFGGNYDLVRFVKLVKQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIS  149

Query  486  FRTDNEPFKSAMQKF  530
            FRTDN PFK+AM KF
Sbjct  150  FRTDNGPFKAAMAKF  164



>gb|KGN66238.1| hypothetical protein Csa_1G587980 [Cucumis sativus]
Length=661

 Score =   240 bits (613),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = +3

Query  129  SSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWN  308
            SSV ASV+YD  A IING R+ILISGSIHYPRS P+MWPDL+QKAK+GGLDVI+TY+FWN
Sbjct  20   SSVMASVTYDHKAIIINGRRRILISGSIHYPRSIPQMWPDLIQKAKDGGLDVIETYVFWN  79

Query  309  GHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISF  488
            GHEP PG+Y FEDRYD+V+F+KL  QAGLYVHLRIGPY C EWNFGGFPVWLK+VPGI+F
Sbjct  80   GHEPSPGQYNFEDRYDLVRFVKLVHQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIAF  139

Query  489  RTDNEPFKSAMQKF  530
            RTDN PFK+AMQKF
Sbjct  140  RTDNGPFKAAMQKF  153



>ref|XP_010911412.1| PREDICTED: beta-galactosidase-like, partial [Elaeis guineensis]
Length=585

 Score =   238 bits (608),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +3

Query  138  NASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNGHE  317
            +A+VSYD  A IING R+ILISGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FWNGHE
Sbjct  37   DATVSYDHKALIINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  96

Query  318  PQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFRTD  497
            P PG+YYF  RYD+V+FIKL +QAGLYVHLRIGPY C EWNFGGFP+WLK+VPGISFRTD
Sbjct  97   PSPGQYYFGGRYDLVRFIKLVKQAGLYVHLRIGPYVCAEWNFGGFPIWLKYVPGISFRTD  156

Query  498  NEPFKSAMQKF  530
            N PFK+AM+KF
Sbjct  157  NGPFKAAMEKF  167



>ref|XP_010545349.1| PREDICTED: beta-galactosidase 12-like isoform X2 [Tarenaya hassleriana]
Length=588

 Score =   238 bits (608),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
             SSV  +VSYD  A IING R+IL+SGSIHYPRSTPEMW DL+QKAK+GGLDVIQTY+FW
Sbjct  21   ISSVKGAVSYDHKAVIINGQRRILLSGSIHYPRSTPEMWSDLIQKAKDGGLDVIQTYVFW  80

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PG YYFEDRYD+V+FI++ Q+AGLYVHLRIGPY C EWNFGGFPVWLK+VPGI+
Sbjct  81   NGHEPSPGNYYFEDRYDLVRFIRVVQKAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIA  140

Query  486  FRTDNEPFKSAMQKF  530
            FRT+N PFK+AMQKF
Sbjct  141  FRTNNGPFKAAMQKF  155



>gb|AAK96780.1| beta-galactosidase [Arabidopsis thaliana]
 gb|AAL47393.1| beta-galactosidase [Arabidopsis thaliana]
Length=724

 Score =   241 bits (615),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  135  VNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNGH  314
            V ASVSYD+ A IING R+IL+SGSIHYPRSTPEMWP L+QKAKEGGLDVI+TY+FWNGH
Sbjct  25   VKASVSYDRKAVIINGQRRILLSGSIHYPRSTPEMWPGLIQKAKEGGLDVIETYVFWNGH  84

Query  315  EPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFRT  494
            EP PG+YYF DRYD+VKFIKL  QAGLYV+LRIGPY C EWNFGGFPVWLKFVPG++FRT
Sbjct  85   EPSPGQYYFGDRYDLVKFIKLVHQAGLYVNLRIGPYVCAEWNFGGFPVWLKFVPGMAFRT  144

Query  495  DNEPFKSAMQKF  530
            DNEPFK+AM+KF
Sbjct  145  DNEPFKAAMKKF  156



>ref|NP_001234303.1| beta-galactosidase precursor [Solanum lycopersicum]
 gb|AAF70822.1|AF154421_1 beta-galactosidase [Solanum lycopersicum]
 emb|CAA10173.1| ss-galactosidase [Solanum lycopersicum]
Length=838

 Score =   243 bits (620),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            +W  S  ASVSYD  A I+NG R+ILISGS+HYPRSTPEMWP ++QKAKEGG+DVIQTY+
Sbjct  18   SWVFSGTASVSYDHRAIIVNGQRRILISGSVHYPRSTPEMWPGIIQKAKEGGVDVIQTYV  77

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEPQ GKYYFE RYD+VKFIKL  QAGLYVHLR+GPYAC EWNFGGFPVWLK+VPG
Sbjct  78   FWNGHEPQQGKYYFEGRYDLVKFIKLVHQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPG  137

Query  480  ISFRTDNEPFKSAMQKF  530
            ISFRTDN PFK+AMQKF
Sbjct  138  ISFRTDNGPFKAAMQKF  154



>gb|ADO34788.1| beta-galactosidase STBG3 [Solanum lycopersicum]
Length=838

 Score =   243 bits (620),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            +W  S  ASVSYD  A I+NG R+ILISGS+HYPRSTPEMWP ++QKAKEGG+DVIQTY+
Sbjct  18   SWVFSGTASVSYDHRAIIVNGQRRILISGSVHYPRSTPEMWPGIIQKAKEGGVDVIQTYV  77

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEPQ GKYYFE RYD+VKFIKL  QAGLYVHLR+GPYAC EWNFGGFPVWLK+VPG
Sbjct  78   FWNGHEPQQGKYYFEGRYDLVKFIKLVHQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPG  137

Query  480  ISFRTDNEPFKSAMQKF  530
            ISFRTDN PFK+AMQKF
Sbjct  138  ISFRTDNGPFKAAMQKF  154



>ref|XP_003595162.1| Beta-galactosidase [Medicago truncatula]
 gb|ABN08770.1| Galactose-binding like [Medicago truncatula]
 gb|AES65413.1| beta-like galactosidase [Medicago truncatula]
Length=726

 Score =   241 bits (615),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  135  VNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNGH  314
            V ASV+YD  A +ING R+ILISGSIHYPRSTP+MWPDL+QKAK+GG+DVI+TY+FWNGH
Sbjct  24   VTASVTYDHKAIVINGKRRILISGSIHYPRSTPQMWPDLIQKAKDGGVDVIETYVFWNGH  83

Query  315  EPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFRT  494
            EP  GKYYFEDR+D+VKFIK+ QQAGLYVHLRIGPY C EWNFGGFPVWLK+VPG++FRT
Sbjct  84   EPSQGKYYFEDRFDLVKFIKVVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGVAFRT  143

Query  495  DNEPFKSAMQKF  530
            DNEPFK+AMQKF
Sbjct  144  DNEPFKAAMQKF  155



>ref|NP_200498.1| beta-galactosidase 4 [Arabidopsis thaliana]
 sp|Q9SCV8.1|BGAL4_ARATH RecName: Full=Beta-galactosidase 4; Short=Lactase 4; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAB64740.1| putative beta-galactosidase [Arabidopsis thaliana]
 dbj|BAA97206.1| beta-galactosidase [Arabidopsis thaliana]
 gb|AED96817.1| beta-galactosidase 4 [Arabidopsis thaliana]
Length=724

 Score =   241 bits (615),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  135  VNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNGH  314
            V ASVSYD+ A IING R+IL+SGSIHYPRSTPEMWP L+QKAKEGGLDVI+TY+FWNGH
Sbjct  25   VKASVSYDRKAVIINGQRRILLSGSIHYPRSTPEMWPGLIQKAKEGGLDVIETYVFWNGH  84

Query  315  EPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFRT  494
            EP PG+YYF DRYD+VKFIKL  QAGLYV+LRIGPY C EWNFGGFPVWLKFVPG++FRT
Sbjct  85   EPSPGQYYFGDRYDLVKFIKLVHQAGLYVNLRIGPYVCAEWNFGGFPVWLKFVPGMAFRT  144

Query  495  DNEPFKSAMQKF  530
            DNEPFK+AM+KF
Sbjct  145  DNEPFKAAMKKF  156



>gb|KDO57767.1| hypothetical protein CISIN_1g004219mg [Citrus sinensis]
Length=635

 Score =   239 bits (610),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
             S V ASVSYD  A IING ++ILISGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FW
Sbjct  32   ISFVKASVSYDHKAVIINGQKRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFW  91

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP  G YYF+DRYD+V+FIKL QQAGLYVHLRIGPY C EWN+GGFPVWLK+VPGI 
Sbjct  92   NGHEPTQGNYYFQDRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNYGGFPVWLKYVPGIE  151

Query  486  FRTDNEPFKSAMQKF  530
            FRTDN PFK+AM KF
Sbjct  152  FRTDNGPFKAAMHKF  166



>ref|XP_011460033.1| PREDICTED: beta-galactosidase isoform X3 [Fragaria vesca subsp. 
vesca]
 ref|XP_011460035.1| PREDICTED: beta-galactosidase isoform X3 [Fragaria vesca subsp. 
vesca]
Length=746

 Score =   241 bits (616),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = +3

Query  135  VNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNGH  314
              ASVSYD  A II+G ++IL+SGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FWNGH
Sbjct  26   ATASVSYDHRAIIIDGQKRILLSGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGH  85

Query  315  EPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFRT  494
            EP PGKYYFEDRYD+VKFIKL +QAGLYVHLRIGPY C EWNFGGFP WLK+VPGI FRT
Sbjct  86   EPSPGKYYFEDRYDLVKFIKLVKQAGLYVHLRIGPYVCAEWNFGGFPAWLKYVPGIEFRT  145

Query  495  DNEPFKSAMQKF  530
            DNEPFK+AM+ F
Sbjct  146  DNEPFKAAMKTF  157



>emb|CBI27912.3| unnamed protein product [Vitis vinifera]
Length=833

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            +W S  +ASV+YDK +FIING RKILISGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+
Sbjct  14   SWVSHGSASVTYDKRSFIINGQRKILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYV  73

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEP  GKYYFE RYD+V+FIK+ Q AGLYVHLRIGPY C EWNFGGFPVWLK+VPG
Sbjct  74   FWNGHEPSRGKYYFEGRYDLVRFIKVVQAAGLYVHLRIGPYICAEWNFGGFPVWLKYVPG  133

Query  480  ISFRTDNEPFKSAMQKF  530
            I+FRTDN PFK AMQ F
Sbjct  134  IAFRTDNGPFKVAMQGF  150



>gb|KFK34528.1| hypothetical protein AALP_AA5G157800 [Arabis alpina]
Length=708

 Score =   241 bits (614),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
              S  A VSYD  A IING R+IL+SGSIHYPRSTPEMWPDL++KAKEGGLDVIQTY+FW
Sbjct  3    ICSTKAEVSYDHKALIINGQRRILLSGSIHYPRSTPEMWPDLVKKAKEGGLDVIQTYVFW  62

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PG+YYFEDRYD+VKFIK+ QQAGLYV LRIGPY C EWNFGG PVWLK+VPGI 
Sbjct  63   NGHEPSPGQYYFEDRYDLVKFIKVVQQAGLYVSLRIGPYVCAEWNFGGLPVWLKYVPGIV  122

Query  486  FRTDNEPFKSAMQKF  530
            FRTDNEPFK AMQKF
Sbjct  123  FRTDNEPFKIAMQKF  137



>ref|XP_002282132.1| PREDICTED: beta-galactosidase [Vitis vinifera]
Length=836

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            +W S  +ASV+YDK +FIING RKILISGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+
Sbjct  17   SWVSHGSASVTYDKRSFIINGQRKILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYV  76

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEP  GKYYFE RYD+V+FIK+ Q AGLYVHLRIGPY C EWNFGGFPVWLK+VPG
Sbjct  77   FWNGHEPSRGKYYFEGRYDLVRFIKVVQAAGLYVHLRIGPYICAEWNFGGFPVWLKYVPG  136

Query  480  ISFRTDNEPFKSAMQKF  530
            I+FRTDN PFK AMQ F
Sbjct  137  IAFRTDNGPFKVAMQGF  153



>gb|KDO57766.1| hypothetical protein CISIN_1g004219mg [Citrus sinensis]
Length=649

 Score =   239 bits (611),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
             S V ASVSYD  A IING ++ILISGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FW
Sbjct  32   ISFVKASVSYDHKAVIINGQKRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFW  91

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP  G YYF+DRYD+V+FIKL QQAGLYVHLRIGPY C EWN+GGFPVWLK+VPGI 
Sbjct  92   NGHEPTQGNYYFQDRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNYGGFPVWLKYVPGIE  151

Query  486  FRTDNEPFKSAMQKF  530
            FRTDN PFK+AM KF
Sbjct  152  FRTDNGPFKAAMHKF  166



>emb|CDY11899.1| BnaC03g13250D [Brassica napus]
Length=722

 Score =   241 bits (614),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
              SV A+VSYD+ A IING R+IL+SGSIHYPRSTPEMWP L+QKAKEGGLDVI+TY+FW
Sbjct  22   ICSVKATVSYDRKAVIINGQRRILLSGSIHYPRSTPEMWPGLIQKAKEGGLDVIETYVFW  81

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PG YYF DRYD+VKFIKL  QAGLYV+LRIGPY C EWNFGGFPVWLKFVPG++
Sbjct  82   NGHEPSPGNYYFGDRYDLVKFIKLVHQAGLYVNLRIGPYVCAEWNFGGFPVWLKFVPGMA  141

Query  486  FRTDNEPFKSAMQKF  530
            FRTDNEPFK+AM+KF
Sbjct  142  FRTDNEPFKAAMKKF  156



>ref|XP_009132166.1| PREDICTED: beta-galactosidase 4 [Brassica rapa]
Length=722

 Score =   241 bits (614),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
              SV A+VSYD+ A IING R+IL+SGSIHYPRSTPEMWP L+QKAKEGGLDVI+TY+FW
Sbjct  22   ICSVKATVSYDRKAVIINGQRRILLSGSIHYPRSTPEMWPGLIQKAKEGGLDVIETYVFW  81

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PG YYF DRYD+VKFIKL  QAGLYV+LRIGPY C EWNFGGFPVWLKFVPG++
Sbjct  82   NGHEPSPGNYYFGDRYDLVKFIKLVHQAGLYVNLRIGPYVCAEWNFGGFPVWLKFVPGMA  141

Query  486  FRTDNEPFKSAMQKF  530
            FRTDNEPFK+AM+KF
Sbjct  142  FRTDNEPFKAAMKKF  156



>ref|XP_006401275.1| hypothetical protein EUTSA_v10012847mg [Eutrema salsugineum]
 gb|ESQ42728.1| hypothetical protein EUTSA_v10012847mg [Eutrema salsugineum]
Length=693

 Score =   240 bits (613),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +3

Query  132  SVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNG  311
            SV A+VSYD+ A IING R+IL+SGSIHYPRSTPEMWP L+QKAKEGGLDV++TY+FWNG
Sbjct  24   SVKATVSYDRKAVIINGQRRILLSGSIHYPRSTPEMWPGLIQKAKEGGLDVVETYVFWNG  83

Query  312  HEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFR  491
            HEP PG YYF DRYD+VKFIKL  QAGLYV+LRIGPY C EWNFGGFPVWLKFVPG++FR
Sbjct  84   HEPSPGNYYFGDRYDLVKFIKLVHQAGLYVNLRIGPYVCAEWNFGGFPVWLKFVPGMAFR  143

Query  492  TDNEPFKSAMQKF  530
            TDNEPFK+AM+KF
Sbjct  144  TDNEPFKAAMKKF  156



>ref|XP_002864484.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40743.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=726

 Score =   241 bits (614),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  135  VNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNGH  314
            V ASVSYD+ A IING R+IL+SGSIHYPRSTPEMWP L+QKAKEGGLDVI+TY+FWNGH
Sbjct  25   VKASVSYDRKAVIINGQRRILLSGSIHYPRSTPEMWPGLIQKAKEGGLDVIETYVFWNGH  84

Query  315  EPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFRT  494
            EP PG+YYF DRYD+VKFIKL  QAGLYV+LRIGPY C EWNFGGFPVWLKFVPG++FRT
Sbjct  85   EPSPGQYYFGDRYDLVKFIKLVHQAGLYVNLRIGPYVCAEWNFGGFPVWLKFVPGMAFRT  144

Query  495  DNEPFKSAMQKF  530
            DNEPFK+AM+KF
Sbjct  145  DNEPFKAAMKKF  156



>ref|XP_011460028.1| PREDICTED: beta-galactosidase isoform X2 [Fragaria vesca subsp. 
vesca]
Length=764

 Score =   241 bits (616),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = +3

Query  135  VNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNGH  314
              ASVSYD  A II+G ++IL+SGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FWNGH
Sbjct  44   ATASVSYDHRAIIIDGQKRILLSGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGH  103

Query  315  EPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFRT  494
            EP PGKYYFEDRYD+VKFIKL +QAGLYVHLRIGPY C EWNFGGFP WLK+VPGI FRT
Sbjct  104  EPSPGKYYFEDRYDLVKFIKLVKQAGLYVHLRIGPYVCAEWNFGGFPAWLKYVPGIEFRT  163

Query  495  DNEPFKSAMQKF  530
            DNEPFK+AM+ F
Sbjct  164  DNEPFKAAMKTF  175



>ref|XP_003597608.1| Beta-galactosidase [Medicago truncatula]
 gb|ABN08398.1| D-galactoside/L-rhamnose binding SUEL lectin; Galactose-binding 
like [Medicago truncatula]
 gb|AES67859.1| beta-galactosidase [Medicago truncatula]
Length=841

 Score =   242 bits (618),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
              SV ASVSYD  A  ING  +ILISGSIHYPRSTPEMWPDL+QKAKEGGLDVIQTY+FW
Sbjct  21   ICSVIASVSYDSKAITINGQSRILISGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYVFW  80

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PGKYYFE  YD+VKFIKL QQAGLYVHLRIGPY C EWNFGGFPVWLK++PGIS
Sbjct  81   NGHEPSPGKYYFEGNYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGIS  140

Query  486  FRTDNEPFKSAMQKF  530
            FRTDNEPFK  MQKF
Sbjct  141  FRTDNEPFKFQMQKF  155



>ref|XP_004287560.2| PREDICTED: beta-galactosidase isoform X1 [Fragaria vesca subsp. 
vesca]
Length=780

 Score =   241 bits (616),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = +3

Query  135  VNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNGH  314
              ASVSYD  A II+G ++IL+SGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FWNGH
Sbjct  60   ATASVSYDHRAIIIDGQKRILLSGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGH  119

Query  315  EPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFRT  494
            EP PGKYYFEDRYD+VKFIKL +QAGLYVHLRIGPY C EWNFGGFP WLK+VPGI FRT
Sbjct  120  EPSPGKYYFEDRYDLVKFIKLVKQAGLYVHLRIGPYVCAEWNFGGFPAWLKYVPGIEFRT  179

Query  495  DNEPFKSAMQKF  530
            DNEPFK+AM+ F
Sbjct  180  DNEPFKAAMKTF  191



>ref|XP_004486826.1| PREDICTED: beta-galactosidase 1-like [Cicer arietinum]
Length=847

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +3

Query  132  SVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNG  311
            S  ASVSYD  A  ING R+ILISGSIHYPRSTPEMWPDL+QKAKEGGLDVIQTY+FWNG
Sbjct  29   SATASVSYDSKAITINGQRRILISGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYVFWNG  88

Query  312  HEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFR  491
            HEP P KYYFE  YD+VKFIKL QQAGLYVHLRIGPY C EWNFGGFPVWLK++PGISFR
Sbjct  89   HEPSPDKYYFEGNYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGISFR  148

Query  492  TDNEPFKSAMQKF  530
            TDNEPFK  MQKF
Sbjct  149  TDNEPFKFQMQKF  161



>ref|XP_003563718.1| PREDICTED: beta-galactosidase 9 [Brachypodium distachyon]
Length=719

 Score =   240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = +3

Query  129  SSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWN  308
            S  NA+VSYD  A +ING R+IL+SGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FWN
Sbjct  20   SPANAAVSYDHKAIVINGQRRILMSGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWN  79

Query  309  GHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISF  488
            GHEP  G+YYF DRYD+V+F+KLA+QAGLYVHLRIGPY C EWNFGGFPVWLK+VPGISF
Sbjct  80   GHEPVQGQYYFGDRYDLVRFVKLAKQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISF  139

Query  489  RTDNEPFKSAMQKF  530
            RTDN PFK+AMQ F
Sbjct  140  RTDNGPFKAAMQTF  153



>gb|KHN30042.1| Beta-galactosidase 1 [Glycine soja]
Length=831

 Score =   242 bits (617),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +3

Query  132  SVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNG  311
            S  ASVSYD  A  ING R+ILISGSIHYPRSTPEMWPDL+QKAK+G LDVIQTY+FWNG
Sbjct  15   SAKASVSYDSKAITINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGSLDVIQTYVFWNG  74

Query  312  HEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFR  491
            HEP PGKYYFE  YD+VKFIKL QQAGLYVHLRIGPY C EWNFGGFPVWLK++PGISFR
Sbjct  75   HEPSPGKYYFEGNYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGISFR  134

Query  492  TDNEPFKSAMQKF  530
            TDNEPFK  MQKF
Sbjct  135  TDNEPFKVQMQKF  147



>gb|AAN60229.1| unknown [Arabidopsis thaliana]
Length=569

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +3

Query  132  SVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNG  311
            S  A V+YD  A IING R+ILISGSIHYPRSTPEMWPDL++KAKEGGLDVIQTY+FWNG
Sbjct  24   STEAVVTYDHKALIINGQRRILISGSIHYPRSTPEMWPDLIKKAKEGGLDVIQTYVFWNG  83

Query  312  HEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFR  491
            HEP PG YYF+DRYD+VKF KL  QAGLY+ LRIGPY C EWNFGGFPVWLK+VPG+ FR
Sbjct  84   HEPSPGNYYFQDRYDLVKFTKLVHQAGLYLDLRIGPYVCAEWNFGGFPVWLKYVPGMVFR  143

Query  492  TDNEPFKSAMQKF  530
            TDNEPFK AMQKF
Sbjct  144  TDNEPFKIAMQKF  156



>ref|XP_006342989.1| PREDICTED: beta-galactosidase-like [Solanum tuberosum]
Length=838

 Score =   241 bits (616),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            +W  S  ASVSYD  A I+NG R+ILISGS+HYPRSTPEMWP ++QKAKEGG+DVIQTY+
Sbjct  18   SWVFSGTASVSYDHRAIIVNGQRRILISGSVHYPRSTPEMWPGIIQKAKEGGVDVIQTYV  77

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEPQ GKYYFE RYD+VKFIKL  QAGLYVHLR+GPYAC EWNFGGFPVWLK+VPG
Sbjct  78   FWNGHEPQQGKYYFEGRYDLVKFIKLVHQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPG  137

Query  480  ISFRTDNEPFKSAMQKF  530
            ISFRT+N PFK+AMQKF
Sbjct  138  ISFRTNNGPFKAAMQKF  154



>ref|XP_007150529.1| hypothetical protein PHAVU_005G160000g [Phaseolus vulgaris]
 gb|ESW22523.1| hypothetical protein PHAVU_005G160000g [Phaseolus vulgaris]
Length=837

 Score =   241 bits (616),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
             +S  ASVSYD  A  ING R+ILISGSIHYPRSTPEMWPDL+QKAKEGGLDVIQTY+FW
Sbjct  19   IASAEASVSYDSKAITINGQRRILISGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYVFW  78

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PG+YYFE  YD+VKFIKL QQAGLYV+LRIGPY C EWNFGGFPVWLK++PGIS
Sbjct  79   NGHEPSPGQYYFEGNYDLVKFIKLVQQAGLYVNLRIGPYVCAEWNFGGFPVWLKYIPGIS  138

Query  486  FRTDNEPFKSAMQKF  530
            FRTDNEPFK  MQKF
Sbjct  139  FRTDNEPFKYQMQKF  153



>ref|XP_004170887.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase-like [Cucumis 
sativus]
Length=716

 Score =   239 bits (611),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            TW  S   +V+YD+ A IIN  R+ILISGSIHYPRSTP+MWPDL+QKAK+GGLD+I+TY+
Sbjct  13   TWVGSTIGAVTYDEKAIIINDQRRILISGSIHYPRSTPQMWPDLIQKAKDGGLDIIETYV  72

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEP  GKYYFE+RYD+V FIKL Q+AGLYVHLRIGPY C EWN+GGFP+WLKFVPG
Sbjct  73   FWNGHEPSEGKYYFEERYDLVGFIKLVQKAGLYVHLRIGPYVCAEWNYGGFPIWLKFVPG  132

Query  480  ISFRTDNEPFKSAMQKF  530
            I+FRTDNEPFK+AMQKF
Sbjct  133  IAFRTDNEPFKAAMQKF  149



>ref|XP_004158444.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase-like [Cucumis 
sativus]
Length=725

 Score =   239 bits (611),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = +3

Query  129  SSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWN  308
            SSV ASV+YD  A IING R+ILISGSIHYPRS P+MWPDL+QKAK+GGLDVI+TY+FWN
Sbjct  20   SSVMASVTYDHKAIIINGRRRILISGSIHYPRSIPQMWPDLIQKAKDGGLDVIETYVFWN  79

Query  309  GHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISF  488
            GHEP PG+Y FEDRYD+V+F+KL  QAGLYVHLRIGPY C EWNFGGFPVWLK+VPGI+F
Sbjct  80   GHEPSPGQYNFEDRYDLVRFVKLVHQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIAF  139

Query  489  RTDNEPFKSAMQKF  530
            RTDN PFK+AMQKF
Sbjct  140  RTDNGPFKAAMQKF  153



>ref|XP_009762312.1| PREDICTED: beta-galactosidase-like [Nicotiana sylvestris]
Length=725

 Score =   239 bits (611),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
            FSSV A+VSYD  A IING RKILISGSIHYPRSTPEMWPDL+QKAK+GGLDVI+TY+FW
Sbjct  19   FSSVKATVSYDDRAIIINGRRKILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIETYVFW  78

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PGKY FE RYD+VKF+KL Q+AGLYV+LRIGPY C EWNFGGFP+WLK++PG+ 
Sbjct  79   NGHEPSPGKYNFEGRYDLVKFVKLVQKAGLYVNLRIGPYVCAEWNFGGFPIWLKYIPGME  138

Query  486  FRTDNEPFKSAMQKF  530
            FRTDN+PFK AMQ F
Sbjct  139  FRTDNQPFKVAMQGF  153



>ref|XP_010090040.1| hypothetical protein L484_027271 [Morus notabilis]
 gb|EXB38837.1| hypothetical protein L484_027271 [Morus notabilis]
Length=838

 Score =   241 bits (615),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
            FSS  ASV+YD  A +ING R+ILISGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FW
Sbjct  22   FSSATASVTYDHRAIVINGKRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFW  81

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP  GKYYFE+RYD+VKFIKL  QAGLYVHLRIGPY CGEWNFGGFPVWLK+VPGI+
Sbjct  82   NGHEPSEGKYYFENRYDLVKFIKLVHQAGLYVHLRIGPYICGEWNFGGFPVWLKYVPGIA  141

Query  486  FRTDNEPFKSAMQKF  530
            FRTDN PFK  MQ+F
Sbjct  142  FRTDNGPFKWHMQRF  156



>ref|XP_010418820.1| PREDICTED: beta-galactosidase 8-like [Camelina sativa]
Length=231

 Score =   226 bits (577),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +3

Query  141  ASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNGHEP  320
            A+V+YD  A +I+G RKILISGSIHYPRSTPEMWPDL+QK+K+GGLDVI+TY+FW+GHEP
Sbjct  26   ANVTYDHRALVIDGKRKILISGSIHYPRSTPEMWPDLIQKSKDGGLDVIETYVFWSGHEP  85

Query  321  QPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFRTDN  500
            +  KY FE RYD+VKF+KLA +AGLYVHLRIGPY C EWN+GGFPVWL FVPGI FRTDN
Sbjct  86   EKNKYNFEGRYDLVKFVKLAAKAGLYVHLRIGPYVCAEWNYGGFPVWLHFVPGIKFRTDN  145

Query  501  EPFKSAMQKF  530
            EPFK+ MQ+F
Sbjct  146  EPFKAEMQRF  155



>gb|KGN59822.1| hypothetical protein Csa_3G848310 [Cucumis sativus]
Length=737

 Score =   239 bits (611),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  132  SVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNG  311
            SV ASVSYD  A IINGHR+ILISGSIHYPRST EMWPDL+QKAKEGGLDVI+TY+FWNG
Sbjct  23   SVQASVSYDSKAIIINGHRRILISGSIHYPRSTSEMWPDLIQKAKEGGLDVIETYVFWNG  82

Query  312  HEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFR  491
            HEP+PGKYYFE  YD+V+F+KL  QAGLYVHLRIGPY C EWNFGGFPVWLK++PGISFR
Sbjct  83   HEPEPGKYYFEGNYDLVRFVKLVHQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGISFR  142

Query  492  TDNEPFKSAMQKF  530
            TDN PFK  M++F
Sbjct  143  TDNAPFKFQMERF  155



>gb|KDO57765.1| hypothetical protein CISIN_1g004219mg [Citrus sinensis]
Length=710

 Score =   239 bits (610),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
             S V ASVSYD  A IING ++ILISGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FW
Sbjct  32   ISFVKASVSYDHKAVIINGQKRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFW  91

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP  G YYF+DRYD+V+FIKL QQAGLYVHLRIGPY C EWN+GGFPVWLK+VPGI 
Sbjct  92   NGHEPTQGNYYFQDRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNYGGFPVWLKYVPGIE  151

Query  486  FRTDNEPFKSAMQKF  530
            FRTDN PFK+AM KF
Sbjct  152  FRTDNGPFKAAMHKF  166



>ref|XP_006385360.1| beta-galactosidase 1 family protein [Populus trichocarpa]
 gb|ERP63157.1| beta-galactosidase 1 family protein [Populus trichocarpa]
Length=846

 Score =   241 bits (614),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +3

Query  129  SSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWN  308
             SV ASVSYD  A  ING R+ILISGSIHYPRS+PEMWPDL+QKAKEGGLDVIQTY+FWN
Sbjct  27   CSVTASVSYDSKAITINGQRRILISGSIHYPRSSPEMWPDLIQKAKEGGLDVIQTYVFWN  86

Query  309  GHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISF  488
            GHEP PGKYYFE  YD+VKF+KLA++AGLYVHLRIGPY C EWNFGGFPVWLK++PGI+F
Sbjct  87   GHEPSPGKYYFEGNYDLVKFVKLAKEAGLYVHLRIGPYICAEWNFGGFPVWLKYIPGINF  146

Query  489  RTDNEPFKSAMQKF  530
            RTDN PFK+ MQKF
Sbjct  147  RTDNGPFKAQMQKF  160



>gb|KDO57764.1| hypothetical protein CISIN_1g004219mg [Citrus sinensis]
Length=702

 Score =   239 bits (609),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
             S V ASVSYD  A IING ++ILISGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FW
Sbjct  32   ISFVKASVSYDHKAVIINGQKRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFW  91

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP  G YYF+DRYD+V+FIKL QQAGLYVHLRIGPY C EWN+GGFPVWLK+VPGI 
Sbjct  92   NGHEPTQGNYYFQDRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNYGGFPVWLKYVPGIE  151

Query  486  FRTDNEPFKSAMQKF  530
            FRTDN PFK+AM KF
Sbjct  152  FRTDNGPFKAAMHKF  166



>gb|ABK96254.1| unknown [Populus trichocarpa x Populus deltoides]
Length=846

 Score =   241 bits (614),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +3

Query  129  SSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWN  308
             SV ASVSYD  A  ING R+ILISGSIHYPRS+PEMWPDL+QKAKEGGLDVIQTY+FWN
Sbjct  27   CSVTASVSYDSKAITINGQRRILISGSIHYPRSSPEMWPDLIQKAKEGGLDVIQTYVFWN  86

Query  309  GHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISF  488
            GHEP PGKYYFE  YD+VKF+KLA++AGLYVHLRIGPY C EWNFGGFPVWLK++PGI+F
Sbjct  87   GHEPSPGKYYFEGNYDLVKFVKLAKEAGLYVHLRIGPYICAEWNFGGFPVWLKYIPGINF  146

Query  489  RTDNEPFKSAMQKF  530
            RTDN PFK+ MQKF
Sbjct  147  RTDNGPFKAQMQKF  160



>ref|XP_006451459.1| hypothetical protein CICLE_v10007531mg [Citrus clementina]
 gb|ESR64699.1| hypothetical protein CICLE_v10007531mg [Citrus clementina]
Length=702

 Score =   239 bits (609),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
             S V ASVSYD  A IING ++ILISGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FW
Sbjct  32   ISFVKASVSYDHKAVIINGQKRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFW  91

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP  G YYF+DRYD+V+FIKL QQAGLYVHLRIGPY C EWN+GGFPVWLK+VPGI 
Sbjct  92   NGHEPTQGNYYFQDRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNYGGFPVWLKYVPGIE  151

Query  486  FRTDNEPFKSAMQKF  530
            FRTDN PFK+AM KF
Sbjct  152  FRTDNGPFKAAMHKF  166



>ref|XP_007012844.1| Beta-galactosidase [Theobroma cacao]
 gb|EOY30463.1| Beta-galactosidase [Theobroma cacao]
Length=847

 Score =   241 bits (614),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 124/145 (86%), Gaps = 8/145 (6%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            +W  SV+A+VSYD  A IING R+IL+SGSIHYPRSTP+MWPDL+ KAKEGGLDVIQTY+
Sbjct  21   SWVFSVSATVSYDSKAIIINGRRRILLSGSIHYPRSTPQMWPDLIAKAKEGGLDVIQTYV  80

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEP PGKYYF+DRYD+V+FIKL QQAGLYVHLRIGPY C EWNFGGFPVWLK+VPG
Sbjct  81   FWNGHEPSPGKYYFDDRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPG  140

Query  480  ISFRTDNEPFK--------SAMQKF  530
            I FRTDN PFK        +AMQKF
Sbjct  141  IVFRTDNGPFKVENFDYLIAAMQKF  165



>ref|NP_001130532.1| beta-galactosidase isoform 1 precursor [Zea mays]
 ref|XP_008678520.1| PREDICTED: beta-galactosidase 9 [Zea mays]
 gb|ACF78784.1| unknown [Zea mays]
 gb|ACN34336.1| unknown [Zea mays]
 gb|AFW61986.1| beta-galactosidase isoform 1 [Zea mays]
 gb|AFW61987.1| beta-galactosidase isoform 2 [Zea mays]
 gb|AFW87015.1| beta-galactosidase isoform 1 [Zea mays]
 gb|AFW87016.1| beta-galactosidase isoform 2 [Zea mays]
Length=722

 Score =   239 bits (609),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +3

Query  129  SSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWN  308
            S  NA+VSYD  A +ING R+ILISGSIHYPRSTPEMWP LLQKAK+GGLDV+QTY+FWN
Sbjct  22   SPANAAVSYDHRAVVINGQRRILISGSIHYPRSTPEMWPGLLQKAKDGGLDVVQTYVFWN  81

Query  309  GHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISF  488
            GHEP  G+YYF DRYD+V+F+KLA+QAGLYVHLRIGPY C EWNFGGFPVWLK+VPGISF
Sbjct  82   GHEPVRGQYYFGDRYDLVRFVKLAKQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISF  141

Query  489  RTDNEPFKSAMQKF  530
            RTDN PFK+AMQ F
Sbjct  142  RTDNGPFKAAMQAF  155



>gb|KCW53602.1| hypothetical protein EUGRSUZ_J02867 [Eucalyptus grandis]
Length=673

 Score =   238 bits (607),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +3

Query  129  SSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWN  308
            +SV ASVSYD  A  ING R+ILISGSIHYPRSTPEMWPDL++KAKEGGLDVIQTY+FWN
Sbjct  25   TSVTASVSYDAKAITINGQRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWN  84

Query  309  GHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISF  488
            GHEP PGKY FE  YD+VKF+KLAQQAGLYVHLR+GPY C EWNFGGFPVWLK+V GISF
Sbjct  85   GHEPSPGKYNFEGNYDIVKFVKLAQQAGLYVHLRVGPYVCAEWNFGGFPVWLKYVRGISF  144

Query  489  RTDNEPFKSAMQKF  530
            RTDN PFK  MQKF
Sbjct  145  RTDNGPFKYYMQKF  158



>ref|XP_009599425.1| PREDICTED: beta-galactosidase-like [Nicotiana tomentosiformis]
Length=725

 Score =   239 bits (609),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
            FSSV A+VSYD  A +ING RKILISGSIHYPRSTPEMWPDL+QKAK+GGLDVI+TY+FW
Sbjct  19   FSSVKATVSYDDRAILINGKRKILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIETYVFW  78

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PGKY FE RYD++KF+KL Q+AGLYV+LRIGPY C EWNFGGFPVWLK+VPG+ 
Sbjct  79   NGHEPSPGKYNFEGRYDLIKFVKLVQKAGLYVNLRIGPYVCAEWNFGGFPVWLKYVPGME  138

Query  486  FRTDNEPFKSAMQKF  530
            FRTDN+PFK AMQ F
Sbjct  139  FRTDNQPFKVAMQGF  153



>ref|XP_010090042.1| Beta-galactosidase 1 [Morus notabilis]
 gb|EXB38839.1| Beta-galactosidase 1 [Morus notabilis]
Length=733

 Score =   239 bits (609),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 121/141 (86%), Gaps = 4/141 (3%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            +W   V A VSYD  A IING R+ILISGSIHYPRSTPEMWPDL+QKAK GGLDVIQTY+
Sbjct  19   SWVFEVEARVSYDNRAIIINGRRRILISGSIHYPRSTPEMWPDLIQKAKNGGLDVIQTYV  78

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFG----GFPVWLK  467
            FWNGHEP PGKYYFE RYD+V+FIKL Q+AGLYVHLRIGPY C EWNFG    GFPVWLK
Sbjct  79   FWNGHEPSPGKYYFEGRYDLVQFIKLVQKAGLYVHLRIGPYVCAEWNFGFAIRGFPVWLK  138

Query  468  FVPGISFRTDNEPFKSAMQKF  530
            +VPGI FRTDN+PFK+AM+KF
Sbjct  139  YVPGIVFRTDNQPFKAAMEKF  159



>ref|XP_009407297.1| PREDICTED: beta-galactosidase 2 [Musa acuminata subsp. malaccensis]
Length=836

 Score =   240 bits (613),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = +3

Query  135  VNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNGH  314
             +ASVSYD  A  I+G R+ILISGSIHYPRS PEMWPDL+QKAK+GGLDVIQTY+FWNGH
Sbjct  31   ASASVSYDHKAIAIDGRRRILISGSIHYPRSVPEMWPDLIQKAKDGGLDVIQTYVFWNGH  90

Query  315  EPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFRT  494
            EP PG+YYFE RYD+V+FIKL QQAGLYVHLRIGPY C EWNFGGFPVWLK+VPGI FRT
Sbjct  91   EPSPGEYYFEGRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIVFRT  150

Query  495  DNEPFKSAMQKF  530
            DNEPFK+AMQKF
Sbjct  151  DNEPFKAAMQKF  162



>ref|XP_010545348.1| PREDICTED: beta-galactosidase 12-like isoform X1 [Tarenaya hassleriana]
Length=726

 Score =   239 bits (609),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
             SSV  +VSYD  A IING R+IL+SGSIHYPRSTPEMW DL+QKAK+GGLDVIQTY+FW
Sbjct  21   ISSVKGAVSYDHKAVIINGQRRILLSGSIHYPRSTPEMWSDLIQKAKDGGLDVIQTYVFW  80

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PG YYFEDRYD+V+FI++ Q+AGLYVHLRIGPY C EWNFGGFPVWLK+VPGI+
Sbjct  81   NGHEPSPGNYYFEDRYDLVRFIRVVQKAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIA  140

Query  486  FRTDNEPFKSAMQKF  530
            FRT+N PFK+AMQKF
Sbjct  141  FRTNNGPFKAAMQKF  155



>gb|ACG30563.1| beta-galactosidase precursor [Zea mays]
Length=723

 Score =   238 bits (608),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +3

Query  129  SSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWN  308
            S  NA+VSYD  A +ING R+ILISGSIHYPRSTPEMWP LLQKAK+GGLDV+QTY+FWN
Sbjct  22   SPANAAVSYDHRAVVINGQRRILISGSIHYPRSTPEMWPGLLQKAKDGGLDVVQTYVFWN  81

Query  309  GHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISF  488
            GHEP  G+YYF DRYD+V+F+KLA+QAGLYVHLRIGPY C EWNFGGFPVWLK+VPGISF
Sbjct  82   GHEPVRGQYYFGDRYDLVRFVKLAKQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISF  141

Query  489  RTDNEPFKSAMQKF  530
            RTDN PFK+AMQ F
Sbjct  142  RTDNGPFKAAMQAF  155



>ref|XP_006353531.1| PREDICTED: beta-galactosidase-like [Solanum tuberosum]
Length=726

 Score =   238 bits (608),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
            FSSV ASVSYD  A IING RKILISGSIHYPRSTP+MWPDL+QKAK+GGLDVI+TY+FW
Sbjct  20   FSSVKASVSYDDRAIIINGKRKILISGSIHYPRSTPQMWPDLIQKAKDGGLDVIETYVFW  79

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            N HEP PGKY FE RYD+V+FIKLAQ+AGLYV+LRIGPY C EWNFGGFPVWLK+VPG+ 
Sbjct  80   NAHEPSPGKYNFEGRYDLVRFIKLAQRAGLYVNLRIGPYICAEWNFGGFPVWLKYVPGME  139

Query  486  FRTDNEPFKSAMQKF  530
            FRTDN+PFK AMQ F
Sbjct  140  FRTDNQPFKVAMQGF  154



>ref|XP_009408846.1| PREDICTED: beta-galactosidase-like [Musa acuminata subsp. malaccensis]
Length=730

 Score =   238 bits (608),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 122/137 (89%), Gaps = 1/137 (1%)
 Frame = +3

Query  123  WFSS-VNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            W SS V+ASVSYD  A IING R+ILISGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+
Sbjct  26   WLSSPVDASVSYDHKAIIINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYV  85

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEP PG+YYF   YD+V+FIKL +QAGLYVHLRIGPY C EWNFGGFPVWLK+VPG
Sbjct  86   FWNGHEPSPGQYYFGGNYDLVRFIKLVKQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPG  145

Query  480  ISFRTDNEPFKSAMQKF  530
            I+FRTDN PFK+AM KF
Sbjct  146  INFRTDNGPFKAAMAKF  162



>ref|NP_001275845.1| beta-galactosidase [Citrus sinensis]
 gb|AAK31801.1| beta-galactosidase [Citrus sinensis]
Length=737

 Score =   238 bits (608),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
             S V ASVSYD  A IING ++ILISGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FW
Sbjct  32   ISFVKASVSYDHKAVIINGQKRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFW  91

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP  G YYF+DRYD+V+FIKL QQAGLYVHLRIGPY C EWN+GGFPVWLK+VPGI 
Sbjct  92   NGHEPTQGNYYFQDRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNYGGFPVWLKYVPGIE  151

Query  486  FRTDNEPFKSAMQKF  530
            FRTDN PFK+AM KF
Sbjct  152  FRTDNGPFKAAMHKF  166



>gb|KDO57763.1| hypothetical protein CISIN_1g004219mg [Citrus sinensis]
Length=737

 Score =   238 bits (608),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
             S V ASVSYD  A IING ++ILISGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FW
Sbjct  32   ISFVKASVSYDHKAVIINGQKRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFW  91

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP  G YYF+DRYD+V+FIKL QQAGLYVHLRIGPY C EWN+GGFPVWLK+VPGI 
Sbjct  92   NGHEPTQGNYYFQDRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNYGGFPVWLKYVPGIE  151

Query  486  FRTDNEPFKSAMQKF  530
            FRTDN PFK+AM KF
Sbjct  152  FRTDNGPFKAAMHKF  166



>gb|EPS62826.1| beta-galactosidase, partial [Genlisea aurea]
Length=638

 Score =   236 bits (603),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  141  ASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNGHEP  320
            A VSYD     ING +K+LISGSIHYPRSTPEMWPDL+QKAK+GG+DVIQTY+FWNGHEP
Sbjct  16   AYVSYDSKGISINGQKKLLISGSIHYPRSTPEMWPDLIQKAKDGGVDVIQTYVFWNGHEP  75

Query  321  QPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFRTDN  500
            +PG YYF DRYD+V+FIKL QQAGLY HLRIGPYAC EWNFGGFP+WLK+VPGISFRTDN
Sbjct  76   EPGNYYFGDRYDLVRFIKLVQQAGLYAHLRIGPYACAEWNFGGFPIWLKYVPGISFRTDN  135

Query  501  EPFKSAMQKF  530
             PFK+AMQKF
Sbjct  136  GPFKAAMQKF  145



>gb|KCW53601.1| hypothetical protein EUGRSUZ_J02867 [Eucalyptus grandis]
Length=696

 Score =   238 bits (606),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +3

Query  129  SSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWN  308
            +SV ASVSYD  A  ING R+ILISGSIHYPRSTPEMWPDL++KAKEGGLDVIQTY+FWN
Sbjct  25   TSVTASVSYDAKAITINGQRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWN  84

Query  309  GHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISF  488
            GHEP PGKY FE  YD+VKF+KLAQQAGLYVHLR+GPY C EWNFGGFPVWLK+V GISF
Sbjct  85   GHEPSPGKYNFEGNYDIVKFVKLAQQAGLYVHLRVGPYVCAEWNFGGFPVWLKYVRGISF  144

Query  489  RTDNEPFKSAMQKF  530
            RTDN PFK  MQKF
Sbjct  145  RTDNGPFKYYMQKF  158



>ref|XP_006451461.1| hypothetical protein CICLE_v10007531mg [Citrus clementina]
 gb|ESR64701.1| hypothetical protein CICLE_v10007531mg [Citrus clementina]
Length=737

 Score =   238 bits (608),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
             S V ASVSYD  A IING ++ILISGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FW
Sbjct  32   ISFVKASVSYDHKAVIINGQKRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFW  91

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP  G YYF+DRYD+V+FIKL QQAGLYVHLRIGPY C EWN+GGFPVWLK+VPGI 
Sbjct  92   NGHEPTQGNYYFQDRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNYGGFPVWLKYVPGIE  151

Query  486  FRTDNEPFKSAMQKF  530
            FRTDN PFK+AM KF
Sbjct  152  FRTDNGPFKAAMHKF  166



>gb|ADV41669.1| beta-D-galactosidase [Actinidia deliciosa var. deliciosa]
Length=728

 Score =   238 bits (607),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = +3

Query  129  SSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWN  308
             SV ASV+YD  A  ING R+IL SGSIHYPRSTPEMWP L+QKAKEGGLDVIQTY+FWN
Sbjct  23   CSVTASVTYDGKAIKINGQRRILFSGSIHYPRSTPEMWPGLIQKAKEGGLDVIQTYVFWN  82

Query  309  GHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISF  488
            GHEP PG+YYFE RYD+V+FIKLAQQAGLYVHLRIG Y C EWNFGGFPVWLK+VPGI+F
Sbjct  83   GHEPSPGQYYFEGRYDLVRFIKLAQQAGLYVHLRIGLYVCAEWNFGGFPVWLKYVPGIAF  142

Query  489  RTDNEPFKSAMQKF  530
            RTDN PFK+AMQKF
Sbjct  143  RTDNGPFKAAMQKF  156



>ref|NP_001266102.1| beta-galactosidase 1-like precursor [Cicer arietinum]
 emb|CAA07236.2| beta-galactosidase precursor [Cicer arietinum]
Length=839

 Score =   239 bits (611),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  141  ASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNGHEP  320
            ASVSYD  A  ING RKIL+SGSIHYPRSTPEMWPDL+QKAKEGGLDVIQTY+FWNGHEP
Sbjct  24   ASVSYDYKAITINGQRKILLSGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYVFWNGHEP  83

Query  321  QPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFRTDN  500
             PGKYYFE  YD+VKFI+L QQAGLYVHLRIGPYAC EWNFGGFPVWLK++PGISFRTDN
Sbjct  84   SPGKYYFEGNYDLVKFIRLVQQAGLYVHLRIGPYACAEWNFGGFPVWLKYIPGISFRTDN  143

Query  501  EPFKSAMQKF  530
             PFK  MQKF
Sbjct  144  GPFKFQMQKF  153



>ref|XP_004158465.1| PREDICTED: beta-galactosidase-like [Cucumis sativus]
Length=1225

 Score =   242 bits (617),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +3

Query  129  SSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWN  308
            SSV ASV+YD  A +I+G R+ILISGSIHYPRSTP+MWPDL+QKAK+GGLDVI+TY+FWN
Sbjct  20   SSVMASVTYDHKALVIDGKRRILISGSIHYPRSTPQMWPDLIQKAKDGGLDVIETYVFWN  79

Query  309  GHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISF  488
            GHEP PG+YYFEDRY++V+F+KL QQAGLYVHLRIGPY C EWNFGGFPVWLK+VPGI+F
Sbjct  80   GHEPSPGQYYFEDRYELVRFVKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIAF  139

Query  489  RTDNEPFKSAMQKF  530
            RTDN PFK+AMQKF
Sbjct  140  RTDNGPFKAAMQKF  153



>ref|XP_004146823.1| PREDICTED: beta-galactosidase 1-like [Cucumis sativus]
 ref|XP_004164891.1| PREDICTED: beta-galactosidase 1-like [Cucumis sativus]
Length=841

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  132  SVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNG  311
            SV ASVSYD  A IINGHR+ILISGSIHYPRST EMWPDL+QKAKEGGLDVI+TY+FWNG
Sbjct  23   SVQASVSYDSKAIIINGHRRILISGSIHYPRSTSEMWPDLIQKAKEGGLDVIETYVFWNG  82

Query  312  HEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFR  491
            HEP+PGKYYFE  YD+V+F+KL  QAGLYVHLRIGPY C EWNFGGFPVWLK++PGISFR
Sbjct  83   HEPEPGKYYFEGNYDLVRFVKLVHQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGISFR  142

Query  492  TDNEPFKSAMQKF  530
            TDN PFK  M++F
Sbjct  143  TDNAPFKFQMERF  155



>gb|KDO57762.1| hypothetical protein CISIN_1g004219mg [Citrus sinensis]
Length=767

 Score =   238 bits (608),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
             S V ASVSYD  A IING ++ILISGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FW
Sbjct  32   ISFVKASVSYDHKAVIINGQKRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFW  91

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP  G YYF+DRYD+V+FIKL QQAGLYVHLRIGPY C EWN+GGFPVWLK+VPGI 
Sbjct  92   NGHEPTQGNYYFQDRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNYGGFPVWLKYVPGIE  151

Query  486  FRTDNEPFKSAMQKF  530
            FRTDN PFK+AM KF
Sbjct  152  FRTDNGPFKAAMHKF  166



>ref|XP_009409594.1| PREDICTED: beta-galactosidase-like [Musa acuminata subsp. malaccensis]
Length=735

 Score =   238 bits (607),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 122/137 (89%), Gaps = 1/137 (1%)
 Frame = +3

Query  123  WFSS-VNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            W S+ V+ASVSYD  A I+NG R+ILISGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+
Sbjct  31   WLSTPVDASVSYDHKAIIVNGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYV  90

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEP PG+YYF   YD+V+FIKL + AGLYVHLRIGPY C EWNFGGFPVWLK+VPG
Sbjct  91   FWNGHEPSPGQYYFGGNYDLVRFIKLVKHAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPG  150

Query  480  ISFRTDNEPFKSAMQKF  530
            I+FRTDNEPFK+AM KF
Sbjct  151  INFRTDNEPFKAAMAKF  167



>ref|XP_006451460.1| hypothetical protein CICLE_v10007531mg [Citrus clementina]
 gb|ESR64700.1| hypothetical protein CICLE_v10007531mg [Citrus clementina]
Length=767

 Score =   238 bits (608),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
             S V ASVSYD  A IING ++ILISGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FW
Sbjct  32   ISFVKASVSYDHKAVIINGQKRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFW  91

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP  G YYF+DRYD+V+FIKL QQAGLYVHLRIGPY C EWN+GGFPVWLK+VPGI 
Sbjct  92   NGHEPTQGNYYFQDRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNYGGFPVWLKYVPGIE  151

Query  486  FRTDNEPFKSAMQKF  530
            FRTDN PFK+AM KF
Sbjct  152  FRTDNGPFKAAMHKF  166



>gb|KGN66240.1| hypothetical protein Csa_1G588000 [Cucumis sativus]
Length=745

 Score =   238 bits (607),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            TW  S   +V+YD+ A IIN  R+ILISGSIHYPRSTP+MWPDL+QKAK+GGLD+I+TY+
Sbjct  149  TWVGSTIGAVTYDEKAIIINDQRRILISGSIHYPRSTPQMWPDLIQKAKDGGLDIIETYV  208

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEP  GKYYFE+RYD+V FIKL Q+AGLYVHL IGPY C EWN+GGFP+WLKFVPG
Sbjct  209  FWNGHEPSEGKYYFEERYDLVGFIKLVQKAGLYVHLLIGPYVCAEWNYGGFPIWLKFVPG  268

Query  480  ISFRTDNEPFKSAMQKF  530
            I+FRTDNEPFK+AMQKF
Sbjct  269  IAFRTDNEPFKAAMQKF  285



>gb|KJB56892.1| hypothetical protein B456_009G140800 [Gossypium raimondii]
Length=845

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            +W  SV ASVSYD+ A  ING R+ILISGSIHYPRS+PEMWPDL+QKAKEGGLDVIQTY+
Sbjct  23   SWVCSVTASVSYDRKAITINGQRRILISGSIHYPRSSPEMWPDLIQKAKEGGLDVIQTYV  82

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEP PG Y FE  YD+VKFIKL +QAGLYVHLRIGPY C EWNFGGFPVWLK++PG
Sbjct  83   FWNGHEPAPGMYNFEGNYDLVKFIKLVKQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPG  142

Query  480  ISFRTDNEPFKSAMQKF  530
            I+FRT+N PFK+ MQ+F
Sbjct  143  INFRTNNRPFKAQMQRF  159



>gb|KHG25378.1| Beta-galactosidase 1 -like protein [Gossypium arboreum]
Length=843

 Score =   239 bits (609),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            +W  SV+++VSYD  A  ING R+ILISGSIHYPRS+PEMWPDL+QKAKEGGLDVIQTY+
Sbjct  21   SWVCSVSSTVSYDSKAITINGQRRILISGSIHYPRSSPEMWPDLIQKAKEGGLDVIQTYV  80

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEP PGKYYFE  YD+VKFIKL +QAGLYVHLRIGPY C EWNFGGFPVWLK++PG
Sbjct  81   FWNGHEPAPGKYYFEGNYDLVKFIKLVKQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPG  140

Query  480  ISFRTDNEPFKSAMQKF  530
            I+FRT+N PFK+ M++F
Sbjct  141  INFRTNNGPFKAQMRRF  157



>ref|XP_009622143.1| PREDICTED: beta-galactosidase-like [Nicotiana tomentosiformis]
Length=840

 Score =   239 bits (609),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            +W     ASVSYD  A I+ G R+ILISGS+HYPRSTPEMWP ++QKAKEGG+DVIQTY+
Sbjct  20   SWVFCGTASVSYDHKAIIVKGQRRILISGSVHYPRSTPEMWPGIIQKAKEGGIDVIQTYV  79

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEPQ GKYYFE RYD+VKFIKL  QAGLYVHLRIGPYAC EWNFGGFPVWLK+VPG
Sbjct  80   FWNGHEPQQGKYYFEGRYDLVKFIKLVHQAGLYVHLRIGPYACAEWNFGGFPVWLKYVPG  139

Query  480  ISFRTDNEPFKSAMQKF  530
            ISFRTDN PFK AMQKF
Sbjct  140  ISFRTDNGPFKVAMQKF  156



>gb|AAC25984.1| beta-galactosidase [Solanum lycopersicum]
Length=724

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
            FSSV ASVSYD  A IING RKILISGSIHYPRSTP+MWPDL+QKAK+GGLDVI+TY+FW
Sbjct  18   FSSVKASVSYDDRAIIINGKRKILISGSIHYPRSTPQMWPDLIQKAKDGGLDVIETYVFW  77

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PGKY FE RYD+V+FIK+ Q+AGLYV+LRIGPY C EWNFGGFPVWLK+VPG+ 
Sbjct  78   NGHEPSPGKYNFEGRYDLVRFIKMVQRAGLYVNLRIGPYVCAEWNFGGFPVWLKYVPGME  137

Query  486  FRTDNEPFKSAMQKF  530
            FRT+N+PFK AMQ F
Sbjct  138  FRTNNQPFKVAMQGF  152



>ref|XP_009769408.1| PREDICTED: beta-galactosidase-like [Nicotiana sylvestris]
Length=840

 Score =   239 bits (609),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            +W     ASVSYD  A I+ G R+ILISGS+HYPRSTPEMWP ++QKAKEGG+DVIQTY+
Sbjct  20   SWVFCGKASVSYDHKAIIVKGQRRILISGSVHYPRSTPEMWPGIIQKAKEGGIDVIQTYV  79

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEPQ GKYYFE RYD+VKFIKL  QAGLYVHLRIGPYAC EWNFGGFPVWLK+VPG
Sbjct  80   FWNGHEPQQGKYYFEGRYDLVKFIKLVHQAGLYVHLRIGPYACAEWNFGGFPVWLKYVPG  139

Query  480  ISFRTDNEPFKSAMQKF  530
            ISFRTDN PFK+AMQ+F
Sbjct  140  ISFRTDNGPFKAAMQRF  156



>gb|ADO34789.1| beta-galactosidase STBG4 [Solanum lycopersicum]
Length=724

 Score =   237 bits (605),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
            FSSV ASVSYD  A IING RKILISGSIHYPRSTP+MWPDL+QKAK+GGLDVI+TY+FW
Sbjct  18   FSSVKASVSYDDRAIIINGKRKILISGSIHYPRSTPQMWPDLIQKAKDGGLDVIETYVFW  77

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PGKY FE RYD+V+FIK+ Q+AGLYV+LRIGPY C EWNFGGFPVWLK+VPG+ 
Sbjct  78   NGHEPSPGKYNFEGRYDLVRFIKMVQRAGLYVNLRIGPYVCAEWNFGGFPVWLKYVPGME  137

Query  486  FRTDNEPFKSAMQKF  530
            FRT+N+PFK AMQ F
Sbjct  138  FRTNNQPFKVAMQGF  152



>gb|KHG01120.1| Beta-galactosidase [Gossypium arboreum]
Length=837

 Score =   239 bits (609),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 123/146 (84%), Gaps = 11/146 (8%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
            F  V+A+VSYD  A IING R+IL+SGSIHYPRSTP+MWPDL+ KAKEGGLDVIQTY+FW
Sbjct  26   FPLVSATVSYDSKAIIINGRRRILLSGSIHYPRSTPQMWPDLIAKAKEGGLDVIQTYVFW  85

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFG-----------GF  452
            NGHEP PG YYFEDRYD+V+FIKL QQAGLYVHLRIGPY C EWNFG           GF
Sbjct  86   NGHEPSPGNYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYICAEWNFGCLPICSVFWFRGF  145

Query  453  PVWLKFVPGISFRTDNEPFKSAMQKF  530
            PVWLK+VPGI+FRTDNEPFK+AMQKF
Sbjct  146  PVWLKYVPGIAFRTDNEPFKAAMQKF  171



>ref|XP_010915229.1| PREDICTED: beta-galactosidase isoform X2 [Elaeis guineensis]
Length=836

 Score =   238 bits (608),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
            FSS +A+VSYD  A IING R+ILISGSIHYPRSTP+MWPDL+QKAK+GGLDVIQTY+FW
Sbjct  28   FSSGDAAVSYDHRAVIINGQRRILISGSIHYPRSTPDMWPDLIQKAKDGGLDVIQTYVFW  87

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PG+YYFE RYD+V+F+KL +QAGLYV+LRIGPY C EWNFGGFP+WLK+VPGIS
Sbjct  88   NGHEPFPGQYYFEGRYDLVRFVKLVKQAGLYVNLRIGPYVCAEWNFGGFPIWLKYVPGIS  147

Query  486  FRTDNEPFKSAMQKF  530
            FRTDN PFK+AM+KF
Sbjct  148  FRTDNGPFKAAMEKF  162



>gb|KEH18344.1| beta-galactosidase [Medicago truncatula]
Length=838

 Score =   238 bits (608),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +3

Query  141  ASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNGHEP  320
            ASVSYD  A  ING R+IL+SGSIHYPRSTPEMWPDL+QKAKEGGLDVIQTY+FWNGHEP
Sbjct  23   ASVSYDHKAITINGQRRILLSGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYVFWNGHEP  82

Query  321  QPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFRTDN  500
             PGKYYFE  YD+VKFIKL  QAGLYVHLR+GPYAC EWNFGGFPVWLK++PGISFRTDN
Sbjct  83   SPGKYYFEGNYDLVKFIKLVHQAGLYVHLRVGPYACAEWNFGGFPVWLKYIPGISFRTDN  142

Query  501  EPFKSAMQKF  530
             PFK  MQ+F
Sbjct  143  GPFKIQMQRF  152



>ref|XP_010915228.1| PREDICTED: beta-galactosidase isoform X1 [Elaeis guineensis]
Length=841

 Score =   238 bits (608),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
            FSS +A+VSYD  A IING R+ILISGSIHYPRSTP+MWPDL+QKAK+GGLDVIQTY+FW
Sbjct  28   FSSGDAAVSYDHRAVIINGQRRILISGSIHYPRSTPDMWPDLIQKAKDGGLDVIQTYVFW  87

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PG+YYFE RYD+V+F+KL +QAGLYV+LRIGPY C EWNFGGFP+WLK+VPGIS
Sbjct  88   NGHEPFPGQYYFEGRYDLVRFVKLVKQAGLYVNLRIGPYVCAEWNFGGFPIWLKYVPGIS  147

Query  486  FRTDNEPFKSAMQKF  530
            FRTDN PFK+AM+KF
Sbjct  148  FRTDNGPFKAAMEKF  162



>gb|AAM13196.1| galactosidase, putative [Arabidopsis thaliana]
Length=847

 Score =   238 bits (608),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = +3

Query  129  SSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWN  308
             SV+ SVSYD  A  ING R+ILISGSIHYPRSTPEMWPDL++KAKEGGLDVIQTY+FWN
Sbjct  28   CSVSGSVSYDSRAITINGKRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWN  87

Query  309  GHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISF  488
            GHEP PGKYYFE  YD+VKF+KL QQ+GLY+HLRIGPY C EWNFGGFPVWLK++PGISF
Sbjct  88   GHEPSPGKYYFEGNYDLVKFVKLVQQSGLYLHLRIGPYVCAEWNFGGFPVWLKYIPGISF  147

Query  489  RTDNEPFKSAMQKF  530
            RTDN PFK+ MQ+F
Sbjct  148  RTDNGPFKAQMQRF  161



>ref|NP_187988.1| beta galactosidase 1 [Arabidopsis thaliana]
 sp|Q9SCW1.1|BGAL1_ARATH RecName: Full=Beta-galactosidase 1; Short=Lactase 1; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAB64737.1| putative beta-galactosidase [Arabidopsis thaliana]
 dbj|BAB01923.1| beta-galactosidase [Arabidopsis thaliana]
 gb|AEE75407.1| beta galactosidase 1 [Arabidopsis thaliana]
Length=847

 Score =   238 bits (608),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = +3

Query  129  SSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWN  308
             SV+ SVSYD  A  ING R+ILISGSIHYPRSTPEMWPDL++KAKEGGLDVIQTY+FWN
Sbjct  28   CSVSGSVSYDSRAITINGKRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWN  87

Query  309  GHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISF  488
            GHEP PGKYYFE  YD+VKF+KL QQ+GLY+HLRIGPY C EWNFGGFPVWLK++PGISF
Sbjct  88   GHEPSPGKYYFEGNYDLVKFVKLVQQSGLYLHLRIGPYVCAEWNFGGFPVWLKYIPGISF  147

Query  489  RTDNEPFKSAMQKF  530
            RTDN PFK+ MQ+F
Sbjct  148  RTDNGPFKAQMQRF  161



>ref|XP_009117469.1| PREDICTED: beta-galactosidase 1-like [Brassica rapa]
Length=839

 Score =   238 bits (607),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +3

Query  129  SSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWN  308
            S V+ASVSYD  A  ING R+ILISGSIHYPRSTPEMWPDL++KAKEGGLDVIQTY+FWN
Sbjct  20   SLVSASVSYDSRAITINGKRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWN  79

Query  309  GHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISF  488
            GHEP PGKYYFE  YD+VKF+KL +Q+GLY+HLRIGPY C EWNFGGFPVWLK+VPGISF
Sbjct  80   GHEPSPGKYYFEGNYDLVKFVKLVKQSGLYLHLRIGPYVCAEWNFGGFPVWLKYVPGISF  139

Query  489  RTDNEPFKSAMQKF  530
            RTDN PFK+ MQ+F
Sbjct  140  RTDNGPFKAQMQRF  153



>ref|XP_009409595.1| PREDICTED: beta-galactosidase-like [Musa acuminata subsp. malaccensis]
Length=735

 Score =   236 bits (603),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 122/137 (89%), Gaps = 1/137 (1%)
 Frame = +3

Query  123  WFSS-VNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            W SS V+ASVSYD  A I+NG R+ILISGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+
Sbjct  31   WHSSPVDASVSYDHKAIIVNGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYV  90

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEP PG+YYF   YD+V+FIKL +QAGLYVHLRIGPY C EWNFGGFPVWLK+VPG
Sbjct  91   FWNGHEPSPGQYYFGGNYDLVRFIKLVKQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPG  150

Query  480  ISFRTDNEPFKSAMQKF  530
            I+FR+DN PFK+AM KF
Sbjct  151  ITFRSDNGPFKAAMAKF  167



>emb|CDY51738.1| BnaA01g37210D [Brassica napus]
Length=839

 Score =   238 bits (606),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +3

Query  129  SSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWN  308
            S V+ASVSYD  A  ING R+ILISGSIHYPRSTPEMWPDL++KAKEGGLDVIQTY+FWN
Sbjct  20   SLVSASVSYDSRAITINGKRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWN  79

Query  309  GHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISF  488
            GHEP PGKYYFE  YD+VKF+KL +Q+GLY+HLRIGPY C EWNFGGFPVWLK+VPGISF
Sbjct  80   GHEPSPGKYYFEGNYDLVKFVKLVKQSGLYLHLRIGPYVCAEWNFGGFPVWLKYVPGISF  139

Query  489  RTDNEPFKSAMQKF  530
            RTDN PFK+ MQ+F
Sbjct  140  RTDNGPFKAQMQRF  153



>ref|XP_006403764.1| hypothetical protein EUTSA_v10010152mg [Eutrema salsugineum]
 gb|ESQ45217.1| hypothetical protein EUTSA_v10010152mg [Eutrema salsugineum]
Length=725

 Score =   236 bits (602),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
              S+ A VSYD  A IING R+IL+SGSIHYPRSTPEMWPDL++K+K+GGLDVIQTY+FW
Sbjct  20   ICSIKAVVSYDHKALIINGQRRILLSGSIHYPRSTPEMWPDLIKKSKDGGLDVIQTYVFW  79

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PGKYYF DRYD+VKFIKL Q+AGLYV LRIGPY C EWNFGG PVWLK+VPG+ 
Sbjct  80   NGHEPSPGKYYFGDRYDLVKFIKLVQKAGLYVSLRIGPYVCAEWNFGGIPVWLKYVPGMV  139

Query  486  FRTDNEPFKSAMQKF  530
            FRTDNEPFK AMQKF
Sbjct  140  FRTDNEPFKIAMQKF  154



>ref|XP_004966041.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 9-like [Setaria 
italica]
Length=724

 Score =   236 bits (602),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = +3

Query  135  VNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNGH  314
             NA+VSYD  A  ING R++LISGSIHYPRSTPEMWPDLLQKAK+GGLDV+QTY+FWNGH
Sbjct  25   ANAAVSYDHRAVTINGQRRVLISGSIHYPRSTPEMWPDLLQKAKDGGLDVVQTYVFWNGH  84

Query  315  EPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFRT  494
            EP  G+YYF DRYD+V+F+KLA+QAGL VHLRIGPY C EWNFGGFPVWLK+VPGISFRT
Sbjct  85   EPVQGQYYFGDRYDLVRFVKLAKQAGLLVHLRIGPYVCAEWNFGGFPVWLKYVPGISFRT  144

Query  495  DNEPFKSAMQKF  530
            DN PFK+AMQ F
Sbjct  145  DNGPFKAAMQAF  156



>gb|EYU28411.1| hypothetical protein MIMGU_mgv1a024117mg [Erythranthe guttata]
Length=723

 Score =   236 bits (602),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
             SSV A+V+YD  A IING+R+ILISGSIHYPRSTPEMWPD++Q AK GGLDVIQTY+FW
Sbjct  17   LSSVRAAVTYDDKAIIINGNRRILISGSIHYPRSTPEMWPDIIQTAKNGGLDVIQTYVFW  76

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            +GHEP PG Y FE R+D++KFIKL QQAGLYV+LRIGPYAC EWNFGGFPVWLK+VPGI 
Sbjct  77   DGHEPSPGTYNFEGRFDIIKFIKLVQQAGLYVNLRIGPYACAEWNFGGFPVWLKYVPGIE  136

Query  486  FRTDNEPFKSAMQKF  530
            FRTDN+PFK+AMQ F
Sbjct  137  FRTDNQPFKAAMQGF  151



>ref|NP_190852.2| beta-galactosidase 2 [Arabidopsis thaliana]
 sp|Q9LFA6.2|BGAL2_ARATH RecName: Full=Beta-galactosidase 2; Short=Lactase 2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK32914.1|AF367327_1 AT3g52840/F8J2_10 [Arabidopsis thaliana]
 emb|CAB64738.1| putative beta-galactosidase [Arabidopsis thaliana]
 gb|AAN18080.1| At3g52840/F8J2_10 [Arabidopsis thaliana]
 gb|AEE78999.1| beta-galactosidase 2 [Arabidopsis thaliana]
Length=727

 Score =   236 bits (602),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +3

Query  132  SVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNG  311
            S  A V+YD  A IING R+ILISGSIHYPRSTPEMWPDL++KAKEGGLDVIQTY+FWNG
Sbjct  24   STEAVVTYDHKALIINGQRRILISGSIHYPRSTPEMWPDLIKKAKEGGLDVIQTYVFWNG  83

Query  312  HEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFR  491
            HEP PG YYF+DRYD+VKF KL  QAGLY+ LRIGPY C EWNFGGFPVWLK+VPG+ FR
Sbjct  84   HEPSPGNYYFQDRYDLVKFTKLVHQAGLYLDLRIGPYVCAEWNFGGFPVWLKYVPGMVFR  143

Query  492  TDNEPFKSAMQKF  530
            TDNEPFK AMQKF
Sbjct  144  TDNEPFKIAMQKF  156



>emb|CAB86888.1| beta-galactosidase precursor-like protein [Arabidopsis thaliana]
Length=727

 Score =   236 bits (602),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +3

Query  132  SVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNG  311
            S  A V+YD  A IING R+ILISGSIHYPRSTPEMWPDL++KAKEGGLDVIQTY+FWNG
Sbjct  24   STEAVVTYDHKALIINGQRRILISGSIHYPRSTPEMWPDLIKKAKEGGLDVIQTYVFWNG  83

Query  312  HEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFR  491
            HEP PG YYF+DRYD+VKF KL  QAGLY+ LRIGPY C EWNFGGFPVWLK+VPG+ FR
Sbjct  84   HEPSPGNYYFQDRYDLVKFTKLVHQAGLYLDLRIGPYVCAEWNFGGFPVWLKYVPGMVFR  143

Query  492  TDNEPFKSAMQKF  530
            TDNEPFK AMQKF
Sbjct  144  TDNEPFKIAMQKF  156



>ref|XP_002882842.1| hypothetical protein ARALYDRAFT_897617 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59101.1| hypothetical protein ARALYDRAFT_897617 [Arabidopsis lyrata subsp. 
lyrata]
Length=847

 Score =   238 bits (606),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = +3

Query  129  SSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWN  308
             SV+ SVSYD  A  ING R+ILISGSIHYPRSTPEMWPDL++KAKEGGLDVIQTY+FWN
Sbjct  28   CSVSGSVSYDSRAITINGKRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWN  87

Query  309  GHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISF  488
            GHEP PGKYYFE  YD+V+F+KL QQ+GLY+HLRIGPY C EWNFGGFPVWLK++PGISF
Sbjct  88   GHEPSPGKYYFEGNYDLVRFVKLVQQSGLYLHLRIGPYVCAEWNFGGFPVWLKYIPGISF  147

Query  489  RTDNEPFKSAMQKF  530
            RTDN PFK+ MQ+F
Sbjct  148  RTDNGPFKAQMQRF  161



>ref|XP_010033786.1| PREDICTED: beta-galactosidase 1-like [Eucalyptus grandis]
 gb|KCW53599.1| hypothetical protein EUGRSUZ_J02867 [Eucalyptus grandis]
 gb|KCW53600.1| hypothetical protein EUGRSUZ_J02867 [Eucalyptus grandis]
Length=844

 Score =   237 bits (605),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +3

Query  129  SSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWN  308
            +SV ASVSYD  A  ING R+ILISGSIHYPRSTPEMWPDL++KAKEGGLDVIQTY+FWN
Sbjct  25   TSVTASVSYDAKAITINGQRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWN  84

Query  309  GHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISF  488
            GHEP PGKY FE  YD+VKF+KLAQQAGLYVHLR+GPY C EWNFGGFPVWLK+V GISF
Sbjct  85   GHEPSPGKYNFEGNYDIVKFVKLAQQAGLYVHLRVGPYVCAEWNFGGFPVWLKYVRGISF  144

Query  489  RTDNEPFKSAMQKF  530
            RTDN PFK  MQKF
Sbjct  145  RTDNGPFKYYMQKF  158



>ref|XP_002514109.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF48063.1| beta-galactosidase, putative [Ricinus communis]
Length=827

 Score =   237 bits (605),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
             W  +V A+V YD  A  IN  R+ILISGSIHYPRSTPEMWP L+QKAKEGG++VIQTY+
Sbjct  16   AWVCNVTATVWYDHKAITINNQRRILISGSIHYPRSTPEMWPGLIQKAKEGGIEVIQTYV  75

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEP PG+YYF+DRYD+VKFIKL QQAGLYVHLRIGPY C EWNFGGFP+WLK+VPG
Sbjct  76   FWNGHEPSPGQYYFQDRYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPMWLKYVPG  135

Query  480  ISFRTDNEPFKSAMQKF  530
            I FRTDN PFK+AMQKF
Sbjct  136  IEFRTDNGPFKAAMQKF  152



>ref|XP_002876169.1| AT3g52840/F8J2_10 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52428.1| AT3g52840/F8J2_10 [Arabidopsis lyrata subsp. lyrata]
Length=728

 Score =   236 bits (601),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +3

Query  132  SVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNG  311
            S  A V+YD  A IING R+ILISGSIHYPRSTPEMWPDL++KAKEGGLDVIQTY+FWNG
Sbjct  24   STEAVVTYDHKALIINGQRRILISGSIHYPRSTPEMWPDLIKKAKEGGLDVIQTYVFWNG  83

Query  312  HEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFR  491
            HEP PG YYF+DRYD+VKF KL  QAGLY+ LRIGPY C EWNFGGFPVWLK+VPGI FR
Sbjct  84   HEPSPGNYYFQDRYDLVKFTKLVHQAGLYLDLRIGPYVCAEWNFGGFPVWLKYVPGIVFR  143

Query  492  TDNEPFKSAMQKF  530
            TDNEPFK AMQ+F
Sbjct  144  TDNEPFKIAMQRF  156



>ref|XP_010465236.1| PREDICTED: beta-galactosidase 1 [Camelina sativa]
Length=846

 Score =   237 bits (604),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = +3

Query  129  SSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWN  308
             SV+ SVSYD  A  ING R+ILISGSIHYPRSTPEMWPDL++KAKEGGLDVIQTY+FWN
Sbjct  27   CSVSGSVSYDSRAITINGKRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWN  86

Query  309  GHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISF  488
            GHEP PGKYYFE  YD+VKF+KL +Q+GLY+HLRIGPY C EWNFGGFPVWLK++PGISF
Sbjct  87   GHEPSPGKYYFEGNYDLVKFVKLVKQSGLYLHLRIGPYVCAEWNFGGFPVWLKYIPGISF  146

Query  489  RTDNEPFKSAMQKF  530
            RTDN PFK+ MQ+F
Sbjct  147  RTDNGPFKAQMQRF  160



>ref|XP_010501131.1| PREDICTED: beta-galactosidase 1-like [Camelina sativa]
Length=846

 Score =   237 bits (604),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = +3

Query  129  SSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWN  308
             SV+ SVSYD  A  ING R+ILISGSIHYPRSTPEMWPDL++KAKEGGLDVIQTY+FWN
Sbjct  27   CSVSGSVSYDSRAITINGKRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWN  86

Query  309  GHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISF  488
            GHEP PGKYYFE  YD+VKF+KL +Q+GLY+HLRIGPY C EWNFGGFPVWLK++PGISF
Sbjct  87   GHEPSPGKYYFEGNYDLVKFVKLVKQSGLYLHLRIGPYVCAEWNFGGFPVWLKYIPGISF  146

Query  489  RTDNEPFKSAMQKF  530
            RTDN PFK+ MQ+F
Sbjct  147  RTDNGPFKAQMQRF  160



>ref|XP_009768469.1| PREDICTED: beta-galactosidase-like [Nicotiana sylvestris]
Length=837

 Score =   237 bits (604),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
            +SSV ASV+YD  A +ING R+ILISGSIHYPRSTPEMWPDL+QKAK+GGLDVI+TY+FW
Sbjct  19   YSSVRASVTYDDRAIVINGKRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIETYVFW  78

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PGK+ FE RYD+VKFIKL QQAGLYV+LRIGPY C EWNFGGFPVWLK+VPG+ 
Sbjct  79   NGHEPSPGKFNFEGRYDLVKFIKLVQQAGLYVNLRIGPYVCAEWNFGGFPVWLKYVPGME  138

Query  486  FRTDNEPFKSAMQKF  530
            FR DN+PFK AMQ F
Sbjct  139  FRADNQPFKVAMQGF  153



>ref|XP_006300095.1| hypothetical protein CARUB_v10016323mg [Capsella rubella]
 gb|EOA32993.1| hypothetical protein CARUB_v10016323mg [Capsella rubella]
Length=846

 Score =   237 bits (604),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = +3

Query  129  SSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWN  308
             SV+ SVSYD  A  ING R+ILISGSIHYPRSTPEMWPDL++KAKEGGLDVIQTY+FWN
Sbjct  27   CSVSGSVSYDSRAITINGKRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWN  86

Query  309  GHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISF  488
            GHEP PGKYYFE  YD+VKF+KL +Q+GLY+HLRIGPY C EWNFGGFPVWLK++PGISF
Sbjct  87   GHEPSPGKYYFEGNYDLVKFVKLVKQSGLYLHLRIGPYVCAEWNFGGFPVWLKYIPGISF  146

Query  489  RTDNEPFKSAMQKF  530
            RTDN PFK+ MQ+F
Sbjct  147  RTDNGPFKAQMQRF  160



>ref|XP_008447606.1| PREDICTED: beta-galactosidase 1 [Cucumis melo]
Length=844

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  132  SVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNG  311
            SV ASVSYD  A IING R+ILISGSIHYPRST EMWPDL+QKAKEGGLDVI+TY+FWNG
Sbjct  26   SVQASVSYDSKAIIINGQRRILISGSIHYPRSTSEMWPDLIQKAKEGGLDVIETYVFWNG  85

Query  312  HEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFR  491
            HEP+PGKYYFE  YD+V+F+KL  QAGLYVHLRIGPY C EWNFGGFPVWLK++PGISFR
Sbjct  86   HEPEPGKYYFEGNYDLVRFVKLVHQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGISFR  145

Query  492  TDNEPFKSAMQKF  530
            TDN PFK  M++F
Sbjct  146  TDNAPFKFQMERF  158



>ref|XP_008775429.1| PREDICTED: beta-galactosidase 2-like [Phoenix dactylifera]
Length=832

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +3

Query  129  SSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWN  308
            S  +A+VSYD  A I+NG R+ILISGSIHYPRSTPEMWPDL+QKAK+GGLDVIQTY+FWN
Sbjct  26   SPASAAVSYDHKAVIVNGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWN  85

Query  309  GHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISF  488
            GHEP PG+YYFE RYD+V FIKL  QAGL+VHLRIGPY C EWNFGGFPVWLK+VPGI F
Sbjct  86   GHEPSPGEYYFEGRYDLVHFIKLVHQAGLFVHLRIGPYVCAEWNFGGFPVWLKYVPGIRF  145

Query  489  RTDNEPFKSAMQKF  530
            RTDNEPFK+AM  F
Sbjct  146  RTDNEPFKAAMANF  159



>ref|XP_010426910.1| PREDICTED: beta-galactosidase 2-like [Camelina sativa]
Length=727

 Score =   235 bits (599),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +3

Query  132  SVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNG  311
            S+ A V+YD  A IING R IL+SGSIHYPRSTPEMWPDL+ KAKEGGLDVIQTY+FW+G
Sbjct  24   SIEAVVTYDHKALIINGQRSILLSGSIHYPRSTPEMWPDLIHKAKEGGLDVIQTYVFWSG  83

Query  312  HEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFR  491
            HEP PG YYFEDRYD+VKF KL  QAGLY+ LRIGPY C EWNFGGFPVWLK+VPGI FR
Sbjct  84   HEPSPGNYYFEDRYDLVKFTKLVHQAGLYLDLRIGPYVCAEWNFGGFPVWLKYVPGIVFR  143

Query  492  TDNEPFKSAMQKF  530
            TDNEPFK AMQKF
Sbjct  144  TDNEPFKIAMQKF  156



>gb|AFD54987.1| beta-galactosidase [Momordica charantia]
Length=719

 Score =   234 bits (598),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  TWFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYI  299
            +W     A+V+YD+ A IING R+IL+SGSIHYPRSTP+MWP L+Q AK+GGLD+I+TY+
Sbjct  13   SWVCYAMATVTYDQKAIIINGKRRILVSGSIHYPRSTPQMWPSLIQNAKDGGLDIIETYV  72

Query  300  FWNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPG  479
            FWNGHEP  GKYYFEDRYD+V+FIKL QQAGLYVHLRIGPY C EWN+GGFP+WLK VPG
Sbjct  73   FWNGHEPTQGKYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNYGGFPIWLKHVPG  132

Query  480  ISFRTDNEPFKSAMQKF  530
            I FRT+NEPFK+AMQKF
Sbjct  133  IVFRTENEPFKAAMQKF  149



>ref|XP_010515757.1| PREDICTED: beta-galactosidase 2 isoform X1 [Camelina sativa]
Length=727

 Score =   234 bits (598),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +3

Query  132  SVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNG  311
            S  A V+YD  A IING R+IL+SGSIHYPRSTPEMWPDL+ KAKEGGLDVIQTY+FW+G
Sbjct  24   STEAVVTYDHKALIINGQRRILLSGSIHYPRSTPEMWPDLIHKAKEGGLDVIQTYVFWSG  83

Query  312  HEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFR  491
            HEP PG YYFEDRYD+VKF KL  QAGLY+ LRIGPY C EWNFGGFPVWLK+VPGI FR
Sbjct  84   HEPSPGNYYFEDRYDLVKFTKLVHQAGLYLDLRIGPYVCAEWNFGGFPVWLKYVPGIVFR  143

Query  492  TDNEPFKSAMQKF  530
            TDNEPFK AMQKF
Sbjct  144  TDNEPFKIAMQKF  156



>emb|CDY37486.1| BnaC01g37460D [Brassica napus]
Length=839

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = +3

Query  129  SSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWN  308
            S V+ASVSYD  A  ING R+ILISGSIHYPRS PEMWPDL++KAKEGGLDVIQTY+FWN
Sbjct  20   SLVSASVSYDSRAITINGKRRILISGSIHYPRSAPEMWPDLIRKAKEGGLDVIQTYVFWN  79

Query  309  GHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISF  488
            GHEP PGKYYFE  YD+VKF+KL +Q+GLY+HLRIGPY C EWNFGGFPVWLK+VPGISF
Sbjct  80   GHEPSPGKYYFEGNYDLVKFVKLVKQSGLYLHLRIGPYVCAEWNFGGFPVWLKYVPGISF  139

Query  489  RTDNEPFKSAMQKF  530
            RTDN PFK+ MQ+F
Sbjct  140  RTDNGPFKAQMQRF  153



>gb|ACP18874.1| beta-galactosidase pBG(b) [Carica papaya]
Length=514

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +3

Query  141  ASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNGHEP  320
            ASVSYD  A  ING R+IL+SGSIHYPRSTPEMWPDL+QKAKEGGLDVIQTY+FWNGHEP
Sbjct  19   ASVSYDHKAITINGKRRILLSGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYVFWNGHEP  78

Query  321  QPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFRTDN  500
             PGKYYF   YD+V+FIKL +QAGLYVHLRIGPY C EWNFGGFPVWLK++PGI+FRT+N
Sbjct  79   SPGKYYFGGNYDLVRFIKLVKQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGIAFRTNN  138

Query  501  EPFKSAMQKF  530
             PFK+ MQ+F
Sbjct  139  GPFKAYMQRF  148



>ref|XP_010234045.1| PREDICTED: beta-galactosidase 4 [Brachypodium distachyon]
Length=724

 Score =   234 bits (598),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
            F+  NA+VSYD  + +ING R+ILISGSIHYPRSTPEMWP L+QKAK+GGLDV+QTY+FW
Sbjct  24   FAVANAAVSYDHRSLVINGRRRILISGSIHYPRSTPEMWPGLIQKAKDGGLDVVQTYVFW  83

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP  G+YYF DRYD+++F+KL +QAGLYVHLRIGPY C EWNFGGFPVWLK+VPGIS
Sbjct  84   NGHEPVKGQYYFSDRYDLIRFVKLVKQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIS  143

Query  486  FRTDNEPFKSAMQKF  530
            FRTDN PFK+ MQ+F
Sbjct  144  FRTDNGPFKAEMQRF  158



>sp|Q6Z6K4.1|BGAL4_ORYSJ RecName: Full=Beta-galactosidase 4; Short=Lactase 4; Flags: Precursor 
[Oryza sativa Japonica Group]
 dbj|BAD17189.1| putative beta-galactosidase precursor [Oryza sativa Japonica 
Group]
Length=729

 Score =   234 bits (598),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = +3

Query  135  VNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNGH  314
             NA+VSYD+ + +ING R+IL+SGSIHYPRSTPEMWP L+QKAK+GGLDVIQTY+FWNGH
Sbjct  34   ANAAVSYDRRSLVINGRRRILLSGSIHYPRSTPEMWPGLIQKAKDGGLDVIQTYVFWNGH  93

Query  315  EPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFRT  494
            EP  G+YYF DRYD+V+F+KL +QAGLYVHLRIGPY C EWNFGGFPVWLK+VPG+SFRT
Sbjct  94   EPVQGQYYFSDRYDLVRFVKLVKQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGVSFRT  153

Query  495  DNEPFKSAMQKF  530
            DN PFK+ MQKF
Sbjct  154  DNGPFKAEMQKF  165



>ref|XP_010487145.1| PREDICTED: beta-galactosidase 1-like [Camelina sativa]
Length=846

 Score =   236 bits (602),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +3

Query  129  SSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWN  308
             SV+ SVSYD  A  ING R+ILISGSIHYPRSTPEMWPDL++KAKEGGLDVIQTY+FWN
Sbjct  27   CSVSGSVSYDSRAITINGKRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWN  86

Query  309  GHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISF  488
            GHEP PGKYYFE  YD+VKF+KL +Q+GLY+HLRIGPY C EWNFGGFPVWLK++PGISF
Sbjct  87   GHEPSPGKYYFEGNYDLVKFVKLVKQSGLYLHLRIGPYVCAEWNFGGFPVWLKYIPGISF  146

Query  489  RTDNEPFKSAMQKF  530
            RTDN PFK+ MQ F
Sbjct  147  RTDNGPFKAQMQSF  160



>sp|A2X2H7.1|BGAL4_ORYSI RecName: Full=Beta-galactosidase 4; Short=Lactase 4; Flags: Precursor 
[Oryza sativa Indica Group]
 gb|EAY85037.1| hypothetical protein OsI_06394 [Oryza sativa Indica Group]
Length=729

 Score =   234 bits (598),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = +3

Query  135  VNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNGH  314
             NA+VSYD+ + +ING R+IL+SGSIHYPRSTPEMWP L+QKAK+GGLDVIQTY+FWNGH
Sbjct  34   ANAAVSYDRRSLVINGRRRILLSGSIHYPRSTPEMWPGLIQKAKDGGLDVIQTYVFWNGH  93

Query  315  EPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFRT  494
            EP  G+YYF DRYD+V+F+KL +QAGLYVHLRIGPY C EWNFGGFPVWLK+VPG+SFRT
Sbjct  94   EPVQGQYYFSDRYDLVRFVKLVKQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGVSFRT  153

Query  495  DNEPFKSAMQKF  530
            DN PFK+ MQKF
Sbjct  154  DNGPFKAEMQKF  165



>ref|XP_006648459.1| PREDICTED: beta-galactosidase 4-like [Oryza brachyantha]
Length=748

 Score =   234 bits (598),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = +3

Query  135  VNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNGH  314
             NA+VSYD+ + +ING R+IL+SGSIHYPRSTPEMWP L+QKAK+GGLDVIQTY+FWNGH
Sbjct  53   ANAAVSYDRRSLVINGRRRILLSGSIHYPRSTPEMWPGLIQKAKDGGLDVIQTYVFWNGH  112

Query  315  EPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFRT  494
            EP  G+YYF DRYD+V F+KL +QAGLYVHLRIGPY C EWNFGGFPVWLK+VPGISFRT
Sbjct  113  EPVQGQYYFSDRYDLVSFVKLVKQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISFRT  172

Query  495  DNEPFKSAMQKF  530
            DN PFK+ MQKF
Sbjct  173  DNGPFKAEMQKF  184



>ref|XP_011010891.1| PREDICTED: beta-galactosidase 1-like [Populus euphratica]
Length=845

 Score =   236 bits (601),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = +3

Query  129  SSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWN  308
             SV ASVSYD  A  ING R+ILISGSIHYPRS+PEMWPDL+QKAKEGGLDVIQTY+FWN
Sbjct  26   CSVTASVSYDSKAITINGQRRILISGSIHYPRSSPEMWPDLIQKAKEGGLDVIQTYVFWN  85

Query  309  GHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISF  488
            GHEP PGKYYFE  YD+VKF+KL ++AGLYV+LRIGPY C EWNFGGFPVWLK++PGI+F
Sbjct  86   GHEPSPGKYYFEGSYDLVKFVKLVKEAGLYVNLRIGPYVCAEWNFGGFPVWLKYIPGINF  145

Query  489  RTDNEPFKSAMQKF  530
            RTDN PFK+ M+KF
Sbjct  146  RTDNGPFKAQMRKF  159



>gb|EAZ22260.1| hypothetical protein OsJ_05915 [Oryza sativa Japonica Group]
Length=754

 Score =   234 bits (598),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = +3

Query  135  VNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNGH  314
             NA+VSYD+ + +ING R+IL+SGSIHYPRSTPEMWP L+QKAK+GGLDVIQTY+FWNGH
Sbjct  34   ANAAVSYDRRSLVINGRRRILLSGSIHYPRSTPEMWPGLIQKAKDGGLDVIQTYVFWNGH  93

Query  315  EPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFRT  494
            EP  G+YYF DRYD+V+F+KL +QAGLYVHLRIGPY C EWNFGGFPVWLK+VPG+SFRT
Sbjct  94   EPVQGQYYFSDRYDLVRFVKLVKQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGVSFRT  153

Query  495  DNEPFKSAMQKF  530
            DN PFK+ MQKF
Sbjct  154  DNGPFKAEMQKF  165



>ref|XP_009148743.1| PREDICTED: beta-galactosidase 2 isoform X1 [Brassica rapa]
Length=727

 Score =   234 bits (596),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = +3

Query  126  FSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFW  305
              S  A VSYD  A IING ++IL+SGSIHYPRSTPEMWPDL+ KAKEGGLDVIQTY+FW
Sbjct  22   ICSTKALVSYDHKALIINGQKRILLSGSIHYPRSTPEMWPDLINKAKEGGLDVIQTYVFW  81

Query  306  NGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGIS  485
            NGHEP PG+YYF DRYD+V+FIKL QQAGLYV LRIGPY C EWNFGG PVWLK+VPG+ 
Sbjct  82   NGHEPSPGQYYFGDRYDLVRFIKLVQQAGLYVSLRIGPYVCAEWNFGGIPVWLKYVPGMV  141

Query  486  FRTDNEPFKSAMQKF  530
            FRTDN PFK+AMQKF
Sbjct  142  FRTDNGPFKTAMQKF  156



>ref|XP_010504030.1| PREDICTED: beta-galactosidase 2-like [Camelina sativa]
Length=727

 Score =   234 bits (596),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +3

Query  132  SVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNG  311
            S+ A V+YD  A IING R+IL+SGSIHYPRSTPEMWPDL+ KAKEGGLDVIQTY+FW+G
Sbjct  24   SIEAVVTYDHKALIINGQRRILLSGSIHYPRSTPEMWPDLIHKAKEGGLDVIQTYVFWSG  83

Query  312  HEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFR  491
            HEP PG YYFEDRYD+VKF KL  +AGLY+ LRIGPY C EWNFGGFPVWLK+VPGI FR
Sbjct  84   HEPSPGNYYFEDRYDLVKFTKLVHRAGLYLDLRIGPYVCAEWNFGGFPVWLKYVPGIVFR  143

Query  492  TDNEPFKSAMQKF  530
            TDNEPFK AMQKF
Sbjct  144  TDNEPFKIAMQKF  156



>dbj|BAB83260.1| beta-D-galactosidase [Persea americana]
Length=766

 Score =   234 bits (597),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +3

Query  132  SVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNG  311
            S   SV+YD+ A +ING R+ILISGSIHYPRSTPEMWPDL+QKAKEGGLDVIQTY+FW+G
Sbjct  32   SATCSVTYDRKAIVINGQRRILISGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYVFWDG  91

Query  312  HEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFR  491
            HEP PGKYYFE RYD+VKFIKL +QAGLYV+LRIGPY C EWN GGFPVWLK++PGISFR
Sbjct  92   HEPSPGKYYFEGRYDLVKFIKLVKQAGLYVNLRIGPYICAEWNLGGFPVWLKYIPGISFR  151

Query  492  TDNEPFKSAMQKF  530
            TDNEPFK  M  F
Sbjct  152  TDNEPFKRYMAGF  164



>gb|AHG94613.1| beta-galactosidase [Camellia sinensis]
Length=725

 Score =   234 bits (596),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = +3

Query  129  SSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWN  308
            SSV ASVSYD  A IING R+ILISGSIHYPRSTPEMWP L++KAK+GGLDVIQTY+FWN
Sbjct  21   SSVTASVSYDGRAIIINGQRRILISGSIHYPRSTPEMWPGLIRKAKDGGLDVIQTYVFWN  80

Query  309  GHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISF  488
            GHEP  G+Y F  RYD+V+FIK+ QQAGLYVHLRIGPY C EWNFGGFPVWLK+VPGI+F
Sbjct  81   GHEPIQGQYNFAGRYDLVQFIKVVQQAGLYVHLRIGPYICAEWNFGGFPVWLKYVPGIAF  140

Query  489  RTDNEPFKSAMQKF  530
            RTDN PFK+AMQKF
Sbjct  141  RTDNGPFKAAMQKF  154



>gb|KJB70253.1| hypothetical protein B456_011G065300 [Gossypium raimondii]
Length=788

 Score =   234 bits (597),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = +3

Query  135  VNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIFWNGH  314
            V+ SVSYD  A  ING R+IL+SGSIHYPRS+PEMWPDL+QKAKEGGLDVIQTY+FWNGH
Sbjct  29   VSGSVSYDHKAITINGQRRILLSGSIHYPRSSPEMWPDLIQKAKEGGLDVIQTYVFWNGH  88

Query  315  EPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGISFRT  494
            EP PGKYYF+  YD+VKFIKL QQAGLYVHLRIGPY C EWNFGGFPVWLK++PGI FRT
Sbjct  89   EPAPGKYYFQGNYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGIVFRT  148

Query  495  DNEPFKSAMQKF  530
            +N PFK+ MQ+F
Sbjct  149  NNGPFKAQMQRF  160



>gb|KHN06610.1| Beta-galactosidase [Glycine soja]
Length=831

 Score =   234 bits (598),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 120/136 (88%), Gaps = 2/136 (1%)
 Frame = +3

Query  123  WFSSVNASVSYDKNAFIINGHRKILISGSIHYPRSTPEMWPDLLQKAKEGGLDVIQTYIF  302
            W  +V ASV+YD  A ++NG R+ILISGSIHYPRSTPE   +L+QKAK+GGLDVIQTY+F
Sbjct  17   WVCAVTASVTYDHKAIVVNGQRRILISGSIHYPRSTPEA--NLIQKAKDGGLDVIQTYVF  74

Query  303  WNGHEPQPGKYYFEDRYDVVKFIKLAQQAGLYVHLRIGPYACGEWNFGGFPVWLKFVPGI  482
            WNGHEP PGKYYFEDRYD+VKFIKL QQAGL VHLRIGPY C EWNFGGFPVWLK+VP I
Sbjct  75   WNGHEPSPGKYYFEDRYDLVKFIKLVQQAGLSVHLRIGPYICAEWNFGGFPVWLKYVPDI  134

Query  483  SFRTDNEPFKSAMQKF  530
            +FRTDNEPFK+AMQKF
Sbjct  135  AFRTDNEPFKAAMQKF  150



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556507818200