BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS078C04

Length=627
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009783913.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...    141   2e-34   Nicotiana sylvestris
gb|AFD22619.1|  dicer-like 2 protein                                    136   1e-32   Nicotiana attenuata
ref|XP_009625898.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...    134   4e-32   
ref|XP_011084676.1|  PREDICTED: endoribonuclease Dicer homolog 2        122   7e-28   Sesamum indicum [beniseed]
emb|CDO96786.1|  unnamed protein product                                119   9e-28   Coffea canephora [robusta coffee]
emb|CDO96788.1|  unnamed protein product                                120   1e-27   Coffea canephora [robusta coffee]
ref|XP_010312608.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...    121   1e-27   
ref|XP_008218472.1|  PREDICTED: endoribonuclease Dicer homolog 2        121   1e-27   Prunus mume [ume]
emb|CDP06207.1|  unnamed protein product                                116   4e-26   Coffea canephora [robusta coffee]
ref|XP_007208392.1|  hypothetical protein PRUPE_ppa000240mg             116   6e-26   
ref|XP_002514810.1|  ATP binding protein, putative                      115   1e-25   
ref|XP_008370841.1|  PREDICTED: endoribonuclease Dicer homolog 2        114   4e-25   
gb|KCW84635.1|  hypothetical protein EUGRSUZ_B01461                     114   5e-25   Eucalyptus grandis [rose gum]
ref|XP_010038609.1|  PREDICTED: endoribonuclease Dicer homolog 2        114   5e-25   Eucalyptus grandis [rose gum]
emb|CDP04170.1|  unnamed protein product                                113   7e-25   Coffea canephora [robusta coffee]
ref|XP_009361581.1|  PREDICTED: endoribonuclease Dicer homolog 2        112   1e-24   
ref|XP_009340367.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    112   1e-24   Pyrus x bretschneideri [bai li]
ref|XP_006480493.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    112   2e-24   Citrus sinensis [apfelsine]
ref|XP_006428679.1|  hypothetical protein CICLE_v10010912mg             112   2e-24   Citrus clementina [clementine]
ref|XP_006300010.1|  hypothetical protein CARUB_v10016233mg             110   6e-24   
ref|XP_010312607.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    110   1e-23   
ref|XP_010508928.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    108   2e-23   
ref|XP_010508779.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    108   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010508629.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    108   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_002312197.1|  hypothetical protein POPTR_0008s07580g             108   3e-23   
ref|XP_011015099.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    107   1e-22   Populus euphratica
ref|XP_011015091.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    107   1e-22   Populus euphratica
ref|XP_011015068.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    107   1e-22   Populus euphratica
gb|ABF19798.1|  dicer-like 2 spliceform 2                               107   1e-22   Arabidopsis thaliana [mouse-ear cress]
gb|AAF26098.1|AC012328_1  unknown protein                               107   1e-22   Arabidopsis thaliana [mouse-ear cress]
gb|ABF19797.1|  dicer-like 2 spliceform 1                               107   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001078101.1|  endoribonuclease Dicer-like 2                      107   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566199.4|  endoribonuclease Dicer-like 2                         106   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010549772.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    106   2e-22   Tarenaya hassleriana [spider flower]
ref|XP_002884369.1|  hypothetical protein ARALYDRAFT_317213             106   2e-22   
ref|XP_010549776.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    106   2e-22   Tarenaya hassleriana [spider flower]
ref|XP_008240740.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    105   2e-22   Prunus mume [ume]
ref|XP_011006570.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...    105   3e-22   Populus euphratica
ref|XP_006480490.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    105   3e-22   Citrus sinensis [apfelsine]
ref|XP_006480488.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    105   3e-22   
ref|XP_006428678.1|  hypothetical protein CICLE_v10010911mg             105   3e-22   Citrus clementina [clementine]
ref|XP_010485670.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    105   3e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010649216.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    105   3e-22   Vitis vinifera
ref|XP_010649214.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    105   3e-22   Vitis vinifera
ref|XP_010649215.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    105   4e-22   Vitis vinifera
ref|XP_002315119.1|  hypothetical protein POPTR_0010s18870g             105   4e-22   
ref|XP_010485668.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    105   4e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010485666.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    105   4e-22   Camelina sativa [gold-of-pleasure]
emb|CBI17597.3|  unnamed protein product                                105   4e-22   Vitis vinifera
ref|XP_010649218.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    105   4e-22   Vitis vinifera
gb|KJB14793.1|  hypothetical protein B456_002G143000                    105   4e-22   Gossypium raimondii
gb|KDO45679.1|  hypothetical protein CISIN_1g0030621mg                  102   7e-22   Citrus sinensis [apfelsine]
ref|XP_007217819.1|  hypothetical protein PRUPE_ppa027063mg             103   9e-22   
ref|XP_011466081.1|  PREDICTED: endoribonuclease Dicer homolog 2        103   1e-21   Fragaria vesca subsp. vesca
gb|KHG30500.1|  hypothetical protein F383_12835                         102   3e-21   Gossypium arboreum [tree cotton]
gb|KHG30499.1|  hypothetical protein F383_12835                         102   3e-21   Gossypium arboreum [tree cotton]
ref|XP_007216896.1|  hypothetical protein PRUPE_ppa019601mg             102   3e-21   
ref|XP_007029209.1|  Dicer-like protein isoform 2                       101   7e-21   
ref|XP_007029211.1|  Dicer-like protein isoform 4                       101   7e-21   
ref|XP_007029208.1|  Dicer-like protein isoform 1                       101   8e-21   
emb|CAN77284.1|  hypothetical protein VITISV_043738                     101   8e-21   Vitis vinifera
ref|XP_007029213.1|  Dicer-like protein isoform 6                       101   8e-21   
emb|CDY50692.1|  BnaC05g47910D                                          101   9e-21   Brassica napus [oilseed rape]
emb|CDO96789.1|  unnamed protein product                                100   1e-20   Coffea canephora [robusta coffee]
ref|XP_008392375.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    100   1e-20   
ref|XP_003535104.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    100   3e-20   Glycine max [soybeans]
ref|XP_008351646.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  99.4    3e-20   
emb|CDY43132.1|  BnaA05g32540D                                          100   3e-20   Brassica napus [oilseed rape]
ref|XP_009130358.1|  PREDICTED: endoribonuclease Dicer homolog 2        100   3e-20   
gb|KFK39865.1|  hypothetical protein AALP_AA3G298800                  99.8    3e-20   Arabis alpina [alpine rockcress]
ref|XP_006408318.1|  hypothetical protein EUTSA_v10019898mg           99.8    3e-20   Eutrema salsugineum [saltwater cress]
gb|EYU39730.1|  hypothetical protein MIMGU_mgv1a0003142mg             99.0    6e-20   Erythranthe guttata [common monkey flower]
ref|XP_007216887.1|  hypothetical protein PRUPE_ppa020875mg           97.1    2e-19   
ref|XP_008373031.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  96.3    3e-19   
gb|ACE60552.1|  dicer-like protein 2                                  97.1    3e-19   Brassica rapa
ref|XP_008373030.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  96.3    3e-19   
ref|XP_009348591.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  95.5    3e-19   
ref|XP_008240779.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  96.3    4e-19   Prunus mume [ume]
ref|XP_009348590.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  95.1    7e-19   Pyrus x bretschneideri [bai li]
ref|XP_010312606.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  95.5    1e-18   Solanum lycopersicum
gb|KJB61693.1|  hypothetical protein B456_009G374900                  94.4    2e-18   Gossypium raimondii
gb|KJB61692.1|  hypothetical protein B456_009G374900                  94.4    2e-18   Gossypium raimondii
gb|KJB61696.1|  hypothetical protein B456_009G374900                  94.0    2e-18   Gossypium raimondii
gb|KEH42074.1|  endoribonuclease dicer-like protein                   94.0    3e-18   Medicago truncatula
ref|XP_003594551.1|  Endoribonuclease Dicer                           92.8    8e-18   
gb|AES64802.2|  endoribonuclease dicer-like protein                   92.8    8e-18   Medicago truncatula
gb|KEH20231.1|  endoribonuclease dicer-like protein                   92.4    9e-18   Medicago truncatula
ref|XP_004171378.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  90.9    9e-18   
ref|XP_007147466.1|  hypothetical protein PHAVU_006G127100g           92.0    2e-17   Phaseolus vulgaris [French bean]
ref|XP_008443676.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  91.3    3e-17   Cucumis melo [Oriental melon]
ref|XP_008443675.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  91.3    3e-17   
ref|XP_008443674.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  91.3    3e-17   Cucumis melo [Oriental melon]
ref|XP_008443670.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  91.3    3e-17   Cucumis melo [Oriental melon]
ref|XP_007147469.1|  hypothetical protein PHAVU_006G127200g           90.9    3e-17   Phaseolus vulgaris [French bean]
ref|XP_004139098.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  90.5    4e-17   Cucumis sativus [cucumbers]
ref|XP_004303843.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  89.7    8e-17   Fragaria vesca subsp. vesca
ref|XP_007029210.1|  Dicer-like protein isoform 3                     89.4    1e-16   
ref|XP_010101236.1|  Endoribonuclease Dicer-2-like protein            89.4    1e-16   
ref|XP_010673887.1|  PREDICTED: endoribonuclease Dicer homolog 2      89.0    1e-16   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007029212.1|  Dicer-like protein isoform 5                     89.0    1e-16   
ref|XP_007029214.1|  Dicer-like protein isoform 7                     88.6    2e-16   
ref|XP_006586846.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  86.3    1e-15   Glycine max [soybeans]
ref|XP_003534774.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  86.3    1e-15   Glycine max [soybeans]
ref|XP_006586847.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  86.3    1e-15   Glycine max [soybeans]
gb|KHN23014.1|  Endoribonuclease Dicer like 2                         85.9    1e-15   Glycine soja [wild soybean]
ref|XP_004486471.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  84.3    5e-15   Cicer arietinum [garbanzo]
ref|XP_010249397.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  84.0    7e-15   Nelumbo nucifera [Indian lotus]
ref|XP_010249398.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  83.6    7e-15   Nelumbo nucifera [Indian lotus]
ref|XP_007147294.1|  hypothetical protein PHAVU_006G111800g           83.2    8e-15   Phaseolus vulgaris [French bean]
ref|XP_007140643.1|  hypothetical protein PHAVU_008G129500g           82.4    2e-14   Phaseolus vulgaris [French bean]
ref|XP_006604892.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  78.2    3e-13   Glycine max [soybeans]
ref|XP_003553782.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  78.2    4e-13   Glycine max [soybeans]
ref|XP_006844770.1|  hypothetical protein AMTR_s00016p00258500        78.2    5e-13   
gb|ACU23800.1|  unknown                                               73.9    1e-12   Glycine max [soybeans]
gb|KHN43108.1|  Endoribonuclease Dicer like 2                         76.6    1e-12   Glycine soja [wild soybean]
ref|XP_010088523.1|  Endoribonuclease Dicer-2-like protein            61.2    1e-07   
ref|XP_010312604.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  60.8    2e-07   Solanum lycopersicum
ref|XP_008681081.1|  PREDICTED: uncharacterized protein LOC100192...  60.1    3e-07   
ref|XP_008681082.1|  PREDICTED: uncharacterized protein LOC100192...  60.1    3e-07   Zea mays [maize]
ref|XP_008681083.1|  PREDICTED: uncharacterized protein LOC100192...  60.1    3e-07   
ref|XP_008644679.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  59.7    3e-07   Zea mays [maize]
ref|XP_010229604.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...  60.1    3e-07   
ref|XP_008644681.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  59.7    3e-07   Zea mays [maize]
ref|XP_008644676.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  59.7    3e-07   Zea mays [maize]
gb|AFW68292.1|  hypothetical protein ZEAMMB73_963828                  57.8    7e-07   
ref|XP_006651573.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  58.2    1e-06   Oryza brachyantha
ref|XP_010233057.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  56.6    4e-06   
ref|XP_010233062.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  56.6    4e-06   
ref|XP_004982510.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  56.2    5e-06   Setaria italica
ref|XP_004982511.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  56.2    5e-06   Setaria italica
ref|XP_004982509.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  55.8    6e-06   Setaria italica
gb|AAS07190.1|  putative ribonuclease III, 5'-partial (with alter...  55.8    7e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002464288.1|  hypothetical protein SORBIDRAFT_01g015663        55.1    7e-06   
ref|XP_004982512.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  55.5    7e-06   
gb|EEE59414.1|  hypothetical protein OsJ_11564                        55.8    8e-06   Oryza sativa Japonica Group [Japonica rice]
gb|AAS07189.1|  putative ribonuclease III, 5'-partial (with alter...  55.8    8e-06   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD34005.1|  CAF protein-like                                     55.8    8e-06   Oryza sativa Japonica Group [Japonica rice]
sp|Q69LX2.2|DCL2B_ORYSJ  RecName: Full=Endoribonuclease Dicer hom...  55.8    8e-06   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001050564.1|  Os03g0583900                                     55.8    8e-06   
gb|EEC75643.1|  hypothetical protein OsI_12390                        55.8    8e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_004982513.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  54.7    2e-05   Setaria italica
ref|XP_004982514.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  54.3    2e-05   Setaria italica
gb|AAS07188.1|  putative ribonuclease III, 5'-partial (with alter...  53.5    3e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002464290.1|  hypothetical protein SORBIDRAFT_01g015670        53.9    3e-05   
gb|EMS67762.1|  Endoribonuclease Dicer-like protein 2a                52.4    1e-04   Triticum urartu



>ref|XP_009783913.1| PREDICTED: LOW QUALITY PROTEIN: endoribonuclease Dicer homolog 
2-like [Nicotiana sylvestris]
Length=1403

 Score =   141 bits (355),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 71/152 (47%), Positives = 104/152 (68%), Gaps = 7/152 (5%)
 Frame = +2

Query  185  QELGCQ------PKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRL  346
            +ELGCQ       KYFPPELV    N  +T+Y CY+++L    Y   QL+ I+LA+RTRL
Sbjct  648  KELGCQISTDEESKYFPPELVSHCANDTETVYYCYVVDLQHDSYSSYQLRGIVLAVRTRL  707

Query  347  ESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEA  526
            + DDE L+F+L+++ G+ + Q  Y G V L++E+ILRC+RFQV++ R+L + +L+ L +A
Sbjct  708  KFDDERLTFDLDVDKGSLLVQVNYSGVVRLTSEEILRCQRFQVSLFRILLDRDLSKLQDA  767

Query  527  LGRLNLVDGSAVIDYLLLPSSMDPSDVPKIDW  622
            L  + L  GSAV DYLLLP S+  +  P+I+W
Sbjct  768  LAAVQLPVGSAVSDYLLLP-SLGSTQNPQINW  798



>gb|AFD22619.1| dicer-like 2 protein [Nicotiana attenuata]
Length=1403

 Score =   136 bits (342),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 70/152 (46%), Positives = 102/152 (67%), Gaps = 7/152 (5%)
 Frame = +2

Query  185  QELGCQP------KYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRL  346
            +ELGCQ       KYFPPELV    N  + +Y CY ++L    Y   QL  IILA+RTRL
Sbjct  648  KELGCQIYTDEELKYFPPELVSHCANDTEAVYYCYEVDLQHDSYSSYQLCGIILAVRTRL  707

Query  347  ESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEA  526
            + DDE L+F+L+++ G+ + Q  Y G V L++E++LRC+RFQV++ R+L + +L+ L++A
Sbjct  708  KFDDERLTFDLDVDKGSLLVQVNYSGVVRLTSEEVLRCQRFQVSLFRILLDRDLSKLEDA  767

Query  527  LGRLNLVDGSAVIDYLLLPSSMDPSDVPKIDW  622
            L  + L  GSAV DYLLLP S+  +  P+I+W
Sbjct  768  LAAVQLPVGSAVSDYLLLP-SLGSTQNPQINW  798



>ref|XP_009625898.1| PREDICTED: LOW QUALITY PROTEIN: endoribonuclease Dicer homolog 
2-like [Nicotiana tomentosiformis]
Length=1403

 Score =   134 bits (338),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 102/152 (67%), Gaps = 7/152 (5%)
 Frame = +2

Query  185  QELGCQ------PKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRL  346
            +ELGCQ       KYFPPELV    N  + +Y CY+++L    Y   QL+ IILA+RTRL
Sbjct  648  KELGCQIYTDEESKYFPPELVSHCANDTEAVYYCYVVDLQHDSYSNYQLRGIILAVRTRL  707

Query  347  ESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEA  526
            + DDE L F+L+++ G+ + Q  Y G V L++E+ILRC+RFQV++ R+L + +L+ L +A
Sbjct  708  KLDDERLIFDLDVDNGSLLVQVNYSGVVRLTSEEILRCQRFQVSLFRILLDRDLSKLQDA  767

Query  527  LGRLNLVDGSAVIDYLLLPSSMDPSDVPKIDW  622
            L  + L  GSAV DYLLLP S+  +  P+I+W
Sbjct  768  LSAVQLPVGSAVSDYLLLP-SLGSTQNPQINW  798



>ref|XP_011084676.1| PREDICTED: endoribonuclease Dicer homolog 2 [Sesamum indicum]
Length=1398

 Score =   122 bits (306),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 64/140 (46%), Positives = 92/140 (66%), Gaps = 7/140 (5%)
 Frame = +2

Query  185  QELGCQP------KYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRL  346
            QE G +P      KY PPELVG+  N  +TLY+CY IEL   +   T+LQ+I+LA+ TRL
Sbjct  648  QECGYEPYSDECAKYLPPELVGSHGNVSETLYNCYAIELRPNFEYDTKLQDIVLAVHTRL  707

Query  347  ESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEA  526
            + D E  + +L+++ G  + +  ++G V L++EQ+  C+RFQ+TV RVL +HNLN L E 
Sbjct  708  DDDLERSNLDLDVDRGKLIVRIKHVGYVTLNSEQVALCQRFQLTVFRVLIDHNLNKLHEE  767

Query  527  LGRLNLVDGSAVIDYLLLPS  586
            L   +  +GS V +YLLLPS
Sbjct  768  LHEYSNRNGS-VFNYLLLPS  786



>emb|CDO96786.1| unnamed protein product [Coffea canephora]
Length=478

 Score =   119 bits (297),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 87/138 (63%), Gaps = 1/138 (1%)
 Frame = +2

Query  209  YFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFELNIE  388
            Y P ELVG   N  +TLY CYLI L   +   T+  +I+LA R RLE DDE L+FEL+++
Sbjct  61   YVPSELVGCPGNDSETLYHCYLIALQPDFSCDTKPHDILLARRARLEFDDETLTFELDVD  120

Query  389  GGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSAVID  568
             G    +  YI  + L++E+++ C++FQVT+LR+L +HN   L EAL  LN      V D
Sbjct  121  RGKLKIRMNYIRQIKLTSEEVVLCQKFQVTLLRLLLDHNQKKLKEALSGLNRNSQRDVFD  180

Query  569  YLLLPSSMDPSDVPKIDW  622
            YLL+PS+  P + P IDW
Sbjct  181  YLLIPST-GPHENPSIDW  197



>emb|CDO96788.1| unnamed protein product [Coffea canephora]
Length=726

 Score =   120 bits (301),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 62/139 (45%), Positives = 87/139 (63%), Gaps = 1/139 (1%)
 Frame = +2

Query  206  KYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFELNI  385
            +Y P ELVG   N  +TLY CY I L   +   T   +I+LA R RLE DDE L+FEL++
Sbjct  2    QYVPSELVGCPGNESETLYHCYQIALQPDFSCNTMPHDILLATRARLEFDDETLNFELDV  61

Query  386  EGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSAVI  565
              G+   +  Y+  + L++E+++ C++FQVT+LR+L +HN N L EAL  LN      V 
Sbjct  62   PRGSLKIRMKYVRRIKLASEEVVLCQKFQVTLLRLLLDHNQNKLKEALSGLNRNSQRDVF  121

Query  566  DYLLLPSSMDPSDVPKIDW  622
            DYLL+PS+  P + P IDW
Sbjct  122  DYLLIPST-SPHENPSIDW  139



>ref|XP_010312608.1| PREDICTED: LOW QUALITY PROTEIN: endoribonuclease Dicer homolog 
2-like [Solanum lycopersicum]
Length=1406

 Score =   121 bits (304),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 69/153 (45%), Positives = 94/153 (61%), Gaps = 10/153 (7%)
 Frame = +2

Query  185  QELGCQ------PKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRL  346
            +EL CQ       KYFPPELV    N  + +Y CYL+E+    Y   +L  IILA+RTRL
Sbjct  649  KELECQIQTVEESKYFPPELVSHCSNDSEAVYYCYLVEMQHASYNDFELHGIILAVRTRL  708

Query  347  ESDDENLSFELNIE-GGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDE  523
            + DDE L+F+L+++  G    Q  Y   V L+ E+I RC+RFQV+V R+L + +L+ L +
Sbjct  709  KCDDEILAFDLDVDRRGLLQVQLNYSKVVTLTAEEIRRCQRFQVSVFRILLDRDLSILQD  768

Query  524  ALGRLNLVDGSAVIDYLLLPSSMDPSDVPKIDW  622
            ALG +    GSAV DYLLLPS       P+I+W
Sbjct  769  ALGAVQSPIGSAVSDYLLLPSL---GSTPEINW  798



>ref|XP_008218472.1| PREDICTED: endoribonuclease Dicer homolog 2 [Prunus mume]
Length=1396

 Score =   121 bits (304),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 64/153 (42%), Positives = 91/153 (59%), Gaps = 8/153 (5%)
 Frame = +2

Query  185  QELGCQP------KYFPPELVGTR-DNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTR  343
            QELGC+P       Y P ELV     N    LY CYLIELN+ +     + +I+L +R+ 
Sbjct  648  QELGCEPYDDVQSSYVPVELVKPFCSNDASMLYHCYLIELNQNFGYDIPVHDIVLGMRSE  707

Query  344  LESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDE  523
            L+ D+ N+ F+L +  G       Y+G++ LS+EQ+L CR+FQ+T+ R+L +HNLN L+E
Sbjct  708  LDCDNANMHFDLEVGRGTLTMNFKYVGEIHLSSEQVLLCRKFQITIFRILMDHNLNKLEE  767

Query  524  ALGRLNLVDGSAVIDYLLLPSSMDPSDVPKIDW  622
             L  L L  G+  +DYLLLP +  P     IDW
Sbjct  768  VLDGLCL-GGNIGVDYLLLPGTKVPQRPLIIDW  799



>emb|CDP06207.1| unnamed protein product [Coffea canephora]
Length=761

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 87/141 (62%), Gaps = 1/141 (1%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  379
            Q  Y P ELVG   N  + LY CYLI L   +   T   +I+LA R+RLE DDE L+FEL
Sbjct  21   QKHYVPWELVGRPGNDSEILYHCYLIALEPGFSCDTMPHDILLATRSRLEFDDETLTFEL  80

Query  380  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  559
            +++ GN   +  Y+  + L++E++L C++FQV +LR+L +HN N L EAL  LN      
Sbjct  81   DVDRGNLKIRMKYVRHIKLTSEEVLLCQKFQVALLRLLLDHNQNKLQEALSGLNQNSQRD  140

Query  560  VIDYLLLPSSMDPSDVPKIDW  622
            V DYLL+PS+    + P IDW
Sbjct  141  VFDYLLIPST-GLHENPSIDW  160



>ref|XP_007208392.1| hypothetical protein PRUPE_ppa000240mg [Prunus persica]
 gb|EMJ09591.1| hypothetical protein PRUPE_ppa000240mg [Prunus persica]
Length=1415

 Score =   116 bits (291),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 63/153 (41%), Positives = 88/153 (58%), Gaps = 8/153 (5%)
 Frame = +2

Query  185  QELGCQP------KYFPPELVGTR-DNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTR  343
            QELGC+P       Y P ELV     N     Y CYLIELN+ +     + +I+L +R+ 
Sbjct  667  QELGCEPYDDVQSSYVPVELVKPFCSNDASISYHCYLIELNQNFGYDIPVHDIVLGMRSE  726

Query  344  LESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDE  523
            L+ D  N+ F+L +  G       Y+G++ LS+EQ+L CR+FQ+T+ R+L +HNLN L+E
Sbjct  727  LDCDIANMHFDLEVGRGTLTMNFKYVGEIHLSSEQVLLCRKFQITIFRILMDHNLNKLEE  786

Query  524  ALGRLNLVDGSAVIDYLLLPSSMDPSDVPKIDW  622
             L  L L  G   +DYLLLP +  P     IDW
Sbjct  787  VLDGLCL-GGQIGVDYLLLPGTKVPQRPLIIDW  818



>ref|XP_002514810.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF47364.1| ATP binding protein, putative [Ricinus communis]
Length=1388

 Score =   115 bits (289),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 63/164 (38%), Positives = 94/164 (57%), Gaps = 4/164 (2%)
 Frame = +2

Query  134  DMATTGSTGLQSDPPPYQELGCQPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQL  313
            D+    +   QS   PY +    P YFPPELVG      +  Y CYLIELN+ +     +
Sbjct  627  DIVVEETVAQQSGNGPYDDE--HPMYFPPELVGQASQKSEAKYYCYLIELNQNFVYEIPV  684

Query  314  QNIILALRTRLESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVL  493
             N +LA+R+ LESD   L  +L  + G  + +  YIG++ L+ E ++ CR+F +TVL+VL
Sbjct  685  HNFVLAMRSELESDILGLDLDLEADRGLLMVKLKYIGEIHLTPETVIMCRKFLITVLKVL  744

Query  494  FEHNLNTLDEALGRLNLVDGSAVIDYLLLPSSMDPSDVPKIDWN  625
             +H+++ L++ L  L L +G   IDYLLLP  +     P IDW+
Sbjct  745  VDHSIDKLEDILKGLKLRNGPE-IDYLLLP-LVGSCQKPSIDWD  786



>ref|XP_008370841.1| PREDICTED: endoribonuclease Dicer homolog 2 [Malus domestica]
 ref|XP_008370842.1| PREDICTED: endoribonuclease Dicer homolog 2 [Malus domestica]
Length=1397

 Score =   114 bits (285),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 63/153 (41%), Positives = 89/153 (58%), Gaps = 8/153 (5%)
 Frame = +2

Query  185  QELGCQP------KYFPPELVGTR-DNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTR  343
            QELG +P       Y P ELV     N P  LY CYLIELN+ +     + NI+L +R+ 
Sbjct  639  QELGSEPYDDVQCSYVPIELVKPFCSNDPSILYHCYLIELNQNFEYDIPVHNIVLGMRSE  698

Query  344  LESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDE  523
            L+ D  N  F+L +  G+      Y+G++ L++EQ+L CRRFQ+T+ ++L +HNLN L E
Sbjct  699  LDCDIANPHFDLEVGRGSVTVNFKYVGEIHLNSEQVLLCRRFQITIFQILIDHNLNKLGE  758

Query  524  ALGRLNLVDGSAVIDYLLLPSSMDPSDVPKIDW  622
             L  L+   G+  IDYLLLP +    +   IDW
Sbjct  759  VLDGLS-SGGNVGIDYLLLPGTRIHQEAVIIDW  790



>gb|KCW84635.1| hypothetical protein EUGRSUZ_B01461 [Eucalyptus grandis]
Length=1194

 Score =   114 bits (284),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 83/141 (59%), Gaps = 1/141 (1%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  379
             P YFPPELV    N  +TLY CY+IEL + Y     ++N++LA R+ LE+D  + SF+L
Sbjct  454  HPAYFPPELVNHHPNKSKTLYHCYVIELRQDYNYDATVENMVLATRSELEADICDKSFKL  513

Query  380  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  559
             +  G       Y+G++ L   Q+  CR+FQ+T+L VL +H++  L E L  LNLV  S 
Sbjct  514  QVPRGLLSVNVTYVGEIHLDENQVHLCRKFQITLLSVLLDHSMVKLRETLSGLNLVKASD  573

Query  560  VIDYLLLPSSMDPSDVPKIDW  622
            V DYLLLP +        IDW
Sbjct  574  V-DYLLLPHAGAHPTPGAIDW  593



>ref|XP_010038609.1| PREDICTED: endoribonuclease Dicer homolog 2 [Eucalyptus grandis]
Length=1403

 Score =   114 bits (284),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 83/141 (59%), Gaps = 1/141 (1%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  379
             P YFPPELV    N  +TLY CY+IEL + Y     ++N++LA R+ LE+D  + SF+L
Sbjct  663  HPAYFPPELVNHHPNKSKTLYHCYVIELRQDYNYDATVENMVLATRSELEADICDKSFKL  722

Query  380  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  559
             +  G       Y+G++ L   Q+  CR+FQ+T+L VL +H++  L E L  LNLV  S 
Sbjct  723  QVPRGLLSVNVTYVGEIHLDENQVHLCRKFQITLLSVLLDHSMVKLRETLSGLNLVKASD  782

Query  560  VIDYLLLPSSMDPSDVPKIDW  622
            V DYLLLP +        IDW
Sbjct  783  V-DYLLLPHAGAHPTPGAIDW  802



>emb|CDP04170.1| unnamed protein product [Coffea canephora]
Length=1351

 Score =   113 bits (283),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 64/152 (42%), Positives = 89/152 (59%), Gaps = 7/152 (5%)
 Frame = +2

Query  185  QELGCQP------KYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRL  346
            QEL  QP      +Y PPELV    N  +T Y CYLI+L   +       +I+LA+R  L
Sbjct  595  QELCRQPYVEEQVQYVPPELVDCLGNDSETSYYCYLIKLQPEFNYDDLPHDIVLAVRKTL  654

Query  347  ESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEA  526
            E   E L+F+L+ + G+   +  Y G + L++E++L CR+FQVT+ R L +HNLN L EA
Sbjct  655  ECHGETLNFDLDADRGSLKIEISYAGSITLASEEVLLCRKFQVTIFRALLDHNLNKLHEA  714

Query  527  LGRLNLVDGSAVIDYLLLPSSMDPSDVPKIDW  622
            LG L+L     + DYLLLPS+    +   IDW
Sbjct  715  LGGLHLNSECPLFDYLLLPSTGSCGNA-LIDW  745



>ref|XP_009361581.1| PREDICTED: endoribonuclease Dicer homolog 2 [Pyrus x bretschneideri]
 ref|XP_009361582.1| PREDICTED: endoribonuclease Dicer homolog 2 [Pyrus x bretschneideri]
Length=1410

 Score =   112 bits (281),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 63/153 (41%), Positives = 86/153 (56%), Gaps = 8/153 (5%)
 Frame = +2

Query  185  QELGCQP------KYFPPELVGTR-DNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTR  343
            QELG +P       Y P ELV     N P  LY CYLIELN+ +     + NI+L +R  
Sbjct  639  QELGSEPYDDAQCSYVPIELVKPFCSNDPSILYHCYLIELNQNFEYDIPVHNIVLGMRCE  698

Query  344  LESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDE  523
            L+ D  N  F+L +  G+      Y+G + L++EQ+L CRRFQ+T+ R+L +HNLN L +
Sbjct  699  LDCDIANTHFDLEVGRGSLTVNFKYVGGIHLNSEQVLLCRRFQITIFRILIDHNLNKLGK  758

Query  524  ALGRLNLVDGSAVIDYLLLPSSMDPSDVPKIDW  622
             L  L    G+  IDYLLLP +    +   IDW
Sbjct  759  VLDGL-CSGGNVGIDYLLLPGTRIHQEAVIIDW  790



>ref|XP_009340367.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Pyrus x bretschneideri]
 ref|XP_009340372.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Pyrus x bretschneideri]
Length=1397

 Score =   112 bits (281),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 63/153 (41%), Positives = 86/153 (56%), Gaps = 8/153 (5%)
 Frame = +2

Query  185  QELGCQP------KYFPPELVGTR-DNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTR  343
            QELG +P       Y P ELV     N P  LY CYLIELN+ +     + NI+L +R  
Sbjct  639  QELGSEPYDDAQCSYVPIELVKPFCSNDPSILYHCYLIELNQNFEYDIPVHNIVLGMRCE  698

Query  344  LESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDE  523
            L+ D  N  F+L +  G+      Y+G + L++EQ+L CRRFQ+T+ R+L +HNLN L +
Sbjct  699  LDCDIANTHFDLEVGRGSLTVNFKYVGGIHLNSEQVLLCRRFQITIFRILIDHNLNKLGK  758

Query  524  ALGRLNLVDGSAVIDYLLLPSSMDPSDVPKIDW  622
             L  L    G+  IDYLLLP +    +   IDW
Sbjct  759  VLDGL-CSGGNVGIDYLLLPGTRIHQEAVIIDW  790



>ref|XP_006480493.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X6 [Citrus 
sinensis]
Length=1396

 Score =   112 bits (280),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 56/130 (43%), Positives = 81/130 (62%), Gaps = 1/130 (1%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  379
             P YFPPELV       +  Y CYLIEL +++      +NI+LA+RT LES+ + ++F+L
Sbjct  659  HPIYFPPELVNQSPQDTKITYHCYLIELKQHFNYDISARNIVLAMRTELESEIKKVNFDL  718

Query  380  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  559
             +E G       ++G + L   Q+L CRRFQ+T+ RV+ +HNL+ L+E L    L D + 
Sbjct  719  EVERGRLTVNLKHLGRIQLIPNQVLLCRRFQITLFRVIMDHNLDKLNEILDGFELRD-NL  777

Query  560  VIDYLLLPSS  589
             IDYLLLPS+
Sbjct  778  EIDYLLLPST  787



>ref|XP_006428679.1| hypothetical protein CICLE_v10010912mg [Citrus clementina]
 gb|ESR41919.1| hypothetical protein CICLE_v10010912mg [Citrus clementina]
 gb|KDO45680.1| hypothetical protein CISIN_1g000607mg [Citrus sinensis]
Length=1396

 Score =   112 bits (280),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 56/130 (43%), Positives = 81/130 (62%), Gaps = 1/130 (1%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  379
             P YFPPELV       +  Y CYLIEL +++      +NI+LA+RT LES+ + ++F+L
Sbjct  659  HPIYFPPELVNQSPQDTKITYHCYLIELKQHFNYDISARNIVLAMRTELESEIKKVNFDL  718

Query  380  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  559
             +E G       ++G + L   Q+L CRRFQ+T+ RV+ +HNL+ L+E L    L D + 
Sbjct  719  EVERGRLTVNLKHLGRIQLIPNQVLLCRRFQITLFRVIMDHNLDKLNEILDGFELRD-NL  777

Query  560  VIDYLLLPSS  589
             IDYLLLPS+
Sbjct  778  EIDYLLLPST  787



>ref|XP_006300010.1| hypothetical protein CARUB_v10016233mg, partial [Capsella rubella]
 gb|EOA32908.1| hypothetical protein CARUB_v10016233mg, partial [Capsella rubella]
Length=1392

 Score =   110 bits (276),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 59/141 (42%), Positives = 80/141 (57%), Gaps = 2/141 (1%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  379
            QP YFPPELV      PQT Y  YLI +     ++  L +++L  R  LE D  N  F+L
Sbjct  658  QPCYFPPELVSQFSAQPQTTYHFYLIRMEPNSPRKIHLNDVLLGTRVELEDDIGNTGFQL  717

Query  380  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  559
                G       Y+G   L+ E++L CRRFQ+T+ RVL +H++  L EAL  L+L DG A
Sbjct  718  EDHKGTIAVTLSYVGAFHLTQEEVLMCRRFQITLFRVLLDHSVENLMEALDGLHLRDGVA  777

Query  560  VIDYLLLPSSMDPSDVPKIDW  622
             +DYLL+PS+    +   IDW
Sbjct  778  -LDYLLVPSTYS-HETSLIDW  796



>ref|XP_010312607.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X3 [Solanum 
lycopersicum]
Length=1370

 Score =   110 bits (274),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 65/153 (42%), Positives = 92/153 (60%), Gaps = 10/153 (7%)
 Frame = +2

Query  185  QELGCQPK------YFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRL  346
            +EL C+ K      Y+P E V    N  + +Y CYL+EL    Y  +QL  IILA+RT+L
Sbjct  631  KELECKIKIVEQSLYYPSEFVSHCGNESEAVYYCYLVELPHDSYNDSQLHGIILAVRTKL  690

Query  347  ESDDENLSFELNIE-GGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDE  523
            + DDE L+F+L+++  G    Q  Y   V  ++E+I RC+RFQV+V R+L + +L+ L E
Sbjct  691  KFDDEILAFDLDVDRRGRLKVQLNYRKVVIFTSEEIRRCQRFQVSVFRILRDPDLSKLQE  750

Query  524  ALGRLNLVDGSAVIDYLLLPSSMDPSDVPKIDW  622
             L  +    GSAV DYLLLPS   P   P+I+W
Sbjct  751  VLAAVQSPIGSAVSDYLLLPSVGTP---PEINW  780



>ref|XP_010508928.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X3 [Camelina 
sativa]
Length=1355

 Score =   108 bits (271),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 59/141 (42%), Positives = 79/141 (56%), Gaps = 2/141 (1%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  379
            QP YFPPELV      PQT Y  YLI +     ++  L +++L  R  LE D  N  F L
Sbjct  662  QPCYFPPELVSQFSAQPQTTYHFYLIRMEPNSPRKFHLNDVLLGTRVELEDDIGNTGFRL  721

Query  380  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  559
                G       Y+G   L+ E++L CRRFQ+T+ RVL +H++  L +AL  L+L DG A
Sbjct  722  EDHKGTIAVTLSYVGAFHLTQEEVLMCRRFQITLFRVLLDHSVENLMKALDGLHLSDGVA  781

Query  560  VIDYLLLPSSMDPSDVPKIDW  622
            V DYLL+PS+    +   IDW
Sbjct  782  V-DYLLVPSTYS-HETSLIDW  800



>ref|XP_010508779.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Camelina 
sativa]
 ref|XP_010508854.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Camelina 
sativa]
Length=1394

 Score =   108 bits (271),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 59/141 (42%), Positives = 79/141 (56%), Gaps = 2/141 (1%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  379
            QP YFPPELV      PQT Y  YLI +     ++  L +++L  R  LE D  N  F L
Sbjct  659  QPCYFPPELVSQFSAQPQTTYHFYLIRMEPNSPRKFHLNDVLLGTRVELEDDIGNTGFRL  718

Query  380  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  559
                G       Y+G   L+ E++L CRRFQ+T+ RVL +H++  L +AL  L+L DG A
Sbjct  719  EDHKGTIAVTLSYVGAFHLTQEEVLMCRRFQITLFRVLLDHSVENLMKALDGLHLSDGVA  778

Query  560  VIDYLLLPSSMDPSDVPKIDW  622
            V DYLL+PS+    +   IDW
Sbjct  779  V-DYLLVPSTYS-HETSLIDW  797



>ref|XP_010508629.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Camelina 
sativa]
 ref|XP_010508709.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Camelina 
sativa]
Length=1397

 Score =   108 bits (271),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 59/141 (42%), Positives = 79/141 (56%), Gaps = 2/141 (1%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  379
            QP YFPPELV      PQT Y  YLI +     ++  L +++L  R  LE D  N  F L
Sbjct  662  QPCYFPPELVSQFSAQPQTTYHFYLIRMEPNSPRKFHLNDVLLGTRVELEDDIGNTGFRL  721

Query  380  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  559
                G       Y+G   L+ E++L CRRFQ+T+ RVL +H++  L +AL  L+L DG A
Sbjct  722  EDHKGTIAVTLSYVGAFHLTQEEVLMCRRFQITLFRVLLDHSVENLMKALDGLHLSDGVA  781

Query  560  VIDYLLLPSSMDPSDVPKIDW  622
            V DYLL+PS+    +   IDW
Sbjct  782  V-DYLLVPSTYS-HETSLIDW  800



>ref|XP_002312197.1| hypothetical protein POPTR_0008s07580g [Populus trichocarpa]
 gb|EEE89564.1| hypothetical protein POPTR_0008s07580g [Populus trichocarpa]
Length=1468

 Score =   108 bits (270),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 61/142 (43%), Positives = 83/142 (58%), Gaps = 3/142 (2%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESD-DENLSFE  376
            QP Y PPELV       +T Y CYLIELN+ +     + +++L +RT LESD   ++ F+
Sbjct  709  QPIYLPPELVSRGPRNLKTKYYCYLIELNQNFAYDIPVHDVVLVVRTELESDVIRSMGFD  768

Query  377  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  556
            L  E G       YIGD+ L    +L CRRFQ+T+ +VL +H++N L E L  L+L  G 
Sbjct  769  LEAERGLLTVNLRYIGDIDLERVLVLLCRRFQITLFKVLLDHSVNKLKEVLEGLDLGSG-  827

Query  557  AVIDYLLLPSSMDPSDVPKIDW  622
            A IDY LLP+    S  P I+W
Sbjct  828  AEIDYFLLPAFRSCSQ-PSINW  848



>ref|XP_011015099.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X4 [Populus 
euphratica]
Length=1407

 Score =   107 bits (266),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 61/142 (43%), Positives = 79/142 (56%), Gaps = 3/142 (2%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD-ENLSFE  376
            QP Y PPEL        +T Y CYLIELN+ +     + +I+L +RT LESD   ++ FE
Sbjct  660  QPIYLPPELASQGPRNLKTKYYCYLIELNQKFDYGVPVHDIVLVMRTELESDVLSSMGFE  719

Query  377  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  556
            L +E G       YIGD+ L    +L CRRFQ+T+  VL    +N L+E L  L L  G 
Sbjct  720  LEVERGLLAVNLRYIGDIYLDQVPVLLCRRFQITLFEVLIHREVNKLEEVLKGLELGTG-  778

Query  557  AVIDYLLLPSSMDPSDVPKIDW  622
             V+DY LLP+    S  P IDW
Sbjct  779  VVMDYFLLPAIRSRSQ-PSIDW  799



>ref|XP_011015091.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X3 [Populus 
euphratica]
Length=1408

 Score =   107 bits (266),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 61/142 (43%), Positives = 79/142 (56%), Gaps = 3/142 (2%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD-ENLSFE  376
            QP Y PPEL        +T Y CYLIELN+ +     + +I+L +RT LESD   ++ FE
Sbjct  660  QPIYLPPELASQGPRNLKTKYYCYLIELNQKFDYGVPVHDIVLVMRTELESDVLSSMGFE  719

Query  377  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  556
            L +E G       YIGD+ L    +L CRRFQ+T+  VL    +N L+E L  L L  G 
Sbjct  720  LEVERGLLAVNLRYIGDIYLDQVPVLLCRRFQITLFEVLIHREVNKLEEVLKGLELGTG-  778

Query  557  AVIDYLLLPSSMDPSDVPKIDW  622
             V+DY LLP+    S  P IDW
Sbjct  779  VVMDYFLLPAIRSRSQ-PSIDW  799



>ref|XP_011015068.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Populus 
euphratica]
 ref|XP_011015076.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Populus 
euphratica]
 ref|XP_011015084.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Populus 
euphratica]
Length=1409

 Score =   107 bits (266),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 61/142 (43%), Positives = 79/142 (56%), Gaps = 3/142 (2%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD-ENLSFE  376
            QP Y PPEL        +T Y CYLIELN+ +     + +I+L +RT LESD   ++ FE
Sbjct  660  QPIYLPPELASQGPRNLKTKYYCYLIELNQKFDYGVPVHDIVLVMRTELESDVLSSMGFE  719

Query  377  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  556
            L +E G       YIGD+ L    +L CRRFQ+T+  VL    +N L+E L  L L  G 
Sbjct  720  LEVERGLLAVNLRYIGDIYLDQVPVLLCRRFQITLFEVLIHREVNKLEEVLKGLELGTG-  778

Query  557  AVIDYLLLPSSMDPSDVPKIDW  622
             V+DY LLP+    S  P IDW
Sbjct  779  VVMDYFLLPAIRSRSQ-PSIDW  799



>gb|ABF19798.1| dicer-like 2 spliceform 2 [Arabidopsis thaliana]
Length=1374

 Score =   107 bits (266),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 59/141 (42%), Positives = 79/141 (56%), Gaps = 2/141 (1%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  379
            QP YFPPELV      P+T Y  YLI +     +   L +++L  R  LE D  N SF L
Sbjct  644  QPCYFPPELVSQFSAQPETTYHFYLIRMKPNSPRNLHLNDVLLGTRVVLEDDIGNTSFRL  703

Query  380  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  559
                G       Y+G   L+ E++L CRRFQ+T+ RVL +H++  L EAL  L+L DG A
Sbjct  704  EDHRGTIAVTLSYVGAFHLTREEVLFCRRFQITLFRVLLDHSVENLMEALNGLHLRDGVA  763

Query  560  VIDYLLLPSSMDPSDVPKIDW  622
             +DYLL+PS+    +   IDW
Sbjct  764  -LDYLLVPSTHS-HETSLIDW  782



>gb|AAF26098.1|AC012328_1 unknown protein [Arabidopsis thaliana]
Length=2042

 Score =   107 bits (266),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 59/141 (42%), Positives = 79/141 (56%), Gaps = 2/141 (1%)
 Frame = +2

Query  200   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  379
             QP YFPPELV      P+T Y  YLI +     +   L +++L  R  LE D  N SF L
Sbjct  1312  QPCYFPPELVSQFSAQPETTYHFYLIRMKPNSPRNFHLNDVLLGTRVVLEDDIGNTSFRL  1371

Query  380   NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  559
                 G       Y+G   L+ E++L CRRFQ+T+ RVL +H++  L EAL  L+L DG A
Sbjct  1372  EDHRGTIAVTLSYVGAFHLTQEEVLFCRRFQITLFRVLLDHSVENLMEALNGLHLRDGVA  1431

Query  560   VIDYLLLPSSMDPSDVPKIDW  622
              +DYLL+PS+    +   IDW
Sbjct  1432  -LDYLLVPSTHS-HETSLIDW  1450



>gb|ABF19797.1| dicer-like 2 spliceform 1 [Arabidopsis thaliana]
Length=1386

 Score =   107 bits (266),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 59/141 (42%), Positives = 79/141 (56%), Gaps = 2/141 (1%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  379
            QP YFPPELV      P+T Y  YLI +     +   L +++L  R  LE D  N SF L
Sbjct  656  QPCYFPPELVSQFSAQPETTYHFYLIRMKPNSPRNLHLNDVLLGTRVVLEDDIGNTSFRL  715

Query  380  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  559
                G       Y+G   L+ E++L CRRFQ+T+ RVL +H++  L EAL  L+L DG A
Sbjct  716  EDHRGTIAVTLSYVGAFHLTREEVLFCRRFQITLFRVLLDHSVENLMEALNGLHLRDGVA  775

Query  560  VIDYLLLPSSMDPSDVPKIDW  622
             +DYLL+PS+    +   IDW
Sbjct  776  -LDYLLVPSTHS-HETSLIDW  794



>ref|NP_001078101.1| endoribonuclease Dicer-like 2 [Arabidopsis thaliana]
 gb|AEE73925.1| endoribonuclease Dicer-like 2 [Arabidopsis thaliana]
Length=1374

 Score =   107 bits (266),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 59/141 (42%), Positives = 79/141 (56%), Gaps = 2/141 (1%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  379
            QP YFPPELV      P+T Y  YLI +     +   L +++L  R  LE D  N SF L
Sbjct  644  QPCYFPPELVSQFSAQPETTYHFYLIRMKPNSPRNFHLNDVLLGTRVVLEDDIGNTSFRL  703

Query  380  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  559
                G       Y+G   L+ E++L CRRFQ+T+ RVL +H++  L EAL  L+L DG A
Sbjct  704  EDHRGTIAVTLSYVGAFHLTQEEVLFCRRFQITLFRVLLDHSVENLMEALNGLHLRDGVA  763

Query  560  VIDYLLLPSSMDPSDVPKIDW  622
             +DYLL+PS+    +   IDW
Sbjct  764  -LDYLLVPSTHS-HETSLIDW  782



>ref|NP_566199.4| endoribonuclease Dicer-like 2 [Arabidopsis thaliana]
 ref|NP_001189798.1| endoribonuclease Dicer-like 2 [Arabidopsis thaliana]
 sp|Q3EBC8.2|DCL2_ARATH RecName: Full=Endoribonuclease Dicer homolog 2; AltName: Full=Dicer-like 
protein 2; Short=AtDCL2 [Arabidopsis thaliana]
 gb|AEE73924.1| endoribonuclease Dicer-like 2 [Arabidopsis thaliana]
 gb|AEE73926.1| endoribonuclease Dicer-like 2 [Arabidopsis thaliana]
Length=1388

 Score =   106 bits (265),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 59/141 (42%), Positives = 79/141 (56%), Gaps = 2/141 (1%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  379
            QP YFPPELV      P+T Y  YLI +     +   L +++L  R  LE D  N SF L
Sbjct  658  QPCYFPPELVSQFSAQPETTYHFYLIRMKPNSPRNFHLNDVLLGTRVVLEDDIGNTSFRL  717

Query  380  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  559
                G       Y+G   L+ E++L CRRFQ+T+ RVL +H++  L EAL  L+L DG A
Sbjct  718  EDHRGTIAVTLSYVGAFHLTQEEVLFCRRFQITLFRVLLDHSVENLMEALNGLHLRDGVA  777

Query  560  VIDYLLLPSSMDPSDVPKIDW  622
             +DYLL+PS+    +   IDW
Sbjct  778  -LDYLLVPSTHS-HETSLIDW  796



>ref|XP_010549772.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010549773.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010549775.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Tarenaya 
hassleriana]
Length=1395

 Score =   106 bits (265),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 61/149 (41%), Positives = 83/149 (56%), Gaps = 4/149 (3%)
 Frame = +2

Query  179  PYQELGCQPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD  358
            PY +   QP YFPPEL+G      +T Y  YLI L  +Y     +Q+I+L  R  LE D 
Sbjct  651  PYSDE--QPCYFPPELIGHFLVESKTTYHFYLIGLKPWYPDDFHVQDILLGTRAELEDDI  708

Query  359  ENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  538
               SF+L ++GG       YIG   L+ E++  CRRFQ+T+LR L +HN  TL EAL  L
Sbjct  709  GTTSFKLGVKGGAITVTLKYIGVFHLTQEEVFLCRRFQITLLRTLLDHNPETLTEALDGL  768

Query  539  NLVDGSAVIDYLLLPSSMDPSDVPKIDWN  625
               +G   +D+LLLP++        I+WN
Sbjct  769  QCRNG-PTLDFLLLPANHG-HQTSHINWN  795



>ref|XP_002884369.1| hypothetical protein ARALYDRAFT_317213 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60628.1| hypothetical protein ARALYDRAFT_317213 [Arabidopsis lyrata subsp. 
lyrata]
Length=2033

 Score =   106 bits (265),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 59/141 (42%), Positives = 77/141 (55%), Gaps = 2/141 (1%)
 Frame = +2

Query  200   QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  379
             QP YFPPELV      P+T Y  YLI +     +   L +++L  R  LE D  N  F L
Sbjct  1303  QPCYFPPELVSQFSVQPETTYHFYLIRMKPSSQRNFHLNDVLLGTRVVLEDDIGNTGFRL  1362

Query  380   NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  559
                 G       Y+G   L+ E++L CRRFQ+T+ RVL +H++  L EAL  L L DG A
Sbjct  1363  EDHKGTIAVTLSYVGAFHLTQEEVLLCRRFQITLFRVLLDHSVKNLMEALNGLLLRDGIA  1422

Query  560   VIDYLLLPSSMDPSDVPKIDW  622
              +DYLL+PS+      P IDW
Sbjct  1423  -LDYLLVPSTHSHETSP-IDW  1441



>ref|XP_010549776.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Tarenaya 
hassleriana]
Length=1350

 Score =   106 bits (264),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 61/149 (41%), Positives = 83/149 (56%), Gaps = 4/149 (3%)
 Frame = +2

Query  179  PYQELGCQPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD  358
            PY +   QP YFPPEL+G      +T Y  YLI L  +Y     +Q+I+L  R  LE D 
Sbjct  606  PYSDE--QPCYFPPELIGHFLVESKTTYHFYLIGLKPWYPDDFHVQDILLGTRAELEDDI  663

Query  359  ENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  538
               SF+L ++GG       YIG   L+ E++  CRRFQ+T+LR L +HN  TL EAL  L
Sbjct  664  GTTSFKLGVKGGAITVTLKYIGVFHLTQEEVFLCRRFQITLLRTLLDHNPETLTEALDGL  723

Query  539  NLVDGSAVIDYLLLPSSMDPSDVPKIDWN  625
               +G   +D+LLLP++        I+WN
Sbjct  724  QCRNG-PTLDFLLLPANHG-HQTSHINWN  750



>ref|XP_008240740.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Prunus mume]
Length=804

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/144 (40%), Positives = 83/144 (58%), Gaps = 3/144 (2%)
 Frame = +2

Query  200  QPKYFPPELVGT-RDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  376
            QP Y PPELV     N    LY CYLI++   +     + +I+L +R+ L+ D  N++F+
Sbjct  59   QPSYVPPELVKPWCSNDASILYHCYLIQMKPNFCSDIPVNDIVLGMRSELDCDVANMNFD  118

Query  377  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  556
            L +  G          ++ LS+EQIL+CRRFQ+T+ R+L +HNL  L+E L RL++    
Sbjct  119  LGVGKGTITVNFKKAAEIHLSSEQILQCRRFQITIFRILMDHNLQKLEEVLERLSVGQNL  178

Query  557  AV--IDYLLLPSSMDPSDVPKIDW  622
             V  IDYLLLP++        IDW
Sbjct  179  EVESIDYLLLPAARMHQKPFIIDW  202



>ref|XP_011006570.1| PREDICTED: LOW QUALITY PROTEIN: endoribonuclease Dicer homolog 
2-like [Populus euphratica]
Length=1406

 Score =   105 bits (263),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 59/142 (42%), Positives = 82/142 (58%), Gaps = 3/142 (2%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESD-DENLSFE  376
            QP Y+PPELV       +T Y CYLIELN+ +     + +++L +RT LESD   ++ F+
Sbjct  660  QPIYWPPELVSQGPRNLKTKYYCYLIELNQNFAYDIPVHDVVLVMRTELESDVIRSMGFD  719

Query  377  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  556
            L  E G       YIGD+ L    +L CRRFQ+T+ +VL +H++N L E L  L+L  G 
Sbjct  720  LEAERGLLTVNLRYIGDIDLERVLVLLCRRFQITLFKVLLDHSVNKLKEVLEGLDLGSGF  779

Query  557  AVIDYLLLPSSMDPSDVPKIDW  622
              IDY LLP +      P I+W
Sbjct  780  E-IDYFLLP-AFRSCPQPSINW  799



>ref|XP_006480490.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X3 [Citrus 
sinensis]
 ref|XP_006480491.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X4 [Citrus 
sinensis]
 ref|XP_006480492.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X5 [Citrus 
sinensis]
Length=1401

 Score =   105 bits (263),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 56/141 (40%), Positives = 84/141 (60%), Gaps = 6/141 (4%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  379
             P YFPPELV       +  Y CYLIEL + +       +I+LA+RT LES+ + ++F+L
Sbjct  659  HPIYFPPELVNQCPQDTKITYHCYLIELKQNFNYDIPAHDIVLAVRTELESEIKKVNFDL  718

Query  380  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  559
             ++ G       ++G + L+ +++L CRRFQ+ + RV+ +HNL+ L+E L  L L D + 
Sbjct  719  EVDRGRLTVNLKHLGKIQLTPDKVLLCRRFQIALFRVIMDHNLDKLNEILKGLRLRD-NL  777

Query  560  VIDYLLLPSSMDPSDVPKIDW  622
             IDYLLLP+S        IDW
Sbjct  778  EIDYLLLPASEQ-----LIDW  793



>ref|XP_006480488.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006480489.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Citrus 
sinensis]
Length=1401

 Score =   105 bits (263),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 56/141 (40%), Positives = 84/141 (60%), Gaps = 6/141 (4%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  379
             P YFPPELV       +  Y CYLIEL + +       +I+LA+RT LES+ + ++F+L
Sbjct  659  HPIYFPPELVNQCPQDTKITYHCYLIELKQNFNYDIPAHDIVLAVRTELESEIKKVNFDL  718

Query  380  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  559
             ++ G       ++G + L+ +++L CRRFQ+ + RV+ +HNL+ L+E L  L L D + 
Sbjct  719  EVDRGRLTVNLKHLGKIQLTPDKVLLCRRFQIALFRVIMDHNLDKLNEILKGLRLRD-NL  777

Query  560  VIDYLLLPSSMDPSDVPKIDW  622
             IDYLLLP+S        IDW
Sbjct  778  EIDYLLLPASEQ-----LIDW  793



>ref|XP_006428678.1| hypothetical protein CICLE_v10010911mg [Citrus clementina]
 gb|ESR41918.1| hypothetical protein CICLE_v10010911mg [Citrus clementina]
Length=1401

 Score =   105 bits (263),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 56/141 (40%), Positives = 84/141 (60%), Gaps = 6/141 (4%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  379
             P YFPPELV       +  Y CYLIEL + +       +I+LA+RT LES+ + ++F+L
Sbjct  659  HPIYFPPELVNQCPQDTKITYHCYLIELKQNFNYDIPAHDIVLAVRTELESEIKKVNFDL  718

Query  380  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  559
             ++ G       ++G + L+ +++L CRRFQ+ + RV+ +HNL+ L+E L  L L D + 
Sbjct  719  EVDRGRLTVNLKHLGKIQLTPDKVLLCRRFQIALFRVIMDHNLDKLNEILKGLRLRD-NL  777

Query  560  VIDYLLLPSSMDPSDVPKIDW  622
             IDYLLLP+S        IDW
Sbjct  778  EIDYLLLPASEQ-----LIDW  793



>ref|XP_010485670.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X3 [Camelina 
sativa]
Length=1354

 Score =   105 bits (263),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 58/141 (41%), Positives = 78/141 (55%), Gaps = 2/141 (1%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  379
            QP YFPPELV      PQT Y  YLI +     ++  L +++L  R  LE D  N  F L
Sbjct  663  QPCYFPPELVSQFSAQPQTTYHFYLIRMAPNSPRKFHLNDVLLGTRVELEDDIGNTGFRL  722

Query  380  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  559
                G       Y+G   L+ E++L CRRFQ+T+ RVL + ++  L EAL  L+L DG A
Sbjct  723  EDHKGTIAVTLSYVGAFHLTQEEVLVCRRFQITLFRVLLDQSVENLMEALDGLHLRDGVA  782

Query  560  VIDYLLLPSSMDPSDVPKIDW  622
             +DYLL+PS+    +   IDW
Sbjct  783  -LDYLLVPSTYS-HETSLIDW  801



>ref|XP_010649216.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X3 [Vitis 
vinifera]
Length=1460

 Score =   105 bits (263),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 57/154 (37%), Positives = 90/154 (58%), Gaps = 7/154 (5%)
 Frame = +2

Query  164  QSDPPPYQELGCQPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTR  343
            Q +  PY +   Q  Y+PPEL+      P T Y CYLIEL++ Y      Q I+LA+R+ 
Sbjct  651  QDENMPYDDE--QATYYPPELINPSLKDPVTPYHCYLIELDQKYEYEVSPQGIVLAVRSE  708

Query  344  LESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDE  523
            LE D  N++F+L ++ G       Y+G + L+ EQ+L CR+FQ+T+LRVL +     +D+
Sbjct  709  LEYDVGNVNFDLQVDRGTMTVSMNYVGVIHLTAEQVLMCRKFQITLLRVLIDR---AIDK  765

Query  524  ALGRLNLVDGSAVIDYLLLPSSMDPSDVPKI-DW  622
             +     +    ++DYL+LPS+ +  ++P I DW
Sbjct  766  GVFDRYDLGNDQMVDYLMLPST-NSREIPSIVDW  798



>ref|XP_010649214.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Vitis 
vinifera]
Length=1468

 Score =   105 bits (262),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 57/154 (37%), Positives = 90/154 (58%), Gaps = 7/154 (5%)
 Frame = +2

Query  164  QSDPPPYQELGCQPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTR  343
            Q +  PY +   Q  Y+PPEL+      P T Y CYLIEL++ Y      Q I+LA+R+ 
Sbjct  659  QDENMPYDDE--QATYYPPELINPSLKDPVTPYHCYLIELDQKYEYEVSPQGIVLAVRSE  716

Query  344  LESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDE  523
            LE D  N++F+L ++ G       Y+G + L+ EQ+L CR+FQ+T+LRVL +     +D+
Sbjct  717  LEYDVGNVNFDLQVDRGTMTVSMNYVGVIHLTAEQVLMCRKFQITLLRVLIDR---AIDK  773

Query  524  ALGRLNLVDGSAVIDYLLLPSSMDPSDVPKI-DW  622
             +     +    ++DYL+LPS+ +  ++P I DW
Sbjct  774  GVFDRYDLGNDQMVDYLMLPST-NSREIPSIVDW  806



>ref|XP_010649215.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Vitis 
vinifera]
Length=1461

 Score =   105 bits (262),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 57/154 (37%), Positives = 90/154 (58%), Gaps = 7/154 (5%)
 Frame = +2

Query  164  QSDPPPYQELGCQPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTR  343
            Q +  PY +   Q  Y+PPEL+      P T Y CYLIEL++ Y      Q I+LA+R+ 
Sbjct  659  QDENMPYDDE--QATYYPPELINPSLKDPVTPYHCYLIELDQKYEYEVSPQGIVLAVRSE  716

Query  344  LESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDE  523
            LE D  N++F+L ++ G       Y+G + L+ EQ+L CR+FQ+T+LRVL +     +D+
Sbjct  717  LEYDVGNVNFDLQVDRGTMTVSMNYVGVIHLTAEQVLMCRKFQITLLRVLIDR---AIDK  773

Query  524  ALGRLNLVDGSAVIDYLLLPSSMDPSDVPKI-DW  622
             +     +    ++DYL+LPS+ +  ++P I DW
Sbjct  774  GVFDRYDLGNDQMVDYLMLPST-NSREIPSIVDW  806



>ref|XP_002315119.1| hypothetical protein POPTR_0010s18870g [Populus trichocarpa]
 gb|EEF01290.1| hypothetical protein POPTR_0010s18870g [Populus trichocarpa]
Length=1408

 Score =   105 bits (262),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 61/142 (43%), Positives = 78/142 (55%), Gaps = 3/142 (2%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD-ENLSFE  376
            QP Y PPEL        +T Y CYLIELN+ +     + +I+L +RT LESD   ++ FE
Sbjct  659  QPIYLPPELASQGPRNLKTKYYCYLIELNQKFDYGVPVHDIVLVMRTELESDVLSSMGFE  718

Query  377  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  556
            L  E G       YIGD+ L    +L CRRFQ+T+  VL    +N L+E L  L L  G 
Sbjct  719  LEAERGLLAVSLRYIGDIYLDQVPVLLCRRFQITLFEVLIHREVNKLEEVLKGLELGTG-  777

Query  557  AVIDYLLLPSSMDPSDVPKIDW  622
             V+DY LLP+    S  P IDW
Sbjct  778  VVMDYFLLPAIRSRSQ-PSIDW  798



>ref|XP_010485668.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Camelina 
sativa]
 ref|XP_010485669.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Camelina 
sativa]
Length=1395

 Score =   105 bits (262),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 58/141 (41%), Positives = 78/141 (55%), Gaps = 2/141 (1%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  379
            QP YFPPELV      PQT Y  YLI +     ++  L +++L  R  LE D  N  F L
Sbjct  660  QPCYFPPELVSQFSAQPQTTYHFYLIRMAPNSPRKFHLNDVLLGTRVELEDDIGNTGFRL  719

Query  380  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  559
                G       Y+G   L+ E++L CRRFQ+T+ RVL + ++  L EAL  L+L DG A
Sbjct  720  EDHKGTIAVTLSYVGAFHLTQEEVLVCRRFQITLFRVLLDQSVENLMEALDGLHLRDGVA  779

Query  560  VIDYLLLPSSMDPSDVPKIDW  622
             +DYLL+PS+    +   IDW
Sbjct  780  -LDYLLVPSTYS-HETSLIDW  798



>ref|XP_010485666.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010485667.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Camelina 
sativa]
Length=1398

 Score =   105 bits (262),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 58/141 (41%), Positives = 78/141 (55%), Gaps = 2/141 (1%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  379
            QP YFPPELV      PQT Y  YLI +     ++  L +++L  R  LE D  N  F L
Sbjct  663  QPCYFPPELVSQFSAQPQTTYHFYLIRMAPNSPRKFHLNDVLLGTRVELEDDIGNTGFRL  722

Query  380  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  559
                G       Y+G   L+ E++L CRRFQ+T+ RVL + ++  L EAL  L+L DG A
Sbjct  723  EDHKGTIAVTLSYVGAFHLTQEEVLVCRRFQITLFRVLLDQSVENLMEALDGLHLRDGVA  782

Query  560  VIDYLLLPSSMDPSDVPKIDW  622
             +DYLL+PS+    +   IDW
Sbjct  783  -LDYLLVPSTYS-HETSLIDW  801



>emb|CBI17597.3| unnamed protein product [Vitis vinifera]
Length=1340

 Score =   105 bits (262),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 57/154 (37%), Positives = 90/154 (58%), Gaps = 7/154 (5%)
 Frame = +2

Query  164  QSDPPPYQELGCQPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTR  343
            Q +  PY +   Q  Y+PPEL+      P T Y CYLIEL++ Y      Q I+LA+R+ 
Sbjct  596  QDENMPYDDE--QATYYPPELINPSLKDPVTPYHCYLIELDQKYEYEVSPQGIVLAVRSE  653

Query  344  LESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDE  523
            LE D  N++F+L ++ G       Y+G + L+ EQ+L CR+FQ+T+LRVL +     +D+
Sbjct  654  LEYDVGNVNFDLQVDRGTMTVSMNYVGVIHLTAEQVLMCRKFQITLLRVLIDR---AIDK  710

Query  524  ALGRLNLVDGSAVIDYLLLPSSMDPSDVPKI-DW  622
             +     +    ++DYL+LPS+ +  ++P I DW
Sbjct  711  GVFDRYDLGNDQMVDYLMLPST-NSREIPSIVDW  743



>ref|XP_010649218.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X4 [Vitis 
vinifera]
Length=1405

 Score =   105 bits (262),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 57/154 (37%), Positives = 90/154 (58%), Gaps = 7/154 (5%)
 Frame = +2

Query  164  QSDPPPYQELGCQPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTR  343
            Q +  PY +   Q  Y+PPEL+      P T Y CYLIEL++ Y      Q I+LA+R+ 
Sbjct  659  QDENMPYDDE--QATYYPPELINPSLKDPVTPYHCYLIELDQKYEYEVSPQGIVLAVRSE  716

Query  344  LESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDE  523
            LE D  N++F+L ++ G       Y+G + L+ EQ+L CR+FQ+T+LRVL +     +D+
Sbjct  717  LEYDVGNVNFDLQVDRGTMTVSMNYVGVIHLTAEQVLMCRKFQITLLRVLIDR---AIDK  773

Query  524  ALGRLNLVDGSAVIDYLLLPSSMDPSDVPKI-DW  622
             +     +    ++DYL+LPS+ +  ++P I DW
Sbjct  774  GVFDRYDLGNDQMVDYLMLPST-NSREIPSIVDW  806



>gb|KJB14793.1| hypothetical protein B456_002G143000 [Gossypium raimondii]
Length=1393

 Score =   105 bits (261),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 63/174 (36%), Positives = 93/174 (53%), Gaps = 12/174 (7%)
 Frame = +2

Query  101  DIVLDVWMQRFDMATTGSTGLQSDPPPYQELGCQPKYFPPELVGTRDNAPQTLYSCYLIE  280
            ++V D+ ++  D    G      D         QP +FPPELV        T Y CYL+E
Sbjct  635  NLVPDIVVEENDAEEIGKESYNDD---------QPIFFPPELVNQDSQESMTKYYCYLME  685

Query  281  LNRYYYKRTQLQNIILALRTRLESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRC  460
            L + +     +QNIIL +R++LE + +++  EL ++ G       YIG + LS++Q++ C
Sbjct  686  LKQNFGYEFPVQNIILLVRSQLEMEAKSVGIELEVDRGTLTVNLKYIGLIRLSSDQVILC  745

Query  461  RRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSAVIDYLLLPSSMDPSDVPKIDW  622
            RRFQ+ + RVL +H    L E L  L   + S  IDYLLLPS+    + P IDW
Sbjct  746  RRFQIALFRVLMDHKAEKLTE-LSDLTSGNNSE-IDYLLLPSNYMGQN-PVIDW  796



>gb|KDO45679.1| hypothetical protein CISIN_1g0030621mg, partial [Citrus sinensis]
Length=506

 Score =   102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 83/141 (59%), Gaps = 6/141 (4%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  379
             P YFPPELV       +  Y CYLIEL + +       +I+LA+RT LES+ + ++F+L
Sbjct  115  HPIYFPPELVNQCPQDTKITYHCYLIELKQNFNYDIPAHDIVLAVRTELESEIKKVNFDL  174

Query  380  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  559
             ++ G       ++G + L+ +++L CRRFQ+ + RV+ +HNL+ L+E L  L L D   
Sbjct  175  EVDRGRLTVNLKHLGKIQLTPDKVLLCRRFQIALFRVIMDHNLDKLNEILKGLWLRDNLE  234

Query  560  VIDYLLLPSSMDPSDVPKIDW  622
             IDYLLLP+S        IDW
Sbjct  235  -IDYLLLPASEQ-----SIDW  249



>ref|XP_007217819.1| hypothetical protein PRUPE_ppa027063mg, partial [Prunus persica]
 gb|EMJ19018.1| hypothetical protein PRUPE_ppa027063mg, partial [Prunus persica]
Length=758

 Score =   103 bits (257),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 58/151 (38%), Positives = 85/151 (56%), Gaps = 5/151 (3%)
 Frame = +2

Query  179  PYQELGCQPKYFPPELVGTR-DNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESD  355
            PY +   QP Y PPELV     N    LY CYLI++   +     + +I+L +R+ L+ D
Sbjct  8    PYDDQ--QPSYVPPELVKPWCSNDASVLYHCYLIQMKPNFCSDIPVNDIVLGMRSELDCD  65

Query  356  DENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGR  535
              N++F+L +             ++ LS+EQIL+CRRFQ+T+ R+L +HNL  L+E L R
Sbjct  66   VANMNFDLGVGKSTITVNFKKAAEIHLSSEQILQCRRFQITIFRILMDHNLQKLEEVLER  125

Query  536  LNLVDGSAV--IDYLLLPSSMDPSDVPKIDW  622
            L++     V  IDYLLLP++        IDW
Sbjct  126  LSVGQNLEVESIDYLLLPAARMHQRPFIIDW  156



>ref|XP_011466081.1| PREDICTED: endoribonuclease Dicer homolog 2 [Fragaria vesca subsp. 
vesca]
Length=1397

 Score =   103 bits (258),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 59/154 (38%), Positives = 84/154 (55%), Gaps = 5/154 (3%)
 Frame = +2

Query  164  QSDPPPYQELGCQPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTR  343
            +S+  PY E   Q  Y P ELV         LY CYLIEL++ +     + + +L +R++
Sbjct  649  ESEHAPYDEE--QSSYVPIELVKPSSAGTSILYHCYLIELDQKFGYEIPVNDFVLGVRSQ  706

Query  344  LESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDE  523
            L+ D  NL FEL    G+      Y G++ L +EQ+L CRRFQ+T+ R+L +HNL+ L E
Sbjct  707  LDRDISNLHFELEFGRGSLSVNFKYAGEMHLDSEQVLLCRRFQITIFRILMDHNLDKLKE  766

Query  524  ALGRLNLVDGSAV-IDYLLLPSSMDPSDVPKIDW  622
            AL    L  G  +  DYL+LP  +       IDW
Sbjct  767  ALD--GLCSGENLGFDYLMLPGIIIHKRPSMIDW  798



>gb|KHG30500.1| hypothetical protein F383_12835 [Gossypium arboreum]
Length=1290

 Score =   102 bits (255),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 64/174 (37%), Positives = 89/174 (51%), Gaps = 14/174 (8%)
 Frame = +2

Query  101  DIVLDVWMQRFDMATTGSTGLQSDPPPYQELGCQPKYFPPELVGTRDNAPQTLYSCYLIE  280
            ++V D+ ++  D    G      D         QP +FPPELV        T Y CYL+E
Sbjct  686  NLVPDIVVEENDAEEIGKESYNDD---------QPIFFPPELVNQDSQESMTKYYCYLME  736

Query  281  LNRYYYKRTQLQNIILALRTRLESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRC  460
            L + +     + NIIL +R++LE   E  S EL ++ G       YIG + LS++Q++ C
Sbjct  737  LKQNFGYEIPVHNIILLVRSQLEM--EAKSIELEVDRGTLTVNLKYIGLIRLSSDQVILC  794

Query  461  RRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSAVIDYLLLPSSMDPSDVPKIDW  622
            RRFQ+ + RVL +H    L E L  L   + S  IDYLLLPS+      P IDW
Sbjct  795  RRFQIALFRVLMDHKAEKLTELLSDLTSGNNSE-IDYLLLPSNY--MGQPVIDW  845



>gb|KHG30499.1| hypothetical protein F383_12835 [Gossypium arboreum]
Length=1358

 Score =   102 bits (255),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 64/174 (37%), Positives = 89/174 (51%), Gaps = 14/174 (8%)
 Frame = +2

Query  101  DIVLDVWMQRFDMATTGSTGLQSDPPPYQELGCQPKYFPPELVGTRDNAPQTLYSCYLIE  280
            ++V D+ ++  D    G      D         QP +FPPELV        T Y CYL+E
Sbjct  686  NLVPDIVVEENDAEEIGKESYNDD---------QPIFFPPELVNQDSQESMTKYYCYLME  736

Query  281  LNRYYYKRTQLQNIILALRTRLESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRC  460
            L + +     + NIIL +R++LE   E  S EL ++ G       YIG + LS++Q++ C
Sbjct  737  LKQNFGYEIPVHNIILLVRSQLEM--EAKSIELEVDRGTLTVNLKYIGLIRLSSDQVILC  794

Query  461  RRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSAVIDYLLLPSSMDPSDVPKIDW  622
            RRFQ+ + RVL +H    L E L  L   + S  IDYLLLPS+      P IDW
Sbjct  795  RRFQIALFRVLMDHKAEKLTELLSDLTSGNNSE-IDYLLLPSNY--MGQPVIDW  845



>ref|XP_007216896.1| hypothetical protein PRUPE_ppa019601mg, partial [Prunus persica]
 gb|EMJ18095.1| hypothetical protein PRUPE_ppa019601mg, partial [Prunus persica]
Length=806

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 93/180 (52%), Gaps = 14/180 (8%)
 Frame = +2

Query  122  MQRFDMATTGSTGLQSDP----PPYQELGC------QPKYFPPELVGT-RDNAPQTLYSC  268
            M+  DM   G T   +DP       QELG       QP Y P ELV     N    LY C
Sbjct  2    MEPIDMEIDG-TQQSADPLVVEEATQELGSEPYDDEQPSYVPAELVKPWCSNDASVLYHC  60

Query  269  YLIELNRYYYKRTQLQNIILALRTRLESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQ  448
            YLIE+ + +     + N++L LR+ L  D  N++F+L ++ G          ++ LS EQ
Sbjct  61   YLIEMKQNFCSYIPVNNVVLGLRSELNCDIANMNFDLVVDKGTITVNFKKATEIHLSPEQ  120

Query  449  ILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVD--GSAVIDYLLLPSSMDPSDVPKIDW  622
            +L+CRRFQ+T+ R+L + NL  L E L RL+L    G   I+YLLLP++        IDW
Sbjct  121  VLQCRRFQITIFRILVDCNLQNLKEVLERLSLGQNIGVESINYLLLPAARMHQKPLIIDW  180



>ref|XP_007029209.1| Dicer-like protein isoform 2 [Theobroma cacao]
 gb|EOY09711.1| Dicer-like protein isoform 2 [Theobroma cacao]
Length=1307

 Score =   101 bits (252),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 57/148 (39%), Positives = 85/148 (57%), Gaps = 4/148 (3%)
 Frame = +2

Query  179  PYQELGCQPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD  358
            PY +   QP +FPPELV   ++     Y CYLIEL + +     + NI+L +R++LE D+
Sbjct  563  PYND--DQPIFFPPELVNQCEHEDMKKYYCYLIELKQNFDYEFPVHNIMLLVRSQLEIDN  620

Query  359  ENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  538
            +++ FEL ++ G       Y+G + L   Q++  +RFQ+ V RVL +H +  L E LG  
Sbjct  621  KSMGFELEVDRGFLTVNLKYVGLIRLDPSQVILSKRFQIAVFRVLMDHKVEKLTEVLGDP  680

Query  539  NLVDGSAVIDYLLLPSSMDPSDVPKIDW  622
               + S  IDYLLLPS+    + P IDW
Sbjct  681  RSGNNSD-IDYLLLPSTYLGQN-PVIDW  706



>ref|XP_007029211.1| Dicer-like protein isoform 4, partial [Theobroma cacao]
 gb|EOY09713.1| Dicer-like protein isoform 4, partial [Theobroma cacao]
Length=970

 Score =   101 bits (251),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 55/141 (39%), Positives = 82/141 (58%), Gaps = 2/141 (1%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  379
            QP +FPPELV   ++     Y CYLIEL + +     + NI+L +R++LE D++++ FEL
Sbjct  642  QPIFFPPELVNQCEHEDMKKYYCYLIELKQNFDYEFPVHNIMLLVRSQLEIDNKSMGFEL  701

Query  380  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  559
             ++ G       Y+G + L   Q++  +RFQ+ V RVL +H +  L E LG     + S 
Sbjct  702  EVDRGFLTVNLKYVGLIRLDPSQVILSKRFQIAVFRVLMDHKVEKLTEVLGDPRSGNNSD  761

Query  560  VIDYLLLPSSMDPSDVPKIDW  622
             IDYLLLPS+    + P IDW
Sbjct  762  -IDYLLLPSTYLGQN-PVIDW  780



>ref|XP_007029208.1| Dicer-like protein isoform 1 [Theobroma cacao]
 gb|EOY09710.1| Dicer-like protein isoform 1 [Theobroma cacao]
Length=1418

 Score =   101 bits (252),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 57/148 (39%), Positives = 85/148 (57%), Gaps = 4/148 (3%)
 Frame = +2

Query  179  PYQELGCQPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD  358
            PY +   QP +FPPELV   ++     Y CYLIEL + +     + NI+L +R++LE D+
Sbjct  674  PYND--DQPIFFPPELVNQCEHEDMKKYYCYLIELKQNFDYEFPVHNIMLLVRSQLEIDN  731

Query  359  ENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  538
            +++ FEL ++ G       Y+G + L   Q++  +RFQ+ V RVL +H +  L E LG  
Sbjct  732  KSMGFELEVDRGFLTVNLKYVGLIRLDPSQVILSKRFQIAVFRVLMDHKVEKLTEVLGDP  791

Query  539  NLVDGSAVIDYLLLPSSMDPSDVPKIDW  622
               + S  IDYLLLPS+    + P IDW
Sbjct  792  RSGNNSD-IDYLLLPSTYLGQN-PVIDW  817



>emb|CAN77284.1| hypothetical protein VITISV_043738 [Vitis vinifera]
Length=1296

 Score =   101 bits (252),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 85/143 (59%), Gaps = 5/143 (3%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  379
            Q  Y+PPEL+      P T Y CYLIEL++ Y      Q I+LA+R+ LE D  N++F+L
Sbjct  562  QATYYPPELINPSLKDPVTPYHCYLIELBQKYEYEVSPQGIVLAVRSELEYDVGNVNFDL  621

Query  380  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  559
             ++ G       Y+G + L+ EQ+L CR+FQ+T+LRVL +     +D+ +     +    
Sbjct  622  QVDRGTMTVSMNYVGVIHLTAEQVLMCRKFQITLLRVLID---RAIDKGVFDRYDLGNDQ  678

Query  560  VIDYLLLPSSMDPSDVPKI-DWN  625
            ++DYL+LPS+ +  ++P I DW 
Sbjct  679  MVDYLMLPST-NSREIPSIVDWK  700



>ref|XP_007029213.1| Dicer-like protein isoform 6 [Theobroma cacao]
 gb|EOY09715.1| Dicer-like protein isoform 6 [Theobroma cacao]
Length=1114

 Score =   101 bits (251),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 55/141 (39%), Positives = 82/141 (58%), Gaps = 2/141 (1%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  379
            QP +FPPELV   ++     Y CYLIEL + +     + NI+L +R++LE D++++ FEL
Sbjct  375  QPIFFPPELVNQCEHEDMKKYYCYLIELKQNFDYEFPVHNIMLLVRSQLEIDNKSMGFEL  434

Query  380  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  559
             ++ G       Y+G + L   Q++  +RFQ+ V RVL +H +  L E LG     + S 
Sbjct  435  EVDRGFLTVNLKYVGLIRLDPSQVILSKRFQIAVFRVLMDHKVEKLTEVLGDPRSGNNSD  494

Query  560  VIDYLLLPSSMDPSDVPKIDW  622
             IDYLLLPS+    + P IDW
Sbjct  495  -IDYLLLPSTYLGQN-PVIDW  513



>emb|CDY50692.1| BnaC05g47910D [Brassica napus]
Length=1389

 Score =   101 bits (252),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 56/141 (40%), Positives = 76/141 (54%), Gaps = 2/141 (1%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  379
            QP YFPPELV       QT Y  Y I +   +      ++I+L  R +LE D  N  F L
Sbjct  654  QPSYFPPELVSQFSALSQTTYHLYSIRMKSEFPGNLHFKDILLGTRVKLEDDIGNTCFRL  713

Query  380  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  559
                G       Y+G   L+ ++IL CRRFQ+T+ RVL +H++  L  AL  L+L DG A
Sbjct  714  EDHLGTIAVTLSYVGAFDLAQDEILLCRRFQITLFRVLLDHSVENLVAALDGLHLRDGLA  773

Query  560  VIDYLLLPSSMDPSDVPKIDW  622
             +DYLL+PS+ +      IDW
Sbjct  774  -LDYLLVPSTHE-QKASLIDW  792



>emb|CDO96789.1| unnamed protein product [Coffea canephora]
Length=801

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 83/141 (59%), Gaps = 3/141 (2%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  379
            Q +Y P ELVG   N  + LY CYLI L   +   T   +I+LA  TRLE D E L FEL
Sbjct  26   QMQYVPRELVGRPGNDSEILYHCYLIALQPDFSCNTMPHDILLA--TRLEFDAETLDFEL  83

Query  380  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  559
            ++  G+   +  Y+  + L++E++L C++FQVT+ R+L + N N L EAL   N     A
Sbjct  84   DVPRGSLKIRMKYVRHIKLTSEEVLLCQKFQVTLFRLLIDQNQNKLQEALSGSNENIEHA  143

Query  560  VIDYLLLPSSMDPSDVPKIDW  622
             +DYLL+PS+    + P IDW
Sbjct  144  FLDYLLIPSTGSREN-PSIDW  163



>ref|XP_008392375.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Malus domestica]
Length=731

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 85/145 (59%), Gaps = 10/145 (7%)
 Frame = +2

Query  185  QELG---C---QPKYFPPELVGT-RDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTR  343
            QELG   C   QP+Y P ELV     N    +Y CYLI+L +       + +I+LA R +
Sbjct  19   QELGREPCDDEQPRYVPTELVKPPCSNDASVMYHCYLIKLKQNIDCDIPVSDIVLATRNK  78

Query  344  LESDD-ENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLD  520
            L+ D   N++FEL ++ G       Y GDV L +EQ+L CRRFQ+T+ R+L +H L  L+
Sbjct  79   LDCDTIANMNFELQVQRGPLAVNFKYAGDVNLCSEQVLVCRRFQITIFRILVDHELTKLE  138

Query  521  EALGRLNLVD--GSAVIDYLLLPSS  589
            + L R +L    G+  IDYLLLP++
Sbjct  139  KVLERFHLGQNYGTESIDYLLLPAA  163



>ref|XP_003535104.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Glycine 
max]
 ref|XP_006586845.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Glycine 
max]
 gb|KHN23015.1| Endoribonuclease Dicer like 2 [Glycine soja]
Length=1414

 Score =   100 bits (248),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 58/174 (33%), Positives = 92/174 (53%), Gaps = 11/174 (6%)
 Frame = +2

Query  101  DIVLDVWMQRFDMATTGSTGLQSDPPPYQELGCQPKYFPPELVGTRDNAPQTLYSCYLIE  280
            ++V D+ M+  ++   G+        PY E   QP + P  LV +  N  QT+Y CY +E
Sbjct  634  NLVPDIVMEEAEVEELGNE-------PYDE--NQPTFVPFGLVNSVSNNSQTVYHCYFME  684

Query  281  LNRYYYKRTQLQNIILALRTRLESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRC  460
             N  +     +Q+I L +R  L+ +   + F++  + G+      Y G + LS +Q+L C
Sbjct  685  FNNKFSYDVSVQDIFLLMRIELDPEIGCMQFDMGFDRGSLSVNFRYKGTINLSPDQVLLC  744

Query  461  RRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSAVIDYLLLPSSMDPSDVPKIDW  622
            ++FQVT+LR+L +H++N L   L R  L D    IDYLLLP +M       I+W
Sbjct  745  KKFQVTILRILIDHDMNKLTAGLDRCYLED-DLEIDYLLLP-AMGKGKYTAINW  796



>ref|XP_008351646.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Malus domestica]
Length=730

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 80/134 (60%), Gaps = 4/134 (3%)
 Frame = +2

Query  200  QPKYFPPELVGT-RDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD-ENLSF  373
            QP+Y P ELV     N    +Y CYLI+L +       + +I+LA R +L+ D   N++F
Sbjct  29   QPRYVPTELVKPPCSNDASVMYHCYLIKLKQNIDCDIPVSDIVLATRNKLDCDTIANMNF  88

Query  374  ELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVD-  550
            EL ++ G       Y GDV L +EQ+L CRRFQ+T+ R+L +H L  L++ L R +L   
Sbjct  89   ELQVQRGPLAVNFKYAGDVNLCSEQVLVCRRFQITIFRILVDHELTKLEKVLERFHLGQN  148

Query  551  -GSAVIDYLLLPSS  589
             G+  IDYLLLP++
Sbjct  149  YGTESIDYLLLPAA  162



>emb|CDY43132.1| BnaA05g32540D [Brassica napus]
Length=1388

 Score =   100 bits (248),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 54/141 (38%), Positives = 76/141 (54%), Gaps = 2/141 (1%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  379
            QP YFPPELV       QT Y  Y I +   +      ++++L  R +LE D  N  F L
Sbjct  654  QPSYFPPELVSQFSALSQTTYHFYSIRMKSEFPGNLHFKDVLLGTRVKLEDDIGNTCFRL  713

Query  380  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  559
                G       Y+G   L+ +++L CRRFQ+T+ RVL +H++  L  AL  L+L DG A
Sbjct  714  EDHLGTIAVTLSYVGGFDLTQDEVLLCRRFQITLFRVLLDHSVENLLAALDGLHLRDGPA  773

Query  560  VIDYLLLPSSMDPSDVPKIDW  622
             +DYLL+PS+ +      IDW
Sbjct  774  -LDYLLVPSTHE-QKASLIDW  792



>ref|XP_009130358.1| PREDICTED: endoribonuclease Dicer homolog 2 [Brassica rapa]
 ref|XP_009130359.1| PREDICTED: endoribonuclease Dicer homolog 2 [Brassica rapa]
Length=1388

 Score =   100 bits (248),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 54/141 (38%), Positives = 76/141 (54%), Gaps = 2/141 (1%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  379
            QP YFPPELV       QT Y  Y I +   +      ++++L  R +LE D  N  F L
Sbjct  654  QPSYFPPELVSQFSALSQTTYHFYSIRMKSEFPGNLHFKDVLLGTRVKLEDDIGNTCFRL  713

Query  380  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  559
                G       Y+G   L+ +++L CRRFQ+T+ RVL +H++  L  AL  L+L DG A
Sbjct  714  EDHLGTIAVTLSYVGGFDLTQDEVLLCRRFQITLFRVLLDHSVENLLAALDGLHLRDGPA  773

Query  560  VIDYLLLPSSMDPSDVPKIDW  622
             +DYLL+PS+ +      IDW
Sbjct  774  -LDYLLVPSTHE-QKASLIDW  792



>gb|KFK39865.1| hypothetical protein AALP_AA3G298800 [Arabis alpina]
Length=986

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 74/141 (52%), Gaps = 2/141 (1%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  379
            QP Y PPELV      PQT Y  Y I +     +  + + I L  R  LE D  N  F L
Sbjct  436  QPCYLPPELVSQFSAEPQTTYHMYSIRMKPSSSRDIKFKEIFLGTRVELEDDLGNTGFRL  495

Query  380  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  559
                G       Y+G   L+ E++L CRRFQ+T+ RVL +H++  L EAL  L L DG A
Sbjct  496  EDHKGTVAVTLSYVGAFHLTQEEVLLCRRFQITLFRVLLDHSVENLVEALDGLQLRDGVA  555

Query  560  VIDYLLLPSSMDPSDVPKIDW  622
             +DYLL+PS++       IDW
Sbjct  556  -LDYLLVPSTLSLG-TSLIDW  574



>ref|XP_006408318.1| hypothetical protein EUTSA_v10019898mg [Eutrema salsugineum]
 gb|ESQ49771.1| hypothetical protein EUTSA_v10019898mg [Eutrema salsugineum]
Length=1390

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 54/142 (38%), Positives = 79/142 (56%), Gaps = 2/142 (1%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  379
            QP Y PPELV       QT Y  YLI +     +  Q  +I L  RT LE D  +  F+L
Sbjct  656  QPCYLPPELVSQFSGQSQTTYHLYLIRMKPDSRRNFQFNDIFLGTRTELEDDIGSTCFQL  715

Query  380  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  559
                G       Y+G    + E++L CR+FQ+T+ RVL +H++  L EAL  L+L DG A
Sbjct  716  EDHHGTIAVTLSYVGAFDFTQEEVLLCRKFQITLFRVLLDHSVENLMEALDGLHLRDGVA  775

Query  560  VIDYLLLPSSMDPSDVPKIDWN  625
             +DYLL+P++ + ++   I+W+
Sbjct  776  -LDYLLVPATPE-NETSLINWD  795



>gb|EYU39730.1| hypothetical protein MIMGU_mgv1a0003142mg, partial [Erythranthe 
guttata]
Length=1143

 Score = 99.0 bits (245),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 91/153 (59%), Gaps = 7/153 (5%)
 Frame = +2

Query  185  QELGCQP------KYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRL  346
            +ELG +P      KYFPPEL+G+     +T Y CYLIEL   +    QLQ ++LA+  RL
Sbjct  394  KELGSEPYIDEHAKYFPPELIGSCRKESKTHYHCYLIELKANFQYDVQLQEVVLAVHERL  453

Query  347  ESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEA  526
            + D E ++ +L+++ G  +    +IG + L +EQ+  CRRFQ+T+ R+L +H L+ L E 
Sbjct  454  DDDIEKVNLDLDVDRGKIIVGIKHIGYISLDSEQVALCRRFQITLFRLLLDHKLDKLYEE  513

Query  527  LGRLNLVDGSAVIDYLLLPSSMDPSDVPKIDWN  625
              + +    S++ +YLLLP+   P +   IDW 
Sbjct  514  DNQSSEKIDSSIFNYLLLPTIGSPHNT-SIDWK  545



>ref|XP_007216887.1| hypothetical protein PRUPE_ppa020875mg, partial [Prunus persica]
 gb|EMJ18086.1| hypothetical protein PRUPE_ppa020875mg, partial [Prunus persica]
Length=752

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 79/144 (55%), Gaps = 3/144 (2%)
 Frame = +2

Query  200  QPKYFPPELVGT-RDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  376
            QP Y P ELV     N    LY CYLI++   +     + +I+L +R+ L+ D  N++F+
Sbjct  8    QPSYVPAELVKPWCSNDASALYHCYLIQMKPNFCYDIPVNDIVLGMRSELDCDIANMTFD  67

Query  377  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVD--  550
            L +  G          ++ LS+EQ+L+CRRFQ+T+ R+L +H L  L + L RL L    
Sbjct  68   LEVGRGTITVNFKKAAEIHLSSEQVLQCRRFQITIFRILLDHELPNLGKVLERLCLGQNL  127

Query  551  GSAVIDYLLLPSSMDPSDVPKIDW  622
            G   IDYLLLP++        IDW
Sbjct  128  GIESIDYLLLPAARMHQRPSIIDW  151



>ref|XP_008373031.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Malus 
domestica]
Length=665

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 77/133 (58%), Gaps = 4/133 (3%)
 Frame = +2

Query  200  QPKYFPPELVGT-RDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD-ENLSF  373
            QP+Y P ELV     N    +Y CYLIEL   +     + +I+L +R  L+ D   N++F
Sbjct  32   QPRYVPIELVKPPCSNDASVMYHCYLIELKPNFDCDIPVSDIVLGMRNELDCDTIANMNF  91

Query  374  ELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDG  553
            EL ++ G       + GDV LS+EQ+L CRRFQ+T+ ++L +H L  L+E L R  L   
Sbjct  92   ELQVQRGPLTVNFKHAGDVSLSSEQVLACRRFQITIFKILVDHKLKKLEEVLERFCLGQN  151

Query  554  --SAVIDYLLLPS  586
              +  IDYLLLP+
Sbjct  152  HWTESIDYLLLPA  164



>gb|ACE60552.1| dicer-like protein 2 [Brassica rapa]
Length=1392

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 56/142 (39%), Positives = 78/142 (55%), Gaps = 4/142 (3%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  379
            Q  YFPPELV       QT Y  Y I +   + +     +I+L  R  LE+D  N  F L
Sbjct  657  QSSYFPPELVSQFSAHSQTTYHFYSIRMKSEFPRNLHFNDILLGTRVELEADIGNTCFRL  716

Query  380  NIEGGNWVGQTV-YIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  556
                G  +G T+ Y+G   L+  ++L CRRFQ+T+ RVL +H++  L  AL  L+L DG 
Sbjct  717  EDHLGT-IGVTLSYVGAFDLTQNEVLLCRRFQITLFRVLLDHSVENLAAALDGLHLRDGV  775

Query  557  AVIDYLLLPSSMDPSDVPKIDW  622
            A +DYLL+PS+ +      IDW
Sbjct  776  A-LDYLLVPSTHE-QKASLIDW  795



>ref|XP_008373030.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Malus 
domestica]
Length=776

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 77/133 (58%), Gaps = 4/133 (3%)
 Frame = +2

Query  200  QPKYFPPELVGT-RDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD-ENLSF  373
            QP+Y P ELV     N    +Y CYLIEL   +     + +I+L +R  L+ D   N++F
Sbjct  32   QPRYVPIELVKPPCSNDASVMYHCYLIELKPNFDCDIPVSDIVLGMRNELDCDTIANMNF  91

Query  374  ELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDG  553
            EL ++ G       + GDV LS+EQ+L CRRFQ+T+ ++L +H L  L+E L R  L   
Sbjct  92   ELQVQRGPLTVNFKHAGDVSLSSEQVLACRRFQITIFKILVDHKLKKLEEVLERFCLGQN  151

Query  554  --SAVIDYLLLPS  586
              +  IDYLLLP+
Sbjct  152  HWTESIDYLLLPA  164



>ref|XP_009348591.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Pyrus 
x bretschneideri]
Length=581

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 75/132 (57%), Gaps = 4/132 (3%)
 Frame = +2

Query  200  QPKYFPPELVGT-RDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD-ENLSF  373
            QP+Y P ELV     N    +Y CYLIEL   +     + +I+L  R  L+ D   N++F
Sbjct  32   QPRYVPIELVKPPCSNDASVMYHCYLIELKPNFDCDIPVSDIVLGTRNELDCDTVANMNF  91

Query  374  ELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDG  553
            EL ++GG       + GDV LS+EQ+L CRRFQ+T+ ++L +  L  LDE L R  L   
Sbjct  92   ELQVQGGPLTVNFKHAGDVSLSSEQVLACRRFQITIFKILVDCKLKKLDEVLERFCLGQN  151

Query  554  --SAVIDYLLLP  583
              +  IDYLLLP
Sbjct  152  HRTESIDYLLLP  163



>ref|XP_008240779.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Prunus mume]
Length=781

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 79/144 (55%), Gaps = 3/144 (2%)
 Frame = +2

Query  200  QPKYFPPELVGT-RDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  376
            QP Y P ELV     N    LY CYLIE+   +     + +I+L +R+ L+ D  N++F+
Sbjct  37   QPSYVPAELVKPWCSNDASALYHCYLIEMKPNFCYDIPVNDIVLGMRSELDCDIANMTFD  96

Query  377  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVD--  550
            L +  G          ++ LS+EQ+L+CRRFQ+T+  +L +H L  L + L RL L    
Sbjct  97   LEVGRGTITVNFKKAAEIHLSSEQVLQCRRFQITIFGILLDHELPNLGKVLERLCLGQNL  156

Query  551  GSAVIDYLLLPSSMDPSDVPKIDW  622
            G+  IDYLLLP++        IDW
Sbjct  157  GNESIDYLLLPAARMHQRPSIIDW  180



>ref|XP_009348590.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Pyrus 
x bretschneideri]
Length=775

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 75/132 (57%), Gaps = 4/132 (3%)
 Frame = +2

Query  200  QPKYFPPELVGT-RDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD-ENLSF  373
            QP+Y P ELV     N    +Y CYLIEL   +     + +I+L  R  L+ D   N++F
Sbjct  32   QPRYVPIELVKPPCSNDASVMYHCYLIELKPNFDCDIPVSDIVLGTRNELDCDTVANMNF  91

Query  374  ELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDG  553
            EL ++GG       + GDV LS+EQ+L CRRFQ+T+ ++L +  L  LDE L R  L   
Sbjct  92   ELQVQGGPLTVNFKHAGDVSLSSEQVLACRRFQITIFKILVDCKLKKLDEVLERFCLGQN  151

Query  554  --SAVIDYLLLP  583
              +  IDYLLLP
Sbjct  152  HRTESIDYLLLP  163



>ref|XP_010312606.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Solanum 
lycopersicum]
Length=1406

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 65/189 (34%), Positives = 93/189 (49%), Gaps = 46/189 (24%)
 Frame = +2

Query  185  QELGCQPK------YFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRL  346
            +EL C+ K      Y+P E V    N  + +Y CYL+EL    Y  +QL  IILA+RT+L
Sbjct  631  KELECKIKIVEQSLYYPSEFVSHCGNESEAVYYCYLVELPHDSYNDSQLHGIILAVRTKL  690

Query  347  ESDDENLSFELNI--------------------EGGNWVGQTVYIGDVGL----------  436
            + DDE L+F+L++                    E   W   + Y   V +          
Sbjct  691  KFDDEILAFDLDVDRRGRLKVQLNYRKVVIFTSEEVRWFLSSFYSLPVKMVWGRLKVQLN  750

Query  437  -------SNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSAVIDYLLLPSSMD  595
                   ++E+I RC+RFQV+V R+L + +L+ L E L  +    GSAV DYLLLPS   
Sbjct  751  YRKVVIFTSEEIRRCQRFQVSVFRILRDPDLSKLQEVLAAVQSPIGSAVSDYLLLPSVGT  810

Query  596  PSDVPKIDW  622
            P   P+I+W
Sbjct  811  P---PEINW  816



>gb|KJB61693.1| hypothetical protein B456_009G374900 [Gossypium raimondii]
Length=1306

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 51/141 (36%), Positives = 78/141 (55%), Gaps = 2/141 (1%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  379
            QP +FPPELV        T Y CYL+EL + +     + NI+L +R + + D+++++ EL
Sbjct  570  QPIFFPPELVNKGSLDSMTKYYCYLMELKQNFDYEVPVHNIMLLVRNQFDMDEKSVNIEL  629

Query  380  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  559
             ++ G       YIG + L+++Q++ CRRFQ+ V +VL +       E L      + S 
Sbjct  630  EVDRGTLTVNMKYIGLIRLNSDQVILCRRFQLAVFQVLMDRKAEKFAEVLCDHTFGNNSE  689

Query  560  VIDYLLLPSSMDPSDVPKIDW  622
             IDYLLLPS+      P IDW
Sbjct  690  -IDYLLLPSNY-VGQSPLIDW  708



>gb|KJB61692.1| hypothetical protein B456_009G374900 [Gossypium raimondii]
 gb|KJB61694.1| hypothetical protein B456_009G374900 [Gossypium raimondii]
 gb|KJB61695.1| hypothetical protein B456_009G374900 [Gossypium raimondii]
Length=1395

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 51/141 (36%), Positives = 78/141 (55%), Gaps = 2/141 (1%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  379
            QP +FPPELV        T Y CYL+EL + +     + NI+L +R + + D+++++ EL
Sbjct  659  QPIFFPPELVNKGSLDSMTKYYCYLMELKQNFDYEVPVHNIMLLVRNQFDMDEKSVNIEL  718

Query  380  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  559
             ++ G       YIG + L+++Q++ CRRFQ+ V +VL +       E L      + S 
Sbjct  719  EVDRGTLTVNMKYIGLIRLNSDQVILCRRFQLAVFQVLMDRKAEKFAEVLCDHTFGNNSE  778

Query  560  VIDYLLLPSSMDPSDVPKIDW  622
             IDYLLLPS+      P IDW
Sbjct  779  -IDYLLLPSNY-VGQSPLIDW  797



>gb|KJB61696.1| hypothetical protein B456_009G374900 [Gossypium raimondii]
Length=1076

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 51/141 (36%), Positives = 78/141 (55%), Gaps = 2/141 (1%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  379
            QP +FPPELV        T Y CYL+EL + +     + NI+L +R + + D+++++ EL
Sbjct  340  QPIFFPPELVNKGSLDSMTKYYCYLMELKQNFDYEVPVHNIMLLVRNQFDMDEKSVNIEL  399

Query  380  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  559
             ++ G       YIG + L+++Q++ CRRFQ+ V +VL +       E L      + S 
Sbjct  400  EVDRGTLTVNMKYIGLIRLNSDQVILCRRFQLAVFQVLMDRKAEKFAEVLCDHTFGNNSE  459

Query  560  VIDYLLLPSSMDPSDVPKIDW  622
             IDYLLLPS+      P IDW
Sbjct  460  -IDYLLLPSNY-VGQSPLIDW  478



>gb|KEH42074.1| endoribonuclease dicer-like protein [Medicago truncatula]
Length=1385

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 53/148 (36%), Positives = 78/148 (53%), Gaps = 5/148 (3%)
 Frame = +2

Query  179  PYQELGCQPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD  358
            PY E   QP Y P ELV    N   T+Y CYL+EL + +     +Q+I LA R +L+ + 
Sbjct  651  PYDE--DQPSYVPLELVNRMPNNSNTIYYCYLLELKQNFSYDITVQDIFLATRVKLDLET  708

Query  359  ENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  538
            E + F +  + G+      Y G + LS +Q+L C+RFQV VL +L  H  +   E +   
Sbjct  709  ECMQFNMGFDRGSLSVNLKYKGSINLSPDQVLLCKRFQVNVLGILMNHKTDM--ETVSDK  766

Query  539  NLVDGSAVIDYLLLPSSMDPSDVPKIDW  622
              ++     DYLLLP S+   + P +DW
Sbjct  767  FCLEDDLEFDYLLLP-SIAIEETPSVDW  793



>ref|XP_003594551.1| Endoribonuclease Dicer [Medicago truncatula]
Length=1418

 Score = 92.8 bits (229),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 52/148 (35%), Positives = 80/148 (54%), Gaps = 5/148 (3%)
 Frame = +2

Query  179  PYQELGCQPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD  358
            PY E   QP Y P ELV    N   T+Y CYLIEL + +     +Q+I LA R  L+ + 
Sbjct  688  PYSEE--QPSYVPFELVNHMSNNSSTIYYCYLIELKQNFSYDITVQDIFLATRVELDPEI  745

Query  359  ENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  538
              + F++  + G+      Y G++ LS +Q+L C+RFQV++L +L    ++   E+    
Sbjct  746  GCMQFDMCFDRGSLAVNLRYRGNINLSPDQVLLCKRFQVSILGILMNSKMDK--ESFSEK  803

Query  539  NLVDGSAVIDYLLLPSSMDPSDVPKIDW  622
              ++    IDYLLLP S+   + P +DW
Sbjct  804  YSLEDDLEIDYLLLP-SIAIEETPSVDW  830



>gb|AES64802.2| endoribonuclease dicer-like protein [Medicago truncatula]
Length=1377

 Score = 92.8 bits (229),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 52/148 (35%), Positives = 80/148 (54%), Gaps = 5/148 (3%)
 Frame = +2

Query  179  PYQELGCQPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD  358
            PY E   QP Y P ELV    N   T+Y CYLIEL + +     +Q+I LA R  L+ + 
Sbjct  649  PYSEE--QPSYVPFELVNHMSNNSSTIYYCYLIELKQNFSYDITVQDIFLATRVELDPEI  706

Query  359  ENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  538
              + F++  + G+      Y G++ LS +Q+L C+RFQV++L +L    ++   E+    
Sbjct  707  GCMQFDMCFDRGSLAVNLRYRGNINLSPDQVLLCKRFQVSILGILMNSKMDK--ESFSEK  764

Query  539  NLVDGSAVIDYLLLPSSMDPSDVPKIDW  622
              ++    IDYLLLP S+   + P +DW
Sbjct  765  YSLEDDLEIDYLLLP-SIAIEETPSVDW  791



>gb|KEH20231.1| endoribonuclease dicer-like protein [Medicago truncatula]
Length=1219

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 56/148 (38%), Positives = 81/148 (55%), Gaps = 5/148 (3%)
 Frame = +2

Query  179  PYQELGCQPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD  358
            PY E   QP Y P ELV    N   T+Y CYLIEL + +     +Q+I LA R +L+ + 
Sbjct  653  PYDEE--QPSYVPLELVNRMSNNSCTIYYCYLIELKQKFSYDLTVQDIFLATRVKLDLES  710

Query  359  ENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  538
            E + F++  + G+      Y G + LS +Q+L C+RFQV VL +L  H  +   ++ G+ 
Sbjct  711  ECMEFDMCFDRGSLSVNLRYKGSINLSPDQVLLCKRFQVNVLGILMNHKTDKETDS-GKF  769

Query  539  NLVDGSAVIDYLLLPSSMDPSDVPKIDW  622
             L D    IDYLLLP S+   +   +DW
Sbjct  770  CLED-DLEIDYLLLP-SIAIEETLSVDW  795



>ref|XP_004171378.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Cucumis sativus]
Length=453

 Score = 90.9 bits (224),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 74/130 (57%), Gaps = 1/130 (1%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  379
            QP Y PPE V    +    +Y CYLIEL + ++      NI+LA+RT LE + +++  +L
Sbjct  163  QPIYVPPEFVHCCPHNSSVVYHCYLIELKQNFHYDISAHNIVLAMRTELEFEVQSMCHDL  222

Query  380  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  559
            +++ G++     Y+G + LS EQ+L  R+FQ T+ RVL  H           + L DG  
Sbjct  223  DVDRGSFDVNFKYVGIIKLSPEQVLLSRQFQRTIFRVLLNHTWTDKLSENNEICLGDGPR  282

Query  560  VIDYLLLPSS  589
            V DYLLLPS+
Sbjct  283  V-DYLLLPST  291



>ref|XP_007147466.1| hypothetical protein PHAVU_006G127100g [Phaseolus vulgaris]
 ref|XP_007147467.1| hypothetical protein PHAVU_006G127100g [Phaseolus vulgaris]
 ref|XP_007147468.1| hypothetical protein PHAVU_006G127100g [Phaseolus vulgaris]
 gb|ESW19460.1| hypothetical protein PHAVU_006G127100g [Phaseolus vulgaris]
 gb|ESW19461.1| hypothetical protein PHAVU_006G127100g [Phaseolus vulgaris]
 gb|ESW19462.1| hypothetical protein PHAVU_006G127100g [Phaseolus vulgaris]
Length=1392

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 49/141 (35%), Positives = 82/141 (58%), Gaps = 2/141 (1%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  379
            QP Y P  LV    N+  T Y CYL+E +  +   T +Q++ LA+R +L+ +   + F+L
Sbjct  656  QPIYAPFGLVNCVSNSSHTTYHCYLMEFSPNFCYHTSVQDVFLAIRIKLDPEIGCMQFDL  715

Query  380  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSA  559
            + + G+   +  Y G + LS++Q+L C++FQVT+LR+L ++ +N     L +  L D   
Sbjct  716  DFDRGSVSVKLRYKGTINLSSDQVLLCKKFQVTLLRILIDNCMNKFTTGLDKCFLKD-DL  774

Query  560  VIDYLLLPSSMDPSDVPKIDW  622
             IDYLLLP++    +   +DW
Sbjct  775  EIDYLLLPATGKRPN-STVDW  794



>ref|XP_008443676.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X4 [Cucumis 
melo]
 ref|XP_008443677.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X4 [Cucumis 
melo]
Length=1306

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 52/131 (40%), Positives = 76/131 (58%), Gaps = 3/131 (2%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  379
            QP Y PPE V    +    +Y CYLIEL + ++      NI+LA+RT LE + +++  +L
Sbjct  566  QPIYVPPEFVHCCPHNSSVVYHCYLIELKQNFHYDISAHNIVLAMRTELEFEVQSMCHDL  625

Query  380  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHN-LNTLDEALGRLNLVDGS  556
            +++ G++     Y+G + LS EQ+L  R+FQ T+ R L  H   N L E    + L DG 
Sbjct  626  DVDRGSFDVNFKYVGIIKLSPEQVLLSRQFQRTIFRALLNHTWTNKLSEN-NEIYLGDGP  684

Query  557  AVIDYLLLPSS  589
             V DYLLLPS+
Sbjct  685  KV-DYLLLPST  694



>ref|XP_008443675.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X3 [Cucumis 
melo]
Length=1346

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 52/131 (40%), Positives = 76/131 (58%), Gaps = 3/131 (2%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  379
            QP Y PPE V    +    +Y CYLIEL + ++      NI+LA+RT LE + +++  +L
Sbjct  606  QPIYVPPEFVHCCPHNSSVVYHCYLIELKQNFHYDISAHNIVLAMRTELEFEVQSMCHDL  665

Query  380  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHN-LNTLDEALGRLNLVDGS  556
            +++ G++     Y+G + LS EQ+L  R+FQ T+ R L  H   N L E    + L DG 
Sbjct  666  DVDRGSFDVNFKYVGIIKLSPEQVLLSRQFQRTIFRALLNHTWTNKLSEN-NEIYLGDGP  724

Query  557  AVIDYLLLPSS  589
             V DYLLLPS+
Sbjct  725  KV-DYLLLPST  734



>ref|XP_008443674.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Cucumis 
melo]
Length=1365

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 52/131 (40%), Positives = 76/131 (58%), Gaps = 3/131 (2%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  379
            QP Y PPE V    +    +Y CYLIEL + ++      NI+LA+RT LE + +++  +L
Sbjct  653  QPIYVPPEFVHCCPHNSSVVYHCYLIELKQNFHYDISAHNIVLAMRTELEFEVQSMCHDL  712

Query  380  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHN-LNTLDEALGRLNLVDGS  556
            +++ G++     Y+G + LS EQ+L  R+FQ T+ R L  H   N L E    + L DG 
Sbjct  713  DVDRGSFDVNFKYVGIIKLSPEQVLLSRQFQRTIFRALLNHTWTNKLSEN-NEIYLGDGP  771

Query  557  AVIDYLLLPSS  589
             V DYLLLPS+
Sbjct  772  KV-DYLLLPST  781



>ref|XP_008443670.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Cucumis 
melo]
 ref|XP_008443671.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Cucumis 
melo]
 ref|XP_008443672.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Cucumis 
melo]
Length=1393

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 52/131 (40%), Positives = 76/131 (58%), Gaps = 3/131 (2%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  379
            QP Y PPE V    +    +Y CYLIEL + ++      NI+LA+RT LE + +++  +L
Sbjct  653  QPIYVPPEFVHCCPHNSSVVYHCYLIELKQNFHYDISAHNIVLAMRTELEFEVQSMCHDL  712

Query  380  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHN-LNTLDEALGRLNLVDGS  556
            +++ G++     Y+G + LS EQ+L  R+FQ T+ R L  H   N L E    + L DG 
Sbjct  713  DVDRGSFDVNFKYVGIIKLSPEQVLLSRQFQRTIFRALLNHTWTNKLSEN-NEIYLGDGP  771

Query  557  AVIDYLLLPSS  589
             V DYLLLPS+
Sbjct  772  KV-DYLLLPST  781



>ref|XP_007147469.1| hypothetical protein PHAVU_006G127200g [Phaseolus vulgaris]
 ref|XP_007147470.1| hypothetical protein PHAVU_006G127200g [Phaseolus vulgaris]
 gb|ESW19463.1| hypothetical protein PHAVU_006G127200g [Phaseolus vulgaris]
 gb|ESW19464.1| hypothetical protein PHAVU_006G127200g [Phaseolus vulgaris]
Length=1388

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 54/162 (33%), Positives = 89/162 (55%), Gaps = 10/162 (6%)
 Frame = +2

Query  101  DIVLDVWMQRFDMATTGSTGLQSDPPPYQELGCQPKYFPPELVGTRDNAPQTLYSCYLIE  280
            ++V D++++  +M   G+        PY E   QP Y P  LV    N   T Y CYL+E
Sbjct  631  NLVPDIFIEEAEMEGFGNE-------PYDE--NQPAYVPFGLVNCVSNNSHTTYHCYLME  681

Query  281  LNRYYYKRTQLQNIILALRTRLESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRC  460
            L + +     +Q+I LA R  L+ +     F++  + G+   + +Y G + LS + +L C
Sbjct  682  LIQNFSYDICVQDIFLATRIELDPEIGCTQFDMGFDRGSLSVKLIYKGTIDLSPDLVLLC  741

Query  461  RRFQVTVLRVLFEHNLNTLDEALGRLNLVDGSAVIDYLLLPS  586
            ++FQVT+LR+L ++++N L   L +  L +G   IDYLLLP+
Sbjct  742  KKFQVTLLRILIDNSMNKLAMGLDKCYL-EGDVEIDYLLLPA  782



>ref|XP_004139098.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Cucumis sativus]
 gb|KGN66658.1| hypothetical protein Csa_1G654870 [Cucumis sativus]
Length=1393

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 52/131 (40%), Positives = 77/131 (59%), Gaps = 3/131 (2%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  379
            QP Y PPE V    +    +Y CYLIEL + ++      NI+LA+RT LE + +++  +L
Sbjct  653  QPIYVPPEFVHCCPHNSSVVYHCYLIELKQNFHYDISAHNIVLAMRTELEFEVQSMCHDL  712

Query  380  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHN-LNTLDEALGRLNLVDGS  556
            +++ G++     Y+G + LS EQ+L  R+FQ T+ +VL  H   N L E    + L DG 
Sbjct  713  DVDRGSFDVNFKYVGIIKLSPEQVLLSRQFQRTIFKVLLNHTWTNKLSEN-NEICLGDGP  771

Query  557  AVIDYLLLPSS  589
             V DYLLLPS+
Sbjct  772  RV-DYLLLPST  781



>ref|XP_004303843.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Fragaria vesca 
subsp. vesca]
Length=1393

 Score = 89.7 bits (221),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 56/153 (37%), Positives = 83/153 (54%), Gaps = 11/153 (7%)
 Frame = +2

Query  185  QELGCQPK------YFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRL  346
            QE  C+P       Y P ELV T  N    LY  Y+I L++ +     +++ +L +RT+L
Sbjct  640  QEFECEPYDEEQSCYVPSELVKTCSNDDTMLYHQYIIVLDQTFDYEIPVKDFVLCMRTKL  699

Query  347  ESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEA  526
            + +  N   EL    G       Y G++ L+ EQ+L CRRFQVT+  +L +HNL+  +E 
Sbjct  700  DFEIANWHSELEFGSGCLTVNFKYGGEIHLNAEQVLNCRRFQVTIFGILIDHNLDKWNEV  759

Query  527  LGRLNLVDGSAVIDYLLLPSS-MDPSDVPKIDW  622
               L+L + S  +DYLLLP + + PS    IDW
Sbjct  760  FDGLSLRE-SLGVDYLLLPGTRVRPS---IIDW  788



>ref|XP_007029210.1| Dicer-like protein isoform 3 [Theobroma cacao]
 gb|EOY09712.1| Dicer-like protein isoform 3 [Theobroma cacao]
Length=1202

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 44/118 (37%), Positives = 69/118 (58%), Gaps = 2/118 (2%)
 Frame = +2

Query  179  PYQELGCQPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD  358
            PY +   QP +FPPELV   ++     Y CYLIEL + +     + NI+L +R++LE D+
Sbjct  565  PYND--DQPIFFPPELVNQCEHEDMKKYYCYLIELKQNFDYEFPVHNIMLLVRSQLEIDN  622

Query  359  ENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALG  532
            +++ FEL ++ G       Y+G + L   Q++  +RFQ+ V RVL +H +  L E LG
Sbjct  623  KSMGFELEVDRGFLTVNLKYVGLIRLDPSQVILSKRFQIAVFRVLMDHKVEKLTEVLG  680



>ref|XP_010101236.1| Endoribonuclease Dicer-2-like protein [Morus notabilis]
 gb|EXB88160.1| Endoribonuclease Dicer-2-like protein [Morus notabilis]
Length=1429

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 53/149 (36%), Positives = 85/149 (57%), Gaps = 5/149 (3%)
 Frame = +2

Query  179  PYQELGCQPKYFPPELVGTRDNAPQTL-YSCYLIELNRYYYKRTQLQNIILALRTRLESD  355
            PY++   QP Y P E+VG+   A   + Y CYLIEL + +     + +++L +R+ LESD
Sbjct  650  PYKDE--QPSYVPSEMVGSFGPADAGVSYHCYLIELKQDFGYDVPIHDLVLCMRSALESD  707

Query  356  DENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGR  535
              N+ F+L +  G+       +G + L+ +Q+   R FQVT+LR+L +H  + L E   +
Sbjct  708  LANIHFDLQVGRGSVTVNLKNVGTLSLNRDQVTWSRMFQVTLLRLLVDHKFDNLREVHSQ  767

Query  536  LNLVDGSAVIDYLLLPSSMDPSDVPKIDW  622
            L   + +  IDYLLLP ++  +  P IDW
Sbjct  768  LYFSE-TIQIDYLLLP-AITMNKRPLIDW  794



>ref|XP_010673887.1| PREDICTED: endoribonuclease Dicer homolog 2 [Beta vulgaris subsp. 
vulgaris]
Length=1432

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 50/140 (36%), Positives = 79/140 (56%), Gaps = 7/140 (5%)
 Frame = +2

Query  179  PYQELGCQPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD  358
            PY +   Q +Y P E VG    +   +Y  YL+EL + +Y    + +I+L  +T L SD 
Sbjct  678  PYNDH--QARYVPSEFVGDGPTSSSDVYHGYLMELKQDFYSDIPVHDIVLVFKTELASDV  735

Query  359  ENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  538
             N+ F+++++ GN      YIG + L+ +Q+  C ++QV VLRVL + + + L E++  L
Sbjct  736  GNMHFDMDVDWGNMSVDVKYIGKINLTRKQVALCTQYQVAVLRVLRDLDFDKLVESVKEL  795

Query  539  NLV---DGSAV--IDYLLLP  583
            N     DG+ V   DYLLLP
Sbjct  796  NKWENNDGAPVSHYDYLLLP  815



>ref|XP_007029212.1| Dicer-like protein isoform 5 [Theobroma cacao]
 gb|EOY09714.1| Dicer-like protein isoform 5 [Theobroma cacao]
Length=1077

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 44/118 (37%), Positives = 69/118 (58%), Gaps = 2/118 (2%)
 Frame = +2

Query  179  PYQELGCQPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD  358
            PY +   QP +FPPELV   ++     Y CYLIEL + +     + NI+L +R++LE D+
Sbjct  440  PYND--DQPIFFPPELVNQCEHEDMKKYYCYLIELKQNFDYEFPVHNIMLLVRSQLEIDN  497

Query  359  ENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALG  532
            +++ FEL ++ G       Y+G + L   Q++  +RFQ+ V RVL +H +  L E LG
Sbjct  498  KSMGFELEVDRGFLTVNLKYVGLIRLDPSQVILSKRFQIAVFRVLMDHKVEKLTEVLG  555



>ref|XP_007029214.1| Dicer-like protein isoform 7, partial [Theobroma cacao]
 gb|EOY09716.1| Dicer-like protein isoform 7, partial [Theobroma cacao]
Length=947

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 42/111 (38%), Positives = 66/111 (59%), Gaps = 0/111 (0%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  379
            QP +FPPELV   ++     Y CYLIEL + +     + NI+L +R++LE D++++ FEL
Sbjct  375  QPIFFPPELVNQCEHEDMKKYYCYLIELKQNFDYEFPVHNIMLLVRSQLEIDNKSMGFEL  434

Query  380  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALG  532
             ++ G       Y+G + L   Q++  +RFQ+ V RVL +H +  L E LG
Sbjct  435  EVDRGFLTVNLKYVGLIRLDPSQVILSKRFQIAVFRVLMDHKVEKLTEVLG  485



>ref|XP_006586846.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Glycine 
max]
Length=1420

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 48/136 (35%), Positives = 78/136 (57%), Gaps = 3/136 (2%)
 Frame = +2

Query  179  PYQELGCQPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD  358
            PY E   QP + P  LV +  N   T+Y CYL+EL++ +     +Q+I LA+R  L+ + 
Sbjct  686  PYDE--NQPTFVPFGLVNSVSNNSHTIYHCYLMELSQNFSYDISVQDIFLAIRIELDPEI  743

Query  359  ENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  538
                F++  + G+   +  Y G + LS   +L C++FQVT+L  + +H++N L  +L + 
Sbjct  744  GCTQFDMGFDRGSVSLKLRYKGTINLSPNLVLLCKKFQVTLLGSIIDHSMNKLATSLDKC  803

Query  539  NLVDGSAVIDYLLLPS  586
             L D +  IDYLLLP+
Sbjct  804  YLED-NVEIDYLLLPA  818



>ref|XP_003534774.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Glycine 
max]
Length=1421

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 48/136 (35%), Positives = 78/136 (57%), Gaps = 3/136 (2%)
 Frame = +2

Query  179  PYQELGCQPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD  358
            PY E   QP + P  LV +  N   T+Y CYL+EL++ +     +Q+I LA+R  L+ + 
Sbjct  686  PYDE--NQPTFVPFGLVNSVSNNSHTIYHCYLMELSQNFSYDISVQDIFLAIRIELDPEI  743

Query  359  ENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  538
                F++  + G+   +  Y G + LS   +L C++FQVT+L  + +H++N L  +L + 
Sbjct  744  GCTQFDMGFDRGSVSLKLRYKGTINLSPNLVLLCKKFQVTLLGSIIDHSMNKLATSLDKC  803

Query  539  NLVDGSAVIDYLLLPS  586
             L D +  IDYLLLP+
Sbjct  804  YLED-NVEIDYLLLPA  818



>ref|XP_006586847.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X3 [Glycine 
max]
Length=1387

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 48/136 (35%), Positives = 78/136 (57%), Gaps = 3/136 (2%)
 Frame = +2

Query  179  PYQELGCQPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD  358
            PY E   QP + P  LV +  N   T+Y CYL+EL++ +     +Q+I LA+R  L+ + 
Sbjct  652  PYDE--NQPTFVPFGLVNSVSNNSHTIYHCYLMELSQNFSYDISVQDIFLAIRIELDPEI  709

Query  359  ENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  538
                F++  + G+   +  Y G + LS   +L C++FQVT+L  + +H++N L  +L + 
Sbjct  710  GCTQFDMGFDRGSVSLKLRYKGTINLSPNLVLLCKKFQVTLLGSIIDHSMNKLATSLDKC  769

Query  539  NLVDGSAVIDYLLLPS  586
             L D +  IDYLLLP+
Sbjct  770  YLED-NVEIDYLLLPA  784



>gb|KHN23014.1| Endoribonuclease Dicer like 2 [Glycine soja]
Length=1324

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 48/136 (35%), Positives = 78/136 (57%), Gaps = 3/136 (2%)
 Frame = +2

Query  179  PYQELGCQPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD  358
            PY E   QP + P  LV +  N   T+Y CYL+EL++ +     +Q+I LA+R  L+ + 
Sbjct  589  PYDE--NQPTFVPFGLVNSVSNNSHTIYHCYLMELSQNFSYDISVQDIFLAIRIELDPEI  646

Query  359  ENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  538
                F++  + G+   +  Y G + LS   +L C++FQVT+L  + +H++N L  +L + 
Sbjct  647  GCTQFDMGFDRGSVSLKLRYKGTINLSPNLVLLCKKFQVTLLGSIIDHSMNKLATSLDKC  706

Query  539  NLVDGSAVIDYLLLPS  586
             L D +  IDYLLLP+
Sbjct  707  YLED-NVEIDYLLLPA  721



>ref|XP_004486471.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Cicer arietinum]
Length=1400

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 55/151 (36%), Positives = 77/151 (51%), Gaps = 11/151 (7%)
 Frame = +2

Query  179  PYQELGCQPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD  358
            PY E   QP Y P ELV    N   T Y CYLIEL + +     +Q+I LA R  L+ + 
Sbjct  667  PYDEE--QPSYVPFELVNRVLNNSNTTYYCYLIELKQNFSYDFTVQDIFLATRVELDPEI  724

Query  359  ENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLN---TLDEAL  529
              + F++  + G+      Y G + LS +Q+L C+RFQV VL +L +H  +     DE  
Sbjct  725  ACMQFDMCFDRGSLDVNLKYKGSINLSPDQVLLCKRFQVNVLGILMDHKTDKGTVFDECC  784

Query  530  GRLNLVDGSAVIDYLLLPSSMDPSDVPKIDW  622
               NL      +DYLLLP S+   +   +DW
Sbjct  785  LEDNL-----EVDYLLLP-SIAIEERTDVDW  809



>ref|XP_010249397.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Nelumbo 
nucifera]
Length=1394

 Score = 84.0 bits (206),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 49/145 (34%), Positives = 77/145 (53%), Gaps = 10/145 (7%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQT----LYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENL  367
            Q  YFP ELV   ++ P      +Y CY+I L + +      ++I L +R  L +D EN 
Sbjct  651  QVNYFPAELV---NHCPSCSVIEMYHCYVIRLKKNFKYDVPFRDIALLVRHNLGADFENF  707

Query  368  SFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLV  547
             F+L ++ G      VY G + LS +Q+L  RRFQ+TVLRVL +H+++ + + +      
Sbjct  708  YFDLEVDWGFVTVNLVYNGTIHLSPDQVLMARRFQITVLRVLIDHSMDKVKDVMDETFQK  767

Query  548  DGSAVIDYLLLPSSMDPSDVPKIDW  622
                ++DY+LLP S    +    DW
Sbjct  768  QILPIVDYILLPFS---DNTKCFDW  789



>ref|XP_010249398.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Nelumbo 
nucifera]
Length=1188

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 47/134 (35%), Positives = 74/134 (55%), Gaps = 7/134 (5%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQT----LYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENL  367
            Q  YFP ELV   ++ P      +Y CY+I L + +      ++I L +R  L +D EN 
Sbjct  445  QVNYFPAELV---NHCPSCSVIEMYHCYVIRLKKNFKYDVPFRDIALLVRHNLGADFENF  501

Query  368  SFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLV  547
             F+L ++ G      VY G + LS +Q+L  RRFQ+TVLRVL +H+++ + + +      
Sbjct  502  YFDLEVDWGFVTVNLVYNGTIHLSPDQVLMARRFQITVLRVLIDHSMDKVKDVMDETFQK  561

Query  548  DGSAVIDYLLLPSS  589
                ++DY+LLP S
Sbjct  562  QILPIVDYILLPFS  575



>ref|XP_007147294.1| hypothetical protein PHAVU_006G111800g [Phaseolus vulgaris]
 gb|ESW19288.1| hypothetical protein PHAVU_006G111800g [Phaseolus vulgaris]
Length=754

 Score = 83.2 bits (204),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 55/147 (37%), Positives = 76/147 (52%), Gaps = 7/147 (5%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQTLYS--CYLIELNRYYYKRTQLQNIILALRTRLESDD-ENLS  370
             P Y PPELV     +    Y   CYL+EL   Y    ++ +I+LA+RT LES+  E LS
Sbjct  8    HPCYVPPELVNCSSKSCSVTYEYYCYLMELKEDYKYEVKVGDIVLAMRTELESEIIETLS  67

Query  371  -FELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLV  547
               L +E G           + LS+EQ+ +CRRFQ T+ ++L   + N L  A    +L 
Sbjct  68   GTSLVVERGKLSLNLTPAKPIQLSSEQVEKCRRFQTTLFKILLNGDFNQLPSASDNFSLG  127

Query  548  DGSAVIDYLLLPSSMDPSDVPK--IDW  622
            D    IDYLLLP+++      K  IDW
Sbjct  128  DNPE-IDYLLLPATVKDQRPSKSIIDW  153



>ref|XP_007140643.1| hypothetical protein PHAVU_008G129500g [Phaseolus vulgaris]
 gb|ESW12637.1| hypothetical protein PHAVU_008G129500g [Phaseolus vulgaris]
Length=1420

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 48/138 (35%), Positives = 76/138 (55%), Gaps = 8/138 (6%)
 Frame = +2

Query  179  PYQELGCQPKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD  358
            PY +   QP Y P  LV    N   T Y CYL+EL++ +     +++I LA+R  L+++ 
Sbjct  685  PYDD--NQPTYVPFGLVNCVSNNSHTTYHCYLMELSQNFSYDIFVEDIFLAMRVELDTEV  742

Query  359  ENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGR-  535
                F++  + G+   +  Y G + LS +Q+L C+ FQ T+LR+L   ++N     L + 
Sbjct  743  VCSQFDMGFDRGDVSVKLSYKGTINLSQDQVLLCKNFQATLLRILIRRDINKFPIGLDKS  802

Query  536  -LNLVDGSAVIDYLLLPS  586
             L+ VD    IDYLLLP+
Sbjct  803  CLHEVD----IDYLLLPA  816



>ref|XP_006604892.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Glycine 
max]
Length=788

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 46/145 (32%), Positives = 76/145 (52%), Gaps = 7/145 (5%)
 Frame = +2

Query  203  PKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESD--DENLSFE  376
            P Y P ELV          Y CYL+EL ++Y  +  + +I+LA+R+ L+S+  D      
Sbjct  9    PSYVPSELVSCSSKGRNVTYHCYLMELEQHYEYQVSVNDIVLAIRSELDSEIVDTLSGTS  68

Query  377  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  556
             +++ G  +    ++  + LS E++  CRRFQ T+ R+L   ++  L       +L D  
Sbjct  69   FDVKRGKLLVNLRHLEPIQLSPEKVQSCRRFQTTLFRILLNRDVTKLTSVSDDFSLGDNP  128

Query  557  AVIDYLLLPSSMD---PSDVPKIDW  622
              ID+LLLP+++    PS+   IDW
Sbjct  129  E-IDFLLLPATVKHQRPSN-SIIDW  151



>ref|XP_003553782.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Glycine 
max]
Length=756

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 46/145 (32%), Positives = 76/145 (52%), Gaps = 7/145 (5%)
 Frame = +2

Query  203  PKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESD--DENLSFE  376
            P Y P ELV          Y CYL+EL ++Y  +  + +I+LA+R+ L+S+  D      
Sbjct  9    PSYVPSELVSCSSKGRNVTYHCYLMELEQHYEYQVSVNDIVLAIRSELDSEIVDTLSGTS  68

Query  377  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  556
             +++ G  +    ++  + LS E++  CRRFQ T+ R+L   ++  L       +L D  
Sbjct  69   FDVKRGKLLVNLRHLEPIQLSPEKVQSCRRFQTTLFRILLNRDVTKLTSVSDDFSLGDNP  128

Query  557  AVIDYLLLPSSMD---PSDVPKIDW  622
              ID+LLLP+++    PS+   IDW
Sbjct  129  E-IDFLLLPATVKHQRPSN-SIIDW  151



>ref|XP_006844770.1| hypothetical protein AMTR_s00016p00258500 [Amborella trichopoda]
 gb|ERN06445.1| hypothetical protein AMTR_s00016p00258500 [Amborella trichopoda]
Length=1424

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 85/169 (50%), Gaps = 15/169 (9%)
 Frame = +2

Query  134  DMATTGSTGLQSDPPPYQELGCQPKYFPPELVGT-RDNAPQTLYSCYLIELNRYYYKRTQ  310
            D A+ GS G      P +E      YFP EL+G  +    + LY CY I L+       +
Sbjct  657  DDASMGSGG-----EPCEEF--HAMYFPQELIGHLKKGCGKELYDCYSITLHSNVDHGWE  709

Query  311  LQNIILALRTRLESDDENLSFELNIEGGNWVGQTVYIGDVG---LSNEQILRCRRFQVTV  481
             ++++L ++  L  D E LSF   + G N V   V +G  G   L  EQ+L  RRFQ T+
Sbjct  710  FRSLLLMVKCNLGYDFEQLSF---VMGPNQVSVAVNMGYAGTRELDVEQVLMARRFQTTI  766

Query  482  LRVLFEHNLNTLDEALGRLNLVDGSAV-IDYLLLPSSMDPSDVPKIDWN  625
             ++L   N++ + E+L RLN  +     I+YLLLPS        +IDW+
Sbjct  767  FKILITGNVSEMRESLERLNQGETCCTQIEYLLLPSIGSGFTSSQIDWD  815



>gb|ACU23800.1| unknown [Glycine max]
Length=273

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 75/145 (52%), Gaps = 7/145 (5%)
 Frame = +2

Query  203  PKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESD--DENLSFE  376
            P Y P E V          Y CYL+EL ++Y  +  + +I+LA+R+ L+S+  D      
Sbjct  9    PSYVPSERVSCSSKGRNVTYHCYLMELEQHYEYQVSVNDIVLAIRSELDSEIVDTLSGTS  68

Query  377  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  556
             +++ G  +    ++  + LS E++  CRRFQ T+ R+L   ++  L       +L D  
Sbjct  69   FDVKRGKLLVNLRHLEPIQLSPEKVQSCRRFQTTLFRILLNRDVTKLTSVSDDFSLGDNP  128

Query  557  AVIDYLLLPSSMD---PSDVPKIDW  622
              ID+LLLP+++    PS+   IDW
Sbjct  129  E-IDFLLLPATVKHQRPSN-SIIDW  151



>gb|KHN43108.1| Endoribonuclease Dicer like 2 [Glycine soja]
Length=836

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/146 (32%), Positives = 76/146 (52%), Gaps = 7/146 (5%)
 Frame = +2

Query  203  PKYFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESD--DENLSFE  376
            P Y P ELV          Y CYL+EL ++Y  +  + +I+LA+R+ L+S+  D      
Sbjct  57   PSYVPSELVSCSSKGRNVTYHCYLMELEQHYEYQVSVNDIVLAIRSELDSEIVDTLSGTS  116

Query  377  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  556
             +++ G  +    ++  + LS E++  CRRFQ T+ R+L   ++  L       +L D  
Sbjct  117  FDVKRGKLLVNLRHLEPIQLSPEKVQSCRRFQTTLFRILLNRDVTKLTSVSDDFSLGDNP  176

Query  557  AVIDYLLLPSSMD---PSDVPKIDWN  625
              ID+LLLP+++    PS+   IDW 
Sbjct  177  E-IDFLLLPATVKHQRPSN-SIIDWK  200



>ref|XP_010088523.1| Endoribonuclease Dicer-2-like protein [Morus notabilis]
 gb|EXB36440.1| Endoribonuclease Dicer-2-like protein [Morus notabilis]
Length=1077

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 74/154 (48%), Gaps = 24/154 (16%)
 Frame = +2

Query  170  DPPPYQELGCQPKYFPPELVGTR--DNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTR  343
            +  PY++    P+Y P E+VG+   D    TLY CYL+EL + +     + NI+L  R  
Sbjct  337  ESQPYED--AHPRYIPSEMVGSFCPDGDAHTLYYCYLLELKQEFEYDIPVHNILLGTRNE  394

Query  344  LESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDE  523
            LE D  N  F+L +  G+ +    Y+G        + +C            E N N + E
Sbjct  395  LEVDGGNTHFDLKVGSGSLIVNLKYVG--------VKKCYS---------SEENFNYVRE  437

Query  524  ALGRLNLVDGSAVIDYLLLPSS-MDPSDVPKIDW  622
               + +L +    IDYL+LP++ ++P D+  + W
Sbjct  438  VSSQHHLQE-DIEIDYLILPATILNPRDL-MVKW  469



>ref|XP_010312604.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010312605.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Solanum 
lycopersicum]
Length=1433

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 55/96 (57%), Gaps = 7/96 (7%)
 Frame = +2

Query  185  QELGCQPK------YFPPELVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRL  346
            +EL C+ K      Y+P E V    N  + +Y CYL+EL    Y  +QL  IILA+RT+L
Sbjct  631  KELECKIKIVEQSLYYPSEFVSHCGNESEAVYYCYLVELPHDSYNDSQLHGIILAVRTKL  690

Query  347  ESDDENLSFELNIE-GGNWVGQTVYIGDVGLSNEQI  451
            + DDE L+F+L+++  G    Q  Y   V  ++E++
Sbjct  691  KFDDEILAFDLDVDRRGRLKVQLNYRKVVIFTSEEV  726



>ref|XP_008681081.1| PREDICTED: uncharacterized protein LOC100192986 isoform X1 [Zea 
mays]
Length=1408

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 46/148 (31%), Positives = 72/148 (49%), Gaps = 20/148 (14%)
 Frame = +2

Query  200  QPKYFPPELVGTRDN-APQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  376
            QP YFP +LV    + + +  Y CY++ L      +T    I+LA++  + SD  + SF+
Sbjct  677  QPDYFPEQLVDNWSSFSRRGFYYCYMVSLEGC--SKTTPAEIVLAVKCDMGSDFISNSFK  734

Query  377  LNIEGGNWVGQTV------YIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  538
            L      W  Q        Y+G + L+ EQ++  RRFQ T+L +L  ++L+ +   +  L
Sbjct  735  L------WGVQDYLSFTMRYVGIIHLNQEQVIAARRFQTTILSLLISNDLSEVSNYIKNL  788

Query  539  NLVDGSAVIDYLLLPSSMDPSDVPKIDW  622
              +  S    YLLLP         KIDW
Sbjct  789  LEMPASPGAVYLLLPVVSG-----KIDW  811



>ref|XP_008681082.1| PREDICTED: uncharacterized protein LOC100192986 isoform X2 [Zea 
mays]
Length=1401

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 46/148 (31%), Positives = 72/148 (49%), Gaps = 20/148 (14%)
 Frame = +2

Query  200  QPKYFPPELVGTRDN-APQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  376
            QP YFP +LV    + + +  Y CY++ L      +T    I+LA++  + SD  + SF+
Sbjct  670  QPDYFPEQLVDNWSSFSRRGFYYCYMVSLEGC--SKTTPAEIVLAVKCDMGSDFISNSFK  727

Query  377  LNIEGGNWVGQTV------YIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  538
            L      W  Q        Y+G + L+ EQ++  RRFQ T+L +L  ++L+ +   +  L
Sbjct  728  L------WGVQDYLSFTMRYVGIIHLNQEQVIAARRFQTTILSLLISNDLSEVSNYIKNL  781

Query  539  NLVDGSAVIDYLLLPSSMDPSDVPKIDW  622
              +  S    YLLLP         KIDW
Sbjct  782  LEMPASPGAVYLLLPVVSG-----KIDW  804



>ref|XP_008681083.1| PREDICTED: uncharacterized protein LOC100192986 isoform X3 [Zea 
mays]
Length=1192

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 46/148 (31%), Positives = 72/148 (49%), Gaps = 20/148 (14%)
 Frame = +2

Query  200  QPKYFPPELVGTRDN-APQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  376
            QP YFP +LV    + + +  Y CY++ L      +T    I+LA++  + SD  + SF+
Sbjct  677  QPDYFPEQLVDNWSSFSRRGFYYCYMVSLEGC--SKTTPAEIVLAVKCDMGSDFISNSFK  734

Query  377  LNIEGGNWVGQTV------YIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  538
            L      W  Q        Y+G + L+ EQ++  RRFQ T+L +L  ++L+ +   +  L
Sbjct  735  L------WGVQDYLSFTMRYVGIIHLNQEQVIAARRFQTTILSLLISNDLSEVSNYIKNL  788

Query  539  NLVDGSAVIDYLLLPSSMDPSDVPKIDW  622
              +  S    YLLLP         KIDW
Sbjct  789  LEMPASPGAVYLLLPVVSG-----KIDW  811



>ref|XP_008644679.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X4 
[Zea mays]
Length=682

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 49/145 (34%), Positives = 69/145 (48%), Gaps = 16/145 (11%)
 Frame = +2

Query  200  QPKYFPPELVGTRDN----APQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENL  367
            QP YFP EL+   DN    + + LY CY I L           +IILA++  +  D    
Sbjct  37   QPVYFPEELM---DNWVSFSLRGLYYCYNISLQGSCNTTADPTDIILAVKCDMGPDFFRY  93

Query  368  SFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLV  547
            SF L   GG  +    Y+  + L+ EQ+L  RRFQ+TVL +L   N + +  A+      
Sbjct  94   SFNL---GGTDI-TIKYLYKIHLNQEQVLFARRFQITVLSLLINSNSSEVSNAIKYFREW  149

Query  548  DGSAVIDYLLLPSSMDPSDVPKIDW  622
                 + YLLLP++       KIDW
Sbjct  150  QVDLGVVYLLLPTASG-----KIDW  169



>ref|XP_010229604.1| PREDICTED: LOW QUALITY PROTEIN: endoribonuclease Dicer homolog 
2a-like [Brachypodium distachyon]
Length=1398

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 44/144 (31%), Positives = 73/144 (51%), Gaps = 9/144 (6%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQT-LYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  376
            QP YFP E +G   +     +Y CY I L           +IILA++  L SD    SF+
Sbjct  660  QPDYFPEEFLGNWFSFSHLGIYHCYKISLGGCLKTIASPTDIILAVKCDLGSDFIANSFK  719

Query  377  LNIEGGNWVGQTV-YIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL-NLVD  550
            L+    +++  ++ Y+G++ L+ EQ+   RRFQ T+L +L   + +    A+ +  ++ +
Sbjct  720  LS-GAQDFISVSIKYVGNIHLNQEQVNSARRFQTTILSLLINKDHSEASNAIKQFHDMQE  778

Query  551  GSAVIDYLLLPSSMDPSDVPKIDW  622
             S  + YLLLP         K+DW
Sbjct  779  ASVGVVYLLLPFVSG-----KVDW  797



>ref|XP_008644681.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X6 
[Zea mays]
Length=639

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 49/145 (34%), Positives = 69/145 (48%), Gaps = 16/145 (11%)
 Frame = +2

Query  200  QPKYFPPELVGTRDN----APQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENL  367
            QP YFP EL+   DN    + + LY CY I L           +IILA++  +  D    
Sbjct  37   QPVYFPEELM---DNWVSFSLRGLYYCYNISLQGSCNTTADPTDIILAVKCDMGPDFFRY  93

Query  368  SFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLV  547
            SF L   GG  +    Y+  + L+ EQ+L  RRFQ+TVL +L   N + +  A+      
Sbjct  94   SFNL---GGTDI-TIKYLYKIHLNQEQVLFARRFQITVLSLLINSNSSEVSNAIKYFREW  149

Query  548  DGSAVIDYLLLPSSMDPSDVPKIDW  622
                 + YLLLP++       KIDW
Sbjct  150  QVDLGVVYLLLPTASG-----KIDW  169



>ref|XP_008644676.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X1 
[Zea mays]
Length=751

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 49/145 (34%), Positives = 69/145 (48%), Gaps = 16/145 (11%)
 Frame = +2

Query  200  QPKYFPPELVGTRDN----APQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENL  367
            QP YFP EL+   DN    + + LY CY I L           +IILA++  +  D    
Sbjct  37   QPVYFPEELM---DNWVSFSLRGLYYCYNISLQGSCNTTADPTDIILAVKCDMGPDFFRY  93

Query  368  SFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLV  547
            SF L   GG  +    Y+  + L+ EQ+L  RRFQ+TVL +L   N + +  A+      
Sbjct  94   SFNL---GGTDI-TIKYLYKIHLNQEQVLFARRFQITVLSLLINSNSSEVSNAIKYFREW  149

Query  548  DGSAVIDYLLLPSSMDPSDVPKIDW  622
                 + YLLLP++       KIDW
Sbjct  150  QVDLGVVYLLLPTASG-----KIDW  169



>gb|AFW68292.1| hypothetical protein ZEAMMB73_963828 [Zea mays]
Length=251

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 49/145 (34%), Positives = 69/145 (48%), Gaps = 16/145 (11%)
 Frame = +2

Query  200  QPKYFPPELVGTRDN----APQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENL  367
            QP YFP EL+   DN    + + LY CY I L           +IILA++  +  D    
Sbjct  37   QPVYFPEELM---DNWVSFSLRGLYYCYNISLQGSCNTTADPTDIILAVKCDMGPDFFRY  93

Query  368  SFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLV  547
            SF L   GG  +    Y+  + L+ EQ+L  RRFQ+TVL +L   N + +  A+      
Sbjct  94   SFNL---GGTDI-TIKYLYKIHLNQEQVLFARRFQITVLSLLINSNSSEVSNAIKYFREW  149

Query  548  DGSAVIDYLLLPSSMDPSDVPKIDW  622
                 + YLLLP++       KIDW
Sbjct  150  QVDLGVVYLLLPTASG-----KIDW  169



>ref|XP_006651573.1| PREDICTED: endoribonuclease Dicer homolog 2a-like [Oryza brachyantha]
Length=1348

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 46/145 (32%), Positives = 70/145 (48%), Gaps = 13/145 (9%)
 Frame = +2

Query  200  QPKYFPPELVGTRDN----APQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENL  367
            QP YFP E V   DN    + Q +Y CY I L       +   +I+LA++  + SD  ++
Sbjct  604  QPAYFPEEFV---DNWCSFSHQGIYYCYKISLEGCLETDSP-TDILLAVKCDMGSDFTSI  659

Query  368  SFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLV  547
            SF++     N      Y G + L+ EQ++  RRFQ T+L +L   +   +  A+   + +
Sbjct  660  SFQMPGGQDNACVTMNYAGIIHLNQEQVIIARRFQTTILSLLISDDHLVVSNAIKYSHEM  719

Query  548  DGSAVIDYLLLPSSMDPSDVPKIDW  622
              S  + YLLLP         KIDW
Sbjct  720  QVSIGVVYLLLPLVSG-----KIDW  739



>ref|XP_010233057.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X1 
[Brachypodium distachyon]
Length=1248

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 70/145 (48%), Gaps = 20/145 (14%)
 Frame = +2

Query  200  QPKYFPPELVGTRDN----APQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENL  367
            QP YFP ELV   DN    +   +Y CY+I L  +  + T   +IILA++  + SD  + 
Sbjct  506  QPAYFPEELV---DNWLSFSCLGIYICYMISLEGFL-QTTAPTDIILAMKCDMGSDFVSR  561

Query  368  SFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLV  547
            SF+L            Y+G + L+ EQ++  RRFQ ++L +L  + +    E    + +V
Sbjct  562  SFKLYGTQDYVTVAIKYMGIIHLNQEQVIIARRFQTSILSLLINNAIKYYYEMQRSIGIV  621

Query  548  DGSAVIDYLLLPSSMDPSDVPKIDW  622
                   YLLLP         KIDW
Sbjct  622  -------YLLLPLVSG-----KIDW  634



>ref|XP_010233062.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X2 
[Brachypodium distachyon]
 ref|XP_010233066.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X2 
[Brachypodium distachyon]
Length=1144

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 70/145 (48%), Gaps = 20/145 (14%)
 Frame = +2

Query  200  QPKYFPPELVGTRDN----APQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENL  367
            QP YFP ELV   DN    +   +Y CY+I L  +  + T   +IILA++  + SD  + 
Sbjct  402  QPAYFPEELV---DNWLSFSCLGIYICYMISLEGFL-QTTAPTDIILAMKCDMGSDFVSR  457

Query  368  SFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLV  547
            SF+L            Y+G + L+ EQ++  RRFQ ++L +L  + +    E    + +V
Sbjct  458  SFKLYGTQDYVTVAIKYMGIIHLNQEQVIIARRFQTSILSLLINNAIKYYYEMQRSIGIV  517

Query  548  DGSAVIDYLLLPSSMDPSDVPKIDW  622
                   YLLLP         KIDW
Sbjct  518  -------YLLLPLVSG-----KIDW  530



>ref|XP_004982510.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X2 
[Setaria italica]
Length=720

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 53/164 (32%), Positives = 77/164 (47%), Gaps = 28/164 (17%)
 Frame = +2

Query  176  PPYQELGC----------QPKYFPPELVGTRDN----APQTLYSCYLIELNRYYYKRTQL  313
            P   E GC          QP YFP ELV   DN    + + LY CY I +          
Sbjct  10   PSGSEEGCGNAEDTYQHGQPVYFPEELV---DNWVSFSRRGLYYCYNISMRGCLNTDAAP  66

Query  314  QNIILALRTRLESDDENLSFELNIEGGNWVGQTV-YIGDVGLSNEQILRCRRFQVTVLRV  490
             +IILA++  L  +    SF     GG  V  T+ Y+  + L+ EQ++  RRFQ T+L +
Sbjct  67   TDIILAVKCDLGPEFLRNSFN---SGG--VEVTIQYMRIIHLNQEQVIFARRFQTTILSL  121

Query  491  LFEHNLNTLDEALGRLNLVDGSAVIDYLLLPSSMDPSDVPKIDW  622
            L  ++ + + +A+   + +  S  + YLLLPS        KIDW
Sbjct  122  LIGNDHSEVRDAIKYFHELQVSVGVVYLLLPSVSG-----KIDW  160



>ref|XP_004982511.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X3 
[Setaria italica]
Length=719

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 53/164 (32%), Positives = 77/164 (47%), Gaps = 28/164 (17%)
 Frame = +2

Query  176  PPYQELGC----------QPKYFPPELVGTRDN----APQTLYSCYLIELNRYYYKRTQL  313
            P   E GC          QP YFP ELV   DN    + + LY CY I +          
Sbjct  10   PSGSEEGCGNAEDTYQHGQPVYFPEELV---DNWVSFSRRGLYYCYNISMRGCLNTDAAP  66

Query  314  QNIILALRTRLESDDENLSFELNIEGGNWVGQTV-YIGDVGLSNEQILRCRRFQVTVLRV  490
             +IILA++  L  +    SF     GG  V  T+ Y+  + L+ EQ++  RRFQ T+L +
Sbjct  67   TDIILAVKCDLGPEFLRNSFN---SGG--VEVTIQYMRIIHLNQEQVIFARRFQTTILSL  121

Query  491  LFEHNLNTLDEALGRLNLVDGSAVIDYLLLPSSMDPSDVPKIDW  622
            L  ++ + + +A+   + +  S  + YLLLPS        KIDW
Sbjct  122  LIGNDHSEVRDAIKYFHELQVSVGVVYLLLPSVSG-----KIDW  160



>ref|XP_004982509.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X1 
[Setaria italica]
Length=755

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 53/164 (32%), Positives = 77/164 (47%), Gaps = 28/164 (17%)
 Frame = +2

Query  176  PPYQELGC----------QPKYFPPELVGTRDN----APQTLYSCYLIELNRYYYKRTQL  313
            P   E GC          QP YFP ELV   DN    + + LY CY I +          
Sbjct  10   PSGSEEGCGNAEDTYQHGQPVYFPEELV---DNWVSFSRRGLYYCYNISMRGCLNTDAAP  66

Query  314  QNIILALRTRLESDDENLSFELNIEGGNWVGQTV-YIGDVGLSNEQILRCRRFQVTVLRV  490
             +IILA++  L  +    SF     GG  V  T+ Y+  + L+ EQ++  RRFQ T+L +
Sbjct  67   TDIILAVKCDLGPEFLRNSFN---SGG--VEVTIQYMRIIHLNQEQVIFARRFQTTILSL  121

Query  491  LFEHNLNTLDEALGRLNLVDGSAVIDYLLLPSSMDPSDVPKIDW  622
            L  ++ + + +A+   + +  S  + YLLLPS        KIDW
Sbjct  122  LIGNDHSEVRDAIKYFHELQVSVGVVYLLLPSVSG-----KIDW  160



>gb|AAS07190.1| putative ribonuclease III, 5'-partial (with alternative splicing) 
[Oryza sativa Japonica Group]
Length=538

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 45/142 (32%), Positives = 65/142 (46%), Gaps = 7/142 (5%)
 Frame = +2

Query  200  QPKYFPPELVGT-RDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  376
            QP YFP E V   R  +   +Y CY I L     K     +I+LAL+  L SD  + SF+
Sbjct  274  QPSYFPEEFVDNWRSFSRLGIYYCYKISLEGCP-KTASPTDILLALKCDLGSDFTSSSFK  332

Query  377  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  556
            L     N      Y+G + L+ EQ++  RRFQ T+L  L   +   +   +   + +   
Sbjct  333  LPGGQDNASVTMKYVGIIHLNQEQVIIARRFQTTILSFLIGDDHLEVSNGIKYFHEMQVP  392

Query  557  AVIDYLLLPSSMDPSDVPKIDW  622
              + YLLLP         +IDW
Sbjct  393  IGVVYLLLPLVSG-----RIDW  409



>ref|XP_002464288.1| hypothetical protein SORBIDRAFT_01g015663 [Sorghum bicolor]
 gb|EER91286.1| hypothetical protein SORBIDRAFT_01g015663 [Sorghum bicolor]
Length=255

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 50/148 (34%), Positives = 72/148 (49%), Gaps = 20/148 (14%)
 Frame = +2

Query  200  QPKYFPPELVGTRDN----APQTLYSCYLIELNRYYYKRTQLQ--NIILALRTRLESDDE  361
            QP YFP ELV   DN    +   LY CY I ++      T     NIILA++  +  D  
Sbjct  38   QPVYFPEELV---DNWVSFSRHGLYYCYSINISLQGSCNTAADPTNIILAVKCDMGPDFF  94

Query  362  NLSFELNIEGGNWVGQTV-YIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  538
              SF     GG  +G T+ Y+  + L+ EQ++  RRFQ TVL +L   +   + +A+   
Sbjct  95   WHSFN---SGG--IGITIKYLCKIHLNQEQVIFARRFQTTVLSLLINSDHLEVSDAIKYF  149

Query  539  NLVDGSAVIDYLLLPSSMDPSDVPKIDW  622
            + +     + YLLLP+        KIDW
Sbjct  150  HELQVDVGVVYLLLPTVYG-----KIDW  172



>ref|XP_004982512.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X4 
[Setaria italica]
Length=654

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 53/164 (32%), Positives = 77/164 (47%), Gaps = 28/164 (17%)
 Frame = +2

Query  176  PPYQELGC----------QPKYFPPELVGTRDN----APQTLYSCYLIELNRYYYKRTQL  313
            P   E GC          QP YFP ELV   DN    + + LY CY I +          
Sbjct  10   PSGSEEGCGNAEDTYQHGQPVYFPEELV---DNWVSFSRRGLYYCYNISMRGCLNTDAAP  66

Query  314  QNIILALRTRLESDDENLSFELNIEGGNWVGQTV-YIGDVGLSNEQILRCRRFQVTVLRV  490
             +IILA++  L  +    SF     GG  V  T+ Y+  + L+ EQ++  RRFQ T+L +
Sbjct  67   TDIILAVKCDLGPEFLRNSFN---SGG--VEVTIQYMRIIHLNQEQVIFARRFQTTILSL  121

Query  491  LFEHNLNTLDEALGRLNLVDGSAVIDYLLLPSSMDPSDVPKIDW  622
            L  ++ + + +A+   + +  S  + YLLLPS        KIDW
Sbjct  122  LIGNDHSEVRDAIKYFHELQVSVGVVYLLLPSVSG-----KIDW  160



>gb|EEE59414.1| hypothetical protein OsJ_11564 [Oryza sativa Japonica Group]
Length=1371

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 45/142 (32%), Positives = 65/142 (46%), Gaps = 7/142 (5%)
 Frame = +2

Query  200  QPKYFPPELVGT-RDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  376
            QP YFP E V   R  +   +Y CY I L     K     +I+LAL+  L SD  + SF+
Sbjct  632  QPSYFPEEFVDNWRSFSRLGIYYCYKISLEGCP-KTASPTDILLALKCDLGSDFTSSSFK  690

Query  377  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  556
            L     N      Y+G + L+ EQ++  RRFQ T+L  L   +   +   +   + +   
Sbjct  691  LPGGQDNASVTMKYVGIIHLNQEQVIIARRFQTTILSFLIGDDHLEVSNGIKYFHEMQVP  750

Query  557  AVIDYLLLPSSMDPSDVPKIDW  622
              + YLLLP         +IDW
Sbjct  751  IGVVYLLLPLVSG-----RIDW  767



>gb|AAS07189.1| putative ribonuclease III, 5'-partial (with alternative splicing) 
[Oryza sativa Japonica Group]
Length=1017

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 45/142 (32%), Positives = 65/142 (46%), Gaps = 7/142 (5%)
 Frame = +2

Query  200  QPKYFPPELVGT-RDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  376
            QP YFP E V   R  +   +Y CY I L     K     +I+LAL+  L SD  + SF+
Sbjct  274  QPSYFPEEFVDNWRSFSRLGIYYCYKISLEGCP-KTASPTDILLALKCDLGSDFTSSSFK  332

Query  377  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  556
            L     N      Y+G + L+ EQ++  RRFQ T+L  L   +   +   +   + +   
Sbjct  333  LPGGQDNASVTMKYVGIIHLNQEQVIIARRFQTTILSFLIGDDHLEVSNGIKYFHEMQVP  392

Query  557  AVIDYLLLPSSMDPSDVPKIDW  622
              + YLLLP         +IDW
Sbjct  393  IGVVYLLLPLVSG-----RIDW  409



>dbj|BAD34005.1| CAF protein-like [Oryza sativa Japonica Group]
 dbj|BAD36404.1| CAF protein-like [Oryza sativa Japonica Group]
Length=1375

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 45/142 (32%), Positives = 65/142 (46%), Gaps = 7/142 (5%)
 Frame = +2

Query  200  QPKYFPPELVGT-RDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  376
            QP YFP E V   R  +   +Y CY I L     K     +I+LAL+  L SD  + SF+
Sbjct  636  QPSYFPEEFVDNWRSFSRLGIYYCYKISLEGCP-KTASPTDILLALKCDLGSDFTSSSFK  694

Query  377  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  556
            L     N      Y+G + L+ EQ++  RRFQ T+L  L   +   +   +   + +   
Sbjct  695  LPGGQDNASVTMKYVGIIHLNQEQVIIARRFQTTILSFLIGDDHLEVSNGIKYFHEMQVP  754

Query  557  AVIDYLLLPSSMDPSDVPKIDW  622
              + YLLLP         +IDW
Sbjct  755  IGVVYLLLPLVSG-----RIDW  771



>sp|Q69LX2.2|DCL2B_ORYSJ RecName: Full=Endoribonuclease Dicer homolog 2b; AltName: Full=Dicer-like 
protein 2b; Short=OsDCL2b [Oryza sativa Japonica 
Group]
Length=1377

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 45/142 (32%), Positives = 65/142 (46%), Gaps = 7/142 (5%)
 Frame = +2

Query  200  QPKYFPPELVGT-RDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  376
            QP YFP E V   R  +   +Y CY I L     K     +I+LAL+  L SD  + SF+
Sbjct  638  QPSYFPEEFVDNWRSFSRLGIYYCYKISLEGCP-KTASPTDILLALKCDLGSDFTSSSFK  696

Query  377  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  556
            L     N      Y+G + L+ EQ++  RRFQ T+L  L   +   +   +   + +   
Sbjct  697  LPGGQDNASVTMKYVGIIHLNQEQVIIARRFQTTILSFLIGDDHLEVSNGIKYFHEMQVP  756

Query  557  AVIDYLLLPSSMDPSDVPKIDW  622
              + YLLLP         +IDW
Sbjct  757  IGVVYLLLPLVSG-----RIDW  773



>ref|NP_001050564.1| Os03g0583900 [Oryza sativa Japonica Group]
 sp|Q10HL3.1|DCL2A_ORYSJ RecName: Full=Endoribonuclease Dicer homolog 2a; AltName: Full=Dicer-like 
protein 2a; Short=OsDCL2a [Oryza sativa Japonica 
Group]
 gb|AAT76309.1| putative RNA helicase/RNAseIII protein, C-terminus truncated 
[Oryza sativa Japonica Group]
 gb|ABF97330.1| Type III restriction enzyme, res subunit family protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF12478.1| Os03g0583900 [Oryza sativa Japonica Group]
 dbj|BAG92928.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1410

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 45/142 (32%), Positives = 65/142 (46%), Gaps = 7/142 (5%)
 Frame = +2

Query  200  QPKYFPPELVGT-RDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  376
            QP YFP E V   R  +   +Y CY I L     K     +I+LAL+  L SD  + SF+
Sbjct  667  QPSYFPEEFVDNWRSFSRLGIYYCYKISLEGCP-KTASPTDILLALKCDLGSDFTSSSFK  725

Query  377  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  556
            L     N      Y+G + L+ EQ++  RRFQ T+L  L   +   +   +   + +   
Sbjct  726  LPGGQDNASVTMKYVGIIHLNQEQVIIARRFQTTILSFLIGDDHLEVSNGIKYFHEMQVP  785

Query  557  AVIDYLLLPSSMDPSDVPKIDW  622
              + YLLLP         +IDW
Sbjct  786  IGVVYLLLPLVSG-----RIDW  802



>gb|EEC75643.1| hypothetical protein OsI_12390 [Oryza sativa Indica Group]
Length=1318

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 45/142 (32%), Positives = 65/142 (46%), Gaps = 7/142 (5%)
 Frame = +2

Query  200  QPKYFPPELVGT-RDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  376
            QP YFP E V   R  +   +Y CY I L     K     +I+LAL+  L SD  + SF+
Sbjct  575  QPSYFPEEFVDNWRSFSRLGIYYCYKISLEGCP-KTASPTDILLALKCDLGSDFTSSSFK  633

Query  377  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  556
            L     N      Y+G + L+ EQ++  RRFQ T+L  L   +   +   +   + +   
Sbjct  634  LPGGQDNASVTMKYVGIIHLNQEQVIIARRFQTTILSFLIGDDHLEVSNGIKYFHEMQVP  693

Query  557  AVIDYLLLPSSMDPSDVPKIDW  622
              + YLLLP         +IDW
Sbjct  694  IGVVYLLLPLVSG-----RIDW  710



>ref|XP_004982513.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X1 
[Setaria italica]
Length=1404

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 45/143 (31%), Positives = 67/143 (47%), Gaps = 8/143 (6%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQT-LYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  376
            QP YFP +LV +  +  +  LY CY I L            I+LA++  + SD  + SF+
Sbjct  667  QPNYFPEQLVDSWLSFSRLGLYHCYEISLEWCSKTANSPAEIVLAVKCDMGSDFISNSFK  726

Query  377  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHN-LNTLDEALGRLNLVDG  553
            +     +      YIG + L+ EQ++  RRFQ  +L +L  +N L   D     L +   
Sbjct  727  MWGVQDHVSVTMRYIGIIHLNQEQVIVARRFQTAILSLLISNNQLEVRDSIKNSLEMQAS  786

Query  554  SAVIDYLLLPSSMDPSDVPKIDW  622
              V+ YL+LP         KIDW
Sbjct  787  PGVV-YLVLPLVSG-----KIDW  803



>ref|XP_004982514.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X2 
[Setaria italica]
Length=1199

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 45/143 (31%), Positives = 67/143 (47%), Gaps = 8/143 (6%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQT-LYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  376
            QP YFP +LV +  +  +  LY CY I L            I+LA++  + SD  + SF+
Sbjct  667  QPNYFPEQLVDSWLSFSRLGLYHCYEISLEWCSKTANSPAEIVLAVKCDMGSDFISNSFK  726

Query  377  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHN-LNTLDEALGRLNLVDG  553
            +     +      YIG + L+ EQ++  RRFQ  +L +L  +N L   D     L +   
Sbjct  727  MWGVQDHVSVTMRYIGIIHLNQEQVIVARRFQTAILSLLISNNQLEVRDSIKNSLEMQAS  786

Query  554  SAVIDYLLLPSSMDPSDVPKIDW  622
              V+ YL+LP         KIDW
Sbjct  787  PGVV-YLVLPLVSG-----KIDW  803



>gb|AAS07188.1| putative ribonuclease III, 5'-partial (with alternative splicing) 
[Oryza sativa Japonica Group]
Length=416

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 64/130 (49%), Gaps = 3/130 (2%)
 Frame = +2

Query  200  QPKYFPPELVGT-RDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  376
            QP YFP E V   R  +   +Y CY I L     K     +I+LAL+  L SD  + SF+
Sbjct  274  QPSYFPEEFVDNWRSFSRLGIYYCYKISLEGCP-KTASPTDILLALKCDLGSDFTSSSFK  332

Query  377  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLF-EHNLNTLDEALGRLNLVDG  553
            L     N      Y+G + L+ EQ++  RRFQ T+L  L  + +L  L     ++ L  G
Sbjct  333  LPGGQDNASVTMKYVGIIHLNQEQVIIARRFQTTILSFLIGDDHLEILIYCRQKMVLSAG  392

Query  554  SAVIDYLLLP  583
            +++   L +P
Sbjct  393  ASLKIPLCVP  402



>ref|XP_002464290.1| hypothetical protein SORBIDRAFT_01g015670 [Sorghum bicolor]
 gb|EER91288.1| hypothetical protein SORBIDRAFT_01g015670 [Sorghum bicolor]
Length=1385

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 47/147 (32%), Positives = 76/147 (52%), Gaps = 17/147 (12%)
 Frame = +2

Query  200  QPKYFPPELVGTRDN----APQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENL  367
            QP YFP +L+   DN      + LY CY I L       T  + I+LA++  L SD  + 
Sbjct  676  QPDYFPEQLM---DNWLSFCHRGLYYCYKISLEGCSETTTPAE-IVLAVKCDLGSDFIST  731

Query  368  SFEL-NIEGGNWVGQTV-YIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLN  541
            +F+L  ++  +++  T+ Y+G + L+ EQ++  RRFQ  +L +L   +L+    ++  L 
Sbjct  732  TFKLWGVQ--DYLSFTIRYVGVIHLNQEQVIVARRFQTRILSLLISKDLSEDGNSIKSLL  789

Query  542  LVDGSAVIDYLLLPSSMDPSDVPKIDW  622
             +  S+   YLLLP         KIDW
Sbjct  790  EMQVSSGAVYLLLPVVSG-----KIDW  811



>gb|EMS67762.1| Endoribonuclease Dicer-like protein 2a [Triticum urartu]
Length=473

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/142 (30%), Positives = 67/142 (47%), Gaps = 6/142 (4%)
 Frame = +2

Query  200  QPKYFPPELVGTRDNAPQT-LYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  376
            QP+YFP E V    +  +  +Y CY I +           +I+LA++  L  D  + S +
Sbjct  205  QPEYFPEEFVYNWLSFSRLGIYYCYKISVEGCLKTTYCPNDILLAVKCDLGPDFVSTSLK  264

Query  377  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRLNLVDGS  556
               E  N      Y+G + L+ EQ++  RRFQ T+L +L   + + +  A+   + +  S
Sbjct  265  NFGEQDNASVAMKYVGIIHLNQEQVVMARRFQTTILSLLINKDHSEVINAVKYSHEMQVS  324

Query  557  AVIDYLLLPSSMDPSDVPKIDW  622
              I YLLLP         K+DW
Sbjct  325  IGIVYLLLPLVSG-----KVDW  341



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250