BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS075E01

Length=624
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004243472.1|  PREDICTED: aconitate hydratase, cytoplasmic        228   1e-65   Solanum lycopersicum
ref|XP_006366590.1|  PREDICTED: aconitate hydratase 2, mitochondr...    228   1e-65   Solanum tuberosum [potatoes]
gb|KDP22711.1|  hypothetical protein JCGZ_01813                         224   3e-64   Jatropha curcas
dbj|BAG16527.1|  putative aconitase                                     223   1e-63   Capsicum chinense [bonnet pepper]
ref|XP_009770911.1|  PREDICTED: aconitate hydratase, cytoplasmic        221   6e-63   Nicotiana sylvestris
ref|XP_006376779.1|  aconitate hydratase family protein                 220   1e-62   Populus trichocarpa [western balsam poplar]
ref|XP_002524184.1|  aconitase, putative                                219   1e-62   Ricinus communis
ref|XP_011047264.1|  PREDICTED: aconitate hydratase, cytoplasmic        219   2e-62   Populus euphratica
ref|XP_010276105.1|  PREDICTED: aconitate hydratase, cytoplasmic        218   5e-62   Nelumbo nucifera [Indian lotus]
ref|XP_011095404.1|  PREDICTED: putative aconitate hydratase, cyt...    217   1e-61   Sesamum indicum [beniseed]
emb|CDP05740.1|  unnamed protein product                                217   2e-61   Coffea canephora [robusta coffee]
ref|XP_009601350.1|  PREDICTED: aconitate hydratase, cytoplasmic        216   2e-61   Nicotiana tomentosiformis
ref|XP_002321126.2|  hypothetical protein POPTR_0014s15170g             216   3e-61   Populus trichocarpa [western balsam poplar]
emb|CDP10817.1|  unnamed protein product                                216   3e-61   Coffea canephora [robusta coffee]
ref|XP_011048785.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    215   7e-61   Populus euphratica
gb|KDO62733.1|  hypothetical protein CISIN_1g001863mg                   211   6e-60   Citrus sinensis [apfelsine]
ref|XP_006452377.1|  hypothetical protein CICLE_v10007338mg             211   1e-59   Citrus clementina [clementine]
gb|EPS60517.1|  hypothetical protein M569_14286                         208   9e-59   Genlisea aurea
ref|XP_010046497.1|  PREDICTED: aconitate hydratase, cytoplasmic        208   2e-58   Eucalyptus grandis [rose gum]
ref|XP_006351962.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    207   2e-58   Solanum tuberosum [potatoes]
ref|XP_010278679.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    206   1e-57   Nelumbo nucifera [Indian lotus]
gb|KDO54659.1|  hypothetical protein CISIN_1g001917mg                   205   1e-57   Citrus sinensis [apfelsine]
gb|KDO54660.1|  hypothetical protein CISIN_1g001917mg                   204   2e-57   Citrus sinensis [apfelsine]
gb|KDO54661.1|  hypothetical protein CISIN_1g001917mg                   204   2e-57   Citrus sinensis [apfelsine]
ref|XP_006447556.1|  hypothetical protein CICLE_v10014140mg             204   3e-57   
gb|KDO54657.1|  hypothetical protein CISIN_1g001917mg                   205   3e-57   Citrus sinensis [apfelsine]
gb|KDO54656.1|  hypothetical protein CISIN_1g001917mg                   205   3e-57   Citrus sinensis [apfelsine]
ref|XP_006447555.1|  hypothetical protein CICLE_v10014140mg             204   5e-57   Citrus clementina [clementine]
ref|XP_002278138.1|  PREDICTED: aconitate hydratase, cytoplasmic        203   1e-56   Vitis vinifera
gb|EYU27339.1|  hypothetical protein MIMGU_mgv1a000710mg                203   1e-56   Erythranthe guttata [common monkey flower]
ref|XP_009598331.1|  PREDICTED: aconitate hydratase 2, mitochondr...    201   4e-56   Nicotiana tomentosiformis
ref|XP_009598330.1|  PREDICTED: aconitate hydratase, cytoplasmic ...    201   1e-55   Nicotiana tomentosiformis
ref|XP_009787326.1|  PREDICTED: aconitate hydratase 2, mitochondr...    197   8e-55   Nicotiana sylvestris
ref|XP_003543388.1|  PREDICTED: aconitate hydratase 2, mitochondr...    198   9e-55   Glycine max [soybeans]
gb|KJB60836.1|  hypothetical protein B456_009G327800                    196   2e-54   Gossypium raimondii
gb|KJB60837.1|  hypothetical protein B456_009G327800                    196   2e-54   Gossypium raimondii
gb|KHN36531.1|  Aconitate hydratase, cytoplasmic                        197   2e-54   Glycine soja [wild soybean]
ref|XP_009787319.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    197   3e-54   Nicotiana sylvestris
gb|KJB60835.1|  hypothetical protein B456_009G327800                    196   4e-54   Gossypium raimondii
ref|XP_007045642.1|  Aconitase 3                                        196   4e-54   
ref|XP_004251517.2|  PREDICTED: aconitate hydratase, cytoplasmic        194   1e-53   Solanum lycopersicum
ref|XP_003540302.1|  PREDICTED: aconitate hydratase 2, mitochondr...    194   2e-53   Glycine max [soybeans]
gb|KJB50479.1|  hypothetical protein B456_008G173400                    193   4e-53   Gossypium raimondii
gb|KHG15607.1|  Aconitate hydratase 2, mitochondrial -like protein      190   8e-53   Gossypium arboreum [tree cotton]
ref|XP_007149973.1|  hypothetical protein PHAVU_005G115100g             192   1e-52   Phaseolus vulgaris [French bean]
ref|XP_010445106.1|  PREDICTED: aconitate hydratase 3, mitochondr...    184   1e-52   
gb|KHG18502.1|  Aconitate hydratase 2, mitochondrial -like protein      191   3e-52   Gossypium arboreum [tree cotton]
gb|KJB62848.1|  hypothetical protein B456_009G440000                    190   3e-52   Gossypium raimondii
gb|KDP39136.1|  hypothetical protein JCGZ_00893                         191   4e-52   Jatropha curcas
ref|XP_011100304.1|  PREDICTED: aconitate hydratase, cytoplasmic        191   4e-52   Sesamum indicum [beniseed]
gb|KJB62847.1|  hypothetical protein B456_009G440000                    190   8e-52   Gossypium raimondii
gb|EYU24785.1|  hypothetical protein MIMGU_mgv1a000742mg                189   1e-51   Erythranthe guttata [common monkey flower]
ref|XP_003596988.1|  Aconitate hydratase                                189   2e-51   Medicago truncatula
ref|XP_004159202.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    189   2e-51   
ref|XP_008455442.1|  PREDICTED: aconitate hydratase, cytoplasmic        189   2e-51   Cucumis melo [Oriental melon]
ref|XP_006346211.1|  PREDICTED: aconitate hydratase 2, mitochondr...    188   3e-51   Solanum tuberosum [potatoes]
ref|XP_004144496.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    188   4e-51   Cucumis sativus [cucumbers]
ref|XP_010448188.1|  PREDICTED: aconitate hydratase 3, mitochondr...    187   5e-51   Camelina sativa [gold-of-pleasure]
ref|XP_009599619.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    186   1e-50   Nicotiana tomentosiformis
ref|XP_008379632.1|  PREDICTED: aconitate hydratase, cytoplasmic        186   1e-50   
ref|XP_009769027.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    186   1e-50   Nicotiana sylvestris
ref|XP_004487412.1|  PREDICTED: aconitate hydratase 2, mitochondr...    186   2e-50   Cicer arietinum [garbanzo]
ref|XP_003527493.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    186   2e-50   Glycine max [soybeans]
ref|XP_009353280.1|  PREDICTED: aconitate hydratase, cytoplasmic        186   2e-50   Pyrus x bretschneideri [bai li]
ref|XP_006592372.1|  PREDICTED: aconitate hydratase 2, mitochondr...    184   3e-50   Glycine max [soybeans]
ref|NP_567763.2|  aconitase 2                                           185   3e-50   Arabidopsis thaliana [mouse-ear cress]
gb|AAK91447.1|  AT4g26970/F10M23_310                                    185   3e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003539865.1|  PREDICTED: aconitate hydratase 2, mitochondr...    185   4e-50   Glycine max [soybeans]
ref|XP_002869584.1|  hypothetical protein ARALYDRAFT_492099             185   5e-50   
ref|XP_010488774.1|  PREDICTED: aconitate hydratase 2, mitochondrial    184   9e-50   Camelina sativa [gold-of-pleasure]
ref|XP_006413121.1|  hypothetical protein EUTSA_v10024309mg             184   1e-49   Eutrema salsugineum [saltwater cress]
ref|XP_010467089.1|  PREDICTED: aconitate hydratase 2, mitochondr...    184   1e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010433420.1|  PREDICTED: aconitate hydratase 3, mitochondrial    183   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_006283068.1|  hypothetical protein CARUB_v10004061mg             183   2e-49   Capsella rubella
emb|CDY66424.1|  BnaAnng22230D                                          182   3e-49   Brassica napus [oilseed rape]
emb|CDY14291.1|  BnaA08g14220D                                          182   3e-49   Brassica napus [oilseed rape]
gb|KHG08190.1|  Aconitate hydratase 2, mitochondrial                    182   3e-49   Gossypium arboreum [tree cotton]
ref|XP_002883704.1|  hypothetical protein ARALYDRAFT_480186             182   4e-49   
ref|XP_009109156.1|  PREDICTED: aconitate hydratase 3, mitochondrial    182   6e-49   Brassica rapa
ref|XP_008230066.1|  PREDICTED: aconitate hydratase, cytoplasmic        181   8e-49   Prunus mume [ume]
ref|XP_010412716.1|  PREDICTED: aconitate hydratase 2, mitochondr...    181   9e-49   
gb|KJB30569.1|  hypothetical protein B456_005G149700                    180   2e-48   Gossypium raimondii
gb|KJB30566.1|  hypothetical protein B456_005G149700                    180   2e-48   Gossypium raimondii
emb|CDY50945.1|  BnaC03g74450D                                          180   2e-48   Brassica napus [oilseed rape]
ref|XP_007217144.1|  hypothetical protein PRUPE_ppa000812mg             180   3e-48   Prunus persica
ref|XP_008342002.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    179   4e-48   
ref|XP_006296904.1|  hypothetical protein CARUB_v10012896mg             179   4e-48   Capsella rubella
gb|KFK29204.1|  hypothetical protein AALP_AA7G102800                    178   9e-48   Arabis alpina [alpine rockcress]
ref|XP_010675721.1|  PREDICTED: putative aconitate hydratase, cyt...    178   1e-47   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009148490.1|  PREDICTED: aconitate hydratase 2, mitochondrial    178   2e-47   Brassica rapa
emb|CDX97969.1|  BnaA06g07200D                                          177   2e-47   
gb|KFK39331.1|  hypothetical protein AALP_AA3G230700                    177   3e-47   Arabis alpina [alpine rockcress]
ref|XP_003605929.1|  Aconitate hydratase                                176   5e-47   Medicago truncatula
ref|XP_010929878.1|  PREDICTED: putative aconitate hydratase, cyt...    176   7e-47   Elaeis guineensis
ref|XP_008804304.1|  PREDICTED: putative aconitate hydratase, cyt...    176   1e-46   Phoenix dactylifera
ref|XP_010450391.1|  PREDICTED: aconitate hydratase 2, mitochondr...    175   1e-46   Camelina sativa [gold-of-pleasure]
gb|KHG02134.1|  hypothetical protein F383_25649                         175   2e-46   Gossypium arboreum [tree cotton]
ref|NP_178634.2|  aconitate hydratase 3                                 175   2e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009136177.1|  PREDICTED: aconitate hydratase 2, mitochondrial    175   2e-46   Brassica rapa
emb|CDY18054.1|  BnaC07g04160D                                          174   3e-46   Brassica napus [oilseed rape]
ref|XP_006396145.1|  hypothetical protein EUTSA_v10002387mg             174   3e-46   Eutrema salsugineum [saltwater cress]
ref|XP_010440740.1|  PREDICTED: aconitate hydratase 2, mitochondr...    172   1e-45   Camelina sativa [gold-of-pleasure]
ref|XP_002870438.1|  predicted protein                                  172   1e-45   Arabidopsis lyrata subsp. lyrata
ref|XP_002279260.1|  PREDICTED: aconitate hydratase, cytoplasmic        171   3e-45   Vitis vinifera
emb|CDX93088.1|  BnaA03g38100D                                          171   3e-45   
ref|XP_010533007.1|  PREDICTED: aconitate hydratase, cytoplasmic ...    170   7e-45   Tarenaya hassleriana [spider flower]
emb|CDY56501.1|  BnaAnng14360D                                          170   7e-45   Brassica napus [oilseed rape]
ref|XP_010443085.1|  PREDICTED: aconitate hydratase 3, mitochondr...    169   1e-44   Camelina sativa [gold-of-pleasure]
ref|XP_004517086.1|  PREDICTED: aconitate hydratase 2, mitochondr...    168   5e-44   Cicer arietinum [garbanzo]
ref|XP_004287944.1|  PREDICTED: aconitate hydratase, cytoplasmic        165   4e-43   Fragaria vesca subsp. vesca
ref|XP_007132546.1|  hypothetical protein PHAVU_011G1037001g            163   2e-42   Phaseolus vulgaris [French bean]
ref|XP_002532564.1|  aconitase, putative                                162   3e-42   
ref|XP_009419582.1|  PREDICTED: putative aconitate hydratase, cyt...    158   2e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010482909.1|  PREDICTED: putative aconitate hydratase, cyt...    157   4e-40   
ref|XP_008800034.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    156   5e-40   Phoenix dactylifera
ref|XP_010918136.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    155   2e-39   Elaeis guineensis
ref|XP_010943467.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    155   2e-39   Elaeis guineensis
ref|XP_008785050.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    154   4e-39   Phoenix dactylifera
gb|EEC83022.1|  hypothetical protein OsI_28099                          148   1e-38   Oryza sativa Indica Group [Indian rice]
ref|XP_009399225.1|  PREDICTED: putative aconitate hydratase, cyt...    152   1e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008676648.1|  PREDICTED: uncharacterized protein LOC100216...    151   5e-38   
ref|XP_002445174.1|  hypothetical protein SORBIDRAFT_07g005390          150   8e-38   Sorghum bicolor [broomcorn]
ref|XP_007020811.1|  Aconitase 3                                        149   1e-37   
ref|XP_006828850.1|  hypothetical protein AMTR_s00001p00156400          148   3e-37   Amborella trichopoda
ref|XP_004974379.1|  PREDICTED: putative aconitate hydratase, cyt...    148   4e-37   
gb|AAD25640.1|  cytoplasmic aconitate hydratase                         147   6e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009382046.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    146   2e-36   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAO62410.1|  aconitase                                               144   1e-35   Solanum pennellii
gb|AAP30039.1|  aconitase                                               142   3e-35   Solanum pennellii
ref|XP_009384004.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    142   4e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003573387.2|  PREDICTED: putative aconitate hydratase, cyt...    142   5e-35   Brachypodium distachyon [annual false brome]
gb|AAG28426.1|AF194945_1  cytosolic aconitase                           140   3e-34   Nicotiana tabacum [American tobacco]
gb|AAC26045.1|  aconitase-iron regulated protein 1                      139   4e-34   Citrus limon [lemon]
ref|XP_011097878.1|  PREDICTED: putative aconitate hydratase, cyt...    139   5e-34   
gb|KHG08189.1|  hypothetical protein F383_11434                         139   5e-34   Gossypium arboreum [tree cotton]
emb|CBE71057.1|  aconitate hydratase 3                                  139   5e-34   Citrus clementina [clementine]
emb|CBE71058.1|  aconitate hydratase 2                                  137   3e-33   Citrus clementina [clementine]
gb|ADM34980.1|  cytosolic aconitase                                     136   4e-33   Pyrus pyrifolia [sha li]
sp|Q6YZX6.1|ACOC_ORYSJ  RecName: Full=Putative aconitate hydratas...    136   5e-33   Oryza sativa Japonica Group [Japonica rice]
gb|KHN41224.1|  Aconitate hydratase, cytoplasmic                        136   6e-33   Glycine soja [wild soybean]
gb|KJB30565.1|  hypothetical protein B456_005G149700                    136   7e-33   Gossypium raimondii
sp|P49608.1|ACOC_CUCMA  RecName: Full=Aconitate hydratase, cytopl...    136   7e-33   Cucurbita maxima [Boston marrow]
ref|XP_002445994.1|  hypothetical protein SORBIDRAFT_06g000200          123   4e-32   
dbj|BAJ85661.1|  predicted protein                                      133   7e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007020807.1|  Aconitase 3                                        132   8e-32   
ref|XP_006413195.1|  hypothetical protein EUTSA_v10024325mg             132   2e-31   
emb|CAB36543.1|  putative aconitase                                     130   6e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008363093.1|  PREDICTED: aconitate hydratase 1-like              119   2e-30   
gb|EMS45933.1|  Putative aconitate hydratase, cytoplasmic               127   1e-29   Triticum urartu
gb|KDO71346.1|  hypothetical protein CISIN_1g002610mg                   126   1e-29   Citrus sinensis [apfelsine]
gb|KDO71343.1|  hypothetical protein CISIN_1g002610mg                   126   2e-29   Citrus sinensis [apfelsine]
gb|KDO71342.1|  hypothetical protein CISIN_1g002610mg                   126   2e-29   Citrus sinensis [apfelsine]
gb|KDO71344.1|  hypothetical protein CISIN_1g002610mg                   126   2e-29   Citrus sinensis [apfelsine]
ref|XP_004287770.1|  PREDICTED: aconitate hydratase 1                   125   2e-29   Fragaria vesca subsp. vesca
ref|XP_008669746.1|  PREDICTED: putative aconitate hydratase, cyt...    125   3e-29   Zea mays [maize]
emb|CAA58046.1|  aconitase                                              125   3e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007046597.1|  Aconitase 1                                        125   4e-29   
gb|EMT33022.1|  Putative aconitate hydratase, cytoplasmic               125   5e-29   
emb|CDX69174.1|  BnaC01g02790D                                          124   6e-29   
gb|KFK30197.1|  hypothetical protein AALP_AA7G230700                    124   6e-29   Arabis alpina [alpine rockcress]
ref|XP_009109264.1|  PREDICTED: aconitate hydratase 1-like              124   1e-28   Brassica rapa
gb|KHG25175.1|  Aconitate hydratase, cytoplasmic                        124   1e-28   Gossypium arboreum [tree cotton]
ref|XP_009150005.1|  PREDICTED: aconitate hydratase 1                   124   1e-28   Brassica rapa
ref|NP_195308.1|  aconitate hydratase 1                                 124   1e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006285963.1|  hypothetical protein CARUB_v10007484mg             124   1e-28   Capsella rubella
gb|KHG25176.1|  Aconitate hydratase, cytoplasmic                        124   1e-28   Gossypium arboreum [tree cotton]
ref|XP_006412054.1|  hypothetical protein EUTSA_v10024358mg             123   1e-28   
emb|CBE71056.1|  aconitate hydratase 1                                  124   1e-28   Citrus clementina [clementine]
ref|XP_006467022.1|  PREDICTED: aconitate hydratase 1                   124   1e-28   Citrus sinensis [apfelsine]
ref|XP_002460765.1|  hypothetical protein SORBIDRAFT_02g034590          122   2e-28   Sorghum bicolor [broomcorn]
ref|XP_006412056.1|  hypothetical protein EUTSA_v10024358mg             123   2e-28   Eutrema salsugineum [saltwater cress]
ref|XP_001779205.1|  predicted protein                                  123   2e-28   
ref|XP_008669747.1|  PREDICTED: putative aconitate hydratase, cyt...    123   2e-28   Zea mays [maize]
ref|XP_010526818.1|  PREDICTED: aconitate hydratase 1                   123   2e-28   Tarenaya hassleriana [spider flower]
ref|NP_001147431.1|  aconitase2                                         123   2e-28   Zea mays [maize]
ref|XP_008661884.1|  PREDICTED: aconitase2 isoform X1                   123   2e-28   
ref|XP_010446873.1|  PREDICTED: aconitate hydratase 1                   123   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_006425366.1|  hypothetical protein CICLE_v10024840mg             122   3e-28   Citrus clementina [clementine]
ref|XP_010437416.1|  PREDICTED: aconitate hydratase 1-like              122   3e-28   Camelina sativa [gold-of-pleasure]
gb|KHN41868.1|  Aconitate hydratase 1                                   122   4e-28   Glycine soja [wild soybean]
ref|XP_010432222.1|  PREDICTED: aconitate hydratase 1-like              122   4e-28   Camelina sativa [gold-of-pleasure]
gb|KJB48278.1|  hypothetical protein B456_008G061900                    122   4e-28   Gossypium raimondii
emb|CDX75532.1|  BnaA01g01700D                                          122   6e-28   
gb|AAL13084.1|  putative aconitase                                      122   6e-28   Prunus avium [gean]
gb|KDP23953.1|  hypothetical protein JCGZ_25341                         121   7e-28   Jatropha curcas
ref|XP_008242011.1|  PREDICTED: aconitate hydratase 1                   121   7e-28   Prunus mume [ume]
ref|XP_007203240.1|  hypothetical protein PRUPE_ppa001138mg             121   7e-28   Prunus persica
emb|CDY41626.1|  BnaC03g62580D                                          121   8e-28   Brassica napus [oilseed rape]
ref|XP_006380559.1|  hypothetical protein POPTR_0007s09260g             120   1e-27   Populus trichocarpa [western balsam poplar]
ref|XP_010266897.1|  PREDICTED: aconitate hydratase 1                   121   1e-27   Nelumbo nucifera [Indian lotus]
ref|XP_006383042.1|  aconitate hydratase family protein                 119   1e-27   Populus trichocarpa [western balsam poplar]
ref|XP_011022256.1|  PREDICTED: aconitate hydratase 1                   118   1e-27   Populus euphratica
emb|CBI24446.3|  unnamed protein product                                120   2e-27   Vitis vinifera
ref|XP_004985790.1|  PREDICTED: putative aconitate hydratase, cyt...    120   2e-27   Setaria italica
ref|XP_002263337.1|  PREDICTED: aconitate hydratase 1                   120   2e-27   Vitis vinifera
ref|XP_010113288.1|  Aconitate hydratase 1                              120   2e-27   
gb|AES61065.2|  cytoplasmic-like aconitate hydratase                    120   2e-27   Medicago truncatula
ref|XP_003517155.1|  PREDICTED: aconitate hydratase 1                   119   3e-27   Glycine max [soybeans]
dbj|BAJ92965.1|  predicted protein                                      120   3e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008658754.1|  PREDICTED: uncharacterized protein LOC100304...    120   3e-27   
ref|XP_009363442.1|  PREDICTED: aconitate hydratase 1-like              119   3e-27   Pyrus x bretschneideri [bai li]
ref|XP_003537655.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    118   3e-27   Glycine max [soybeans]
ref|XP_009337075.1|  PREDICTED: aconitate hydratase 1-like              119   4e-27   Pyrus x bretschneideri [bai li]
ref|XP_008337967.1|  PREDICTED: aconitate hydratase 1                   119   4e-27   
ref|XP_009344825.1|  PREDICTED: aconitate hydratase 1                   119   4e-27   Pyrus x bretschneideri [bai li]
ref|XP_002976825.1|  hypothetical protein SELMODRAFT_443331             117   5e-27   
ref|XP_008670444.1|  PREDICTED: putative aconitate hydratase, cyt...    117   5e-27   Zea mays [maize]
ref|XP_002980554.1|  hypothetical protein SELMODRAFT_444572             117   5e-27   
ref|XP_008670445.1|  PREDICTED: putative aconitate hydratase, cyt...    117   5e-27   Zea mays [maize]
gb|EEC74472.1|  hypothetical protein OsI_09921                          119   6e-27   Oryza sativa Indica Group [Indian rice]
ref|NP_001048898.1|  Os03g0136900                                       119   6e-27   
ref|XP_007157870.1|  hypothetical protein PHAVU_002G105000g             119   7e-27   Phaseolus vulgaris [French bean]
ref|XP_010029634.1|  PREDICTED: aconitate hydratase 1                   118   1e-26   Eucalyptus grandis [rose gum]
gb|KCW56576.1|  hypothetical protein EUGRSUZ_I02307                     118   1e-26   Eucalyptus grandis [rose gum]
gb|ADZ57218.1|  aconitase protein                                       116   1e-26   Litchi chinensis [litchi]
ref|XP_003558862.1|  PREDICTED: putative aconitate hydratase, cyt...    117   2e-26   Brachypodium distachyon [annual false brome]
emb|CDY24823.1|  BnaA08g14870D                                          117   2e-26   Brassica napus [oilseed rape]
ref|XP_003612247.1|  Aconitate hydratase                                117   2e-26   Medicago truncatula
ref|XP_004512178.1|  PREDICTED: aconitate hydratase 1-like              117   2e-26   Cicer arietinum [garbanzo]
ref|XP_008440877.1|  PREDICTED: aconitate hydratase                     114   3e-26   Cucumis melo [Oriental melon]
ref|XP_002465901.1|  hypothetical protein SORBIDRAFT_01g047850          117   3e-26   Sorghum bicolor [broomcorn]
gb|KJB17578.1|  hypothetical protein B456_003G006000                    117   3e-26   Gossypium raimondii
emb|CAN83844.1|  hypothetical protein VITISV_003004                     116   5e-26   Vitis vinifera
ref|XP_002530635.1|  aconitase, putative                                116   6e-26   Ricinus communis
ref|XP_003590814.1|  Aconitate hydratase                                115   8e-26   
ref|XP_010529315.1|  PREDICTED: aconitate hydratase 1-like              114   2e-25   Tarenaya hassleriana [spider flower]
ref|XP_004166975.1|  PREDICTED: aconitate hydratase 1-like              111   3e-25   
gb|EMS48231.1|  Putative aconitate hydratase, cytoplasmic               113   4e-25   Triticum urartu
ref|XP_004134842.1|  PREDICTED: aconitate hydratase 1-like              111   5e-25   Cucumis sativus [cucumbers]
ref|XP_006651017.1|  PREDICTED: putative aconitate hydratase, cyt...    113   5e-25   
gb|KGN48958.1|  Aconitase                                               111   5e-25   
ref|XP_010100637.1|  Aconitate hydratase                                111   1e-24   
ref|XP_010033531.1|  PREDICTED: aconitate hydratase 1-like              112   1e-24   Eucalyptus grandis [rose gum]
gb|EMT03129.1|  Putative aconitate hydratase, cytoplasmic               112   1e-24   
gb|KHN36000.1|  Aconitate hydratase, cytoplasmic                        108   4e-24   Glycine soja [wild soybean]
gb|EEE58288.1|  hypothetical protein OsJ_09326                          110   6e-24   Oryza sativa Japonica Group [Japonica rice]
gb|KCW53221.1|  hypothetical protein EUGRSUZ_J02488                     110   7e-24   Eucalyptus grandis [rose gum]
gb|EMT24311.1|  Putative aconitate hydratase, cytoplasmic               110   8e-24   
emb|CDY44621.1|  BnaC04g06410D                                          101   9e-24   Brassica napus [oilseed rape]
ref|XP_001770969.1|  predicted protein                                  108   2e-23   
gb|KHN21232.1|  Aconitate hydratase, cytoplasmic                        105   2e-22   Glycine soja [wild soybean]
ref|XP_002991024.1|  hypothetical protein SELMODRAFT_132907             103   2e-21   
emb|CDX91508.1|  BnaC04g06420D                                        94.7    2e-21   
ref|XP_002991716.1|  hypothetical protein SELMODRAFT_133937             101   6e-21   
gb|KDO71345.1|  hypothetical protein CISIN_1g002610mg                 97.8    1e-19   Citrus sinensis [apfelsine]
ref|XP_001016756.1|  aconitate hydratase                              86.7    6e-16   Tetrahymena thermophila SB210
ref|XP_004031131.1|  hypothetical protein IMG5_146680                 85.9    1e-15   Ichthyophthirius multifiliis
emb|CDW89012.1|  aconitate hydratase 1 family protein                 85.5    2e-15   Stylonychia lemnae
gb|EJY70620.1|  Aconitate hydratase 1 family protein                  84.7    3e-15   Oxytricha trifallax
ref|XP_002111662.1|  hypothetical protein TRIADDRAFT_63287            84.0    5e-15   Trichoplax adhaerens
gb|EJY64435.1|  Aconitate hydratase 1 family protein                  83.6    6e-15   Oxytricha trifallax
ref|XP_004362727.1|  putative iron regulatory protein                 83.6    7e-15   Cavenderia fasciculata
gb|ACJ70654.1|  cytoplasmic aconitase/iron-regulatory protein         82.8    1e-14   Ixodes ricinus
ref|XP_004030259.1|  hypothetical protein IMG5_164920                 82.4    2e-14   Ichthyophthirius multifiliis
gb|AGC69746.1|  putative iron regulatory protein                      82.0    2e-14   Tieghemostelium lacteum
dbj|BAN16539.1|  ADB0003847                                           81.6    3e-14   Acytostelium subglobosum
gb|EAR86332.2|  cytoplasmic-like aconitate hydratase                  81.6    3e-14   Tetrahymena thermophila SB210
ref|XP_011411873.1|  PREDICTED: cytoplasmic aconitate hydratase-l...  81.3    4e-14   Crassostrea gigas
ref|XP_011411872.1|  PREDICTED: cytoplasmic aconitate hydratase-l...  80.9    5e-14   Crassostrea gigas
ref|XP_002670969.1|  aconitase                                        80.5    8e-14   Naegleria gruberi strain NEG-M
ref|XP_003427264.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...  80.5    8e-14   
ref|XP_641837.1|  hypothetical protein DDB_G0279159                   80.1    9e-14   Dictyostelium discoideum AX4
gb|EFA77648.1|  putative iron regulatory protein                      80.1    9e-14   Heterostelium album PN500
ref|XP_002413165.1|  RNA-binding translational regulator IRP, put...  79.3    2e-13   
ref|XP_001462507.1|  hypothetical protein                             76.6    2e-13   Paramecium tetraurelia strain d4-2
emb|CAB41634.1|  iron regulatory protein 1-like protein               79.3    2e-13   Pacifastacus leniusculus
emb|CDI83859.1|  aconitate hydratase, putative                        79.3    2e-13   Eimeria acervulina
ref|XP_006830449.1|  hypothetical protein AMTR_s00115p00015570        74.3    2e-13   
ref|XP_003747109.1|  PREDICTED: cytoplasmic aconitate hydratase       78.6    3e-13   Galendromus occidentalis
ref|XP_009495769.1|  cytoplasmic aconitate hydratase                  77.8    4e-13   Fonticula alba
gb|ETN81082.1|  hypothetical protein NECAME_08744                     71.6    7e-13   Necator americanus
emb|CDR97928.1|  aconitate hydratase 1 family protein, putative       77.0    9e-13   Babesia bigemina
ref|XP_001451848.1|  hypothetical protein                             77.0    1e-12   Paramecium tetraurelia strain d4-2
gb|EEE68177.1|  hypothetical protein OsJ_26310                        71.2    1e-12   Oryza sativa Japonica Group [Japonica rice]
gb|KFM82338.1|  hypothetical protein X975_14216                       77.0    1e-12   Stegodyphus mimosarum
ref|XP_011347901.1|  PREDICTED: cytoplasmic aconitate hydratase-l...  76.3    2e-12   Ooceraea biroi
ref|XP_011505192.1|  PREDICTED: cytoplasmic aconitate hydratase-l...  76.3    2e-12   Ceratosolen solmsi marchali
ref|XP_011164631.1|  PREDICTED: cytoplasmic aconitate hydratase-l...  76.3    2e-12   Solenopsis invicta [imported red fire ant]
ref|XP_003699654.1|  PREDICTED: cytoplasmic aconitate hydratase       75.9    2e-12   
ref|XP_731148.1|  aconitate hydratase 1                               75.9    3e-12   
emb|CDW88502.1|  aconitate hydratase 1 family protein                 75.5    3e-12   
ref|XP_007546874.1|  PREDICTED: iron-responsive element-binding p...  75.5    3e-12   
ref|XP_010733493.1|  PREDICTED: iron-responsive element-binding p...  75.5    3e-12   
ref|XP_002259934.1|  IRP-like protein                                 75.5    3e-12   
ref|XP_003283928.1|  hypothetical protein DICPUDRAFT_45137            75.1    4e-12   
ref|XP_011058028.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...  75.1    4e-12   
ref|XP_002591326.1|  hypothetical protein BRAFLDRAFT_121463           75.1    4e-12   
gb|EGI63266.1|  Cytoplasmic aconitate hydratase                       75.1    4e-12   
ref|XP_673124.1|  hypothetical protein                                72.4    5e-12   
ref|XP_005814479.1|  PREDICTED: iron-responsive element-binding p...  75.1    5e-12   
ref|XP_008292786.1|  PREDICTED: iron-responsive element-binding p...  75.1    5e-12   
ref|XP_004069532.1|  PREDICTED: iron-responsive element-binding p...  75.1    5e-12   
emb|CAF98392.1|  unnamed protein product                              74.7    5e-12   
gb|KIH47319.1|  hypothetical protein ANCDUO_22624                     70.5    5e-12   
ref|XP_011148978.1|  PREDICTED: cytoplasmic aconitate hydratase-like  74.7    5e-12   
gb|EFN78177.1|  Cytoplasmic aconitate hydratase                       74.7    6e-12   
ref|XP_009689838.1|  aconitate hydratase 3, mitochondrial precursor   74.7    6e-12   
ref|XP_004833677.1|  aconitate hydratase, putative                    74.3    7e-12   
dbj|BAM15611.1|  IRP-like protein                                     74.3    7e-12   
ref|NP_001133702.1|  Iron-responsive element-binding protein 1        74.3    7e-12   
ref|XP_008409420.1|  PREDICTED: iron-responsive element-binding p...  74.3    8e-12   
ref|XP_676833.1|  IRP-like protein                                    73.9    9e-12   
ref|XP_003487432.1|  PREDICTED: cytoplasmic aconitate hydratase-like  73.9    1e-11   
ref|XP_008622476.1|  aconitate hydratase 1                            73.9    1e-11   
emb|CCF75173.1|  unnamed protein product                              73.9    1e-11   
ref|XP_004223595.1|  aconitate hydratase I                            73.6    1e-11   
gb|EUD71732.1|  aconitate hydratase 1                                 73.6    1e-11   
ref|XP_010224488.1|  PREDICTED: cytoplasmic aconitate hydratase       73.6    1e-11   
gb|AJO69941.1|  IRP1A                                                 73.6    1e-11   
gb|EFZ14973.1|  hypothetical protein SINV_01110                       73.6    1e-11   
ref|XP_003401470.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...  73.6    1e-11   
ref|XP_008433053.1|  PREDICTED: cytoplasmic aconitate hydratase       73.2    2e-11   
ref|XP_007543966.1|  PREDICTED: cytoplasmic aconitate hydratase i...  73.2    2e-11   
ref|XP_008815728.1|  aconitate hydratase 1                            73.2    2e-11   
ref|XP_001614200.1|  aconitate hydratase I                            73.2    2e-11   
ref|XP_004333274.1|  aconitate hydratase                              72.8    2e-11   
ref|XP_003967645.1|  PREDICTED: iron-responsive element-binding p...  73.2    2e-11   
ref|XP_745570.1|  IRP-like protein                                    72.8    2e-11   
ref|XP_006629784.1|  PREDICTED: cytoplasmic aconitate hydratase-like  72.8    2e-11   
ref|XP_006216897.1|  PREDICTED: cytoplasmic aconitate hydratase       72.8    2e-11   
ref|XP_011164630.1|  PREDICTED: cytoplasmic aconitate hydratase-l...  72.8    3e-11   
ref|XP_010965658.1|  PREDICTED: cytoplasmic aconitate hydratase i...  72.8    3e-11   
ref|XP_010974110.1|  PREDICTED: cytoplasmic aconitate hydratase i...  72.8    3e-11   
ref|XP_006192563.1|  PREDICTED: cytoplasmic aconitate hydratase       72.8    3e-11   
ref|XP_011347824.1|  PREDICTED: cytoplasmic aconitate hydratase-l...  72.4    3e-11   
ref|XP_011505193.1|  PREDICTED: cytoplasmic aconitate hydratase-l...  72.4    3e-11   
ref|XP_003225327.2|  PREDICTED: cytoplasmic aconitate hydratase       72.4    3e-11   
gb|EMP30789.1|  Cytoplasmic aconitate hydratase                       72.0    4e-11   
gb|EFN64547.1|  Cytoplasmic aconitate hydratase                       72.0    4e-11   
ref|XP_003754950.1|  PREDICTED: iron-responsive element-binding p...  72.0    4e-11   
ref|XP_007065257.1|  PREDICTED: cytoplasmic aconitate hydratase       72.0    4e-11   
ref|XP_007068414.1|  PREDICTED: iron-responsive element-binding p...  71.6    5e-11   
ref|XP_766571.1|  aconitate hydratase                                 71.6    5e-11   
ref|XP_953725.1|  iron-responsive element binding protein/aconitase   71.6    5e-11   
emb|CDQ69390.1|  unnamed protein product                              71.6    5e-11   
ref|XP_006027291.1|  PREDICTED: iron-responsive element-binding p...  71.6    5e-11   
ref|XP_001612299.1|  aconitate hydratase 1 family protein             71.6    5e-11   
ref|XP_007255248.1|  PREDICTED: cytoplasmic aconitate hydratase-l...  71.6    6e-11   
ref|XP_006261404.1|  PREDICTED: iron-responsive element-binding p...  71.6    6e-11   
ref|XP_011471732.1|  PREDICTED: cytoplasmic aconitate hydratase i...  71.6    6e-11   
ref|XP_004086812.1|  PREDICTED: cytoplasmic aconitate hydratase i...  71.6    6e-11   
ref|XP_007478070.1|  PREDICTED: iron-responsive element-binding p...  71.6    6e-11   
ref|XP_002140470.1|  aconitate hydratase                              71.2    6e-11   
ref|XP_008303429.1|  PREDICTED: cytoplasmic aconitate hydratase       71.2    7e-11   
ref|XP_004570327.1|  PREDICTED: iron-responsive element-binding p...  71.2    8e-11   
ref|XP_005931759.1|  PREDICTED: iron-responsive element-binding p...  71.2    8e-11   
ref|XP_003459702.1|  PREDICTED: cytoplasmic aconitate hydratase       71.2    8e-11   
ref|XP_005754206.1|  PREDICTED: cytoplasmic aconitate hydratase-like  70.9    8e-11   
ref|XP_006782496.1|  PREDICTED: iron-responsive element-binding p...  71.2    9e-11   
ref|XP_005731484.1|  PREDICTED: iron-responsive element-binding p...  70.9    9e-11   
ref|XP_006888329.1|  PREDICTED: iron-responsive element-binding p...  70.9    9e-11   
ref|XP_003447608.1|  PREDICTED: iron-responsive element-binding p...  70.9    9e-11   
ref|XP_011312352.1|  PREDICTED: cytoplasmic aconitate hydratase-like  70.9    9e-11   
ref|XP_008882045.1|  aconitate hydratase ACN/IRP                      70.9    9e-11   
ref|XP_005294554.1|  PREDICTED: iron-responsive element-binding p...  70.9    1e-10   
ref|XP_006809760.1|  PREDICTED: cytoplasmic aconitate hydratase-like  70.9    1e-10   
ref|XP_007950031.1|  PREDICTED: iron-responsive element-binding p...  70.9    1e-10   
ref|XP_001446751.1|  hypothetical protein                             70.9    1e-10   
gb|KDR18766.1|  Cytoplasmic aconitate hydratase                       70.9    1e-10   
ref|XP_010888583.1|  PREDICTED: cytoplasmic aconitate hydratase-like  70.5    1e-10   
ref|XP_006971635.1|  PREDICTED: iron-responsive element-binding p...  70.9    1e-10   
ref|XP_010072074.1|  PREDICTED: cytoplasmic aconitate hydratase-like  69.3    1e-10   
ref|XP_006102185.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...  70.5    1e-10   
gb|KFH13093.1|  aconitate hydratase ACN/IRP                           70.5    1e-10   
gb|KFG42597.1|  aconitate hydratase ACN/IRP                           70.5    1e-10   
gb|EPR62226.1|  aconitate hydratase ACN/IRP                           70.5    1e-10   
ref|XP_002366326.1|  aconitate hydratase, putative                    70.5    1e-10   
gb|ESS32610.1|  aconitate hydratase ACN/IRP                           70.5    1e-10   
gb|KFG60936.1|  aconitate hydratase ACN/IRP                           70.5    1e-10   
ref|XP_004617613.1|  PREDICTED: iron-responsive element-binding p...  70.5    1e-10   
ref|XP_002429734.1|  aconitase, putative                              70.5    1e-10   
ref|XP_006025029.1|  PREDICTED: cytoplasmic aconitate hydratase       70.5    1e-10   
ref|XP_005316909.1|  PREDICTED: iron-responsive element-binding p...  70.5    1e-10   
ref|NP_001030155.1|  cytoplasmic aconitate hydratase                  70.1    1e-10   
ref|XP_005031316.1|  PREDICTED: cytoplasmic aconitate hydratase       70.1    1e-10   
ref|XP_005172430.1|  PREDICTED: cytoplasmic aconitate hydratase i...  70.1    1e-10   
ref|XP_004594666.1|  PREDICTED: iron-responsive element-binding p...  70.5    2e-10   
ref|XP_004480451.1|  PREDICTED: iron-responsive element-binding p...  70.1    2e-10   
ref|XP_004660434.1|  PREDICTED: iron-responsive element-binding p...  70.1    2e-10   
ref|XP_005069362.1|  PREDICTED: iron-responsive element-binding p...  69.7    2e-10   
ref|XP_006511398.1|  PREDICTED: iron-responsive element-binding p...  70.1    2e-10   
ref|XP_004421924.1|  PREDICTED: iron-responsive element-binding p...  70.1    2e-10   
ref|XP_008572752.1|  PREDICTED: LOW QUALITY PROTEIN: iron-respons...  70.1    2e-10   
ref|XP_006863078.1|  PREDICTED: cytoplasmic aconitate hydratase       70.1    2e-10   
ref|XP_011381091.1|  PREDICTED: iron-responsive element-binding p...  70.1    2e-10   
emb|CDJ45344.1|  hypothetical protein ETH_00020300                    70.1    2e-10   
ref|XP_007523186.1|  PREDICTED: iron-responsive element-binding p...  70.1    2e-10   
ref|XP_006905396.1|  PREDICTED: iron-responsive element-binding p...  70.1    2e-10   
ref|XP_006748416.1|  PREDICTED: iron-responsive element-binding p...  70.1    2e-10   
ref|XP_006142674.1|  PREDICTED: iron-responsive element-binding p...  70.1    2e-10   
ref|XP_004700080.1|  PREDICTED: iron-responsive element-binding p...  70.1    2e-10   
ref|NP_073146.2|  iron-responsive element-binding protein 2           70.1    2e-10   
ref|XP_007948891.1|  PREDICTED: cytoplasmic aconitate hydratase       70.1    2e-10   
emb|CDJ67470.1|  hypothetical protein ENH_00038220                    70.1    2e-10   
gb|EYC17822.1|  hypothetical protein Y032_0029g1889                   69.7    2e-10   
gb|EDL25830.1|  iron responsive element binding protein 2, isofor...  70.1    2e-10   
gb|EYC17823.1|  hypothetical protein Y032_0029g1889                   69.7    2e-10   
gb|ERE76459.1|  iron-responsive element-binding protein 2             70.1    2e-10   
gb|EYC17821.1|  hypothetical protein Y032_0029g1889                   69.7    2e-10   
ref|XP_008821632.1|  PREDICTED: iron-responsive element-binding p...  70.1    2e-10   
gb|AAH44665.1|  Iron responsive element binding protein 2             70.1    2e-10   
ref|XP_005602934.1|  PREDICTED: iron-responsive element-binding p...  70.1    2e-10   
ref|XP_008246669.1|  PREDICTED: iron-responsive element-binding p...  70.1    2e-10   
ref|XP_003497952.1|  PREDICTED: iron-responsive element-binding p...  70.1    2e-10   
gb|EYC17824.1|  hypothetical protein Y032_0029g1889                   69.7    2e-10   
ref|XP_004575994.1|  PREDICTED: cytoplasmic aconitate hydratase-like  70.1    2e-10   
ref|XP_008531042.1|  PREDICTED: iron-responsive element-binding p...  70.1    2e-10   
ref|XP_002069487.1|  GK11552                                          70.1    2e-10   
gb|EHH57327.1|  hypothetical protein EGM_06925                        70.1    2e-10   
ref|XP_008686136.1|  PREDICTED: LOW QUALITY PROTEIN: iron-respons...  70.1    2e-10   
ref|XP_005581618.1|  PREDICTED: cytoplasmic aconitate hydratase i...  69.7    2e-10   
ref|XP_001489016.1|  PREDICTED: iron-responsive element-binding p...  70.1    2e-10   
ref|NP_001244794.1|  cytoplasmic aconitate hydratase                  69.7    2e-10   
ref|XP_002696712.2|  PREDICTED: iron-responsive element-binding p...  69.7    2e-10   
ref|XP_004403660.1|  PREDICTED: iron-responsive element-binding p...  69.7    2e-10   
ref|XP_006208841.1|  PREDICTED: iron-responsive element-binding p...  69.7    2e-10   
tpg|DAA17575.1|  TPA: Iron-responsive element-binding protein 2-like  69.7    2e-10   
gb|EHH24050.1|  hypothetical protein EGK_07631                        69.7    2e-10   
ref|XP_010976129.1|  PREDICTED: iron-responsive element-binding p...  69.7    2e-10   
ref|XP_007616070.1|  PREDICTED: iron-responsive element-binding p...  69.7    2e-10   
ref|XP_008309973.1|  PREDICTED: iron-responsive element-binding p...  69.7    2e-10   
gb|ACG25861.1|  hypothetical protein                                  63.9    2e-10   
ref|XP_006265526.1|  PREDICTED: cytoplasmic aconitate hydratase       69.7    2e-10   
ref|XP_005985061.1|  PREDICTED: iron-responsive element-binding p...  69.7    2e-10   
ref|XP_010121598.1|  PREDICTED: cytoplasmic aconitate hydratase-like  67.0    2e-10   
ref|XP_006629138.1|  PREDICTED: iron-responsive element-binding p...  69.7    2e-10   
ref|XP_004017866.1|  PREDICTED: iron-responsive element-binding p...  69.7    2e-10   
ref|XP_004387523.1|  PREDICTED: iron-responsive element-binding p...  69.7    2e-10   
ref|XP_005695242.1|  PREDICTED: iron-responsive element-binding p...  69.7    2e-10   
sp|B3VKQ2.1|IREB2_PIG  RecName: Full=Iron-responsive element-bind...  69.7    2e-10   
ref|XP_008939123.1|  PREDICTED: cytoplasmic aconitate hydratase       69.7    2e-10   
gb|ELR62314.1|  Iron-responsive element-binding protein 2             69.7    2e-10   
ref|XP_005887677.1|  PREDICTED: iron-responsive element-binding p...  69.7    2e-10   
ref|XP_010796964.1|  PREDICTED: LOW QUALITY PROTEIN: iron-respons...  69.7    2e-10   
ref|NP_001161253.1|  iron-responsive element-binding protein 2        69.7    2e-10   
ref|XP_006044445.1|  PREDICTED: iron-responsive element-binding p...  69.7    2e-10   
ref|XP_006870949.1|  PREDICTED: iron-responsive element-binding p...  69.7    2e-10   
ref|XP_009559475.1|  PREDICTED: cytoplasmic aconitate hydratase       69.7    3e-10   
ref|XP_004798701.1|  PREDICTED: iron-responsive element-binding p...  69.7    3e-10   
ref|XP_006123150.1|  PREDICTED: cytoplasmic aconitate hydratase i...  69.7    3e-10   
ref|XP_004781771.1|  PREDICTED: iron-responsive element-binding p...  69.7    3e-10   
ref|XP_003482267.1|  PREDICTED: iron-responsive element-binding p...  69.7    3e-10   
ref|XP_010352748.1|  PREDICTED: cytoplasmic aconitate hydratase       69.3    3e-10   
ref|XP_538698.2|  PREDICTED: cytoplasmic aconitate hydratase          69.3    3e-10   
ref|XP_011227937.1|  PREDICTED: iron-responsive element-binding p...  69.7    3e-10   
ref|XP_006243155.1|  PREDICTED: iron-responsive element-binding p...  69.3    3e-10   
ref|NP_074054.2|  iron-responsive element-binding protein 2           69.3    3e-10   
ref|XP_005347437.1|  PREDICTED: iron-responsive element-binding p...  69.3    3e-10   
ref|XP_006243153.1|  PREDICTED: iron-responsive element-binding p...  69.3    3e-10   
ref|XP_007904798.1|  PREDICTED: cytoplasmic aconitate hydratase       69.3    3e-10   
gb|AAA79927.1|  iron-regulatory protein 2                             69.3    3e-10   
ref|XP_008166967.1|  PREDICTED: cytoplasmic aconitate hydratase       69.3    3e-10   
ref|XP_003911667.1|  PREDICTED: cytoplasmic aconitate hydratase       69.3    3e-10   
ref|XP_003357777.1|  PREDICTED: cytoplasmic aconitate hydratase       69.3    3e-10   
ref|XP_007076652.1|  PREDICTED: cytoplasmic aconitate hydratase       69.3    3e-10   
ref|XP_010724498.1|  PREDICTED: cytoplasmic aconitate hydratase       69.3    3e-10   
ref|XP_006939263.1|  PREDICTED: cytoplasmic aconitate hydratase       69.3    3e-10   
ref|XP_005510592.1|  PREDICTED: cytoplasmic aconitate hydratase       69.3    3e-10   
ref|XP_007967222.1|  PREDICTED: cytoplasmic aconitate hydratase       69.3    3e-10   
ref|XP_005874511.1|  PREDICTED: iron-responsive element-binding p...  69.3    3e-10   
ref|XP_002928311.1|  PREDICTED: cytoplasmic aconitate hydratase       69.3    3e-10   
ref|XP_008693317.1|  PREDICTED: cytoplasmic aconitate hydratase       69.3    3e-10   
ref|XP_003727326.1|  PREDICTED: cytoplasmic aconitate hydratase i...  69.3    3e-10   
ref|XP_532364.2|  PREDICTED: iron-responsive element-binding prot...  69.3    3e-10   
ref|XP_006727401.1|  PREDICTED: cytoplasmic aconitate hydratase       69.3    3e-10   
ref|XP_004632076.1|  PREDICTED: cytoplasmic aconitate hydratase       69.3    3e-10   
ref|XP_009883571.1|  PREDICTED: cytoplasmic aconitate hydratase       69.3    3e-10   
ref|XP_004392229.1|  PREDICTED: cytoplasmic aconitate hydratase       68.9    3e-10   
gb|ERE84356.1|  cytoplasmic aconitate hydratase-like protein          68.9    4e-10   
ref|XP_791082.2|  PREDICTED: cytoplasmic aconitate hydratase isof...  68.9    4e-10   
ref|XP_004765422.1|  PREDICTED: cytoplasmic aconitate hydratase       68.9    4e-10   
ref|XP_011261917.1|  PREDICTED: cytoplasmic aconitate hydratase-like  69.3    4e-10   
ref|XP_008158995.1|  PREDICTED: iron-responsive element-binding p...  68.9    4e-10   
ref|XP_003800343.1|  PREDICTED: cytoplasmic aconitate hydratase       68.9    4e-10   
ref|XP_002053064.1|  GJ23540                                          68.9    4e-10   
ref|XP_010787893.1|  PREDICTED: cytoplasmic aconitate hydratase       68.6    4e-10   
ref|XP_011380734.1|  PREDICTED: cytoplasmic aconitate hydratase       68.9    4e-10   
gb|EPQ05176.1|  Cytoplasmic aconitate hydratase                       68.6    4e-10   
ref|NP_001135643.1|  cytoplasmic aconitate hydratase                  68.9    4e-10   
ref|XP_008154889.1|  PREDICTED: cytoplasmic aconitate hydratase       68.9    5e-10   
ref|XP_006143153.1|  PREDICTED: cytoplasmic aconitate hydratase       68.6    5e-10   
ref|XP_003413887.1|  PREDICTED: iron-responsive element-binding p...  68.9    5e-10   
ref|XP_006913749.1|  PREDICTED: cytoplasmic aconitate hydratase-like  68.6    5e-10   
ref|XP_005862172.1|  PREDICTED: cytoplasmic aconitate hydratase-like  68.6    5e-10   
ref|XP_006131451.1|  PREDICTED: iron-responsive element-binding p...  68.6    5e-10   
ref|XP_007173501.1|  PREDICTED: iron-responsive element-binding p...  68.6    5e-10   
ref|XP_006609084.1|  PREDICTED: cytoplasmic aconitate hydratase-l...  68.6    5e-10   
ref|XP_009327206.1|  PREDICTED: cytoplasmic aconitate hydratase       68.6    5e-10   
emb|CDI74160.1|  Cytoplasmic aconitate hydratase, related             68.6    5e-10   
ref|XP_009044065.1|  hypothetical protein LOTGIDRAFT_181349           68.6    5e-10   
ref|XP_007173500.1|  PREDICTED: iron-responsive element-binding p...  68.6    5e-10   
ref|XP_004285312.1|  PREDICTED: iron-responsive element-binding p...  68.6    5e-10   
ref|XP_007103521.1|  PREDICTED: iron-responsive element-binding p...  68.6    5e-10   
ref|NP_001080577.1|  aconitase 1, soluble                             68.6    5e-10   
ref|XP_007471911.1|  PREDICTED: iron-responsive element-binding p...  68.6    5e-10   
ref|XP_009675961.1|  PREDICTED: cytoplasmic aconitate hydratase i...  68.6    5e-10   
ref|XP_010197370.1|  PREDICTED: cytoplasmic aconitate hydratase       68.6    5e-10   
ref|XP_003884224.1|  Iron regulatory protein-like protein, related    68.6    5e-10   
ref|XP_007665300.1|  PREDICTED: iron-responsive element-binding p...  68.6    5e-10   
ref|XP_006881316.1|  PREDICTED: cytoplasmic aconitate hydratase       68.6    5e-10   



>ref|XP_004243472.1| PREDICTED: aconitate hydratase, cytoplasmic [Solanum lycopersicum]
Length=995

 Score =   228 bits (581),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +1

Query  232  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTS  411
            ++S  RSLRCSVPRWSHGVDWKSP SLTAQIR+AAP LN FHRK+ATMA+ENPFKGI T 
Sbjct  51   YSSTLRSLRCSVPRWSHGVDWKSPISLTAQIRTAAPALNGFHRKLATMAAENPFKGILTG  110

Query  412  LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQV KEDVEKIIDW+
Sbjct  111  LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQVKKEDVEKIIDWE  168



>ref|XP_006366590.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Solanum 
tuberosum]
Length=997

 Score =   228 bits (581),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +1

Query  232  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTS  411
            ++S  RSLRCSVPRWSHGVDWKSP SLTAQIR+AAP LN FHRK+ATMA+ENPFKGI T 
Sbjct  53   YSSTLRSLRCSVPRWSHGVDWKSPISLTAQIRTAAPALNGFHRKLATMAAENPFKGILTG  112

Query  412  LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQV KEDVEKIIDW+
Sbjct  113  LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQVKKEDVEKIIDWE  170



>gb|KDP22711.1| hypothetical protein JCGZ_01813 [Jatropha curcas]
Length=998

 Score =   224 bits (571),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +1

Query  220  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  399
            R L+F +A RS RCSVPRWSHGVDW+SP SL +QIRSAAPV+  F RKIATMA+E+PFKG
Sbjct  50   RSLSFTAAVRSFRCSVPRWSHGVDWRSPVSLRSQIRSAAPVIEQFQRKIATMAAEHPFKG  109

Query  400  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIID  579
            I T+LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQVTKEDVEKIID
Sbjct  110  IVTALPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQVTKEDVEKIID  169

Query  580  WQ  585
            W+
Sbjct  170  WE  171



>dbj|BAG16527.1| putative aconitase [Capsicum chinense]
Length=995

 Score =   223 bits (567),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +1

Query  220  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  399
            R   ++S  RSL CSV RWSHGVDWKSP SLTAQIR+AAP LN FHRK+ATMA+ENPFKG
Sbjct  47   RCYYYSSTLRSLGCSVTRWSHGVDWKSPISLTAQIRTAAPALNSFHRKLATMAAENPFKG  106

Query  400  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIID  579
            I T+LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQV KEDVEKIID
Sbjct  107  ILTALPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQVKKEDVEKIID  166

Query  580  WQ  585
            W+
Sbjct  167  WE  168



>ref|XP_009770911.1| PREDICTED: aconitate hydratase, cytoplasmic [Nicotiana sylvestris]
Length=996

 Score =   221 bits (562),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +1

Query  232  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTS  411
            F+S FRS+RCSVPRWSHG+DWKSP SLTAQIR+AAP LN FHRK++TMA +NPFK I T+
Sbjct  52   FSSTFRSVRCSVPRWSHGIDWKSPISLTAQIRTAAPALNSFHRKLSTMAEKNPFKEILTA  111

Query  412  LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            LPKPGGGEFGKFYSLPALNDPRI+KLPYSIRILLE+AIRNCDNFQV KEDVEKIIDW+
Sbjct  112  LPKPGGGEFGKFYSLPALNDPRIEKLPYSIRILLESAIRNCDNFQVKKEDVEKIIDWE  169



>ref|XP_006376779.1| aconitate hydratase family protein [Populus trichocarpa]
 gb|ERP54576.1| aconitate hydratase family protein [Populus trichocarpa]
Length=995

 Score =   220 bits (560),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +1

Query  220  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  399
            R L+F+SA RSLRCS PRWSHGVDW+SPA+L  QIR+ APV+  F RKIATMA E+PFKG
Sbjct  47   RSLSFSSAVRSLRCSYPRWSHGVDWRSPATLRHQIRAVAPVVERFQRKIATMAHEHPFKG  106

Query  400  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIID  579
            IFTSLPKPGGGEFGKFYSLPALNDPRI+KLPYSIRILLE+AIRNCDNFQVTK DVEKIID
Sbjct  107  IFTSLPKPGGGEFGKFYSLPALNDPRIEKLPYSIRILLESAIRNCDNFQVTKGDVEKIID  166

Query  580  WQ  585
            W+
Sbjct  167  WE  168



>ref|XP_002524184.1| aconitase, putative [Ricinus communis]
 gb|EEF38199.1| aconitase, putative [Ricinus communis]
Length=997

 Score =   219 bits (559),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +1

Query  220  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  399
            R L+F++A RSLRCSVPRWSHGVDW+SP SL +QIR+A+PV+  F RKI+TMA+E+PFKG
Sbjct  48   RSLSFSAAVRSLRCSVPRWSHGVDWRSPVSLRSQIRTASPVIERFQRKISTMAAEHPFKG  107

Query  400  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIID  579
            I T LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQVTK+DVEKIID
Sbjct  108  IVTPLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQVTKQDVEKIID  167

Query  580  WQ  585
            W+
Sbjct  168  WE  169



>ref|XP_011047264.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
 ref|XP_011047265.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
 ref|XP_011047266.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
Length=1001

 Score =   219 bits (559),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +1

Query  220  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  399
            R L+F+SAFRSLRCS PRWSHGVDW+SPA+L  QIR+ +P +  F RKIATM  E+PFKG
Sbjct  53   RSLSFSSAFRSLRCSYPRWSHGVDWRSPATLRHQIRAVSPFVERFQRKIATMVPEHPFKG  112

Query  400  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIID  579
            IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQVTK+DVEKIID
Sbjct  113  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQVTKDDVEKIID  172

Query  580  WQ  585
            W+
Sbjct  173  WE  174



>ref|XP_010276105.1| PREDICTED: aconitate hydratase, cytoplasmic [Nelumbo nucifera]
Length=992

 Score =   218 bits (555),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +1

Query  220  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  399
            R L+F+SAFRSLR S PRWSHG DW+SP SL AQIR+AAPV+  F RKIATMASEN FKG
Sbjct  44   RSLSFSSAFRSLRSSPPRWSHGYDWRSPLSLRAQIRTAAPVIERFQRKIATMASENAFKG  103

Query  400  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIID  579
            I TSLPKPGGGEFGKFYSLPA+NDPRIDKLPYSI+ILLE+AIRNCDNFQVTKEDVEKIID
Sbjct  104  ILTSLPKPGGGEFGKFYSLPAINDPRIDKLPYSIKILLESAIRNCDNFQVTKEDVEKIID  163

Query  580  WQ  585
            W+
Sbjct  164  WK  165



>ref|XP_011095404.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Sesamum 
indicum]
Length=1011

 Score =   217 bits (553),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  220  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  399
            R L+F+SA RS+RCS PRWSHGVDW+SP SL AQIR+A+PVL  F RKIATMASE+PF G
Sbjct  63   RSLSFSSALRSIRCSAPRWSHGVDWRSPVSLRAQIRTASPVLERFERKIATMASEHPFSG  122

Query  400  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIID  579
            I + LPKPGGGEFGKFYSLPAL DPRIDKLPYSIRILLE+AIRNCDNFQV KEDVEKIID
Sbjct  123  ILSGLPKPGGGEFGKFYSLPALKDPRIDKLPYSIRILLESAIRNCDNFQVAKEDVEKIID  182

Query  580  WQ  585
            W+
Sbjct  183  WE  184



>emb|CDP05740.1| unnamed protein product [Coffea canephora]
Length=1009

 Score =   217 bits (552),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +1

Query  235  ASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSL  414
            +SA RSLRCSVPRWSHGVDW+SP SL AQIR+AAPV+  F RKIATMA E+P+KGI TSL
Sbjct  68   SSAVRSLRCSVPRWSHGVDWRSPVSLRAQIRTAAPVIERFERKIATMAPEHPYKGILTSL  127

Query  415  PKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            PKPGGG+FGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQVTK DVEKIIDWQ
Sbjct  128  PKPGGGDFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQVTKNDVEKIIDWQ  184



>ref|XP_009601350.1| PREDICTED: aconitate hydratase, cytoplasmic [Nicotiana tomentosiformis]
Length=997

 Score =   216 bits (551),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +1

Query  232  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTS  411
            F+S  RS+RCSVPRWSHGVDWKSP SLTAQIR+AAP  N FH+K++TMA +NPFK I T+
Sbjct  53   FSSTLRSVRCSVPRWSHGVDWKSPISLTAQIRTAAPAFNSFHKKLSTMAEKNPFKEILTA  112

Query  412  LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            LPKPGGGEFGKFYSLPALNDPRI+KLPYSIRILLE+AIRNCDNFQV KEDVEKIIDW+
Sbjct  113  LPKPGGGEFGKFYSLPALNDPRIEKLPYSIRILLESAIRNCDNFQVKKEDVEKIIDWE  170



>ref|XP_002321126.2| hypothetical protein POPTR_0014s15170g [Populus trichocarpa]
 gb|EEE99441.2| hypothetical protein POPTR_0014s15170g [Populus trichocarpa]
Length=999

 Score =   216 bits (550),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +1

Query  220  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  399
            R L+F+SA RSLRCS  RWSHGVDW+SPA+L  QIR+ AP +  F RKIATMA E+PFKG
Sbjct  51   RSLSFSSAVRSLRCSYRRWSHGVDWRSPATLRHQIRAVAPFVERFQRKIATMAPEHPFKG  110

Query  400  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIID  579
            IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQVTK+DVEKIID
Sbjct  111  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQVTKDDVEKIID  170

Query  580  WQ  585
            W+
Sbjct  171  WE  172



>emb|CDP10817.1| unnamed protein product [Coffea canephora]
Length=1009

 Score =   216 bits (550),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +1

Query  220  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  399
            R L+++SA RS+R SVPRWSHGVDWKSP+SL +QIR+ +P  N F+RK+ATMASENPFKG
Sbjct  62   RLLSYSSALRSVRSSVPRWSHGVDWKSPSSLCSQIRTTSPACNGFYRKMATMASENPFKG  121

Query  400  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIID  579
              TSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCD FQV KEDVEKIID
Sbjct  122  TLTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDGFQVKKEDVEKIID  181

Query  580  WQ  585
            W+
Sbjct  182  WE  183



>ref|XP_011048785.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Populus euphratica]
Length=995

 Score =   215 bits (547),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  220  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  399
            R  +F SA RSLRCS PRWSHGVDW+SPA+L  QIR+ APV+  F RKIATMA E+PFKG
Sbjct  47   RSSSFTSAVRSLRCSYPRWSHGVDWRSPATLRHQIRAVAPVVERFQRKIATMAHEHPFKG  106

Query  400  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIID  579
            IFTSLPKPGGGEFGKFYSLPALNDPRI+KLPYSIRILLE+AIR+CDNFQVTK DVEKIID
Sbjct  107  IFTSLPKPGGGEFGKFYSLPALNDPRIEKLPYSIRILLESAIRHCDNFQVTKGDVEKIID  166

Query  580  WQ  585
            W+
Sbjct  167  WE  168



>gb|KDO62733.1| hypothetical protein CISIN_1g001863mg [Citrus sinensis]
Length=875

 Score =   211 bits (538),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  220  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  399
            R L+F+SA R++RCS PRWSHGV+W+SP SL AQ R AAPVL  F RKIA+MA EN FKG
Sbjct  54   RSLSFSSALRTVRCSAPRWSHGVNWRSPVSLRAQSRIAAPVLERFQRKIASMAPENAFKG  113

Query  400  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIID  579
            I TSLPKPGGGEFGKF+SLPALNDPRID+LPYSIRILLE+AIRNCDNFQVTK+DVEKIID
Sbjct  114  ILTSLPKPGGGEFGKFFSLPALNDPRIDRLPYSIRILLESAIRNCDNFQVTKDDVEKIID  173

Query  580  WQ  585
            W+
Sbjct  174  WE  175



>ref|XP_006452377.1| hypothetical protein CICLE_v10007338mg [Citrus clementina]
 ref|XP_006475065.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Citrus 
sinensis]
 gb|ESR65617.1| hypothetical protein CICLE_v10007338mg [Citrus clementina]
 gb|KDO62731.1| hypothetical protein CISIN_1g001863mg [Citrus sinensis]
Length=1002

 Score =   211 bits (538),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  220  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  399
            R L+F+SA R++RCS PRWSHGV+W+SP SL AQ R AAPVL  F RKIA+MA EN FKG
Sbjct  54   RSLSFSSALRTVRCSAPRWSHGVNWRSPVSLRAQSRIAAPVLERFQRKIASMAPENAFKG  113

Query  400  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIID  579
            I TSLPKPGGGEFGKF+SLPALNDPRID+LPYSIRILLE+AIRNCDNFQVTK+DVEKIID
Sbjct  114  ILTSLPKPGGGEFGKFFSLPALNDPRIDRLPYSIRILLESAIRNCDNFQVTKDDVEKIID  173

Query  580  WQ  585
            W+
Sbjct  174  WE  175



>gb|EPS60517.1| hypothetical protein M569_14286, partial [Genlisea aurea]
Length=862

 Score =   208 bits (529),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +1

Query  220  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  399
            R L+F+SA RSLR S PRWSHGVDW+ P SL +QI + +PVL  FHRKIATMASE+PF G
Sbjct  17   RSLSFSSAIRSLRISAPRWSHGVDWRYPVSLRSQIGTVSPVLERFHRKIATMASEHPFSG  76

Query  400  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIID  579
            +  +LPKPGGGEFGK+YSLPALNDPRI+KLPYSIRILLE+AIRNCDNFQV KEDVEKIID
Sbjct  77   LLQTLPKPGGGEFGKYYSLPALNDPRIEKLPYSIRILLESAIRNCDNFQVMKEDVEKIID  136

Query  580  WQ  585
            W+
Sbjct  137  WE  138



>ref|XP_010046497.1| PREDICTED: aconitate hydratase, cytoplasmic [Eucalyptus grandis]
Length=996

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +1

Query  220  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  399
            R L+F+SAFRSLR SVPRWSHGVDW+SPASL  QIR+ APV+    RK ATMASENPFK 
Sbjct  48   RSLSFSSAFRSLRSSVPRWSHGVDWRSPASLRPQIRAVAPVIERLQRKFATMASENPFKE  107

Query  400  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIID  579
            I T+LPK GGG FGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQV K DVEKI+D
Sbjct  108  ILTTLPKAGGGHFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQVKKGDVEKILD  167

Query  580  WQ  585
            W+
Sbjct  168  WE  169



>ref|XP_006351962.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Solanum tuberosum]
Length=981

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 108/122 (89%), Gaps = 7/122 (6%)
 Frame = +1

Query  226  LTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAA--PVLNDFHRKIATMASENPFKG  399
            L F+S FRS     PRWS+GVDWKSP SL AQIR+AA  PVLN+FHRK+ TMASENPFKG
Sbjct  38   LGFSSTFRS-----PRWSYGVDWKSPISLKAQIRTAAVTPVLNNFHRKLTTMASENPFKG  92

Query  400  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIID  579
            I TSLPKPGGGEFGK+YSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQV KEDVEKIID
Sbjct  93   ILTSLPKPGGGEFGKYYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQVKKEDVEKIID  152

Query  580  WQ  585
            W+
Sbjct  153  WE  154



>ref|XP_010278679.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nelumbo nucifera]
Length=997

 Score =   206 bits (524),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +1

Query  256  RCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGE  435
            R S PRWSHG DWKSP SL AQIR+AAPV+  F RKIATMASEN FKGI TSLPKPGGGE
Sbjct  61   RSSAPRWSHGFDWKSPLSLRAQIRTAAPVIERFQRKIATMASENAFKGILTSLPKPGGGE  120

Query  436  FGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            FGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQVTKEDVEKIIDW+
Sbjct  121  FGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQVTKEDVEKIIDWE  170



>gb|KDO54659.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=896

 Score =   205 bits (521),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  220  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  399
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  ATMA+E+PFK 
Sbjct  48   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  107

Query  400  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIID  579
            I T+LPKPGGGEFGKFYSLPALNDPRI+KLPYSIRILLE+AIRNCDNFQV KEDVEKIID
Sbjct  108  ILTALPKPGGGEFGKFYSLPALNDPRIEKLPYSIRILLESAIRNCDNFQVKKEDVEKIID  167

Query  580  WQ  585
            W+
Sbjct  168  WE  169



>gb|KDO54660.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=902

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  220  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  399
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  ATMA+E+PFK 
Sbjct  48   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  107

Query  400  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIID  579
            I T+LPKPGGGEFGKFYSLPALNDPRI+KLPYSIRILLE+AIRNCDNFQV KEDVEKIID
Sbjct  108  ILTALPKPGGGEFGKFYSLPALNDPRIEKLPYSIRILLESAIRNCDNFQVKKEDVEKIID  167

Query  580  WQ  585
            W+
Sbjct  168  WE  169



>gb|KDO54661.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=876

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  220  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  399
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  ATMA+E+PFK 
Sbjct  48   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  107

Query  400  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIID  579
            I T+LPKPGGGEFGKFYSLPALNDPRI+KLPYSIRILLE+AIRNCDNFQV KEDVEKIID
Sbjct  108  ILTALPKPGGGEFGKFYSLPALNDPRIEKLPYSIRILLESAIRNCDNFQVKKEDVEKIID  167

Query  580  WQ  585
            W+
Sbjct  168  WE  169



>ref|XP_006447556.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
 gb|ESR60796.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
Length=888

 Score =   204 bits (519),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  220  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  399
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  ATMA+E+PFK 
Sbjct  52   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  111

Query  400  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIID  579
            I T+LPKPGGGEFGKFYSLPALNDPRI+KLPYSIRILLE+AIRNCDNFQV KED+EKIID
Sbjct  112  ILTALPKPGGGEFGKFYSLPALNDPRIEKLPYSIRILLESAIRNCDNFQVKKEDIEKIID  171

Query  580  WQ  585
            W+
Sbjct  172  WE  173



>gb|KDO54657.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=996

 Score =   205 bits (521),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  220  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  399
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  ATMA+E+PFK 
Sbjct  48   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  107

Query  400  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIID  579
            I T+LPKPGGGEFGKFYSLPALNDPRI+KLPYSIRILLE+AIRNCDNFQV KEDVEKIID
Sbjct  108  ILTALPKPGGGEFGKFYSLPALNDPRIEKLPYSIRILLESAIRNCDNFQVKKEDVEKIID  167

Query  580  WQ  585
            W+
Sbjct  168  WE  169



>gb|KDO54656.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=996

 Score =   205 bits (521),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  220  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  399
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  ATMA+E+PFK 
Sbjct  48   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  107

Query  400  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIID  579
            I T+LPKPGGGEFGKFYSLPALNDPRI+KLPYSIRILLE+AIRNCDNFQV KEDVEKIID
Sbjct  108  ILTALPKPGGGEFGKFYSLPALNDPRIEKLPYSIRILLESAIRNCDNFQVKKEDVEKIID  167

Query  580  WQ  585
            W+
Sbjct  168  WE  169



>ref|XP_006447555.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
 ref|XP_006469685.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Citrus sinensis]
 ref|XP_006469686.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Citrus sinensis]
 gb|ESR60795.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
Length=1000

 Score =   204 bits (519),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  220  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  399
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  ATMA+E+PFK 
Sbjct  52   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  111

Query  400  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIID  579
            I T+LPKPGGGEFGKFYSLPALNDPRI+KLPYSIRILLE+AIRNCDNFQV KED+EKIID
Sbjct  112  ILTALPKPGGGEFGKFYSLPALNDPRIEKLPYSIRILLESAIRNCDNFQVKKEDIEKIID  171

Query  580  WQ  585
            W+
Sbjct  172  WE  173



>ref|XP_002278138.1| PREDICTED: aconitate hydratase, cytoplasmic [Vitis vinifera]
 emb|CBI26642.3| unnamed protein product [Vitis vinifera]
Length=1009

 Score =   203 bits (516),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 107/122 (88%), Gaps = 5/122 (4%)
 Frame = +1

Query  220  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  399
            R L F SAFRS R     WSHGVDW+SP SL AQIR+AAPV+  F RK+AT+ASE+PFKG
Sbjct  66   RSLGFLSAFRSRR-----WSHGVDWRSPVSLRAQIRAAAPVIERFERKMATIASEHPFKG  120

Query  400  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIID  579
            I TS+PKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQVTK+DVEKIID
Sbjct  121  ILTSVPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQVTKDDVEKIID  180

Query  580  WQ  585
            W+
Sbjct  181  WE  182



>gb|EYU27339.1| hypothetical protein MIMGU_mgv1a000710mg [Erythranthe guttata]
Length=1010

 Score =   203 bits (516),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 107/123 (87%), Gaps = 1/123 (1%)
 Frame = +1

Query  220  RPLTFASAFRSLR-CSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFK  396
            R L+F+SA RS+R  S  RWSHG DW+SP SL AQIRS++PVL  F RKIATMASE+PF 
Sbjct  61   RSLSFSSALRSIRYSSSQRWSHGADWRSPVSLRAQIRSSSPVLERFERKIATMASEHPFN  120

Query  397  GIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKII  576
            GI + LPKP GGEFGKFYSLPALNDPRIDKLPYSI+ILLE+AIRNCDNFQVTKEDVEKII
Sbjct  121  GILSGLPKPEGGEFGKFYSLPALNDPRIDKLPYSIKILLESAIRNCDNFQVTKEDVEKII  180

Query  577  DWQ  585
            DW+
Sbjct  181  DWE  183



>ref|XP_009598331.1| PREDICTED: aconitate hydratase 2, mitochondrial isoform X2 [Nicotiana 
tomentosiformis]
Length=865

 Score =   201 bits (510),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  220  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  399
            R  +F+SA  SLR SVPRWSHGVDW+SP SL AQ+R+A+P +    R IATMASE+PF+G
Sbjct  116  RSFSFSSALPSLRYSVPRWSHGVDWRSPISLRAQVRTASPDIEPLDRNIATMASEHPFRG  175

Query  400  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIID  579
            IFTSLPKPGGGEFGKFYSL ALNDPRIDKLP+SIRILLE+AIRNCDNFQV+K+DVEKI++
Sbjct  176  IFTSLPKPGGGEFGKFYSLTALNDPRIDKLPFSIRILLESAIRNCDNFQVSKDDVEKILN  235

Query  580  WQ  585
            W+
Sbjct  236  WE  237



>ref|XP_009598330.1| PREDICTED: aconitate hydratase, cytoplasmic isoform X1 [Nicotiana 
tomentosiformis]
Length=1063

 Score =   201 bits (511),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  220  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  399
            R  +F+SA  SLR SVPRWSHGVDW+SP SL AQ+R+A+P +    R IATMASE+PF+G
Sbjct  116  RSFSFSSALPSLRYSVPRWSHGVDWRSPISLRAQVRTASPDIEPLDRNIATMASEHPFRG  175

Query  400  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIID  579
            IFTSLPKPGGGEFGKFYSL ALNDPRIDKLP+SIRILLE+AIRNCDNFQV+K+DVEKI++
Sbjct  176  IFTSLPKPGGGEFGKFYSLTALNDPRIDKLPFSIRILLESAIRNCDNFQVSKDDVEKILN  235

Query  580  WQ  585
            W+
Sbjct  236  WE  237



>ref|XP_009787326.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Nicotiana sylvestris]
Length=818

 Score =   197 bits (500),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +1

Query  232  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTS  411
            F+SA  SL  S PRWSHGVDW+SP SL AQIR+A+P +    R IATMASE+PF+GIFTS
Sbjct  73   FSSALPSLSYSTPRWSHGVDWRSPISLRAQIRTASPDIERLDRNIATMASEHPFRGIFTS  132

Query  412  LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            LPKPGGGEFGKFYSL ALNDPRIDKLP+SIRILLE+AIRNCDNFQV+K+DVEKI+DW+
Sbjct  133  LPKPGGGEFGKFYSLTALNDPRIDKLPFSIRILLESAIRNCDNFQVSKDDVEKILDWE  190



>ref|XP_003543388.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Glycine 
max]
Length=984

 Score =   198 bits (503),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +1

Query  223  PLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGI  402
            P + ++A RS   +VPRWSHGVDW+SP  L  QIR+AAP++  FHR+IAT A++NPFKG 
Sbjct  37   PGSSSAATRSFGSAVPRWSHGVDWRSPLGLRPQIRAAAPLIERFHRRIATSATDNPFKGN  96

Query  403  FTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDW  582
             TSLPKPGGGEFGKFYSLP+LNDPRID+LPYSIRILLE+AIRNCDNFQV KEDVEKIIDW
Sbjct  97   LTSLPKPGGGEFGKFYSLPSLNDPRIDRLPYSIRILLESAIRNCDNFQVKKEDVEKIIDW  156

Query  583  Q  585
            +
Sbjct  157  E  157



>gb|KJB60836.1| hypothetical protein B456_009G327800 [Gossypium raimondii]
Length=860

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +1

Query  235  ASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSL  414
            ++A RS  CSVPRWSH +DW+SP SL AQIR+  PV+    RK +TMA+E+PFK + TSL
Sbjct  47   SAAVRSFHCSVPRWSHRLDWRSPFSLRAQIRAVNPVIERLERKFSTMAAEHPFKAVLTSL  106

Query  415  PKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            PKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+A+RNCDNFQV +EDVEKIIDWQ
Sbjct  107  PKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAVRNCDNFQVKEEDVEKIIDWQ  163



>gb|KJB60837.1| hypothetical protein B456_009G327800 [Gossypium raimondii]
Length=865

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +1

Query  235  ASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSL  414
            ++A RS  CSVPRWSH +DW+SP SL AQIR+  PV+    RK +TMA+E+PFK + TSL
Sbjct  47   SAAVRSFHCSVPRWSHRLDWRSPFSLRAQIRAVNPVIERLERKFSTMAAEHPFKAVLTSL  106

Query  415  PKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            PKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+A+RNCDNFQV +EDVEKIIDWQ
Sbjct  107  PKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAVRNCDNFQVKEEDVEKIIDWQ  163



>gb|KHN36531.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=984

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +1

Query  223  PLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGI  402
            P + ++A RS   +VPRWSHGVDW+SP  L  QIR+AAP++  FHR+IAT A++NPFKG 
Sbjct  37   PGSSSAATRSFGSAVPRWSHGVDWRSPLGLRPQIRAAAPLIERFHRRIATSATDNPFKGN  96

Query  403  FTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDW  582
             TSLP+PGGGEFGKFYSLP+LNDPRID+LPYSIRILLE+AIRNCDNFQV KEDVEKIIDW
Sbjct  97   LTSLPRPGGGEFGKFYSLPSLNDPRIDRLPYSIRILLESAIRNCDNFQVKKEDVEKIIDW  156

Query  583  Q  585
            +
Sbjct  157  E  157



>ref|XP_009787319.1| PREDICTED: aconitate hydratase, cytoplasmic-like isoform X1 [Nicotiana 
sylvestris]
Length=1017

 Score =   197 bits (500),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +1

Query  232  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTS  411
            F+SA  SL  S PRWSHGVDW+SP SL AQIR+A+P +    R IATMASE+PF+GIFTS
Sbjct  73   FSSALPSLSYSTPRWSHGVDWRSPISLRAQIRTASPDIERLDRNIATMASEHPFRGIFTS  132

Query  412  LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            LPKPGGGEFGKFYSL ALNDPRIDKLP+SIRILLE+AIRNCDNFQV+K+DVEKI+DW+
Sbjct  133  LPKPGGGEFGKFYSLTALNDPRIDKLPFSIRILLESAIRNCDNFQVSKDDVEKILDWE  190



>gb|KJB60835.1| hypothetical protein B456_009G327800 [Gossypium raimondii]
Length=990

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +1

Query  235  ASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSL  414
            ++A RS  CSVPRWSH +DW+SP SL AQIR+  PV+    RK +TMA+E+PFK + TSL
Sbjct  47   SAAVRSFHCSVPRWSHRLDWRSPFSLRAQIRAVNPVIERLERKFSTMAAEHPFKAVLTSL  106

Query  415  PKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            PKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+A+RNCDNFQV +EDVEKIIDWQ
Sbjct  107  PKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAVRNCDNFQVKEEDVEKIIDWQ  163



>ref|XP_007045642.1| Aconitase 3 [Theobroma cacao]
 gb|EOY01474.1| Aconitase 3 [Theobroma cacao]
Length=995

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 103/122 (84%), Gaps = 1/122 (1%)
 Frame = +1

Query  220  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  399
            R LT ++A RS   SVPRWSH +DW+SP SL AQIR+  PV+    RK ATMASE+PFK 
Sbjct  48   RSLT-SAAVRSFHGSVPRWSHRLDWRSPLSLRAQIRAVTPVIERLERKFATMASEHPFKA  106

Query  400  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIID  579
            + TSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+A+RNCDNFQV KEDVEKIID
Sbjct  107  VLTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAVRNCDNFQVKKEDVEKIID  166

Query  580  WQ  585
            W+
Sbjct  167  WE  168



>ref|XP_004251517.2| PREDICTED: aconitate hydratase, cytoplasmic [Solanum lycopersicum]
Length=981

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 7/116 (6%)
 Frame = +1

Query  244  FRSLRCSVPRWSHGVDWKSPASLTAQIRSAA--PVLNDFHRKIATMASENPFKGIFTSLP  417
            FRSLR     W +GVDWKSP SLT+QIR+AA  PVLN+F RK+ TMAS NPFKGI TSLP
Sbjct  44   FRSLR-----WRYGVDWKSPISLTSQIRTAAVTPVLNNFRRKLTTMASGNPFKGILTSLP  98

Query  418  KPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            KPGGGEFGK+YSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQV KEDVEKIIDW+
Sbjct  99   KPGGGEFGKYYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQVKKEDVEKIIDWE  154



>ref|XP_003540302.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Glycine 
max]
Length=984

 Score =   194 bits (493),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = +1

Query  223  PLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGI  402
            P + A+A RS   +VPRWS GVDW+SP  L   IR+AAP++  FHR+IAT A+ENPFKG 
Sbjct  37   PGSSAAATRSFGSAVPRWSRGVDWRSPLGLRPHIRAAAPLIERFHRRIATSATENPFKGN  96

Query  403  FTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDW  582
             TSLP+PGGGEFGKFYSLP+LNDPRID+LPYSIRILLE+AIRNCDNFQV KEDVEKIIDW
Sbjct  97   LTSLPRPGGGEFGKFYSLPSLNDPRIDRLPYSIRILLESAIRNCDNFQVKKEDVEKIIDW  156

Query  583  Q  585
            +
Sbjct  157  E  157



>gb|KJB50479.1| hypothetical protein B456_008G173400 [Gossypium raimondii]
Length=996

 Score =   193 bits (491),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 104/122 (85%), Gaps = 1/122 (1%)
 Frame = +1

Query  220  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  399
            R LT ++A RS  CSVPRWSH +DW+SP +L ++IR+  P++    RK ATMA+E+PFK 
Sbjct  49   RSLT-SAAVRSFHCSVPRWSHRLDWRSPLNLRSEIRAFNPIIEQLQRKFATMAAEHPFKA  107

Query  400  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIID  579
            + TSLP+PGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQV KEDVEKIID
Sbjct  108  VLTSLPRPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQVKKEDVEKIID  167

Query  580  WQ  585
            W+
Sbjct  168  WE  169



>gb|KHG15607.1| Aconitate hydratase 2, mitochondrial -like protein [Gossypium 
arboreum]
Length=668

 Score =   190 bits (483),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 103/122 (84%), Gaps = 1/122 (1%)
 Frame = +1

Query  220  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  399
            R LT ++A RS  CSVPRWS  +DW+SP +L ++IR+  P++    RK ATMA+E+PFK 
Sbjct  49   RSLT-STAVRSFHCSVPRWSPRLDWRSPLNLRSEIRAFNPIIEQLQRKFATMAAEHPFKA  107

Query  400  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIID  579
            + TSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQV KEDVEKIID
Sbjct  108  VLTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQVKKEDVEKIID  167

Query  580  WQ  585
            W+
Sbjct  168  WE  169



>ref|XP_007149973.1| hypothetical protein PHAVU_005G115100g [Phaseolus vulgaris]
 gb|ESW21967.1| hypothetical protein PHAVU_005G115100g [Phaseolus vulgaris]
Length=983

 Score =   192 bits (488),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = +1

Query  262  SVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFG  441
            +VPRWSHGVDW+SP  L  QIR+ AP++  FHR+IAT A +NPFKG  TSLPKPGGGEFG
Sbjct  49   AVPRWSHGVDWRSPLGLRHQIRAVAPLIERFHRRIATSALDNPFKGNLTSLPKPGGGEFG  108

Query  442  KFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            KFYSLP+LNDPRID+LPYSIRILLE+AIRNCDNFQVTKEDVEKIIDW+
Sbjct  109  KFYSLPSLNDPRIDRLPYSIRILLESAIRNCDNFQVTKEDVEKIIDWE  156



>ref|XP_010445106.1| PREDICTED: aconitate hydratase 3, mitochondrial-like [Camelina 
sativa]
Length=383

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 104/124 (84%), Gaps = 2/124 (2%)
 Frame = +1

Query  220  RPLTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  393
            R  +F+SA RS R CS   RWSHG  W+ PASL AQ R++APV+  F RK AT+ASE+ +
Sbjct  47   RSKSFSSALRSFRVCSASTRWSHGGSWRYPASLRAQSRNSAPVMEKFERKYATIASEHAY  106

Query  394  KGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKI  573
            K I TSLPKPGGGE+G++YSLPALNDPR+DKLPYS+RILLE+AIRNCDN+QVTK+DVEKI
Sbjct  107  KDILTSLPKPGGGEYGQYYSLPALNDPRVDKLPYSVRILLESAIRNCDNYQVTKDDVEKI  166

Query  574  IDWQ  585
            +DW+
Sbjct  167  LDWE  170


 Score = 55.5 bits (132),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 27/27 (100%), Gaps = 0/27 (0%)
 Frame = +1

Query  505  ILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            ILLE+AIRNCDN+QVTK+DVEKI+DW+
Sbjct  334  ILLESAIRNCDNYQVTKDDVEKILDWE  360


 Score = 21.9 bits (45),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 9/13 (69%), Positives = 10/13 (77%), Gaps = 0/13 (0%)
 Frame = +3

Query  585  NTAPKLVEIPFKP  623
            NT+ K VEI FKP
Sbjct  361  NTSTKQVEISFKP  373



>gb|KHG18502.1| Aconitate hydratase 2, mitochondrial -like protein [Gossypium 
arboreum]
Length=933

 Score =   191 bits (484),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 100/117 (85%), Gaps = 1/117 (1%)
 Frame = +1

Query  235  ASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSL  414
            ++A RS  CS PRWSH +DW+SP SL AQ+R+  PV+    RK +TMA+E+PFK + TSL
Sbjct  47   SAAVRSFHCS-PRWSHRLDWRSPFSLRAQVRAVNPVIERLERKFSTMAAEHPFKAVLTSL  105

Query  415  PKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            PKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+A+RNCDNFQV KEDVEKIIDWQ
Sbjct  106  PKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAVRNCDNFQVKKEDVEKIIDWQ  162



>gb|KJB62848.1| hypothetical protein B456_009G440000 [Gossypium raimondii]
Length=864

 Score =   190 bits (482),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 103/122 (84%), Gaps = 4/122 (3%)
 Frame = +1

Query  220  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  399
            R L+F+ + RSLRCS PR    + W+SP SL    R++ PV+  FHR+IAT ASE+PFKG
Sbjct  49   RSLSFSYSLRSLRCSAPR----LHWRSPESLRVLARTSVPVVERFHRRIATTASEHPFKG  104

Query  400  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIID  579
            + TSLPKPGGGEFGKFYSLPALNDPRID+LPYSIRILLE+AIRNCDNFQVTK+DVEKIID
Sbjct  105  VMTSLPKPGGGEFGKFYSLPALNDPRIDRLPYSIRILLESAIRNCDNFQVTKDDVEKIID  164

Query  580  WQ  585
            W+
Sbjct  165  WE  166



>gb|KDP39136.1| hypothetical protein JCGZ_00893 [Jatropha curcas]
Length=1002

 Score =   191 bits (484),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 105/122 (86%), Gaps = 6/122 (5%)
 Frame = +1

Query  220  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  399
            R L+F+   RSLRCS P WSHGVDW SP SL AQ R ++PV+    R+++TM SE+PFKG
Sbjct  57   RYLSFS---RSLRCSAPLWSHGVDWHSPISLRAQARVSSPVV---ERRLSTMTSEHPFKG  110

Query  400  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIID  579
            I T+LPKPGGGEFGKFY+LPALNDPRID+LPYSIRILLE+AIRNCDNFQVTKEDV+KIID
Sbjct  111  ILTNLPKPGGGEFGKFYNLPALNDPRIDRLPYSIRILLESAIRNCDNFQVTKEDVDKIID  170

Query  580  WQ  585
            W+
Sbjct  171  WE  172



>ref|XP_011100304.1| PREDICTED: aconitate hydratase, cytoplasmic [Sesamum indicum]
Length=1001

 Score =   191 bits (484),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 101/117 (86%), Gaps = 4/117 (3%)
 Frame = +1

Query  244  FRSLR-CSVPRWSHGVDWKSPASLTAQIRSAAPVLND--FHRKIATMASENPFKGIFTSL  414
             RSL   S  RWSHGVDWKSP SL AQIR A+ V +D   HRKIATMA+ENPFKGIFTSL
Sbjct  55   LRSLSYLSAARWSHGVDWKSPPSLAAQIRIAS-VSSDTLLHRKIATMAAENPFKGIFTSL  113

Query  415  PKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            PK GGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCD FQVTKEDVEKIIDW+
Sbjct  114  PKSGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDGFQVTKEDVEKIIDWE  170



>gb|KJB62847.1| hypothetical protein B456_009G440000 [Gossypium raimondii]
Length=993

 Score =   190 bits (482),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 103/122 (84%), Gaps = 4/122 (3%)
 Frame = +1

Query  220  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  399
            R L+F+ + RSLRCS PR    + W+SP SL    R++ PV+  FHR+IAT ASE+PFKG
Sbjct  49   RSLSFSYSLRSLRCSAPR----LHWRSPESLRVLARTSVPVVERFHRRIATTASEHPFKG  104

Query  400  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIID  579
            + TSLPKPGGGEFGKFYSLPALNDPRID+LPYSIRILLE+AIRNCDNFQVTK+DVEKIID
Sbjct  105  VMTSLPKPGGGEFGKFYSLPALNDPRIDRLPYSIRILLESAIRNCDNFQVTKDDVEKIID  164

Query  580  WQ  585
            W+
Sbjct  165  WE  166



>gb|EYU24785.1| hypothetical protein MIMGU_mgv1a000742mg [Erythranthe guttata]
Length=997

 Score =   189 bits (481),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 99/115 (86%), Gaps = 2/115 (2%)
 Frame = +1

Query  247  RSLR-CSVPRWSHGVDWKSPASLTAQIR-SAAPVLNDFHRKIATMASENPFKGIFTSLPK  420
            RSL   S  RWSHGVDWKSPASL +QIR S+A      HRKIATMASEN FKGIFTSLPK
Sbjct  54   RSLSYLSAARWSHGVDWKSPASLASQIRISSAFSDTLLHRKIATMASENAFKGIFTSLPK  113

Query  421  PGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            PGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCD FQVTK DVEKIIDW+
Sbjct  114  PGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDGFQVTKADVEKIIDWE  168



>ref|XP_003596988.1| Aconitate hydratase [Medicago truncatula]
 gb|AES67239.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=979

 Score =   189 bits (479),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +1

Query  226  LTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  405
             T ++   + R +V RWSHGV W+SP SL  QIR+ AP +  +HRKIAT A ENPFKG  
Sbjct  33   FTSSAVANAARSTVNRWSHGVLWRSPFSLRPQIRAVAPFIEQYHRKIATSAGENPFKGNL  92

Query  406  TSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            TSLPKPGGGEFGKFYSLP+LNDPRID+LPYSIRILLE+AIRNCDNFQVTK DVEKIIDW+
Sbjct  93   TSLPKPGGGEFGKFYSLPSLNDPRIDRLPYSIRILLESAIRNCDNFQVTKADVEKIIDWE  152

Query  586  T  588
            +
Sbjct  153  S  153



>ref|XP_004159202.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Cucumis sativus]
Length=989

 Score =   189 bits (479),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 101/123 (82%), Gaps = 4/123 (3%)
 Frame = +1

Query  220  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  399
            R L+ +SAFRS      RWSHGV W+SP SL AQIR+ AP +   HRK ++MA+ENPFK 
Sbjct  45   RSLSASSAFRS----TARWSHGVGWRSPLSLRAQIRAVAPAIERLHRKFSSMAAENPFKE  100

Query  400  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIID  579
              TSLPKPGGGEFGK+YSLP+LNDPRIDKLPYSIRILLE+AIRNCDNFQV KEDVEKIID
Sbjct  101  NLTSLPKPGGGEFGKYYSLPSLNDPRIDKLPYSIRILLESAIRNCDNFQVKKEDVEKIID  160

Query  580  WQT  588
            W+ 
Sbjct  161  WEN  163



>ref|XP_008455442.1| PREDICTED: aconitate hydratase, cytoplasmic [Cucumis melo]
Length=989

 Score =   189 bits (479),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 101/122 (83%), Gaps = 4/122 (3%)
 Frame = +1

Query  220  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  399
            R L+ +SAFRS      RWSHGV W+SP SL AQIR+ AP +   HRK ++MA+ENPFK 
Sbjct  45   RSLSASSAFRS----TTRWSHGVGWRSPLSLRAQIRAVAPAIERLHRKFSSMAAENPFKE  100

Query  400  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIID  579
              TSLPKPGGGEFGK+YSLP+LNDPRIDKLPYSIRILLE+AIRNCDNFQV KEDVEKIID
Sbjct  101  NLTSLPKPGGGEFGKYYSLPSLNDPRIDKLPYSIRILLESAIRNCDNFQVKKEDVEKIID  160

Query  580  WQ  585
            W+
Sbjct  161  WE  162



>ref|XP_006346211.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Solanum 
tuberosum]
Length=980

 Score =   188 bits (477),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 106/119 (89%), Gaps = 4/119 (3%)
 Frame = +1

Query  232  FASAFRSLRCSVPRWS-HGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFT  408
            FA+ +RS+RCSVPRWS +GV+ + P SL AQIR+A+ V+    R +ATMASE+PFKGIFT
Sbjct  38   FATTYRSIRCSVPRWSNYGVNRRFPISLKAQIRTASQVV---ERNVATMASEHPFKGIFT  94

Query  409  SLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            SLPKPGGGEFGKFYSLPALNDPRI+KLP+SIRILLE+AIRNCDNF VTK+DVEKI+DW+
Sbjct  95   SLPKPGGGEFGKFYSLPALNDPRINKLPFSIRILLESAIRNCDNFHVTKDDVEKILDWE  153



>ref|XP_004144496.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Cucumis sativus]
 gb|KGN43521.1| hypothetical protein Csa_7G043630 [Cucumis sativus]
Length=989

 Score =   188 bits (477),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 101/123 (82%), Gaps = 4/123 (3%)
 Frame = +1

Query  220  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  399
            R L+ +SAFRS      RWSHGV W+SP SL AQIR+ AP +   HRK ++MA+ENPFK 
Sbjct  45   RSLSASSAFRS----TARWSHGVGWRSPLSLRAQIRAVAPAIERLHRKFSSMAAENPFKE  100

Query  400  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIID  579
              TSLPKPGGGE+GK+YSLP+LNDPRIDKLPYSIRILLE+AIRNCDNFQV KEDVEKIID
Sbjct  101  NLTSLPKPGGGEYGKYYSLPSLNDPRIDKLPYSIRILLESAIRNCDNFQVKKEDVEKIID  160

Query  580  WQT  588
            W+ 
Sbjct  161  WEN  163



>ref|XP_010448188.1| PREDICTED: aconitate hydratase 3, mitochondrial-like [Camelina 
sativa]
Length=998

 Score =   187 bits (476),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 105/124 (85%), Gaps = 2/124 (2%)
 Frame = +1

Query  220  RPLTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  393
            R  +F+SA RS R CS   RWSHG  W+SPASL AQ R++APV+  F RK ATMASE+ +
Sbjct  48   RSKSFSSALRSFRVCSASTRWSHGGSWRSPASLRAQSRNSAPVMEKFERKYATMASEHAY  107

Query  394  KGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKI  573
            K I TSLPKPGGGE+G++YSLPALNDPR+DKLPYS+RILLE+AIRNCDN+QVTK+DVEKI
Sbjct  108  KDILTSLPKPGGGEYGQYYSLPALNDPRVDKLPYSVRILLESAIRNCDNYQVTKDDVEKI  167

Query  574  IDWQ  585
            +DW+
Sbjct  168  LDWE  171



>ref|XP_009599619.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nicotiana tomentosiformis]
Length=985

 Score =   186 bits (473),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 102/124 (82%), Gaps = 11/124 (9%)
 Frame = +1

Query  220  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAA--PVLNDFHRKIATMASENPF  393
            R L F+SA RSLR     W    +WKSP  L AQIR+ A  PVLN FHRK++TMA+ENPF
Sbjct  44   RSLNFSSAVRSLR-----W----NWKSPIILKAQIRTTATTPVLNSFHRKLSTMAAENPF  94

Query  394  KGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKI  573
            KGI T LPKPGGGEFGK+YSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQV KEDVEKI
Sbjct  95   KGILTVLPKPGGGEFGKYYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQVKKEDVEKI  154

Query  574  IDWQ  585
            IDW+
Sbjct  155  IDWE  158



>ref|XP_008379632.1| PREDICTED: aconitate hydratase, cytoplasmic [Malus domestica]
Length=994

 Score =   186 bits (473),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 101/121 (83%), Gaps = 2/121 (2%)
 Frame = +1

Query  226  LTFASAFRSLRCSVPRWSHG-VDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGI  402
            L F SA  + R S PRWSHG V W+SP +L +QIR+ APV+  F RKIA+MASENPFK  
Sbjct  48   LRFLSASSAAR-SFPRWSHGGVHWRSPYTLRSQIRAVAPVIEQFQRKIASMASENPFKAN  106

Query  403  FTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDW  582
             TSLPKPGGGEFGKFYSLP+LNDPRIDKLPYSIRILLE+AIRNCD FQV KEDVEKIIDW
Sbjct  107  LTSLPKPGGGEFGKFYSLPSLNDPRIDKLPYSIRILLESAIRNCDGFQVKKEDVEKIIDW  166

Query  583  Q  585
            +
Sbjct  167  E  167



>ref|XP_009769027.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nicotiana sylvestris]
Length=989

 Score =   186 bits (473),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 103/124 (83%), Gaps = 11/124 (9%)
 Frame = +1

Query  220  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAA--PVLNDFHRKIATMASENPF  393
            R L+F+SA RSLR     W    +WKSP SL AQIR+ A  PVLN  HRK++TMA+ENPF
Sbjct  48   RSLSFSSAVRSLR-----W----NWKSPISLKAQIRTTATTPVLNSSHRKLSTMAAENPF  98

Query  394  KGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKI  573
            KGI T LPKPGGGEFGK+YSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQV KEDVEKI
Sbjct  99   KGILTVLPKPGGGEFGKYYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQVKKEDVEKI  158

Query  574  IDWQ  585
            IDW+
Sbjct  159  IDWE  162



>ref|XP_004487412.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Cicer arietinum]
Length=984

 Score =   186 bits (472),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +1

Query  265  VPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGK  444
            V RWSHGV W+SP SL  QIR+ AP +  FHRKIAT A ENPFKG   +LPKPGGGEFGK
Sbjct  52   VNRWSHGVHWRSPFSLRPQIRAVAPFIERFHRKIATSAGENPFKGNLATLPKPGGGEFGK  111

Query  445  FYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            FYSLP+LNDPRID+LPYSIRILLE+AIRNCDNFQVTKEDVEKIIDW+
Sbjct  112  FYSLPSLNDPRIDRLPYSIRILLESAIRNCDNFQVTKEDVEKIIDWE  158



>ref|XP_003527493.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Glycine max]
Length=979

 Score =   186 bits (471),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = +1

Query  220  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  399
            R  +F++A   LRCSVPRWSH +   SP S    I + APV+  FHR+IATMA+ENPFKG
Sbjct  31   RTSSFSAAPSLLRCSVPRWSHRLHSTSPLSPRPPITAVAPVVERFHRQIATMANENPFKG  90

Query  400  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIID  579
              TSLPKPGGGEFGKFYSLP+LNDPRID+LPYSIRILLE+AIRNCDNFQV KEDVEKI+D
Sbjct  91   NLTSLPKPGGGEFGKFYSLPSLNDPRIDRLPYSIRILLESAIRNCDNFQVKKEDVEKILD  150

Query  580  WQ  585
            W+
Sbjct  151  WE  152



>ref|XP_009353280.1| PREDICTED: aconitate hydratase, cytoplasmic [Pyrus x bretschneideri]
Length=994

 Score =   186 bits (471),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 102/123 (83%), Gaps = 5/123 (4%)
 Frame = +1

Query  220  RPLTFASAFRSLRCSVPRWSHG-VDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFK  396
            R L+ +SA RS     PRWSHG V W+SP +L +QIR+ APV+  F RKIA+MASENPFK
Sbjct  49   RFLSSSSAARSF----PRWSHGGVHWRSPYTLRSQIRAVAPVIEQFQRKIASMASENPFK  104

Query  397  GIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKII  576
               TSLPKPGGGEFGKFYSLP+LNDPRIDKLPYSIRILLE+AIRNCD FQV KEDVEKII
Sbjct  105  ANLTSLPKPGGGEFGKFYSLPSLNDPRIDKLPYSIRILLESAIRNCDGFQVKKEDVEKII  164

Query  577  DWQ  585
            DW+
Sbjct  165  DWE  167



>ref|XP_006592372.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Glycine max]
Length=890

 Score =   184 bits (468),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = +1

Query  229  TFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFT  408
            +F++  RSL CSVPRWSH +   SP +   +I + AP++  FHR+IATMA+ENPFKG  T
Sbjct  39   SFSATARSLLCSVPRWSHRLHSASPLTPRPRISAVAPLVERFHREIATMANENPFKGNLT  98

Query  409  SLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            SLPKPGGGEFGKFYSLP+LNDPRID+LPYSIRILLE+AIRNCDNFQV KEDVEKI+DW+
Sbjct  99   SLPKPGGGEFGKFYSLPSLNDPRIDRLPYSIRILLESAIRNCDNFQVKKEDVEKILDWE  157



>ref|NP_567763.2| aconitase 2 [Arabidopsis thaliana]
 sp|Q94A28.3|ACO3M_ARATH RecName: Full=Aconitate hydratase 3, mitochondrial; Short=Aconitase 
3; AltName: Full=Citrate hydro-lyase 3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE85279.1| aconitase 2 [Arabidopsis thaliana]
Length=995

 Score =   185 bits (470),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 103/124 (83%), Gaps = 2/124 (2%)
 Frame = +1

Query  220  RPLTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  393
            R  +F+SA RS R CS   RWSHG  W SPASL AQ R++ PV+  F RK ATMASE+ +
Sbjct  45   RSKSFSSALRSFRVCSASTRWSHGGSWGSPASLRAQARNSTPVMEKFERKYATMASEHSY  104

Query  394  KGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKI  573
            K I TSLPKPGGGE+GK+YSLPALNDPRIDKLP+S+RILLE+AIRNCDN+QVTK+DVEKI
Sbjct  105  KDILTSLPKPGGGEYGKYYSLPALNDPRIDKLPFSVRILLESAIRNCDNYQVTKDDVEKI  164

Query  574  IDWQ  585
            +DW+
Sbjct  165  LDWE  168



>gb|AAK91447.1| AT4g26970/F10M23_310 [Arabidopsis thaliana]
 gb|AAN18061.1| At4g26970/F10M23_310 [Arabidopsis thaliana]
Length=995

 Score =   185 bits (470),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 103/124 (83%), Gaps = 2/124 (2%)
 Frame = +1

Query  220  RPLTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  393
            R  +F+SA RS R CS   RWSHG  W SPASL AQ R++ PV+  F RK ATMASE+ +
Sbjct  45   RSKSFSSALRSFRVCSASTRWSHGGSWGSPASLRAQARNSTPVMEKFERKYATMASEHSY  104

Query  394  KGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKI  573
            K I TSLPKPGGGE+GK+YSLPALNDPRIDKLP+S+RILLE+AIRNCDN+QVTK+DVEKI
Sbjct  105  KDILTSLPKPGGGEYGKYYSLPALNDPRIDKLPFSVRILLESAIRNCDNYQVTKDDVEKI  164

Query  574  IDWQ  585
            +DW+
Sbjct  165  LDWE  168



>ref|XP_003539865.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Glycine max]
Length=984

 Score =   185 bits (469),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = +1

Query  229  TFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFT  408
            +F++  RSL CSVPRWSH +   SP +   +I + AP++  FHR+IATMA+ENPFKG  T
Sbjct  39   SFSATARSLLCSVPRWSHRLHSASPLTPRPRISAVAPLVERFHREIATMANENPFKGNLT  98

Query  409  SLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            SLPKPGGGEFGKFYSLP+LNDPRID+LPYSIRILLE+AIRNCDNFQV KEDVEKI+DW+
Sbjct  99   SLPKPGGGEFGKFYSLPSLNDPRIDRLPYSIRILLESAIRNCDNFQVKKEDVEKILDWE  157



>ref|XP_002869584.1| hypothetical protein ARALYDRAFT_492099 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45843.1| hypothetical protein ARALYDRAFT_492099 [Arabidopsis lyrata subsp. 
lyrata]
Length=995

 Score =   185 bits (469),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 103/124 (83%), Gaps = 2/124 (2%)
 Frame = +1

Query  220  RPLTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  393
            R  +F+SA RS R CS   RWSHGV W SPASL AQ R++APV+  F R  ATMASE+ +
Sbjct  45   RSKSFSSALRSFRVCSASTRWSHGVSWGSPASLRAQSRNSAPVMEKFERTYATMASEHAY  104

Query  394  KGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKI  573
            K I TSLPKPGGGE+G +YSLPALNDPR+DKLP+S+RILLE+AIRNCDN+QVTK+DVEKI
Sbjct  105  KDILTSLPKPGGGEYGNYYSLPALNDPRVDKLPFSVRILLESAIRNCDNYQVTKDDVEKI  164

Query  574  IDWQ  585
            +DW+
Sbjct  165  LDWE  168



>ref|XP_010488774.1| PREDICTED: aconitate hydratase 2, mitochondrial [Camelina sativa]
Length=991

 Score =   184 bits (467),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 102/120 (85%), Gaps = 5/120 (4%)
 Frame = +1

Query  229  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  405
            T + AFRSL    PRWSH    K SP SLT+QIR+ +PVL+   R  ++MASE+P+KGIF
Sbjct  49   TISPAFRSL----PRWSHCFHSKPSPFSLTSQIRAVSPVLDRLQRTFSSMASEHPYKGIF  104

Query  406  TSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            T+LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQVTKEDVEKIIDW+
Sbjct  105  TTLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQVTKEDVEKIIDWE  164



>ref|XP_006413121.1| hypothetical protein EUTSA_v10024309mg [Eutrema salsugineum]
 gb|ESQ54574.1| hypothetical protein EUTSA_v10024309mg [Eutrema salsugineum]
Length=999

 Score =   184 bits (466),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 104/124 (84%), Gaps = 2/124 (2%)
 Frame = +1

Query  220  RPLTFASAFRSLRC--SVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  393
            R  +F+SA RS R   +  RWS+G +W+SPASL AQ R++APV+  F RK ATMASE+ +
Sbjct  48   RSKSFSSALRSFRVGSASTRWSYGGNWRSPASLRAQTRNSAPVMERFERKYATMASEHAY  107

Query  394  KGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKI  573
            K I TSLPKP GGE+GK+YSLPALNDPRID+LPYS+RILLE+AIRNCDN+QVTK+DVEKI
Sbjct  108  KDILTSLPKPDGGEYGKYYSLPALNDPRIDRLPYSVRILLESAIRNCDNYQVTKDDVEKI  167

Query  574  IDWQ  585
            IDW+
Sbjct  168  IDWE  171



>ref|XP_010467089.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=994

 Score =   184 bits (466),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 102/120 (85%), Gaps = 5/120 (4%)
 Frame = +1

Query  229  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  405
            T + AFRSL    PRWSH    K SP SLT+QIR+ +PVL+   R  ++MASE+P+KGIF
Sbjct  52   TISPAFRSL----PRWSHCFHSKPSPFSLTSQIRAVSPVLDRLQRTFSSMASEHPYKGIF  107

Query  406  TSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            T+LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQVTKEDVEKIIDW+
Sbjct  108  TTLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQVTKEDVEKIIDWE  167



>ref|XP_010433420.1| PREDICTED: aconitate hydratase 3, mitochondrial [Camelina sativa]
Length=997

 Score =   183 bits (465),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 102/124 (82%), Gaps = 2/124 (2%)
 Frame = +1

Query  220  RPLTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  393
            R  +F+SA RS R CS   RWSHG  W+SP SL AQ R++APV+  F RK ATM SE+ +
Sbjct  47   RSKSFSSALRSFRVCSASTRWSHGGSWRSPVSLRAQSRNSAPVMEKFERKYATMTSEHAY  106

Query  394  KGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKI  573
            K I TSLPKPGGG +GK+YSLPALNDPR+DKLPYS+RILLE+AIRNCDN+QVTK+DVEKI
Sbjct  107  KDILTSLPKPGGGAYGKYYSLPALNDPRVDKLPYSVRILLESAIRNCDNYQVTKDDVEKI  166

Query  574  IDWQ  585
            +DW+
Sbjct  167  LDWE  170



>ref|XP_006283068.1| hypothetical protein CARUB_v10004061mg [Capsella rubella]
 gb|EOA15966.1| hypothetical protein CARUB_v10004061mg [Capsella rubella]
Length=995

 Score =   183 bits (464),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 103/124 (83%), Gaps = 2/124 (2%)
 Frame = +1

Query  220  RPLTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  393
            R  +F+SA RS R CS   RWSHG  W+SPASL AQ R +APV+  F RK ATMASE+ +
Sbjct  45   RSKSFSSALRSFRVCSASTRWSHGGSWRSPASLRAQSRISAPVMEKFERKYATMASEHAY  104

Query  394  KGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKI  573
            K I TSLPKPGGGE+GK+YSLPALNDPR+DKLPYS+RILLE+AIRN DN+QVTK+DVEKI
Sbjct  105  KDILTSLPKPGGGEYGKYYSLPALNDPRVDKLPYSVRILLESAIRNYDNYQVTKDDVEKI  164

Query  574  IDWQ  585
            +DW+
Sbjct  165  LDWE  168



>emb|CDY66424.1| BnaAnng22230D [Brassica napus]
Length=995

 Score =   182 bits (463),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 103/124 (83%), Gaps = 2/124 (2%)
 Frame = +1

Query  220  RPLTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  393
            R  +F+SA RS R CS   RWSHG  W+SPASL AQ R +APV+    R+ A+MASE+ +
Sbjct  45   RSRSFSSALRSYRVCSASTRWSHGGSWRSPASLRAQARVSAPVMERLERRYASMASEHAY  104

Query  394  KGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKI  573
            K + TSLPKPGGGE+GK+YSLPALNDPRIDKLPYS+RILLE+AIRNCDN+QVTK+DVEKI
Sbjct  105  KDLLTSLPKPGGGEYGKYYSLPALNDPRIDKLPYSVRILLESAIRNCDNYQVTKDDVEKI  164

Query  574  IDWQ  585
            +DW+
Sbjct  165  LDWE  168



>emb|CDY14291.1| BnaA08g14220D [Brassica napus]
Length=995

 Score =   182 bits (463),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 103/124 (83%), Gaps = 2/124 (2%)
 Frame = +1

Query  220  RPLTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  393
            R  +F+SA RS R CS   RWSHG  W+SPASL AQ R +APV+    R+ A+MASE+ +
Sbjct  45   RSRSFSSALRSYRVCSASTRWSHGGSWRSPASLRAQARVSAPVMERLERRYASMASEHAY  104

Query  394  KGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKI  573
            K + TSLPKPGGGE+GK+YSLPALNDPRIDKLPYS+RILLE+AIRNCDN+QVTK+DVEKI
Sbjct  105  KDLLTSLPKPGGGEYGKYYSLPALNDPRIDKLPYSVRILLESAIRNCDNYQVTKDDVEKI  164

Query  574  IDWQ  585
            +DW+
Sbjct  165  LDWE  168



>gb|KHG08190.1| Aconitate hydratase 2, mitochondrial [Gossypium arboreum]
Length=973

 Score =   182 bits (463),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +1

Query  229  TFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFT  408
            T +   RS   S  RW H +DW+SP SL AQIR+  PV   F ++ ATMA+E+PFK + T
Sbjct  47   TASVVVRSFHSSASRWCHRLDWRSPLSLRAQIRAFNPVTERFQKQFATMAAEHPFKEVLT  106

Query  409  SLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            SLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+A+RNCDNFQV KEDVEKIIDW+
Sbjct  107  SLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAVRNCDNFQVKKEDVEKIIDWE  165



>ref|XP_002883704.1| hypothetical protein ARALYDRAFT_480186 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59963.1| hypothetical protein ARALYDRAFT_480186 [Arabidopsis lyrata subsp. 
lyrata]
Length=993

 Score =   182 bits (462),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 100/120 (83%), Gaps = 5/120 (4%)
 Frame = +1

Query  229  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  405
            T + AFRSL    PRWSH    K SP  LT QIR+ +PVL+   R  ++MASE+PFKGIF
Sbjct  51   TISPAFRSL----PRWSHCFHSKPSPFRLTTQIRAVSPVLDRLERTFSSMASEHPFKGIF  106

Query  406  TSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            T+LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQVTKEDVEKIIDW+
Sbjct  107  TTLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQVTKEDVEKIIDWE  166



>ref|XP_009109156.1| PREDICTED: aconitate hydratase 3, mitochondrial [Brassica rapa]
Length=995

 Score =   182 bits (461),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 102/121 (84%), Gaps = 2/121 (2%)
 Frame = +1

Query  229  TFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGI  402
            +F+SA RS R CS   RWSHG  W+SPASL AQ R +APV+    R+ A+MASE+ ++ I
Sbjct  48   SFSSALRSYRVCSASTRWSHGGSWRSPASLRAQARVSAPVMERLERRYASMASEHTYQDI  107

Query  403  FTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDW  582
             TSLPKPGGGE+GK+YSLPALNDPRIDKLPYS+RILLE+AIRNCDN+QVTK+DVEKI+DW
Sbjct  108  LTSLPKPGGGEYGKYYSLPALNDPRIDKLPYSVRILLESAIRNCDNYQVTKDDVEKILDW  167

Query  583  Q  585
            +
Sbjct  168  E  168



>ref|XP_008230066.1| PREDICTED: aconitate hydratase, cytoplasmic [Prunus mume]
Length=994

 Score =   181 bits (460),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 94/106 (89%), Gaps = 1/106 (1%)
 Frame = +1

Query  271  RWSHG-VDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKF  447
            RWSHG V W+SP +L +QIR+ APV+  F RKIA+MASENPFK   TSLPKPGGGEFGKF
Sbjct  64   RWSHGGVHWRSPYTLRSQIRAIAPVIEQFQRKIASMASENPFKANLTSLPKPGGGEFGKF  123

Query  448  YSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            YSLP+LNDPRID+LPYSIRILLE+AIRNCDNFQV KEDVEKIIDW+
Sbjct  124  YSLPSLNDPRIDRLPYSIRILLESAIRNCDNFQVKKEDVEKIIDWE  169



>ref|XP_010412716.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=991

 Score =   181 bits (460),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 101/120 (84%), Gaps = 5/120 (4%)
 Frame = +1

Query  229  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  405
            T + AFRSL    PRWSH    K SP SLT+QIR+ +PVL+   R  ++MASE+P+KGIF
Sbjct  49   TISPAFRSL----PRWSHCFHSKPSPFSLTSQIRAVSPVLDRLQRTFSSMASEHPYKGIF  104

Query  406  TSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            T+LPKP GGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQVTKEDVEKIIDW+
Sbjct  105  TTLPKPSGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQVTKEDVEKIIDWE  164



>gb|KJB30569.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=985

 Score =   180 bits (457),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = +1

Query  229  TFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFT  408
            T +   RS   S  RW H +DW+SP SL AQIR+  PV+  F ++ ATMA+E+PFK + T
Sbjct  47   TASVVVRSFHSSASRWCHRLDWRSPFSLRAQIRALNPVIERFQKQFATMAAEHPFKEVLT  106

Query  409  SLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDW  582
            SLPKPGGGEFGKFYSLPALNDPRIDKLPYSI ILLE+A+RNCDNFQV KEDVEKIIDW
Sbjct  107  SLPKPGGGEFGKFYSLPALNDPRIDKLPYSITILLESAVRNCDNFQVKKEDVEKIIDW  164



>gb|KJB30566.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
 gb|KJB30567.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=992

 Score =   180 bits (457),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = +1

Query  229  TFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFT  408
            T +   RS   S  RW H +DW+SP SL AQIR+  PV+  F ++ ATMA+E+PFK + T
Sbjct  47   TASVVVRSFHSSASRWCHRLDWRSPFSLRAQIRALNPVIERFQKQFATMAAEHPFKEVLT  106

Query  409  SLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDW  582
            SLPKPGGGEFGKFYSLPALNDPRIDKLPYSI ILLE+A+RNCDNFQV KEDVEKIIDW
Sbjct  107  SLPKPGGGEFGKFYSLPALNDPRIDKLPYSITILLESAVRNCDNFQVKKEDVEKIIDW  164



>emb|CDY50945.1| BnaC03g74450D [Brassica napus]
Length=995

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 104/124 (84%), Gaps = 6/124 (5%)
 Frame = +1

Query  220  RPLTFAS-AFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPF  393
            RP   +S AFRSL    PRWSH +  + SP  L++QIR+ +P L+   RK ++MASE+PF
Sbjct  49   RPFATSSPAFRSL----PRWSHCLHSRLSPFRLSSQIRAVSPGLDRLERKFSSMASEHPF  104

Query  394  KGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKI  573
            KGIFT+LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQVTKEDVEKI
Sbjct  105  KGIFTTLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQVTKEDVEKI  164

Query  574  IDWQ  585
            IDW+
Sbjct  165  IDWE  168



>ref|XP_007217144.1| hypothetical protein PRUPE_ppa000812mg [Prunus persica]
 gb|EMJ18343.1| hypothetical protein PRUPE_ppa000812mg [Prunus persica]
Length=996

 Score =   180 bits (456),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 94/106 (89%), Gaps = 1/106 (1%)
 Frame = +1

Query  271  RWSHG-VDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKF  447
            RWSHG V W+SP +L +QIR+ APV+  F RK+A+MASENPFK   TSLPKPGGGEFGKF
Sbjct  64   RWSHGGVHWRSPYTLRSQIRAVAPVIEQFQRKMASMASENPFKANLTSLPKPGGGEFGKF  123

Query  448  YSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            YSLP+LNDPRID+LPYSIRILLE+AIRNCDNFQV KEDVEKI+DW+
Sbjct  124  YSLPSLNDPRIDRLPYSIRILLESAIRNCDNFQVKKEDVEKILDWE  169



>ref|XP_008342002.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Malus domestica]
Length=992

 Score =   179 bits (455),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 94/107 (88%), Gaps = 1/107 (1%)
 Frame = +1

Query  268  PRWSHG-VDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGK  444
            PRWSHG V W+S  +L +QIR+ APV+  F RKIA+MASENPFK   TSLPKPGGGEFGK
Sbjct  59   PRWSHGGVHWRSSYTLRSQIRAVAPVIEQFQRKIASMASENPFKPNLTSLPKPGGGEFGK  118

Query  445  FYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            FYSLP+LNDPRID+LPYSIRILLE+AIRNCDNFQV KEDVEKI+DW+
Sbjct  119  FYSLPSLNDPRIDRLPYSIRILLESAIRNCDNFQVKKEDVEKILDWE  165



>ref|XP_006296904.1| hypothetical protein CARUB_v10012896mg [Capsella rubella]
 gb|EOA29802.1| hypothetical protein CARUB_v10012896mg [Capsella rubella]
Length=988

 Score =   179 bits (455),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 99/116 (85%), Gaps = 1/116 (1%)
 Frame = +1

Query  241  AFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLP  417
            +F S+  +  RWSH    K SP SLT+QIR+ +PVL+   R  ++MASE+PFKGIFT+LP
Sbjct  46   SFGSISPAFRRWSHCFHSKPSPISLTSQIRAVSPVLDRLQRTFSSMASEHPFKGIFTALP  105

Query  418  KPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            KPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQVTKEDVEKIIDW+
Sbjct  106  KPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQVTKEDVEKIIDWE  161



>gb|KFK29204.1| hypothetical protein AALP_AA7G102800 [Arabis alpina]
Length=999

 Score =   178 bits (452),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 104/127 (82%), Gaps = 4/127 (3%)
 Frame = +1

Query  220  RPLTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMAS--EN  387
            R  +F+SA RS R CS   RWSHG  W+SPASL AQ R +APV+  F RK AT+AS  E+
Sbjct  47   RSKSFSSALRSFRVCSASTRWSHGGSWRSPASLRAQARISAPVMERFERKYATIASDSEH  106

Query  388  PFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVE  567
             +K I TSLPKP GGE+GK+YSLPALNDPR+DKLPYS+RILLE+AIRNCDN+QVTK+DVE
Sbjct  107  AYKDILTSLPKPDGGEYGKYYSLPALNDPRVDKLPYSVRILLESAIRNCDNYQVTKDDVE  166

Query  568  KIIDWQT  588
            KI+DW++
Sbjct  167  KILDWES  173



>ref|XP_010675721.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Beta vulgaris 
subsp. vulgaris]
Length=1015

 Score =   178 bits (451),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +1

Query  220  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  399
            R L F+S  RS+  +  RWSHGVDW+SP SL +QI ++ P++  F RKIATMASE+P+K 
Sbjct  67   RSLGFSSVIRSISSASSRWSHGVDWRSPVSLRSQIAASPPLVERFQRKIATMASEHPYKE  126

Query  400  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIID  579
            IFTSLPKPGGGEFGKFYSLPALNDPR++KLPYSIRILLE+AIRNCD FQVTK+DVEKIID
Sbjct  127  IFTSLPKPGGGEFGKFYSLPALNDPRVEKLPYSIRILLESAIRNCDGFQVTKDDVEKIID  186

Query  580  WQ  585
            W+
Sbjct  187  WE  188



>ref|XP_009148490.1| PREDICTED: aconitate hydratase 2, mitochondrial [Brassica rapa]
Length=991

 Score =   178 bits (451),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 101/120 (84%), Gaps = 5/120 (4%)
 Frame = +1

Query  229  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  405
            T + AFRSL    PRWSH +  + SP  L++QIR+ +P L+   R  ++MASE+PFKGIF
Sbjct  49   TSSPAFRSL----PRWSHCLHSRPSPFRLSSQIRAVSPGLDRLERNFSSMASEHPFKGIF  104

Query  406  TSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            T+LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQVTKEDVEKIIDW+
Sbjct  105  TTLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQVTKEDVEKIIDWE  164



>emb|CDX97969.1| BnaA06g07200D [Brassica napus]
Length=991

 Score =   177 bits (450),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 101/120 (84%), Gaps = 5/120 (4%)
 Frame = +1

Query  229  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  405
            T + AFRSL    PRWSH +  + SP  L++QIR+ +P L+   R  ++MASE+PFKGIF
Sbjct  49   TSSPAFRSL----PRWSHCLHSRPSPFRLSSQIRAVSPGLDRLERNFSSMASEHPFKGIF  104

Query  406  TSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            T+LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQVTKEDVEKIIDW+
Sbjct  105  TTLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQVTKEDVEKIIDWE  164



>gb|KFK39331.1| hypothetical protein AALP_AA3G230700 [Arabis alpina]
Length=986

 Score =   177 bits (449),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 101/120 (84%), Gaps = 5/120 (4%)
 Frame = +1

Query  229  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  405
            +FA+ FRSL    PRWSH +  + S   L++QIR+ +PVL+   R  ++MASE+PFKGIF
Sbjct  44   SFATCFRSL----PRWSHCLHSRPSSFRLSSQIRAVSPVLDRLQRTFSSMASEHPFKGIF  99

Query  406  TSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            T+LPKP GGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQVTKEDVEKIIDW+
Sbjct  100  TTLPKPDGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQVTKEDVEKIIDWE  159



>ref|XP_003605929.1| Aconitate hydratase [Medicago truncatula]
 gb|AES88126.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=979

 Score =   176 bits (446),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +1

Query  247  RSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPG  426
            RS   S+PR++      S  SL  QI + AP++  FHRKIATMASENPFKG  TSLPKPG
Sbjct  40   RSFFYSLPRFNRRFHSSSHLSLRPQITAVAPLVERFHRKIATMASENPFKGNLTSLPKPG  99

Query  427  GGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            GGEFGKFYSLP+LNDPRIDKLPYSIRILLE+AIRNCDNFQVTKEDVEKIIDW+
Sbjct  100  GGEFGKFYSLPSLNDPRIDKLPYSIRILLESAIRNCDNFQVTKEDVEKIIDWE  152



>ref|XP_010929878.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Elaeis 
guineensis]
Length=1009

 Score =   176 bits (446),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 94/113 (83%), Gaps = 1/113 (1%)
 Frame = +1

Query  247  RSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPG  426
            R L  S   W HG +W+SP SL AQIRS+A V+  F RK+AT+A+ENPFK I TSLPKP 
Sbjct  69   RPLVRSFGTWRHG-NWRSPVSLRAQIRSSAVVIERFQRKMATLATENPFKNILTSLPKPR  127

Query  427  GGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            GGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQVT  DVEKIIDW+
Sbjct  128  GGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQVTNNDVEKIIDWE  180



>ref|XP_008804304.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Phoenix 
dactylifera]
Length=1010

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 94/113 (83%), Gaps = 1/113 (1%)
 Frame = +1

Query  247  RSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPG  426
            R L  S   W HG   +SP SL AQIRS+A V+  F RK+ATMA+ENPFK I TSLPKPG
Sbjct  70   RPLVRSFGTWRHGSS-RSPVSLRAQIRSSAAVIERFQRKMATMATENPFKNILTSLPKPG  128

Query  427  GGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            GGEFGKFYSLPAL+DPRIDKLPYSIRILLE+AIRNCDNFQVTK DVEKIIDW+
Sbjct  129  GGEFGKFYSLPALSDPRIDKLPYSIRILLESAIRNCDNFQVTKNDVEKIIDWE  181



>ref|XP_010450391.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=980

 Score =   175 bits (443),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 96/114 (84%), Gaps = 1/114 (1%)
 Frame = +1

Query  247  RSLRCSVPRWSHGVDWKS-PASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKP  423
            RS   S+PR SH +  KS    L +QIR+ +PVL+   R  ++MASE+PFKGIFT+LPKP
Sbjct  40   RSFLTSLPRLSHCLHSKSFQIRLGSQIRAVSPVLDRLQRTFSSMASEHPFKGIFTTLPKP  99

Query  424  GGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            GGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQVTKEDVEKIIDW+
Sbjct  100  GGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQVTKEDVEKIIDWE  153



>gb|KHG02134.1| hypothetical protein F383_25649 [Gossypium arboreum]
Length=993

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 93/109 (85%), Gaps = 4/109 (4%)
 Frame = +1

Query  259  CSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEF  438
            CS PR    + W+SP SL    R++ PV+  FHR+IAT ASE+PFKG+ TSLPKPGGGEF
Sbjct  62   CSAPR----LHWRSPESLRILARTSVPVVERFHRRIATTASEHPFKGVMTSLPKPGGGEF  117

Query  439  GKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            GKFYSLPALNDPRID+LPYSIRILLE+AIRNCDNFQVTK+DVEKIIDW+
Sbjct  118  GKFYSLPALNDPRIDRLPYSIRILLESAIRNCDNFQVTKDDVEKIIDWE  166



>ref|NP_178634.2| aconitate hydratase 3 [Arabidopsis thaliana]
 sp|Q9SIB9.2|ACO2M_ARATH RecName: Full=Aconitate hydratase 2, mitochondrial; Short=Aconitase 
2; AltName: Full=Citrate hydro-lyase 2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAM97080.1| cytoplasmic aconitate hydratase [Arabidopsis thaliana]
 gb|AAP68248.1| At2g05710 [Arabidopsis thaliana]
 gb|AEC05964.1| aconitate hydratase 3 [Arabidopsis thaliana]
Length=990

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 97/116 (84%), Gaps = 1/116 (1%)
 Frame = +1

Query  241  AFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLP  417
            +F ++  +  RWSH    K SP   T+QIR+ +PVL+   R  ++MASE+PFKGIFT+LP
Sbjct  48   SFGTISPAFRRWSHSFHSKPSPFRFTSQIRAVSPVLDRLQRTFSSMASEHPFKGIFTTLP  107

Query  418  KPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            KPGGGEFGKFYSLPALNDPR+DKLPYSIRILLE+AIRNCDNFQVTKEDVEKIIDW+
Sbjct  108  KPGGGEFGKFYSLPALNDPRVDKLPYSIRILLESAIRNCDNFQVTKEDVEKIIDWE  163



>ref|XP_009136177.1| PREDICTED: aconitate hydratase 2, mitochondrial [Brassica rapa]
Length=995

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 100/120 (83%), Gaps = 5/120 (4%)
 Frame = +1

Query  229  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  405
            T + AFRSL    PRWSH +  + SP  L++QIR+ +P L+   R  ++MASE+PFKGIF
Sbjct  53   TSSPAFRSL----PRWSHCLHSRPSPFRLSSQIRAVSPGLDRLERNFSSMASEHPFKGIF  108

Query  406  TSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            T+LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQVTK DVEKIIDW+
Sbjct  109  TTLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQVTKGDVEKIIDWE  168



>emb|CDY18054.1| BnaC07g04160D [Brassica napus]
Length=986

 Score =   174 bits (441),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 101/120 (84%), Gaps = 5/120 (4%)
 Frame = +1

Query  229  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  405
            T++ AFRSL     RWSH +  + SP  L++QIR+A+PVL+   +  ++MASE+PFKGI 
Sbjct  44   TYSPAFRSL----ARWSHCLHSRPSPFRLSSQIRTASPVLDRLEKNFSSMASEHPFKGIL  99

Query  406  TSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            T+LPKPGGGEFGKFYSLPALND RIDKLPY+IRILLE+AIRNCDNFQVTKEDVEKIIDW+
Sbjct  100  TTLPKPGGGEFGKFYSLPALNDSRIDKLPYTIRILLESAIRNCDNFQVTKEDVEKIIDWE  159



>ref|XP_006396145.1| hypothetical protein EUTSA_v10002387mg [Eutrema salsugineum]
 gb|ESQ36924.1| hypothetical protein EUTSA_v10002387mg [Eutrema salsugineum]
Length=995

 Score =   174 bits (441),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 103/121 (85%), Gaps = 4/121 (3%)
 Frame = +1

Query  229  TFASAFRSLRCSVPRWSHGVDWKSPASL--TAQIRSAAPVLNDFHRKIATMASENPFKGI  402
            +FA++  + R S+PRWSH +  + P S   ++QIR+ +PVL+   R  ++MASE+PFKGI
Sbjct  50   SFATSSPTFR-SLPRWSHCLHSR-PYSFRFSSQIRAVSPVLDRLERNFSSMASEHPFKGI  107

Query  403  FTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDW  582
            FTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQVTKEDVEKI+DW
Sbjct  108  FTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQVTKEDVEKIVDW  167

Query  583  Q  585
            +
Sbjct  168  E  168



>ref|XP_010440740.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010440741.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Camelina sativa]
Length=981

 Score =   172 bits (437),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 95/114 (83%), Gaps = 1/114 (1%)
 Frame = +1

Query  247  RSLRCSVPRWSHGVDWKS-PASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKP  423
            RS   S+PR SH +  K     L +QIR+ +PVL+   R  ++MASE+PFKGIFT+LPKP
Sbjct  41   RSFLTSLPRLSHCLHSKPFQIRLGSQIRAVSPVLDRLQRTFSSMASEHPFKGIFTTLPKP  100

Query  424  GGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            GGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQVTKEDVEKIIDW+
Sbjct  101  GGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQVTKEDVEKIIDWE  154



>ref|XP_002870438.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46697.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=977

 Score =   172 bits (436),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 95/113 (84%), Gaps = 2/113 (2%)
 Frame = +1

Query  247  RSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPG  426
            RS   S+PR SH   +  P  + +QIR+ +PVL+   R  ++MASE+P+KGIFT+LPKPG
Sbjct  40   RSFVTSLPRLSHSKPF--PLRIGSQIRAVSPVLDRLQRTFSSMASEHPYKGIFTTLPKPG  97

Query  427  GGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            GGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQVTKEDVEKIIDW+
Sbjct  98   GGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQVTKEDVEKIIDWE  150



>ref|XP_002279260.1| PREDICTED: aconitate hydratase, cytoplasmic [Vitis vinifera]
 emb|CBI28935.3| unnamed protein product [Vitis vinifera]
Length=987

 Score =   171 bits (434),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 97/123 (79%), Gaps = 9/123 (7%)
 Frame = +1

Query  220  RPLTFAS-AFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFK  396
            R L F+S AFRSLR         V+++ P SL AQI +A PV+  F R+IATMA EN FK
Sbjct  46   RSLRFSSSAFRSLRS--------VNFRPPMSLRAQIGAAVPVVEQFQRRIATMAPENAFK  97

Query  397  GIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKII  576
            GI T LPK  GGEFGK+YSLPALNDPR+DKLPYSIRILLE+AIRNCDNFQVTKEDVEKII
Sbjct  98   GILTGLPKASGGEFGKYYSLPALNDPRVDKLPYSIRILLESAIRNCDNFQVTKEDVEKII  157

Query  577  DWQ  585
            DW+
Sbjct  158  DWE  160



>emb|CDX93088.1| BnaA03g38100D [Brassica napus]
Length=994

 Score =   171 bits (433),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 99/120 (83%), Gaps = 5/120 (4%)
 Frame = +1

Query  229  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  405
            T + AFRSL    PRWSH +  + S   L++QIR+ +P L+   R  ++MASE+PFKGIF
Sbjct  52   TSSPAFRSL----PRWSHCLHSRPSLFRLSSQIRAVSPGLDRLERNFSSMASEHPFKGIF  107

Query  406  TSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            T+LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQVTK DVEKIIDW+
Sbjct  108  TTLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQVTKGDVEKIIDWE  167



>ref|XP_010533007.1| PREDICTED: aconitate hydratase, cytoplasmic isoform X1 [Tarenaya 
hassleriana]
Length=998

 Score =   170 bits (431),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 97/123 (79%), Gaps = 6/123 (5%)
 Frame = +1

Query  220  RPLTFASAFRSLRCSVPRWSHGVDWKS-PASLTAQIRSAAPVLNDFHRKIATMASENPFK  396
            R    +  FRSL    PRWSH +  +S P  +  QIR+ +PVL    +  +TMA E+PFK
Sbjct  54   RSFGASPGFRSL----PRWSHCLHRRSIPLRVGPQIRAVSPVLERLEKTFSTMA-EHPFK  108

Query  397  GIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKII  576
            GIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQVTKEDVEKII
Sbjct  109  GIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQVTKEDVEKII  168

Query  577  DWQ  585
            DW+
Sbjct  169  DWE  171



>emb|CDY56501.1| BnaAnng14360D [Brassica napus]
Length=973

 Score =   170 bits (431),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 100/121 (83%), Gaps = 6/121 (5%)
 Frame = +1

Query  229  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASEN-PFKGI  402
            T + AFRSL    PRWSH +  + S   L++ IR+A+PVL+   R  ++MASE+ PFKGI
Sbjct  42   TSSPAFRSL----PRWSHCLHSRPSLFRLSSHIRTASPVLDRLERNFSSMASEHHPFKGI  97

Query  403  FTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDW  582
            FT+LPKPGGGEFGKFYSLPALNDPRIDKLPY IRILLE+AIRNCDNFQVTKEDVEKIIDW
Sbjct  98   FTTLPKPGGGEFGKFYSLPALNDPRIDKLPYYIRILLESAIRNCDNFQVTKEDVEKIIDW  157

Query  583  Q  585
            +
Sbjct  158  E  158



>ref|XP_010443085.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443086.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443087.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443088.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443089.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443090.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443091.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443092.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
Length=981

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 97/122 (80%), Gaps = 2/122 (2%)
 Frame = +1

Query  226  LTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  399
            + F  AFR  R CS   RWSHG +W+ PASL AQ R AAP L  F RK A++ASE+ +K 
Sbjct  38   VKFLLAFRLFRVCSAATRWSHGANWRLPASLQAQTRIAAPRLKKFERKFASIASEHAYKD  97

Query  400  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIID  579
            I T+L KP GGE+GKFYSLPALNDPRID+LPYS+RILLE+AIRNCD+F +TK+DVEKI+D
Sbjct  98   ILTTLHKPDGGEYGKFYSLPALNDPRIDRLPYSVRILLESAIRNCDSFHITKDDVEKIMD  157

Query  580  WQ  585
            W+
Sbjct  158  WE  159



>ref|XP_004517086.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Cicer arietinum]
Length=979

 Score =   168 bits (425),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = +1

Query  247  RSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPG  426
            RS   S+PR++    + S  SL   I +  P +  FHR IATM++ENPFKG  TSLPKPG
Sbjct  40   RSFFSSIPRFNRRFHYTSYRSLRPHISAVTPGIERFHRTIATMSNENPFKGNLTSLPKPG  99

Query  427  GGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            GGEFGKFYSLP+LNDPRI+KLPYSIRILLE+AIRNCDNFQVTKEDVEKIIDW+
Sbjct  100  GGEFGKFYSLPSLNDPRIEKLPYSIRILLESAIRNCDNFQVTKEDVEKIIDWE  152



>ref|XP_004287944.1| PREDICTED: aconitate hydratase, cytoplasmic [Fragaria vesca subsp. 
vesca]
Length=990

 Score =   165 bits (418),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 95/122 (78%), Gaps = 1/122 (1%)
 Frame = +1

Query  223  PLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASE-NPFKG  399
            P +F +       +  RWSHGV W++P +L +QIR+ APV+    R+IATMA E +PFK 
Sbjct  42   PRSFTAQRLLSSSAATRWSHGVHWRAPYTLRSQIRAIAPVVERVQRRIATMAPESHPFKE  101

Query  400  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIID  579
              TSLPKPGGGE+GKFYSL +L DPRID+LPYSIRILLE+AIRNCDNFQV KEDVEKI+D
Sbjct  102  HLTSLPKPGGGEYGKFYSLTSLKDPRIDRLPYSIRILLESAIRNCDNFQVKKEDVEKILD  161

Query  580  WQ  585
            W+
Sbjct  162  WE  163



>ref|XP_007132546.1| hypothetical protein PHAVU_011G1037001g, partial [Phaseolus vulgaris]
 gb|ESW04540.1| hypothetical protein PHAVU_011G1037001g, partial [Phaseolus vulgaris]
Length=846

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = +1

Query  268  PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKF  447
            P+WSH +   SP +L   IR+ AP +  FHR+IA  A ENPFKG  TSLPKPGGGEFGKF
Sbjct  50   PQWSHRLRRVSPLTLRRPIRAVAPPVERFHREIAATAKENPFKGNLTSLPKPGGGEFGKF  109

Query  448  YSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            YSLP+LNDPRID+LPYSIRILLE+AIRNCDNFQV KEDVEKI+ W+
Sbjct  110  YSLPSLNDPRIDRLPYSIRILLESAIRNCDNFQVKKEDVEKILAWE  155



>ref|XP_002532564.1| aconitase, putative [Ricinus communis]
 gb|EEF29825.1| aconitase, putative [Ricinus communis]
Length=990

 Score =   162 bits (411),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 97/126 (77%), Gaps = 9/126 (7%)
 Frame = +1

Query  220  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  399
            R  +F+SA RSL C+V RWSH VDW+SP SL AQ  +A+PV+    RK++T+ASE+P   
Sbjct  51   RSFSFSSALRSLPCAVSRWSHRVDWRSPISLRAQAPAASPVI---ERKLSTIASEHP---  104

Query  400  IFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIID  579
                  KPGGGEFGKFYSL AL+DPRID+LPYSI+ILLE+AIRNCDNFQV KE VEKIID
Sbjct  105  ---XXXKPGGGEFGKFYSLTALDDPRIDRLPYSIKILLESAIRNCDNFQVAKEHVEKIID  161

Query  580  WQTLLL  597
            W+   L
Sbjct  162  WENTSL  167



>ref|XP_009419582.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Musa acuminata 
subsp. malaccensis]
Length=1003

 Score =   158 bits (399),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 90/115 (78%), Gaps = 2/115 (2%)
 Frame = +1

Query  247  RSLRCSVP--RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPK  420
            RS    +P  R      W+SP    A+IRS+A V+  F RK+AT+A+EN FK + TSLPK
Sbjct  60   RSCSSYIPGSRVGLSTSWRSPIGPRARIRSSAAVIERFDRKMATVATENVFKDVLTSLPK  119

Query  421  PGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
             GGGE+GK+YSLPALNDPRID+LPYSIRILLE+AIRNCDNFQVTK DVEKIIDW+
Sbjct  120  TGGGEYGKYYSLPALNDPRIDRLPYSIRILLESAIRNCDNFQVTKNDVEKIIDWE  174



>ref|XP_010482909.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Camelina 
sativa]
Length=997

 Score =   157 bits (396),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 90/118 (76%), Gaps = 2/118 (2%)
 Frame = +1

Query  238  SAFRSLRC--SVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTS  411
            SAFR  R   S  RWS   +W+ P S  AQ R AAP L  F RK A++ASE+ +K I T+
Sbjct  42   SAFRLFRVCSSATRWSQHANWRLPESFRAQTRIAAPRLEKFQRKFASIASEHAYKDILTT  101

Query  412  LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            L KP  GE+GKFYSLPALNDPRID+LPYS+RILLE+AIRNCD+F +TK+DVEKI+DW+
Sbjct  102  LHKPDVGEYGKFYSLPALNDPRIDRLPYSVRILLESAIRNCDSFHITKDDVEKIMDWE  159



>ref|XP_008800034.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Phoenix dactylifera]
Length=997

 Score =   156 bits (395),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  HGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLP  459
            H  DW+SP S  AQIRS+A V   F R+ ATMA+ N ++ I TSL KPGGGEFGK+YSLP
Sbjct  67   HFGDWRSPLSHRAQIRSSAAVAERFERRFATMATRNSYESILTSLSKPGGGEFGKYYSLP  126

Query  460  ALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQT  588
            ALNDPRID+LPYSIRILLE+AIRNCD FQVT +DVEKI+DW++
Sbjct  127  ALNDPRIDRLPYSIRILLESAIRNCDEFQVTGKDVEKILDWES  169



>ref|XP_010918136.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Elaeis guineensis]
Length=992

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  HGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLP  459
            H  DW+SP S  AQIRS+A V + F R+ ATMA+ N ++ I +SL KPGGGEFGK+YSLP
Sbjct  62   HFGDWRSPLSHRAQIRSSAAVADRFERRFATMATRNSYESILSSLSKPGGGEFGKYYSLP  121

Query  460  ALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            ALNDPRID+LPYSIRILLE+AIRNCD FQVT +DVEKI+DW+
Sbjct  122  ALNDPRIDRLPYSIRILLESAIRNCDEFQVTGKDVEKILDWE  163



>ref|XP_010943467.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Elaeis guineensis]
Length=995

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +1

Query  289  DWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALN  468
            DW+SP S  AQIR +A V   F R  ATMA+ N ++ I TSLPKPGGGEFGK+YSLPALN
Sbjct  68   DWRSPLSHRAQIRYSAAVAERFERYFATMATRNAYESILTSLPKPGGGEFGKYYSLPALN  127

Query  469  DPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            DPRID+LPYSIRILLE+AIRNCD FQVT +DVEKI+DW+
Sbjct  128  DPRIDRLPYSIRILLESAIRNCDEFQVTGKDVEKILDWE  166



>ref|XP_008785050.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Phoenix dactylifera]
Length=998

 Score =   154 bits (388),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +1

Query  289  DWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALN  468
            DW+SP S  AQIR +A V   F R   TMA+ N ++ I TSLPKPGGGEFGK+YSLPALN
Sbjct  69   DWRSPLSHRAQIRYSATVAERFERHFTTMATRNAYESILTSLPKPGGGEFGKYYSLPALN  128

Query  469  DPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            DPRID+LPYSIRILLE+AIRNCD FQVT +DVEKI+DW+
Sbjct  129  DPRIDRLPYSIRILLESAIRNCDEFQVTGKDVEKILDWE  167



>gb|EEC83022.1| hypothetical protein OsI_28099 [Oryza sativa Indica Group]
Length=396

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 85/114 (75%), Gaps = 10/114 (9%)
 Frame = +1

Query  274  WSHGVDWKSPASLT---------AQIRSAAPVLNDFHRKIA-TMASENPFKGIFTSLPKP  423
            W+    W   AS +         AQI + AP +   HR++A T A+E+PFK I T+LPKP
Sbjct  51   WAAAGGWSGRASSSPVVGCGACRAQIGAVAPAVERVHRRMAATAAAEHPFKNILTTLPKP  110

Query  424  GGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            GGGE+GKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQV + DVEKIIDW+
Sbjct  111  GGGEYGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQVNQNDVEKIIDWE  164



>ref|XP_009399225.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Musa acuminata 
subsp. malaccensis]
Length=993

 Score =   152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = +1

Query  283  GVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPA  462
            G DW+SP     +IRS++ V+  F RK+ T A+EN FK + TSLPKP GGE+GK+YSLPA
Sbjct  64   GSDWRSPIGPRPRIRSSSTVIQLFDRKMTTTATENVFKDVLTSLPKPEGGEYGKYYSLPA  123

Query  463  LNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            LNDPRID+LPYSIRILLE+AIRNCD+FQVTK DVEKIIDW+
Sbjct  124  LNDPRIDRLPYSIRILLESAIRNCDDFQVTKNDVEKIIDWE  164



>ref|XP_008676648.1| PREDICTED: uncharacterized protein LOC100216599 isoform X1 [Zea 
mays]
Length=987

 Score =   151 bits (381),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +1

Query  304  ASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRID  483
            A   AQI +A P +  F R++AT A+ + FK I TSLPKPGGGE+GKFYSLPALNDPRID
Sbjct  65   AGARAQIGAAVPAVEQFQRRMATQATVHAFKDILTSLPKPGGGEYGKFYSLPALNDPRID  124

Query  484  KLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            KLPYS+RILLE+AIRNCDNFQVTK DVEKIIDW+
Sbjct  125  KLPYSVRILLESAIRNCDNFQVTKNDVEKIIDWE  158



>ref|XP_002445174.1| hypothetical protein SORBIDRAFT_07g005390 [Sorghum bicolor]
 gb|EES14669.1| hypothetical protein SORBIDRAFT_07g005390 [Sorghum bicolor]
Length=996

 Score =   150 bits (379),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 72/95 (76%), Positives = 81/95 (85%), Gaps = 1/95 (1%)
 Frame = +1

Query  304  ASLTAQIRSAA-PVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRI  480
            A   AQI +AA P +  F R++AT A+E+ FK I TSLPKPGGGE+GKFYSLPALNDPRI
Sbjct  73   AGARAQIGAAAVPAVERFQRRMATQATEHAFKDILTSLPKPGGGEYGKFYSLPALNDPRI  132

Query  481  DKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            DKLPYSIRILLE+AIRNCDNFQVTK DVEKIIDW+
Sbjct  133  DKLPYSIRILLESAIRNCDNFQVTKNDVEKIIDWE  167



>ref|XP_007020811.1| Aconitase 3 [Theobroma cacao]
 gb|EOY12336.1| Aconitase 3 [Theobroma cacao]
Length=951

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 83/106 (78%), Gaps = 7/106 (7%)
 Frame = +1

Query  268  PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKF  447
            PRWSHGVDW SP SL AQ+R A PV+  F R+IAT+ S +     +       G E+G+F
Sbjct  67   PRWSHGVDWNSPGSLRAQVRIAVPVMERFRRRIATIGSVDKSSQAW-------GREYGRF  119

Query  448  YSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            YSLPALNDPRID+LPYSIRILLE+AIRNCDNFQVTK+DVEKI+DW+
Sbjct  120  YSLPALNDPRIDRLPYSIRILLESAIRNCDNFQVTKDDVEKIVDWE  165



>ref|XP_006828850.1| hypothetical protein AMTR_s00001p00156400 [Amborella trichopoda]
 gb|ERM96266.1| hypothetical protein AMTR_s00001p00156400 [Amborella trichopoda]
Length=977

 Score =   148 bits (374),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +1

Query  292  WKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALND  471
            W+SP S  A IRS+   L+ F R++ATMA++N ++ I TSLPKP GGEFGK+YSLP+LND
Sbjct  51   WRSPLSHRAFIRSSTINLDRFERRLATMATQNVYESILTSLPKPSGGEFGKYYSLPSLND  110

Query  472  PRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            PRIDKLPYSIRILLE+AIRNCD+F+V K DVEKIIDW+
Sbjct  111  PRIDKLPYSIRILLESAIRNCDDFEVKKNDVEKIIDWE  148



>ref|XP_004974379.1| PREDICTED: putative aconitate hydratase, cytoplasmic-like [Setaria 
italica]
Length=892

 Score =   148 bits (373),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = +1

Query  304  ASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRID  483
            A   AQI +A P +    R++AT A+E+ FK I TSLPKPGGGE+GKFYSLPALNDPRI+
Sbjct  63   AGARAQIGAAVPAVERLQRRMATQATEHAFKNILTSLPKPGGGEYGKFYSLPALNDPRIE  122

Query  484  KLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            KLPYSIRILLE+AIRNCDNFQVT  DVEKIIDW+
Sbjct  123  KLPYSIRILLESAIRNCDNFQVTTNDVEKIIDWE  156



>gb|AAD25640.1| cytoplasmic aconitate hydratase [Arabidopsis thaliana]
Length=898

 Score =   147 bits (372),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 66/71 (93%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MASE+PFKGIFT+LPKPGGGEFGKFYSLPALNDPR+DKLPYSIRILLE+AIRNCDNFQVT
Sbjct  1    MASEHPFKGIFTTLPKPGGGEFGKFYSLPALNDPRVDKLPYSIRILLESAIRNCDNFQVT  60

Query  553  KEDVEKIIDWQ  585
            KEDVEKIIDW+
Sbjct  61   KEDVEKIIDWE  71



>ref|XP_009382046.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
Length=986

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +1

Query  268  PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKF  447
            P   H  D +SP S  A +RS+A V + F R+ ATMAS+N ++ I T+L KPGGGEFGK+
Sbjct  52   PPARHLADLRSPISHRALVRSSAAVADRFERRFATMASKNSYESILTTLSKPGGGEFGKY  111

Query  448  YSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            Y LPAL DPRID+LPYSIRILLE+AIRNCD FQVT +DVEKI+DW+
Sbjct  112  YCLPALTDPRIDRLPYSIRILLESAIRNCDEFQVTGKDVEKILDWE  157



>gb|AAO62410.1| aconitase [Solanum pennellii]
Length=898

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MA+ENPFKGI T LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQV 
Sbjct  1    MAAENPFKGILTVLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQVK  60

Query  553  KEDVEKIIDWQ  585
            KEDVEKIIDW+
Sbjct  61   KEDVEKIIDWE  71



>gb|AAP30039.1| aconitase [Solanum pennellii]
Length=898

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MA+ENPFKGI T LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE++IRNCDNFQV 
Sbjct  1    MAAENPFKGILTVLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESSIRNCDNFQVK  60

Query  553  KEDVEKIIDWQ  585
            KEDVEKIIDW+
Sbjct  61   KEDVEKIIDWE  71



>ref|XP_009384004.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384006.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
Length=977

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 84/107 (79%), Gaps = 1/107 (1%)
 Frame = +1

Query  265  VPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGK  444
            VPR SH  D +SP S  A +RS A V   F R+ ATMA+ N ++ I T+L KPGGG+FGK
Sbjct  43   VPR-SHLSDGRSPISHRALVRSYAAVAYRFERRFATMATRNSYESILTTLRKPGGGDFGK  101

Query  445  FYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            +YSLPAL DPRI++LPYSIRILLE+AIRNCD FQVT +DVEKI+DW+
Sbjct  102  YYSLPALTDPRIERLPYSIRILLESAIRNCDEFQVTGKDVEKILDWE  148



>ref|XP_003573387.2| PREDICTED: putative aconitate hydratase, cytoplasmic [Brachypodium 
distachyon]
Length=987

 Score =   142 bits (358),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 80/93 (86%), Gaps = 3/93 (3%)
 Frame = +1

Query  316  AQIRS-AAPVLN-DFHRK-IATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  486
            AQI + AAP     FHR+ +AT A+E+ FK I TSLPKPGGGEFGKFYSLPALNDPRIDK
Sbjct  66   AQIGAVAAPAAGTSFHRRRMATSATEHAFKNILTSLPKPGGGEFGKFYSLPALNDPRIDK  125

Query  487  LPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            LPYSIRILLE+AIRNCD+FQVTK DVEKIIDW+
Sbjct  126  LPYSIRILLESAIRNCDDFQVTKNDVEKIIDWE  158



>gb|AAG28426.1|AF194945_1 cytosolic aconitase [Nicotiana tabacum]
Length=898

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MA+ENPFKGI T LPKPGGGEFGK+YSLPALNDPRIDKLPYS RILLE+AIRNCDNFQV 
Sbjct  1    MAAENPFKGILTVLPKPGGGEFGKYYSLPALNDPRIDKLPYSSRILLESAIRNCDNFQVK  60

Query  553  KEDVEKIIDWQ  585
            KEDVEKIIDW+
Sbjct  61   KEDVEKIIDWE  71



>gb|AAC26045.1| aconitase-iron regulated protein 1 [Citrus limon]
Length=898

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MA EN FKGI TSLPKPGGGEFGKF+SLPALNDPRID+LPYSIRILLE+AIRNCDNFQVT
Sbjct  1    MAPENAFKGILTSLPKPGGGEFGKFFSLPALNDPRIDRLPYSIRILLESAIRNCDNFQVT  60

Query  553  KEDVEKIIDWQ  585
            K+DVEKIIDW+
Sbjct  61   KDDVEKIIDWE  71



>ref|XP_011097878.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Sesamum 
indicum]
Length=898

 Score =   139 bits (350),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MASE+PFK I T L KPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQVT
Sbjct  1    MASEHPFKEILTGLSKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQVT  60

Query  553  KEDVEKIIDWQ  585
            KEDVEKIIDW+
Sbjct  61   KEDVEKIIDWE  71



>gb|KHG08189.1| hypothetical protein F383_11434 [Gossypium arboreum]
Length=879

 Score =   139 bits (350),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MA+E+PFK + TSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE+A+RNCDNFQV 
Sbjct  1    MAAEHPFKEVLTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLESAVRNCDNFQVK  60

Query  553  KEDVEKIIDWQ  585
            KEDVEKIIDW+
Sbjct  61   KEDVEKIIDWE  71



>emb|CBE71057.1| aconitate hydratase 3 [Citrus clementina]
Length=898

 Score =   139 bits (350),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MA EN FKGI TSLPKPGGGEFGKF+SLPALNDPRID+LPYSIRILLE+AIRNCDNFQVT
Sbjct  1    MAPENAFKGILTSLPKPGGGEFGKFFSLPALNDPRIDRLPYSIRILLESAIRNCDNFQVT  60

Query  553  KEDVEKIIDWQ  585
            K+DVEKIIDW+
Sbjct  61   KDDVEKIIDWE  71



>emb|CBE71058.1| aconitate hydratase 2 [Citrus clementina]
Length=898

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MA+E+PFK I T+LPKPGGGEFGKFYSLPALNDPRI+KLPYSIRILLE+AIRNCDNFQV 
Sbjct  1    MAAEHPFKEILTALPKPGGGEFGKFYSLPALNDPRIEKLPYSIRILLESAIRNCDNFQVK  60

Query  553  KEDVEKIIDWQ  585
            KED+EKIIDW+
Sbjct  61   KEDIEKIIDWE  71



>gb|ADM34980.1| cytosolic aconitase [Pyrus pyrifolia]
Length=898

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MASENPFK   TSLPKPGGGEFGKFYSLP+LNDPRID+LPYSIRILLE+AIRNCDNFQV 
Sbjct  1    MASENPFKPNLTSLPKPGGGEFGKFYSLPSLNDPRIDRLPYSIRILLESAIRNCDNFQVK  60

Query  553  KEDVEKIIDWQ  585
            KEDVEKI+DW+
Sbjct  61   KEDVEKILDWE  71



>sp|Q6YZX6.1|ACOC_ORYSJ RecName: Full=Putative aconitate hydratase, cytoplasmic; Short=Aconitase; 
AltName: Full=Citrate hydro-lyase [Oryza sativa 
Japonica Group]
 dbj|BAD05751.1| putative Aconitate hydratase [Oryza sativa Japonica Group]
Length=898

 Score =   136 bits (342),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MA+E+PFK I T+LPKPGGGE+GKFYSLPALNDPRIDKLPYSIRILLE+AIRNCDNFQV 
Sbjct  1    MAAEHPFKNILTTLPKPGGGEYGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDNFQVN  60

Query  553  KEDVEKIIDWQ  585
            + DVEKIIDW+
Sbjct  61   QNDVEKIIDWE  71



>gb|KHN41224.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=903

 Score =   136 bits (342),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            + +ENPFKG  TSLPKPGGGEFGKFYSLP+LNDPRID+LPYSIRILLE+AIRNCDNFQV 
Sbjct  6    LTNENPFKGNLTSLPKPGGGEFGKFYSLPSLNDPRIDRLPYSIRILLESAIRNCDNFQVK  65

Query  553  KEDVEKIIDWQ  585
            KEDVEKI+DW+
Sbjct  66   KEDVEKILDWE  76



>gb|KJB30565.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
 gb|KJB30568.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=898

 Score =   136 bits (342),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MA+E+PFK + TSLPKPGGGEFGKFYSLPALNDPRIDKLPYSI ILLE+A+RNCDNFQV 
Sbjct  1    MAAEHPFKEVLTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSITILLESAVRNCDNFQVK  60

Query  553  KEDVEKIIDW  582
            KEDVEKIIDW
Sbjct  61   KEDVEKIIDW  70



>sp|P49608.1|ACOC_CUCMA RecName: Full=Aconitate hydratase, cytoplasmic; Short=Aconitase; 
AltName: Full=Citrate hydro-lyase [Cucurbita maxima]
 pir||T10101 aconitate hydratase (EC 4.2.1.3) - cucurbit
 dbj|BAA06108.1| aconitase [Cucurbita cv. Kurokawa Amakuri]
Length=898

 Score =   136 bits (342),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MA+ENPFK   TSLPKPGGGEFGK+YSLP+LNDPRID+LPYSIRILLE+AIRNCDNFQV 
Sbjct  1    MAAENPFKENLTSLPKPGGGEFGKYYSLPSLNDPRIDRLPYSIRILLESAIRNCDNFQVK  60

Query  553  KEDVEKIIDWQ  585
            KEDVEKIIDW+
Sbjct  61   KEDVEKIIDWE  71



>ref|XP_002445994.1| hypothetical protein SORBIDRAFT_06g000200 [Sorghum bicolor]
 gb|EES10322.1| hypothetical protein SORBIDRAFT_06g000200 [Sorghum bicolor]
Length=106

 Score =   123 bits (309),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +1

Query  376  ASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTK  555
            A+++ FK I  SLPKPGGGE+GKF+SLPALNDPRID+LPYSIR+LLE+AIR+CDNFQVT+
Sbjct  6    ATKHAFKSILASLPKPGGGEYGKFFSLPALNDPRIDRLPYSIRVLLESAIRHCDNFQVTE  65

Query  556  EDVEKIIDWQT  588
             DVEKIIDW+ 
Sbjct  66   SDVEKIIDWEN  76



>dbj|BAJ85661.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=984

 Score =   133 bits (334),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 76/98 (78%), Gaps = 2/98 (2%)
 Frame = +1

Query  298  SPASLTAQIR-SAAPVLN-DFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALND  471
            SP+S   + R S AP       R++A   +E+ +  I TSLPKPGGGE+GKFYSLPALND
Sbjct  58   SPSSAAVRGRGSVAPAAQRSQQRRMAASGTEHAYSNILTSLPKPGGGEYGKFYSLPALND  117

Query  472  PRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            PRIDKLPYSIRILLE+AIRNCD FQVTK DVEKI+DW+
Sbjct  118  PRIDKLPYSIRILLESAIRNCDGFQVTKNDVEKIVDWE  155



>ref|XP_007020807.1| Aconitase 3 [Theobroma cacao]
 gb|EOY12332.1| Aconitase 3 [Theobroma cacao]
Length=883

 Score =   132 bits (333),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 71/87 (82%), Gaps = 5/87 (6%)
 Frame = +1

Query  325  RSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIR  504
            R  AP LN     +    SE+ FK I TSLPKPGG EFGKFYSLPALNDPRID+LPYSIR
Sbjct  11   RLMAPQLN-----LGMKCSEHAFKAILTSLPKPGGEEFGKFYSLPALNDPRIDRLPYSIR  65

Query  505  ILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            ILLE+AIRNCDNFQVTK+DVE+IIDW+
Sbjct  66   ILLESAIRNCDNFQVTKDDVERIIDWE  92



>ref|XP_006413195.1| hypothetical protein EUTSA_v10024325mg [Eutrema salsugineum]
 gb|ESQ54648.1| hypothetical protein EUTSA_v10024325mg [Eutrema salsugineum]
Length=962

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  376  ASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTK  555
            ASE+ +K I TSLPKPGGGE+GK+YSLPALNDPRID+LPYSIRILLE+AIRNCDN+QVTK
Sbjct  97   ASEHAYKDILTSLPKPGGGEYGKYYSLPALNDPRIDRLPYSIRILLESAIRNCDNYQVTK  156

Query  556  EDVEKIIDWQ  585
            +DVEKIIDW+
Sbjct  157  DDVEKIIDWE  166



>emb|CAB36543.1| putative aconitase [Arabidopsis thaliana]
 emb|CAB79552.1| putative aconitase [Arabidopsis thaliana]
Length=907

 Score =   130 bits (327),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +1

Query  364  IATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNF  543
            +   ASE+ +K I TSLPKPGGGE+GK+YSLPALNDPRIDKLP+S+RILLE+AIRNCDN+
Sbjct  7    VKNAASEHSYKDILTSLPKPGGGEYGKYYSLPALNDPRIDKLPFSVRILLESAIRNCDNY  66

Query  544  QVTKEDVEKIIDWQ  585
            QVTK+DVEKI+DW+
Sbjct  67   QVTKDDVEKILDWE  80



>ref|XP_008363093.1| PREDICTED: aconitate hydratase 1-like [Malus domestica]
Length=107

 Score =   119 bits (298),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MA+ NPF+ I T+L KP GGEFGK+YSLPALNDPRI+KLP+SI+ILLE+AIRNCD FQV 
Sbjct  1    MAAANPFQKILTALEKPDGGEFGKYYSLPALNDPRIEKLPFSIKILLESAIRNCDEFQVK  60

Query  553  KEDVEKIIDWQT  588
              DVEKIIDW+ 
Sbjct  61   SNDVEKIIDWEN  72



>gb|EMS45933.1| Putative aconitate hydratase, cytoplasmic [Triticum urartu]
Length=858

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +1

Query  364  IATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNF  543
            +A   +E+ +  I TSLPKP GGE+GKFYSLPALNDPRIDKLPYSIRILLE+AIRNCD F
Sbjct  1    MAASGTEHAYNNILTSLPKPEGGEYGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDGF  60

Query  544  QVTKEDVEKIIDWQ  585
            QVTK DVEKIIDW+
Sbjct  61   QVTKNDVEKIIDWE  74



>gb|KDO71346.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=807

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MA+ENPFK I  +L +P GGEFGK+YSLPALNDPRIDKLPYSI+ILLE+AIRNCD FQV 
Sbjct  1    MATENPFKSILKTLQRPDGGEFGKYYSLPALNDPRIDKLPYSIKILLESAIRNCDEFQVK  60

Query  553  KEDVEKIIDWQT  588
             +DVEKIIDW+T
Sbjct  61   SKDVEKIIDWET  72



>gb|KDO71343.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=898

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MA+ENPFK I  +L +P GGEFGK+YSLPALNDPRIDKLPYSI+ILLE+AIRNCD FQV 
Sbjct  1    MATENPFKSILKTLQRPDGGEFGKYYSLPALNDPRIDKLPYSIKILLESAIRNCDEFQVK  60

Query  553  KEDVEKIIDWQT  588
             +DVEKIIDW+T
Sbjct  61   SKDVEKIIDWET  72



>gb|KDO71342.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=900

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MA+ENPFK I  +L +P GGEFGK+YSLPALNDPRIDKLPYSI+ILLE+AIRNCD FQV 
Sbjct  1    MATENPFKSILKTLQRPDGGEFGKYYSLPALNDPRIDKLPYSIKILLESAIRNCDEFQVK  60

Query  553  KEDVEKIIDWQT  588
             +DVEKIIDW+T
Sbjct  61   SKDVEKIIDWET  72



>gb|KDO71344.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=881

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MA+ENPFK I  +L +P GGEFGK+YSLPALNDPRIDKLPYSI+ILLE+AIRNCD FQV 
Sbjct  1    MATENPFKSILKTLQRPDGGEFGKYYSLPALNDPRIDKLPYSIKILLESAIRNCDEFQVK  60

Query  553  KEDVEKIIDWQT  588
             +DVEKIIDW+T
Sbjct  61   SKDVEKIIDWET  72



>ref|XP_004287770.1| PREDICTED: aconitate hydratase 1 [Fragaria vesca subsp. vesca]
Length=898

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MA+ENPFK I  SL KP GGEFGK+YSLPALNDPR+DKLPYSI+ILLE+AIRNCD FQV 
Sbjct  1    MAAENPFKSILKSLEKPDGGEFGKYYSLPALNDPRVDKLPYSIKILLESAIRNCDEFQVK  60

Query  553  KEDVEKIIDWQ  585
             +DVEKIIDW+
Sbjct  61   SKDVEKIIDWE  71



>ref|XP_008669746.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X1 [Zea mays]
 tpg|DAA38797.1| TPA: hypothetical protein ZEAMMB73_641300 [Zea mays]
Length=975

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 69/79 (87%), Gaps = 1/79 (1%)
 Frame = +1

Query  352  FHR-KIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIR  528
             HR ++   A+++ FK I TSL KPGGGE+GKF+SLPALNDPRIDKLPYSIR+LLE+AIR
Sbjct  68   LHRIRVGVGATKHAFKRILTSLIKPGGGEYGKFFSLPALNDPRIDKLPYSIRVLLESAIR  127

Query  529  NCDNFQVTKEDVEKIIDWQ  585
            +CDNFQVT+ DVEKIIDW+
Sbjct  128  HCDNFQVTESDVEKIIDWE  146



>emb|CAA58046.1| aconitase [Arabidopsis thaliana]
Length=919

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +1

Query  364  IATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNF  543
            +++MASENPF+ I  +L KP GGEFG +YSLPALNDPRIDKLPYSIRILLE+AIRNCD F
Sbjct  20   LSSMASENPFRSILKALEKPDGGEFGNYYSLPALNDPRIDKLPYSIRILLESAIRNCDEF  79

Query  544  QVTKEDVEKIIDWQ  585
            QV  +DVEKI+DW+
Sbjct  80   QVKSKDVEKILDWE  93



>ref|XP_007046597.1| Aconitase 1 [Theobroma cacao]
 gb|EOX90754.1| Aconitase 1 [Theobroma cacao]
Length=900

 Score =   125 bits (313),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MA+ENPF  I  +L KPGGGEFGK+YSLPAL+DPRIDKLPYSI+ILLE+AIRNCD FQV 
Sbjct  1    MATENPFNSILKTLEKPGGGEFGKYYSLPALDDPRIDKLPYSIKILLESAIRNCDEFQVK  60

Query  553  KEDVEKIIDWQ  585
             +DVEKIIDW+
Sbjct  61   SKDVEKIIDWE  71



>gb|EMT33022.1| Putative aconitate hydratase, cytoplasmic [Aegilops tauschii]
Length=937

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +1

Query  379  SENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKE  558
            +E+ +  I TSLPKP GGE+GKFYSLPALNDPRIDKLPYSIRILLE+AIRNCD FQVTK 
Sbjct  40   TEHAYSNILTSLPKPEGGEYGKFYSLPALNDPRIDKLPYSIRILLESAIRNCDGFQVTKN  99

Query  559  DVEKIIDWQ  585
            DVEKIIDW+
Sbjct  100  DVEKIIDWE  108



>emb|CDX69174.1| BnaC01g02790D [Brassica napus]
Length=901

 Score =   124 bits (312),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +1

Query  376  ASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTK  555
            ASENPF+ I  +L KPGGGEFG +YSLPALNDPRIDKLPYSIRILLE+AIRNCD FQV  
Sbjct  5    ASENPFRSILKALEKPGGGEFGNYYSLPALNDPRIDKLPYSIRILLESAIRNCDEFQVKS  64

Query  556  EDVEKIIDWQ  585
            +DVEKI+DW+
Sbjct  65   KDVEKILDWE  74



>gb|KFK30197.1| hypothetical protein AALP_AA7G230700 [Arabis alpina]
Length=898

 Score =   124 bits (312),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MASENPF+ IF +L KP GGEFG +YSLPALNDPRID+LPYSIRILLE+AIRNCD FQV 
Sbjct  1    MASENPFRSIFKALEKPDGGEFGNYYSLPALNDPRIDRLPYSIRILLESAIRNCDEFQVK  60

Query  553  KEDVEKIIDWQ  585
              DVEKI+DW+
Sbjct  61   SNDVEKILDWE  71



>ref|XP_009109264.1| PREDICTED: aconitate hydratase 1-like [Brassica rapa]
Length=898

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MASENPF+ I  +L KP GGEFG +YSLPALNDPRIDKLPYSIRILLE+AIRNCD FQV 
Sbjct  1    MASENPFRSILKTLEKPDGGEFGNYYSLPALNDPRIDKLPYSIRILLESAIRNCDEFQVK  60

Query  553  KEDVEKIIDWQ  585
             +DVEKI+DW+
Sbjct  61   SKDVEKILDWE  71



>gb|KHG25175.1| Aconitate hydratase, cytoplasmic [Gossypium arboreum]
Length=900

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MAS NPF  I  +L KP GGEFGK+YSLPALNDPRIDKLPYSI+ILLE+AIRNCD FQV 
Sbjct  1    MASANPFNSILKTLEKPQGGEFGKYYSLPALNDPRIDKLPYSIKILLESAIRNCDEFQVK  60

Query  553  KEDVEKIIDWQ  585
             EDVEKIIDW+
Sbjct  61   SEDVEKIIDWE  71



>ref|XP_009150005.1| PREDICTED: aconitate hydratase 1 [Brassica rapa]
Length=898

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MASENPF+ I  +L KP GGEFG +YSLPALNDPRIDKLPYSIRILLE+AIRNCD FQV 
Sbjct  1    MASENPFRSILKALEKPDGGEFGNYYSLPALNDPRIDKLPYSIRILLESAIRNCDEFQVK  60

Query  553  KEDVEKIIDWQ  585
             +DVEKI+DW+
Sbjct  61   SKDVEKILDWE  71



>ref|NP_195308.1| aconitate hydratase 1 [Arabidopsis thaliana]
 sp|Q42560.2|ACO1_ARATH RecName: Full=Aconitate hydratase 1; Short=Aconitase 1; AltName: 
Full=Citrate hydro-lyase 1 [Arabidopsis thaliana]
 emb|CAA21469.1| cytoplasmatic aconitate hydratase (citrate hydro-lyase)(aconitase)(EC 
4.2.1.3) [Arabidopsis thaliana]
 emb|CAB81492.1| cytoplasmatic aconitate hydratase (citrate hydro-lyase)(aconitase)(EC 
4.2.1.3) [Arabidopsis thaliana]
 gb|AAL32850.1| Unknown protein [Arabidopsis thaliana]
 gb|AEE86576.1| aconitate hydratase 1 [Arabidopsis thaliana]
Length=898

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MASENPF+ I  +L KP GGEFG +YSLPALNDPRIDKLPYSIRILLE+AIRNCD FQV 
Sbjct  1    MASENPFRSILKALEKPDGGEFGNYYSLPALNDPRIDKLPYSIRILLESAIRNCDEFQVK  60

Query  553  KEDVEKIIDWQ  585
             +DVEKI+DW+
Sbjct  61   SKDVEKILDWE  71



>ref|XP_006285963.1| hypothetical protein CARUB_v10007484mg [Capsella rubella]
 gb|EOA18861.1| hypothetical protein CARUB_v10007484mg [Capsella rubella]
Length=898

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MASENPF+ I  +L KP GGEFG +YSLPALNDPRIDKLPYSIRILLE+AIRNCD FQV 
Sbjct  1    MASENPFRSILKALEKPDGGEFGNYYSLPALNDPRIDKLPYSIRILLESAIRNCDEFQVK  60

Query  553  KEDVEKIIDWQ  585
             +DVEKI+DW+
Sbjct  61   SKDVEKILDWE  71



>gb|KHG25176.1| Aconitate hydratase, cytoplasmic [Gossypium arboreum]
Length=929

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MAS NPF  I  +L KP GGEFGK+YSLPALNDPRIDKLPYSI+ILLE+AIRNCD FQV 
Sbjct  1    MASANPFNSILKTLEKPQGGEFGKYYSLPALNDPRIDKLPYSIKILLESAIRNCDEFQVK  60

Query  553  KEDVEKIIDWQ  585
             EDVEKIIDW+
Sbjct  61   SEDVEKIIDWE  71



>ref|XP_006412054.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
 ref|XP_006412055.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
 gb|ESQ53507.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
 gb|ESQ53508.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
Length=763

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MASENPF+ I  +L KPGGGEFG +YSL ALNDPRIDKLPYSIRILLE+AIRNCD FQV 
Sbjct  1    MASENPFRCILKTLQKPGGGEFGNYYSLAALNDPRIDKLPYSIRILLESAIRNCDEFQVK  60

Query  553  KEDVEKIIDWQ  585
             +DVEKI+DW+
Sbjct  61   SKDVEKILDWE  71



>emb|CBE71056.1| aconitate hydratase 1 [Citrus clementina]
Length=900

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MA+ENPFK I  +L +P GGEFGK+YSLPALNDPRI KLPYSI+ILLE+AIRNCD FQV 
Sbjct  1    MATENPFKSILKTLQRPDGGEFGKYYSLPALNDPRIGKLPYSIKILLESAIRNCDEFQVK  60

Query  553  KEDVEKIIDWQT  588
             +DVEKIIDW+T
Sbjct  61   SKDVEKIIDWET  72



>ref|XP_006467022.1| PREDICTED: aconitate hydratase 1 [Citrus sinensis]
Length=900

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MA+ENPFK I  +L +P GGEFGK+YSLPALNDPRI KLPYSI+ILLE+AIRNCD FQV 
Sbjct  1    MATENPFKSILKTLQRPDGGEFGKYYSLPALNDPRIGKLPYSIKILLESAIRNCDEFQVK  60

Query  553  KEDVEKIIDWQT  588
             +DVEKIIDW+T
Sbjct  61   SKDVEKIIDWET  72



>ref|XP_002460765.1| hypothetical protein SORBIDRAFT_02g034590 [Sorghum bicolor]
 gb|EER97286.1| hypothetical protein SORBIDRAFT_02g034590 [Sorghum bicolor]
Length=979

 Score =   122 bits (306),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 66/77 (86%), Gaps = 1/77 (1%)
 Frame = +1

Query  358  RKIATMASENP-FKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNC  534
            R +ATMA  N  F  + TSLPKPGGGE+GK+YSLPALNDPRI++LPYSIR LLE+AIRNC
Sbjct  72   RGLATMADGNSRFGHVLTSLPKPGGGEYGKYYSLPALNDPRIERLPYSIRYLLESAIRNC  131

Query  535  DNFQVTKEDVEKIIDWQ  585
            D FQ+T++DVE IIDW+
Sbjct  132  DGFQITEKDVENIIDWE  148


 Score = 30.8 bits (68),  Expect(2) = 2e-28, Method: Composition-based stats.
 Identities = 13/13 (100%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = +3

Query  585  NTAPKLVEIPFKP  623
            NTAPKLVEIPFKP
Sbjct  149  NTAPKLVEIPFKP  161



>ref|XP_006412056.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
 gb|ESQ53509.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
Length=898

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MASENPF+ I  +L KPGGGEFG +YSL ALNDPRIDKLPYSIRILLE+AIRNCD FQV 
Sbjct  1    MASENPFRCILKTLQKPGGGEFGNYYSLAALNDPRIDKLPYSIRILLESAIRNCDEFQVK  60

Query  553  KEDVEKIIDWQ  585
             +DVEKI+DW+
Sbjct  61   SKDVEKILDWE  71



>ref|XP_001779205.1| predicted protein [Physcomitrella patens]
 gb|EDQ55968.1| predicted protein, partial [Physcomitrella patens]
Length=896

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +1

Query  376  ASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTK  555
            ASENPF  + T LPKP GG +GKFYSL  LNDPR+D LPYSIR LLEAAIRNCDNFQVTK
Sbjct  1    ASENPFSSLITDLPKPDGGSYGKFYSLVKLNDPRVDSLPYSIRYLLEAAIRNCDNFQVTK  60

Query  556  EDVEKIIDWQ  585
            EDVEKI+DW+
Sbjct  61   EDVEKIVDWE  70



>ref|XP_008669747.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X2 [Zea mays]
 tpg|DAA38798.1| TPA: hypothetical protein ZEAMMB73_641300 [Zea mays]
Length=905

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +1

Query  370  TMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQV  549
            + A+++ FK I TSL KPGGGE+GKF+SLPALNDPRIDKLPYSIR+LLE+AIR+CDNFQV
Sbjct  5    STATKHAFKRILTSLIKPGGGEYGKFFSLPALNDPRIDKLPYSIRVLLESAIRHCDNFQV  64

Query  550  TKEDVEKIIDWQ  585
            T+ DVEKIIDW+
Sbjct  65   TESDVEKIIDWE  76



>ref|XP_010526818.1| PREDICTED: aconitate hydratase 1 [Tarenaya hassleriana]
Length=899

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MASENPF  IF +L +P GGEFGK+YSLP LNDPRIDKLPYSIRILLE+AIRNCD FQV 
Sbjct  1    MASENPFHSIFKTLERPDGGEFGKYYSLPDLNDPRIDKLPYSIRILLESAIRNCDEFQVK  60

Query  553  KEDVEKIIDWQT  588
              DVEKI+DW+ 
Sbjct  61   NRDVEKILDWEN  72



>ref|NP_001147431.1| aconitase2 [Zea mays]
 gb|ACG27495.1| aconitate hydratase, cytoplasmic [Zea mays]
 gb|ACN28210.1| unknown [Zea mays]
 gb|AFW57775.1| aconitate hydratase, cytoplasmic [Zea mays]
Length=905

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +1

Query  376  ASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTK  555
            A+++ FK I TSL KPGGGE+GKF+SLPALNDPRIDKLPYSIR+LLE+AIR+CDNFQVT+
Sbjct  6    ATKHAFKRILTSLLKPGGGEYGKFFSLPALNDPRIDKLPYSIRVLLESAIRHCDNFQVTE  65

Query  556  EDVEKIIDWQ  585
             DVEKIIDW+
Sbjct  66   SDVEKIIDWE  75



>ref|XP_008661884.1| PREDICTED: aconitase2 isoform X1 [Zea mays]
Length=949

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +1

Query  376  ASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTK  555
            A+++ FK I TSL KPGGGE+GKF+SLPALNDPRIDKLPYSIR+LLE+AIR+CDNFQVT+
Sbjct  67   ATKHAFKRILTSLLKPGGGEYGKFFSLPALNDPRIDKLPYSIRVLLESAIRHCDNFQVTE  126

Query  556  EDVEKIIDWQ  585
             DVEKIIDW+
Sbjct  127  SDVEKIIDWE  136



>ref|XP_010446873.1| PREDICTED: aconitate hydratase 1 [Camelina sativa]
 ref|XP_010446874.1| PREDICTED: aconitate hydratase 1 [Camelina sativa]
Length=898

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MASENPF+ I  +L KP GGEFG +YSLPALNDPRIDKLPYSIRILLE+AIRNCD FQV 
Sbjct  1    MASENPFRSILKALEKPDGGEFGNYYSLPALNDPRIDKLPYSIRILLESAIRNCDEFQVK  60

Query  553  KEDVEKIIDWQ  585
              DVEKI+DW+
Sbjct  61   SYDVEKILDWE  71



>ref|XP_006425366.1| hypothetical protein CICLE_v10024840mg [Citrus clementina]
 gb|ESR38606.1| hypothetical protein CICLE_v10024840mg [Citrus clementina]
Length=900

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MA+ENPFK I  +L  P GGEFGK+YSLPALNDPRI KLPYSI+ILLE+AIRNCD FQV 
Sbjct  1    MATENPFKSILKTLQSPDGGEFGKYYSLPALNDPRIGKLPYSIKILLESAIRNCDEFQVK  60

Query  553  KEDVEKIIDWQT  588
             +DVEKIIDW+T
Sbjct  61   SKDVEKIIDWET  72



>ref|XP_010437416.1| PREDICTED: aconitate hydratase 1-like [Camelina sativa]
Length=898

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MASENPF+ I  +L KP GGEFG +YSLPALNDPRIDKLPYSIRILLE AIRNCD FQV 
Sbjct  1    MASENPFRSILKALEKPDGGEFGNYYSLPALNDPRIDKLPYSIRILLELAIRNCDEFQVK  60

Query  553  KEDVEKIIDWQ  585
              DVEKI+DW+
Sbjct  61   SNDVEKILDWE  71



>gb|KHN41868.1| Aconitate hydratase 1 [Glycine soja]
Length=901

 Score =   122 bits (305),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 63/72 (88%), Gaps = 1/72 (1%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGG-GEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQV  549
            MA+ENPF  I T+L KPGG GEFGK++SLPALNDPRID+LPYS+RILLE+AIRNCD FQV
Sbjct  1    MATENPFNSILTTLEKPGGAGEFGKYFSLPALNDPRIDRLPYSVRILLESAIRNCDEFQV  60

Query  550  TKEDVEKIIDWQ  585
               DVEKIIDW+
Sbjct  61   KSNDVEKIIDWE  72


 Score = 30.0 bits (66),  Expect(2) = 4e-28, Method: Composition-based stats.
 Identities = 12/13 (92%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = +3

Query  585  NTAPKLVEIPFKP  623
            NT+PKLVEIPFKP
Sbjct  73   NTSPKLVEIPFKP  85



>ref|XP_010432222.1| PREDICTED: aconitate hydratase 1-like [Camelina sativa]
Length=898

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MAS+NPF+ I  +L KP GGEFG +YSLPALNDPRIDKLPYSIRILLE+AIRNCD FQV 
Sbjct  1    MASDNPFRSILKALEKPDGGEFGNYYSLPALNDPRIDKLPYSIRILLESAIRNCDEFQVK  60

Query  553  KEDVEKIIDWQ  585
              DVEKI+DW+
Sbjct  61   SNDVEKILDWE  71



>gb|KJB48278.1| hypothetical protein B456_008G061900 [Gossypium raimondii]
Length=900

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MAS NPF  I  +L KP GGEFGK+YSLPALNDPRIDKLPYSI+ILLE+AIRNCD FQV 
Sbjct  1    MASANPFNSILKTLEKPQGGEFGKYYSLPALNDPRIDKLPYSIKILLESAIRNCDEFQVK  60

Query  553  KEDVEKIIDWQ  585
             +DVEKIIDW+
Sbjct  61   SKDVEKIIDWE  71



>emb|CDX75532.1| BnaA01g01700D [Brassica napus]
Length=925

 Score =   122 bits (305),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = +1

Query  364  IATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNF  543
            +   ASENPF+ I  +L KP GGEFG +YSLPALNDPRIDKLPYSIRILLE+AIRNCD F
Sbjct  25   VCVSASENPFRSILKALEKPDGGEFGSYYSLPALNDPRIDKLPYSIRILLESAIRNCDEF  84

Query  544  QVTKEDVEKIIDWQ  585
            QV  +DVEKI+DW+
Sbjct  85   QVKSKDVEKILDWE  98



>gb|AAL13084.1| putative aconitase [Prunus avium]
Length=902

 Score =   122 bits (305),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MA+ NPF+ I T+L KP GGEFGK+YSLPALNDPRIDKLP+SI+ILLE+AIRNCD FQV 
Sbjct  1    MATANPFQKILTALEKPDGGEFGKYYSLPALNDPRIDKLPFSIKILLESAIRNCDEFQVK  60

Query  553  KEDVEKIIDWQ  585
             +DVEKIIDW+
Sbjct  61   SKDVEKIIDWE  71



>gb|KDP23953.1| hypothetical protein JCGZ_25341 [Jatropha curcas]
Length=900

 Score =   121 bits (304),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            M +ENPF  I  +L KP GGEFGK+YSLPALNDPRIDKLPYSI+ILLE+AIRNCD FQV 
Sbjct  1    MVNENPFTSILKTLEKPDGGEFGKYYSLPALNDPRIDKLPYSIKILLESAIRNCDEFQVK  60

Query  553  KEDVEKIIDWQ  585
             +DVEKIIDW+
Sbjct  61   SKDVEKIIDWE  71



>ref|XP_008242011.1| PREDICTED: aconitate hydratase 1 [Prunus mume]
Length=898

 Score =   121 bits (304),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MA+ NPF+ I T+L KP GGEFGK+YSLPALNDPRIDKLP+SI+ILLE+AIRNCD FQV 
Sbjct  1    MATANPFQKILTALEKPDGGEFGKYYSLPALNDPRIDKLPFSIKILLESAIRNCDEFQVK  60

Query  553  KEDVEKIIDWQ  585
             +DVEKIIDW+
Sbjct  61   SKDVEKIIDWE  71



>ref|XP_007203240.1| hypothetical protein PRUPE_ppa001138mg [Prunus persica]
 gb|EMJ04439.1| hypothetical protein PRUPE_ppa001138mg [Prunus persica]
Length=898

 Score =   121 bits (304),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MA+ NPF+ I T+L KP GGEFGK+YSLPALNDPRIDKLP+SI+ILLE+AIRNCD FQV 
Sbjct  1    MATANPFQKILTALEKPDGGEFGKYYSLPALNDPRIDKLPFSIKILLESAIRNCDEFQVK  60

Query  553  KEDVEKIIDWQ  585
             +DVEKIIDW+
Sbjct  61   SKDVEKIIDWE  71



>emb|CDY41626.1| BnaC03g62580D [Brassica napus]
Length=905

 Score =   121 bits (304),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            ++SENPF+ I  +L KP GGEFG +YSLPALNDPRIDKLPYSIRILLE+AIRNCD FQV 
Sbjct  8    LSSENPFRSILKTLEKPDGGEFGNYYSLPALNDPRIDKLPYSIRILLESAIRNCDEFQVK  67

Query  553  KEDVEKIIDWQ  585
             +DVEKI+DW+
Sbjct  68   SKDVEKILDWE  78



>ref|XP_006380559.1| hypothetical protein POPTR_0007s09260g [Populus trichocarpa]
 gb|ERP58356.1| hypothetical protein POPTR_0007s09260g [Populus trichocarpa]
Length=899

 Score =   120 bits (301),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 63/71 (89%), Gaps = 1/71 (1%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MA+ENPFK I  +L KPGG EFGK+YSLPALNDPRID+LPYSI+ILLE+AIRNCD FQV 
Sbjct  1    MANENPFKSILKTLEKPGG-EFGKYYSLPALNDPRIDRLPYSIKILLESAIRNCDEFQVK  59

Query  553  KEDVEKIIDWQ  585
             +DVEKIIDW+
Sbjct  60   SKDVEKIIDWE  70


 Score = 30.0 bits (66),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 12/13 (92%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = +3

Query  585  NTAPKLVEIPFKP  623
            NT+PKLVEIPFKP
Sbjct  71   NTSPKLVEIPFKP  83



>ref|XP_010266897.1| PREDICTED: aconitate hydratase 1 [Nelumbo nucifera]
Length=900

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MA+ N ++ I  +L KPGGGEFGK+YSLPALNDPRIDKLPYSIRILLE+AIRNCD FQV 
Sbjct  1    MATRNVYESILKTLEKPGGGEFGKYYSLPALNDPRIDKLPYSIRILLESAIRNCDEFQVK  60

Query  553  KEDVEKIIDWQ  585
            ++DVEKI+DW+
Sbjct  61   EKDVEKILDWK  71



>ref|XP_006383042.1| aconitate hydratase family protein [Populus trichocarpa]
 gb|ERP60839.1| aconitate hydratase family protein [Populus trichocarpa]
Length=899

 Score =   119 bits (297),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 61/71 (86%), Gaps = 1/71 (1%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            M +ENPFK I  +L KPGG EFGK+YSLPALNDPRID+LPYSI+ILLE+AIRNCD FQV 
Sbjct  1    MVNENPFKSILKTLEKPGG-EFGKYYSLPALNDPRIDRLPYSIKILLESAIRNCDEFQVK  59

Query  553  KEDVEKIIDWQ  585
              DVEKIIDW+
Sbjct  60   SNDVEKIIDWE  70


 Score = 31.2 bits (69),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 13/13 (100%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = +3

Query  585  NTAPKLVEIPFKP  623
            NTAPKLVEIPFKP
Sbjct  71   NTAPKLVEIPFKP  83



>ref|XP_011022256.1| PREDICTED: aconitate hydratase 1 [Populus euphratica]
Length=899

 Score =   118 bits (296),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 61/71 (86%), Gaps = 1/71 (1%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            M +ENPFK I  +L KPGG EFGK+YSLPALNDPRID+LPYSI+ILLE+AIRNCD FQV 
Sbjct  1    MVNENPFKSILKTLEKPGG-EFGKYYSLPALNDPRIDRLPYSIKILLESAIRNCDEFQVK  59

Query  553  KEDVEKIIDWQ  585
              DVEKIIDW+
Sbjct  60   SNDVEKIIDWE  70


 Score = 31.6 bits (70),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 13/13 (100%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = +3

Query  585  NTAPKLVEIPFKP  623
            NTAPKLVEIPFKP
Sbjct  71   NTAPKLVEIPFKP  83



>emb|CBI24446.3| unnamed protein product [Vitis vinifera]
Length=918

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +1

Query  346  NDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAI  525
            ++F ++    AS NPF  I  +L KP GGEFGK+YSLPAL DPRID+LPYSIRILLE+AI
Sbjct  10   SNFSKRKNNYASSNPFASILKTLEKPAGGEFGKYYSLPALGDPRIDRLPYSIRILLESAI  69

Query  526  RNCDNFQVTKEDVEKIIDWQ  585
            RNCD FQV  +DVEKIIDW+
Sbjct  70   RNCDEFQVKAKDVEKIIDWE  89



>ref|XP_004985790.1| PREDICTED: putative aconitate hydratase, cytoplasmic-like [Setaria 
italica]
Length=986

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 67/79 (85%), Gaps = 1/79 (1%)
 Frame = +1

Query  352  FHRKIATMASENPFKGIFTSLPKPGGGE-FGKFYSLPALNDPRIDKLPYSIRILLEAAIR  528
            F R+ A+ A++N +  I T L KPGGGE FGK+YSLPAL+DPRID+LPYSIRILLE+AIR
Sbjct  81   FERRFASAATKNSYDEILTGLGKPGGGEEFGKYYSLPALSDPRIDRLPYSIRILLESAIR  140

Query  529  NCDNFQVTKEDVEKIIDWQ  585
            NCD FQVT +DVEKI+DW+
Sbjct  141  NCDEFQVTGKDVEKILDWE  159



>ref|XP_002263337.1| PREDICTED: aconitate hydratase 1 [Vitis vinifera]
Length=900

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MAS NPF  I  +L KP GGEFGK+YSLPAL DPRID+LPYSIRILLE+AIRNCD FQV 
Sbjct  1    MASSNPFASILKTLEKPAGGEFGKYYSLPALGDPRIDRLPYSIRILLESAIRNCDEFQVK  60

Query  553  KEDVEKIIDWQ  585
             +DVEKIIDW+
Sbjct  61   AKDVEKIIDWE  71



>ref|XP_010113288.1| Aconitate hydratase 1 [Morus notabilis]
 gb|EXC35295.1| Aconitate hydratase 1 [Morus notabilis]
Length=977

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +1

Query  376  ASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTK  555
              ENPFK I  +L KP GGEFGK+YSLPALNDPRI+KLPYSIRILLE+AIRNCD FQV  
Sbjct  62   TGENPFKSILKTLEKPDGGEFGKYYSLPALNDPRIEKLPYSIRILLESAIRNCDEFQVKS  121

Query  556  EDVEKIIDWQ  585
            +DVEKIIDW+
Sbjct  122  KDVEKIIDWE  131



>gb|AES61065.2| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=895

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 66/75 (88%), Gaps = 1/75 (1%)
 Frame = +1

Query  364  IATMASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDN  540
            +AT+ SE+ FKGI T LPKPGGG E+GKF+SLP LND RI++LPYSIRIL+E+AIRNCDN
Sbjct  1    MATLTSEHVFKGILTGLPKPGGGDEYGKFFSLPLLNDSRIERLPYSIRILVESAIRNCDN  60

Query  541  FQVTKEDVEKIIDWQ  585
            F+VT+ DVE IIDW+
Sbjct  61   FKVTQNDVENIIDWE  75



>ref|XP_003517155.1| PREDICTED: aconitate hydratase 1 [Glycine max]
Length=901

 Score =   119 bits (297),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 62/72 (86%), Gaps = 1/72 (1%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGG-GEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQV  549
            MA+ENPF  I  +L KPGG GEFGK++SLPALNDPRID+LPYS+RILLE+AIRNCD FQV
Sbjct  1    MATENPFNSILRTLEKPGGAGEFGKYFSLPALNDPRIDRLPYSVRILLESAIRNCDEFQV  60

Query  550  TKEDVEKIIDWQ  585
               D+EKIIDW+
Sbjct  61   KSNDIEKIIDWE  72


 Score = 30.0 bits (66),  Expect(2) = 3e-27, Method: Composition-based stats.
 Identities = 12/13 (92%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = +3

Query  585  NTAPKLVEIPFKP  623
            NT+PKLVEIPFKP
Sbjct  73   NTSPKLVEIPFKP  85



>dbj|BAJ92965.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=999

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 67/79 (85%), Gaps = 1/79 (1%)
 Frame = +1

Query  352  FHRKIATMASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIDKLPYSIRILLEAAIR  528
            F R+ A+ A++N +  I TSL KPGGG +FGK+YSLPAL DPRID+LPYSIRILLE+AIR
Sbjct  93   FERRFASAATKNSYDEILTSLAKPGGGADFGKYYSLPALADPRIDRLPYSIRILLESAIR  152

Query  529  NCDNFQVTKEDVEKIIDWQ  585
            NCD FQVT +DVEKI+DW+
Sbjct  153  NCDEFQVTGKDVEKILDWE  171



>ref|XP_008658754.1| PREDICTED: uncharacterized protein LOC100304315 isoform X1 [Zea 
mays]
Length=989

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 67/79 (85%), Gaps = 1/79 (1%)
 Frame = +1

Query  352  FHRKIATMASENPFKGIFTSLPKPGGGE-FGKFYSLPALNDPRIDKLPYSIRILLEAAIR  528
            F R+ A+ A+ N +  I T L +PGGGE FGK+YSLPAL+DPRID+LPYSIRILLE+AIR
Sbjct  84   FERRFASAATRNSYDEILTGLGRPGGGEEFGKYYSLPALSDPRIDRLPYSIRILLESAIR  143

Query  529  NCDNFQVTKEDVEKIIDWQ  585
            NCD+FQVT +DVEKI+DW+
Sbjct  144  NCDDFQVTGKDVEKILDWE  162



>ref|XP_009363442.1| PREDICTED: aconitate hydratase 1-like [Pyrus x bretschneideri]
Length=898

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MA+ NPF+ I T+L KP GGEFGK+YSLPALNDPRI+KLP+SI+ILLE+AIRNCD FQV 
Sbjct  1    MAAANPFQKILTALEKPDGGEFGKYYSLPALNDPRIEKLPFSIKILLESAIRNCDEFQVK  60

Query  553  KEDVEKIIDWQ  585
              DVEKIIDW+
Sbjct  61   SNDVEKIIDWE  71



>ref|XP_003537655.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Glycine max]
Length=901

 Score =   118 bits (296),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 62/72 (86%), Gaps = 1/72 (1%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGG-GEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQV  549
            MA+ENPF  I T+L KPGG GEFGK++SLPALND RID+LPYS+RILLE+AIRNCD FQV
Sbjct  1    MATENPFNSILTTLEKPGGAGEFGKYFSLPALNDRRIDRLPYSVRILLESAIRNCDEFQV  60

Query  550  TKEDVEKIIDWQ  585
               DVEKIIDW+
Sbjct  61   KSNDVEKIIDWE  72


 Score = 30.0 bits (66),  Expect(2) = 3e-27, Method: Composition-based stats.
 Identities = 12/13 (92%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = +3

Query  585  NTAPKLVEIPFKP  623
            NT+PKLVEIPFKP
Sbjct  73   NTSPKLVEIPFKP  85



>ref|XP_009337075.1| PREDICTED: aconitate hydratase 1-like [Pyrus x bretschneideri]
Length=898

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MA+ NPF+ I T+L KP GGEFGK+YSLPALNDPRI+KLP+SI+ILLE+AIRNCD FQV 
Sbjct  1    MAAANPFQKILTALEKPDGGEFGKYYSLPALNDPRIEKLPFSIKILLESAIRNCDEFQVK  60

Query  553  KEDVEKIIDWQ  585
              DVEKIIDW+
Sbjct  61   SNDVEKIIDWE  71



>ref|XP_008337967.1| PREDICTED: aconitate hydratase 1 [Malus domestica]
Length=898

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MA+ NPF+ I T+L KP GGEFGK+YSLPALNDPRI+KLP+SI+ILLE+AIRNCD FQV 
Sbjct  1    MAAANPFQKILTALEKPDGGEFGKYYSLPALNDPRIEKLPFSIKILLESAIRNCDEFQVK  60

Query  553  KEDVEKIIDWQ  585
              DVEKIIDW+
Sbjct  61   SNDVEKIIDWE  71



>ref|XP_009344825.1| PREDICTED: aconitate hydratase 1 [Pyrus x bretschneideri]
Length=898

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MAS NPF+ I T+L +P GGEFGK+YSLPALNDPRI+KLP+SI+ILLE+AIRNCD FQV 
Sbjct  1    MASANPFQKILTALERPDGGEFGKYYSLPALNDPRIEKLPFSIKILLESAIRNCDEFQVK  60

Query  553  KEDVEKIIDWQ  585
              DVEKIIDW+
Sbjct  61   SNDVEKIIDWE  71



>ref|XP_002976825.1| hypothetical protein SELMODRAFT_443331 [Selaginella moellendorffii]
 gb|EFJ21935.1| hypothetical protein SELMODRAFT_443331 [Selaginella moellendorffii]
Length=949

 Score =   117 bits (293),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = +1

Query  355  HRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNC  534
             R+   M S +PF+ I TSL K  GGE+GK+YSLP L+DPRI+KLPYSI+ILLE+AIRNC
Sbjct  45   QRQEIAMVSGHPFESILTSLSKDDGGEYGKYYSLPDLHDPRIEKLPYSIKILLESAIRNC  104

Query  535  DNFQVTKEDVEKIIDW  582
            DNFQVTK+DVEKI DW
Sbjct  105  DNFQVTKDDVEKIADW  120


 Score = 31.2 bits (69),  Expect(2) = 5e-27, Method: Composition-based stats.
 Identities = 13/13 (100%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = +3

Query  585  NTAPKLVEIPFKP  623
            NTAPKLVEIPFKP
Sbjct  122  NTAPKLVEIPFKP  134



>ref|XP_008670444.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X1 [Zea mays]
Length=982

 Score =   117 bits (292),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 65/77 (84%), Gaps = 1/77 (1%)
 Frame = +1

Query  358  RKIATMA-SENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNC  534
            R +ATMA   + F  + TSLPKPGGGE+GK+YSLPALND RI++LPYSIR LLE+AIRNC
Sbjct  74   RGVATMADGSSRFGHVLTSLPKPGGGEYGKYYSLPALNDRRIERLPYSIRYLLESAIRNC  133

Query  535  DNFQVTKEDVEKIIDWQ  585
            D FQ+T++DVE IIDW+
Sbjct  134  DGFQITEKDVENIIDWE  150


 Score = 31.2 bits (69),  Expect(2) = 5e-27, Method: Composition-based stats.
 Identities = 13/13 (100%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = +3

Query  585  NTAPKLVEIPFKP  623
            NTAPKLVEIPFKP
Sbjct  151  NTAPKLVEIPFKP  163



>ref|XP_002980554.1| hypothetical protein SELMODRAFT_444572 [Selaginella moellendorffii]
 gb|EFJ18205.1| hypothetical protein SELMODRAFT_444572 [Selaginella moellendorffii]
Length=949

 Score =   117 bits (292),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = +1

Query  355  HRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNC  534
             R+   M S +PF+ I TSL K  GGE+GK+YSLP L+DPRI+KLPYSI+ILLE+AIRNC
Sbjct  45   QRQEIAMVSGHPFESILTSLSKDDGGEYGKYYSLPDLHDPRIEKLPYSIKILLESAIRNC  104

Query  535  DNFQVTKEDVEKIIDW  582
            DNFQVTK+DVEKI DW
Sbjct  105  DNFQVTKDDVEKIADW  120


 Score = 31.2 bits (69),  Expect(2) = 5e-27, Method: Composition-based stats.
 Identities = 13/13 (100%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = +3

Query  585  NTAPKLVEIPFKP  623
            NTAPKLVEIPFKP
Sbjct  122  NTAPKLVEIPFKP  134



>ref|XP_008670445.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X2 [Zea mays]
 tpg|DAA40969.1| TPA: hypothetical protein ZEAMMB73_742994 [Zea mays]
Length=980

 Score =   117 bits (292),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 65/77 (84%), Gaps = 1/77 (1%)
 Frame = +1

Query  358  RKIATMA-SENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNC  534
            R +ATMA   + F  + TSLPKPGGGE+GK+YSLPALND RI++LPYSIR LLE+AIRNC
Sbjct  74   RGVATMADGSSRFGHVLTSLPKPGGGEYGKYYSLPALNDRRIERLPYSIRYLLESAIRNC  133

Query  535  DNFQVTKEDVEKIIDWQ  585
            D FQ+T++DVE IIDW+
Sbjct  134  DGFQITEKDVENIIDWE  150


 Score = 31.2 bits (69),  Expect(2) = 5e-27, Method: Composition-based stats.
 Identities = 13/13 (100%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = +3

Query  585  NTAPKLVEIPFKP  623
            NTAPKLVEIPFKP
Sbjct  151  NTAPKLVEIPFKP  163



>gb|EEC74472.1| hypothetical protein OsI_09921 [Oryza sativa Indica Group]
Length=986

 Score =   119 bits (297),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 67/79 (85%), Gaps = 1/79 (1%)
 Frame = +1

Query  352  FHRKIATMASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIDKLPYSIRILLEAAIR  528
            F R+ A+ A++N +  I T L KPGGG EFGK+YSLPAL+DPRI++LPYSIRILLE+AIR
Sbjct  81   FERRFASAAAKNSYDEILTGLAKPGGGAEFGKYYSLPALSDPRIERLPYSIRILLESAIR  140

Query  529  NCDNFQVTKEDVEKIIDWQ  585
            NCD FQVT +DVEKI+DW+
Sbjct  141  NCDEFQVTGKDVEKILDWE  159



>ref|NP_001048898.1| Os03g0136900 [Oryza sativa Japonica Group]
 gb|ABF93861.1| Aconitate hydratase, cytoplasmic, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF10812.1| Os03g0136900 [Oryza sativa Japonica Group]
Length=986

 Score =   119 bits (297),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 67/79 (85%), Gaps = 1/79 (1%)
 Frame = +1

Query  352  FHRKIATMASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIDKLPYSIRILLEAAIR  528
            F R+ A+ A++N +  I T L KPGGG EFGK+YSLPAL+DPRI++LPYSIRILLE+AIR
Sbjct  81   FERRFASAAAKNSYDEILTGLAKPGGGAEFGKYYSLPALSDPRIERLPYSIRILLESAIR  140

Query  529  NCDNFQVTKEDVEKIIDWQ  585
            NCD FQVT +DVEKI+DW+
Sbjct  141  NCDEFQVTGKDVEKILDWE  159



>ref|XP_007157870.1| hypothetical protein PHAVU_002G105000g [Phaseolus vulgaris]
 gb|ESW29864.1| hypothetical protein PHAVU_002G105000g [Phaseolus vulgaris]
Length=901

 Score =   119 bits (297),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 61/72 (85%), Gaps = 1/72 (1%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQV  549
            M +ENPF  I  +L KPGGG EFGK+YSLPALNDPRID+LPYS+RILLE+AIRNCD FQV
Sbjct  1    MVTENPFSSILRTLEKPGGGGEFGKYYSLPALNDPRIDRLPYSVRILLESAIRNCDEFQV  60

Query  550  TKEDVEKIIDWQ  585
               DVEKIIDW+
Sbjct  61   KSPDVEKIIDWE  72



>ref|XP_010029634.1| PREDICTED: aconitate hydratase 1 [Eucalyptus grandis]
 gb|KCW56577.1| hypothetical protein EUGRSUZ_I02307 [Eucalyptus grandis]
Length=900

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MA ENPFK I  +L +PGGGEFG ++SLPAL D RID+LPYSIRILLE+AIRNCD FQV 
Sbjct  1    MACENPFKSILKTLERPGGGEFGTYFSLPALGDSRIDRLPYSIRILLESAIRNCDEFQVK  60

Query  553  KEDVEKIIDWQ  585
             +DVEKIIDW+
Sbjct  61   SKDVEKIIDWE  71



>gb|KCW56576.1| hypothetical protein EUGRSUZ_I02307 [Eucalyptus grandis]
Length=898

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MA ENPFK I  +L +PGGGEFG ++SLPAL D RID+LPYSIRILLE+AIRNCD FQV 
Sbjct  1    MACENPFKSILKTLERPGGGEFGTYFSLPALGDSRIDRLPYSIRILLESAIRNCDEFQVK  60

Query  553  KEDVEKIIDWQ  585
             +DVEKIIDW+
Sbjct  61   SKDVEKIIDWE  71



>gb|ADZ57218.1| aconitase protein [Litchi chinensis]
Length=883

 Score =   116 bits (291),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  418  KPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            KPGGGEFGKFY LPALNDPRIDKLPYSIRILLE+AIRNCDNFQV KEDVEKIIDW+
Sbjct  1    KPGGGEFGKFYRLPALNDPRIDKLPYSIRILLESAIRNCDNFQVKKEDVEKIIDWE  56


 Score = 30.0 bits (66),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 12/13 (92%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = +3

Query  585  NTAPKLVEIPFKP  623
            NT+PKLVEIPFKP
Sbjct  57   NTSPKLVEIPFKP  69



>ref|XP_003558862.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Brachypodium 
distachyon]
Length=994

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 66/79 (84%), Gaps = 1/79 (1%)
 Frame = +1

Query  352  FHRKIATMASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIDKLPYSIRILLEAAIR  528
            F R+ A+ A++N +  I TSL KPGGG +FGK+YSLP L DPRID+LPYSIRILLE+AIR
Sbjct  88   FERRFASAATKNSYDEILTSLAKPGGGADFGKYYSLPRLADPRIDRLPYSIRILLESAIR  147

Query  529  NCDNFQVTKEDVEKIIDWQ  585
            NCD FQVT +DVEKI+DW+
Sbjct  148  NCDEFQVTGKDVEKILDWE  166



>emb|CDY24823.1| BnaA08g14870D [Brassica napus]
Length=922

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = +1

Query  358  RKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCD  537
            +++    SENPF+ I  +L KP GGEFG +YSL ALNDPRIDKLPYSIRILLE+AIRNCD
Sbjct  20   QELRIFTSENPFRSILKTLEKPDGGEFGNYYSLAALNDPRIDKLPYSIRILLESAIRNCD  79

Query  538  NFQVTKEDVEKIIDWQ  585
             FQV  +DVEKI+DW+
Sbjct  80   EFQVKSKDVEKILDWE  95



>ref|XP_003612247.1| Aconitate hydratase [Medicago truncatula]
 gb|AES95205.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=901

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 61/72 (85%), Gaps = 1/72 (1%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQV  549
            MA++NPF  I  +L KPGGG EFGK+YSLPALND RID LPYSIRILLE+AIRNCD FQV
Sbjct  1    MATQNPFNNILKTLEKPGGGGEFGKYYSLPALNDSRIDALPYSIRILLESAIRNCDEFQV  60

Query  550  TKEDVEKIIDWQ  585
              +DVEKIIDW+
Sbjct  61   KSDDVEKIIDWK  72



>ref|XP_004512178.1| PREDICTED: aconitate hydratase 1-like [Cicer arietinum]
Length=901

 Score =   117 bits (292),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 61/72 (85%), Gaps = 1/72 (1%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGG-GEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQV  549
            MA+ENPFK I  +L KPGG G FG +YSLPALND RID+LPYSIRILLE+AIRNCD FQV
Sbjct  1    MATENPFKSILKTLEKPGGDGHFGNYYSLPALNDSRIDELPYSIRILLESAIRNCDEFQV  60

Query  550  TKEDVEKIIDWQ  585
              +DVEKIIDW+
Sbjct  61   KSDDVEKIIDWK  72


 Score = 28.9 bits (63),  Expect(2) = 2e-26, Method: Composition-based stats.
 Identities = 12/13 (92%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +3

Query  585  NTAPKLVEIPFKP  623
            NTAPK VEIPFKP
Sbjct  73   NTAPKQVEIPFKP  85



>ref|XP_008440877.1| PREDICTED: aconitate hydratase [Cucumis melo]
Length=900

 Score =   114 bits (286),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MA+ENPF  I  +L  P GG FGK+YSLPALNDPRI++LPYSIRILLE+AIRNCD F V 
Sbjct  1    MATENPFNSILKTLENPEGGVFGKYYSLPALNDPRIERLPYSIRILLESAIRNCDEFAVK  60

Query  553  KEDVEKIIDWQ  585
             +DVEKIIDW+
Sbjct  61   AKDVEKIIDWE  71


 Score = 31.2 bits (69),  Expect(2) = 3e-26, Method: Composition-based stats.
 Identities = 13/13 (100%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = +3

Query  585  NTAPKLVEIPFKP  623
            NTAPKLVEIPFKP
Sbjct  72   NTAPKLVEIPFKP  84



>ref|XP_002465901.1| hypothetical protein SORBIDRAFT_01g047850 [Sorghum bicolor]
 gb|ABE77202.1| putative aconitate hydratase 1 [Sorghum bicolor]
 gb|EER92899.1| hypothetical protein SORBIDRAFT_01g047850 [Sorghum bicolor]
Length=991

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 65/79 (82%), Gaps = 1/79 (1%)
 Frame = +1

Query  352  FHRKIATMASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIDKLPYSIRILLEAAIR  528
            F R+ A+ A+ N +  I T L +PG G EFGK+YSLPAL+DPRID+LPYSIRILLE+AIR
Sbjct  86   FERRFASAATRNTYDEILTGLKRPGAGDEFGKYYSLPALSDPRIDRLPYSIRILLESAIR  145

Query  529  NCDNFQVTKEDVEKIIDWQ  585
            NCD+FQVT  DVEKI+DW+
Sbjct  146  NCDDFQVTGNDVEKILDWE  164



>gb|KJB17578.1| hypothetical protein B456_003G006000 [Gossypium raimondii]
Length=896

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MA+EN F  I  +L KP GGEFGK+Y LPALNDPRIDKLPY I+ILLE+AIRNCD FQV 
Sbjct  1    MAAENAFNTILKTLEKPDGGEFGKYYCLPALNDPRIDKLPYCIKILLESAIRNCDEFQVK  60

Query  553  KEDVEKIIDWQ  585
             +DVEKIIDW+
Sbjct  61   SKDVEKIIDWE  71



>emb|CAN83844.1| hypothetical protein VITISV_003004 [Vitis vinifera]
Length=885

 Score =   116 bits (290),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = +1

Query  379  SENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKE  558
            S NPF  I  +L KP GGEFGK+YSLPAL DPRID+LPYSIRILLE+AIRNCD FQV  +
Sbjct  6    SSNPFASILKTLEKPXGGEFGKYYSLPALGDPRIDRLPYSIRILLESAIRNCDEFQVKAK  65

Query  559  DVEKIIDWQ  585
            DVEKIIDW+
Sbjct  66   DVEKIIDWE  74



>ref|XP_002530635.1| aconitase, putative [Ricinus communis]
 gb|EEF31743.1| aconitase, putative [Ricinus communis]
Length=900

 Score =   116 bits (290),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            M +E+PFK I  +L K  GG FGK+YSLPALNDPRID+LPYSIRILLE+AIRNCD FQV 
Sbjct  1    MVNESPFKSILKTLEKADGGAFGKYYSLPALNDPRIDRLPYSIRILLESAIRNCDEFQVK  60

Query  553  KEDVEKIIDWQ  585
              DVEKIIDW+
Sbjct  61   SNDVEKIIDWE  71



>ref|XP_003590814.1| Aconitate hydratase [Medicago truncatula]
Length=924

 Score =   115 bits (289),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 64/79 (81%), Gaps = 1/79 (1%)
 Frame = +1

Query  352  FHRKIATMASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIDKLPYSIRILLEAAIR  528
            +   I    SE+ FKGI T LPKPGGG E+GKF+SLP LND RI++LPYSIRIL+E+AIR
Sbjct  26   YRVSILDCTSEHVFKGILTGLPKPGGGDEYGKFFSLPLLNDSRIERLPYSIRILVESAIR  85

Query  529  NCDNFQVTKEDVEKIIDWQ  585
            NCDNF+VT+ DVE IIDW+
Sbjct  86   NCDNFKVTQNDVENIIDWE  104



>ref|XP_010529315.1| PREDICTED: aconitate hydratase 1-like [Tarenaya hassleriana]
Length=901

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            M  ENPF+ I  +L +P GGE+GKF+SLP+LNDPRI+KLPYSIRILLE+AIRNCD FQV 
Sbjct  1    MDCENPFRRILKTLERPDGGEYGKFFSLPSLNDPRIEKLPYSIRILLESAIRNCDEFQVR  60

Query  553  KEDVEKIIDWQT  588
              DVEKI+DW+ 
Sbjct  61   SNDVEKILDWEN  72



>ref|XP_004166975.1| PREDICTED: aconitate hydratase 1-like, partial [Cucumis sativus]
Length=466

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MA+ENPF  I  +L    GG FGK+YSLPALNDPRI++LPYSIRILLE+AIRNCD F V 
Sbjct  1    MATENPFNSILKTLENHEGGVFGKYYSLPALNDPRIERLPYSIRILLESAIRNCDEFAVK  60

Query  553  KEDVEKIIDWQT  588
             +DVEKIIDW+ 
Sbjct  61   AKDVEKIIDWEN  72



>gb|EMS48231.1| Putative aconitate hydratase, cytoplasmic [Triticum urartu]
Length=860

 Score =   113 bits (283),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 62/71 (87%), Gaps = 1/71 (1%)
 Frame = +1

Query  376  ASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            A++N +  I TSL KPGGG +FGK+YSLPAL DPRID+LPYSIRILLE+AIRNCD FQVT
Sbjct  14   ATKNSYDEILTSLAKPGGGADFGKYYSLPALADPRIDRLPYSIRILLESAIRNCDEFQVT  73

Query  553  KEDVEKIIDWQ  585
             +DVEKI+DW+
Sbjct  74   GKDVEKILDWE  84



>ref|XP_004134842.1| PREDICTED: aconitate hydratase 1-like [Cucumis sativus]
Length=900

 Score =   111 bits (278),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MA+ENPF  I  +L    GG FGK+YSLPALNDPRI++LPYSIRILLE+AIRNCD F V 
Sbjct  1    MATENPFNSILKTLENHEGGVFGKYYSLPALNDPRIERLPYSIRILLESAIRNCDEFAVK  60

Query  553  KEDVEKIIDWQ  585
             +DVEKIIDW+
Sbjct  61   AKDVEKIIDWE  71


 Score = 30.0 bits (66),  Expect(2) = 5e-25, Method: Composition-based stats.
 Identities = 12/13 (92%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = +3

Query  585  NTAPKLVEIPFKP  623
            NT+PKLVEIPFKP
Sbjct  72   NTSPKLVEIPFKP  84



>ref|XP_006651017.1| PREDICTED: putative aconitate hydratase, cytoplasmic-like [Oryza 
brachyantha]
Length=906

 Score =   113 bits (283),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 63/75 (84%), Gaps = 1/75 (1%)
 Frame = +1

Query  364  IATMASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDN  540
            +   A+ N +  I TSL KPGGG EFGK+YSLPAL+DPRI++LPYSIRILLE+AIRNCD 
Sbjct  5    VVLAATRNSYDEILTSLAKPGGGPEFGKYYSLPALSDPRIERLPYSIRILLESAIRNCDE  64

Query  541  FQVTKEDVEKIIDWQ  585
            FQVT +DVEKI+DW+
Sbjct  65   FQVTGKDVEKILDWE  79



>gb|KGN48958.1| Aconitase [Cucumis sativus]
Length=881

 Score =   111 bits (277),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MA+ENPF  I  +L    GG FGK+YSLPALNDPRI++LPYSIRILLE+AIRNCD F V 
Sbjct  1    MATENPFNSILKTLENHEGGVFGKYYSLPALNDPRIERLPYSIRILLESAIRNCDEFAVK  60

Query  553  KEDVEKIIDWQ  585
             +DVEKIIDW+
Sbjct  61   AKDVEKIIDWE  71


 Score = 30.0 bits (66),  Expect(2) = 5e-25, Method: Composition-based stats.
 Identities = 12/13 (92%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = +3

Query  585  NTAPKLVEIPFKP  623
            NT+PKLVEIPFKP
Sbjct  72   NTSPKLVEIPFKP  84



>ref|XP_010100637.1| Aconitate hydratase [Morus notabilis]
 gb|EXB83385.1| Aconitate hydratase [Morus notabilis]
Length=938

 Score =   111 bits (278),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 70/119 (59%), Gaps = 38/119 (32%)
 Frame = +1

Query  238  SAFRSLRC---SVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFT  408
            +A+RSL     SVPRWSHGV W SP +L +QIR+ APV+  F RKIA+M           
Sbjct  50   AAYRSLSSAVRSVPRWSHGVHWNSPYTLRSQIRAVAPVIQQFQRKIASM-----------  98

Query  409  SLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
                                    D+LPYSIRIL+E+AIRNCDNFQV KEDVEKIIDW+
Sbjct  99   ------------------------DRLPYSIRILIESAIRNCDNFQVKKEDVEKIIDWE  133


 Score = 28.9 bits (63),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 12/13 (92%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +3

Query  585  NTAPKLVEIPFKP  623
            NTAPK VEIPFKP
Sbjct  134  NTAPKQVEIPFKP  146



>ref|XP_010033531.1| PREDICTED: aconitate hydratase 1-like [Eucalyptus grandis]
Length=903

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 60/72 (83%), Gaps = 1/72 (1%)
 Frame = +1

Query  373  MASENPF-KGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQV  549
            M SENPF K I  +L KP GGEFGK+Y LPAL+DPRID+LP SI++LLE+AIRNCD FQV
Sbjct  1    MGSENPFEKSILRTLEKPDGGEFGKYYYLPALDDPRIDRLPISIKVLLESAIRNCDEFQV  60

Query  550  TKEDVEKIIDWQ  585
              EDVEKIIDW+
Sbjct  61   KCEDVEKIIDWE  72



>gb|EMT03129.1| Putative aconitate hydratase, cytoplasmic [Aegilops tauschii]
Length=1967

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 62/71 (87%), Gaps = 1/71 (1%)
 Frame = +1

Query  376   ASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
             A++N +  I TSL KPGGG +FGK+YSLPAL DPRID+LPYSIRILLE+AIRNCD FQVT
Sbjct  1069  ATKNSYDEILTSLAKPGGGADFGKYYSLPALADPRIDRLPYSIRILLESAIRNCDEFQVT  1128

Query  553   KEDVEKIIDWQ  585
              +DVEKI+DW+
Sbjct  1129  GKDVEKILDWE  1139



>gb|KHN36000.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=908

 Score =   108 bits (269),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 56/63 (89%), Gaps = 1/63 (2%)
 Frame = +1

Query  400  IFTSLPKPGG-GEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKII  576
            I T+L KPGG GEFGK++SLPALNDPRID+LPYS+RILLE+AIRNCD FQV   D+EKII
Sbjct  17   ILTTLEKPGGAGEFGKYFSLPALNDPRIDRLPYSVRILLESAIRNCDEFQVKSNDIEKII  76

Query  577  DWQ  585
            DW+
Sbjct  77   DWE  79


 Score = 30.4 bits (67),  Expect(2) = 4e-24, Method: Composition-based stats.
 Identities = 12/13 (92%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = +3

Query  585  NTAPKLVEIPFKP  623
            NT+PKLVEIPFKP
Sbjct  80   NTSPKLVEIPFKP  92



>gb|EEE58288.1| hypothetical protein OsJ_09326 [Oryza sativa Japonica Group]
Length=907

 Score =   110 bits (275),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 61/70 (87%), Gaps = 1/70 (1%)
 Frame = +1

Query  379  SENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTK  555
            ++N +  I T L KPGGG EFGK+YSLPAL+DPRI++LPYSIRILLE+AIRNCD FQVT 
Sbjct  11   AKNSYDEILTGLAKPGGGAEFGKYYSLPALSDPRIERLPYSIRILLESAIRNCDEFQVTG  70

Query  556  EDVEKIIDWQ  585
            +DVEKI+DW+
Sbjct  71   KDVEKILDWE  80



>gb|KCW53221.1| hypothetical protein EUGRSUZ_J02488 [Eucalyptus grandis]
Length=930

 Score =   110 bits (274),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 60/74 (81%), Gaps = 1/74 (1%)
 Frame = +1

Query  367  ATMASENPF-KGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNF  543
            A   SENPF K I  +L KP GGEFGK+Y LPAL+DPRID+LP SI++LLE+AIRNCD F
Sbjct  26   AEQRSENPFEKSILRTLEKPDGGEFGKYYYLPALDDPRIDRLPISIKVLLESAIRNCDEF  85

Query  544  QVTKEDVEKIIDWQ  585
            QV  EDVEKIIDW+
Sbjct  86   QVKCEDVEKIIDWE  99



>gb|EMT24311.1| Putative aconitate hydratase, cytoplasmic [Aegilops tauschii]
Length=1009

 Score =   110 bits (274),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +1

Query  391  FKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEK  570
            F    T LPKPGGGE+GKFYS+PALNDP+IDKLPY IRILLE+A+RN DNFQVT+ DV+ 
Sbjct  120  FAKTLTILPKPGGGEYGKFYSIPALNDPKIDKLPYCIRILLESAVRNYDNFQVTESDVQN  179

Query  571  IIDWQ  585
            IIDW+
Sbjct  180  IIDWE  184



>emb|CDY44621.1| BnaC04g06410D [Brassica napus]
Length=99

 Score =   101 bits (252),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 56/70 (80%), Gaps = 2/70 (3%)
 Frame = +1

Query  379  SENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKE  558
            SENPF+ I  +L    GG+FG +YSL ALND RIDKLPYSIRILLE+AIRNCD FQV  +
Sbjct  10   SENPFRSILKTLD--DGGKFGNYYSLRALNDSRIDKLPYSIRILLESAIRNCDEFQVKSK  67

Query  559  DVEKIIDWQT  588
            DVEKI+DW+ 
Sbjct  68   DVEKILDWEN  77



>ref|XP_001770969.1| predicted protein [Physcomitrella patens]
 gb|EDQ64299.1| predicted protein [Physcomitrella patens]
Length=898

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +1

Query  376  ASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTK  555
            AS+NPF  + T LPK  GG +G++YSL  LNDPR+D+LPYSIR LLE+AIRNCDNFQV +
Sbjct  6    ASKNPFSNLVTDLPKASGGSYGQYYSLVKLNDPRVDELPYSIRYLLESAIRNCDNFQVLE  65

Query  556  EDVEKIIDWQT  588
             DVEKI+DW+ 
Sbjct  66   ADVEKILDWKV  76



>gb|KHN21232.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=918

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +1

Query  430  GEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQ  585
            GEFGKFYSLP+LNDPRID+LPYSIRILLE+AIRNCDNFQV KEDVEKI+DW+
Sbjct  20   GEFGKFYSLPSLNDPRIDRLPYSIRILLESAIRNCDNFQVKKEDVEKILDWE  71



>ref|XP_002991024.1| hypothetical protein SELMODRAFT_132907 [Selaginella moellendorffii]
 gb|EFJ07832.1| hypothetical protein SELMODRAFT_132907 [Selaginella moellendorffii]
Length=907

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 57/68 (84%), Gaps = 5/68 (7%)
 Frame = +1

Query  385  NPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDV  564
            NP+K    +L KP  G  GK+YSLPALNDPR+DKLPYSI+ILLE+ IRNCDNFQVTKEDV
Sbjct  18   NPYK----NLVKPLEGH-GKYYSLPALNDPRVDKLPYSIKILLESCIRNCDNFQVTKEDV  72

Query  565  EKIIDWQT  588
            EKIIDW+ 
Sbjct  73   EKIIDWEN  80



>emb|CDX91508.1| BnaC04g06420D [Brassica napus]
Length=82

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +1

Query  412  LPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDVEKIIDWQT  588
            L KP GG+FG +YSL ALND RIDKLPYSIRILLE+AIRNC  FQV  +DVEKI+DW+ 
Sbjct  2    LEKPDGGKFGNYYSLRALNDSRIDKLPYSIRILLESAIRNCHEFQVKSKDVEKILDWEN  60



>ref|XP_002991716.1| hypothetical protein SELMODRAFT_133937 [Selaginella moellendorffii]
 gb|EFJ07287.1| hypothetical protein SELMODRAFT_133937 [Selaginella moellendorffii]
Length=907

 Score =   101 bits (252),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 57/68 (84%), Gaps = 5/68 (7%)
 Frame = +1

Query  385  NPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDV  564
            NP+K    +L KP  G  GK+YSLPALNDPR++KLPYSI+ILLE+ IRNCDNFQVTKEDV
Sbjct  18   NPYK----NLVKPLEGH-GKYYSLPALNDPRVEKLPYSIKILLESCIRNCDNFQVTKEDV  72

Query  565  EKIIDWQT  588
            EKIIDW+ 
Sbjct  73   EKIIDWEN  80



>gb|KDO71345.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=889

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 53/72 (74%), Gaps = 11/72 (15%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            MA+ENPFK I  +L +P GGEFGK+YSLPALNDPRI           E+AIRNCD FQV 
Sbjct  1    MATENPFKSILKTLQRPDGGEFGKYYSLPALNDPRI-----------ESAIRNCDEFQVK  49

Query  553  KEDVEKIIDWQT  588
             +DVEKIIDW+T
Sbjct  50   SKDVEKIIDWET  61



>ref|XP_001016756.1| aconitate hydratase [Tetrahymena thermophila]
 gb|EAR96511.1| cytoplasmic-like aconitate hydratase [Tetrahymena thermophila 
SB210]
Length=898

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 39/67 (58%), Positives = 48/67 (72%), Gaps = 3/67 (4%)
 Frame = +1

Query  385  NPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDV  564
            NPF+ I   +P   G +  KF+SL  LNDPR+ KLPYSIR+LLE A+RNCD F +   DV
Sbjct  7    NPFEKILKEVP---GLQGKKFFSLNDLNDPRVAKLPYSIRVLLEVAVRNCDEFNIKSADV  63

Query  565  EKIIDWQ  585
            EKI+DWQ
Sbjct  64   EKILDWQ  70



>ref|XP_004031131.1| hypothetical protein IMG5_146680 [Ichthyophthirius multifiliis]
 gb|EGR29895.1| hypothetical protein IMG5_146680 [Ichthyophthirius multifiliis]
Length=909

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 39/70 (56%), Positives = 51/70 (73%), Gaps = 2/70 (3%)
 Frame = +1

Query  376  ASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTK  555
            + +NPF+  F +L K  G  +  FYSLP LND R++KLPYSIR+LLE+A+RNCD F V  
Sbjct  14   SQKNPFQKTFKNL-KVDGKSY-NFYSLPDLNDSRVEKLPYSIRVLLESAVRNCDEFNVKA  71

Query  556  EDVEKIIDWQ  585
            +DVE I+ WQ
Sbjct  72   QDVENILSWQ  81



>emb|CDW89012.1| aconitate hydratase 1 family protein [Stylonychia lemnae]
Length=921

 Score = 85.5 bits (210),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 39/82 (48%), Positives = 56/82 (68%), Gaps = 3/82 (4%)
 Frame = +1

Query  340  VLNDFH-RKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLE  516
            +LN  H R  +T   +NP+  + ++L    G +   FY+LPAL D RI +LPYS+R+LLE
Sbjct  17   LLNKTHQRSFSTGPQKNPYASVLSNLTV--GNQKYSFYNLPALQDQRIQRLPYSVRVLLE  74

Query  517  AAIRNCDNFQVTKEDVEKIIDW  582
            +A+RNCD F V + DVE+I+DW
Sbjct  75   SAVRNCDEFNVKQADVERILDW  96


 Score = 23.9 bits (50),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 10/13 (77%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = +3

Query  585  NTAPKLVEIPFKP  623
            NT+ K VEIPFKP
Sbjct  98   NTSQKDVEIPFKP  110



>gb|EJY70620.1| Aconitate hydratase 1 family protein [Oxytricha trifallax]
Length=892

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 51/72 (71%), Gaps = 2/72 (3%)
 Frame = +1

Query  373  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVT  552
            M   NPF+ +   L   G  +  K+YSLPALNDPR++KLP+S+R+LLE+A+RNCD F V 
Sbjct  1    MEKANPFQNVLQELQVEG--QSYKYYSLPALNDPRVEKLPFSVRVLLESALRNCDEFNVK  58

Query  553  KEDVEKIIDWQT  588
              D+E I++W +
Sbjct  59   STDIETILNWTS  70



>ref|XP_002111662.1| hypothetical protein TRIADDRAFT_63287 [Trichoplax adhaerens]
 gb|EDV25629.1| hypothetical protein TRIADDRAFT_63287 [Trichoplax adhaerens]
Length=891

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 50/67 (75%), Gaps = 2/67 (3%)
 Frame = +1

Query  385  NPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDKLPYSIRILLEAAIRNCDNFQVTKEDV  564
            NPF  I  +     G E  +FYSLP LND R DKLP+SIR+LLE+A+RNCDNFQV ++DV
Sbjct  3    NPFDRILKNTQI--GEENFQFYSLPDLNDGRYDKLPFSIRVLLESAVRNCDNFQVKEKDV  60

Query  565  EKIIDWQ  585
            E I++WQ
Sbjct  61   ENILNWQ  67



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897347644380