BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS075C10

Length=627
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011095158.1|  PREDICTED: receptor-like protein kinase FERONIA    177   2e-47   Sesamum indicum [beniseed]
ref|XP_006341293.1|  PREDICTED: receptor-like protein kinase FERO...    171   4e-45   Solanum tuberosum [potatoes]
ref|XP_004246282.1|  PREDICTED: receptor-like protein kinase FERONIA    169   2e-44   Solanum lycopersicum
ref|XP_009791682.1|  PREDICTED: receptor-like protein kinase FERONIA    160   1e-41   Nicotiana sylvestris
ref|XP_009617447.1|  PREDICTED: receptor-like protein kinase FERONIA    160   2e-41   Nicotiana tomentosiformis
gb|KJB38065.1|  hypothetical protein B456_006G235700                    159   7e-41   Gossypium raimondii
gb|KJB29840.1|  hypothetical protein B456_005G120700                    157   2e-40   Gossypium raimondii
ref|XP_009337788.1|  PREDICTED: receptor-like protein kinase FERONIA    156   5e-40   Pyrus x bretschneideri [bai li]
ref|XP_010244547.1|  PREDICTED: receptor-like protein kinase FERONIA    156   5e-40   Nelumbo nucifera [Indian lotus]
ref|XP_009115840.1|  PREDICTED: receptor-like protein kinase FERONIA    155   9e-40   Brassica rapa
ref|XP_006403905.1|  hypothetical protein EUTSA_v10010114mg             155   9e-40   Eutrema salsugineum [saltwater cress]
emb|CDX78012.1|  BnaA09g32070D                                          155   1e-39   
emb|CDX73714.1|  BnaC08g22890D                                          155   1e-39   
gb|AHZ44752.1|  CrRLK1L-like protein                                    153   3e-39   Platanus x hispanica [London plane tree]
ref|XP_009370899.1|  PREDICTED: receptor-like protein kinase FERONIA    154   3e-39   Pyrus x bretschneideri [bai li]
ref|XP_010252026.1|  PREDICTED: receptor-like protein kinase FERONIA    154   3e-39   Nelumbo nucifera [Indian lotus]
emb|CDX90645.1|  BnaA03g41360D                                          153   6e-39   
gb|ABT18097.1|  FERONIA receptor-like kinase                            153   7e-39   Cardamine flexuosa
gb|EPS73118.1|  hypothetical protein M569_01631                         152   8e-39   Genlisea aurea
ref|XP_009136619.1|  PREDICTED: receptor-like protein kinase FERONIA    152   9e-39   Brassica rapa
emb|CDY29022.1|  BnaC07g32280D                                          152   1e-38   Brassica napus [oilseed rape]
ref|XP_008244701.1|  PREDICTED: receptor-like protein kinase FERONIA    152   2e-38   Prunus mume [ume]
gb|ABT18095.1|  FERONIA receptor-like kinase                            151   2e-38   Cardamine flexuosa
emb|CDP06378.1|  unnamed protein product                                151   2e-38   Coffea canephora [robusta coffee]
gb|EYU42039.1|  hypothetical protein MIMGU_mgv1a001343mg                150   7e-38   Erythranthe guttata [common monkey flower]
ref|XP_010431249.1|  PREDICTED: receptor-like protein kinase FERONIA    147   7e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010252025.1|  PREDICTED: receptor-like protein kinase FERONIA    150   8e-38   Nelumbo nucifera [Indian lotus]
ref|XP_008370279.1|  PREDICTED: receptor-like protein kinase FERONIA    150   8e-38   
ref|XP_007208402.1|  hypothetical protein PRUPE_ppa001164mg             150   8e-38   Prunus persica
gb|KDO64141.1|  hypothetical protein CISIN_1g036624mg                   149   1e-37   Citrus sinensis [apfelsine]
ref|XP_007033491.1|  Malectin/receptor-like protein kinase family...    149   2e-37   Theobroma cacao [chocolate]
gb|KJB71482.1|  hypothetical protein B456_011G124900                    149   2e-37   Gossypium raimondii
ref|XP_006429617.1|  hypothetical protein CICLE_v10011034mg             148   4e-37   Citrus clementina [clementine]
emb|CDY33271.1|  BnaA01g19380D                                          147   6e-37   Brassica napus [oilseed rape]
ref|XP_010426729.1|  PREDICTED: receptor-like protein kinase FERONIA    147   6e-37   Camelina sativa [gold-of-pleasure]
ref|XP_002528705.1|  kinase, putative                                   147   8e-37   
ref|XP_009148931.1|  PREDICTED: receptor-like protein kinase FERONIA    147   9e-37   Brassica rapa
ref|XP_004492579.1|  PREDICTED: receptor-like protein kinase FERO...    146   1e-36   Cicer arietinum [garbanzo]
ref|XP_010503851.1|  PREDICTED: receptor-like protein kinase FERONIA    146   1e-36   
ref|XP_010515573.1|  PREDICTED: receptor-like protein kinase FERONIA    146   2e-36   Camelina sativa [gold-of-pleasure]
gb|KEH32083.1|  feronia receptor-like kinase                            145   2e-36   Medicago truncatula
emb|CDY16299.1|  BnaC01g23340D                                          146   2e-36   Brassica napus [oilseed rape]
gb|ABT18094.1|  FERONIA receptor-like kinase                            145   2e-36   Brassica oleracea
gb|KEH23293.1|  feronia receptor-like kinase                            145   4e-36   Medicago truncatula
ref|XP_003609098.1|  FERONIA receptor-like kinase                       145   5e-36   
ref|NP_001238686.1|  receptor-like kinase                               145   5e-36   Glycine max [soybeans]
ref|XP_004302537.1|  PREDICTED: receptor-like protein kinase FERONIA    144   6e-36   Fragaria vesca subsp. vesca
ref|XP_010529939.1|  PREDICTED: receptor-like protein kinase FERONIA    144   1e-35   Tarenaya hassleriana [spider flower]
gb|KHN29489.1|  Receptor-like protein kinase FERONIA                    144   1e-35   Glycine soja [wild soybean]
ref|NP_001237656.1|  FERONIA receptor-like kinase precursor             144   1e-35   Glycine max [soybeans]
gb|KHN40613.1|  Receptor-like protein kinase FERONIA                    144   1e-35   Glycine soja [wild soybean]
ref|XP_006290584.1|  hypothetical protein CARUB_v10016673mg             142   5e-35   Capsella rubella
ref|XP_002279218.3|  PREDICTED: receptor-like protein kinase FERONIA    142   5e-35   
ref|XP_004142677.1|  PREDICTED: receptor-like protein kinase FERO...    140   3e-34   Cucumis sativus [cucumbers]
gb|AAK59558.1|  putative receptor-protein kinase                        140   3e-34   Arabidopsis thaliana [mouse-ear cress]
ref|NP_190723.1|  receptor-like protein kinase FERONIA                  140   3e-34   Arabidopsis thaliana [mouse-ear cress]
gb|ABT18100.1|  FERONIA receptor-like kinase                            139   3e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007140079.1|  hypothetical protein PHAVU_008G082400g             139   6e-34   Phaseolus vulgaris [French bean]
ref|XP_010043538.1|  PREDICTED: receptor-like protein kinase FERONIA    137   3e-33   Eucalyptus grandis [rose gum]
ref|XP_010098025.1|  Receptor-like protein kinase FERONIA               136   5e-33   Morus notabilis
gb|ABT18098.1|  FERONIA receptor-like kinase                            135   8e-33   Cardamine flexuosa
ref|XP_008463270.1|  PREDICTED: receptor-like protein kinase FERONIA    135   1e-32   Cucumis melo [Oriental melon]
ref|XP_002877809.1|  hypothetical protein ARALYDRAFT_485507             134   3e-32   Arabidopsis lyrata subsp. lyrata
ref|XP_002308259.1|  kinase family protein                              131   3e-31   
ref|XP_002323088.2|  kinase family protein                              131   4e-31   Populus trichocarpa [western balsam poplar]
ref|XP_010553161.1|  PREDICTED: receptor-like protein kinase FERONIA    130   9e-31   Tarenaya hassleriana [spider flower]
ref|XP_011001679.1|  PREDICTED: receptor-like protein kinase FERONIA    130   1e-30   Populus euphratica
ref|XP_007140062.1|  hypothetical protein PHAVU_008G081000g             129   1e-30   Phaseolus vulgaris [French bean]
ref|XP_011016728.1|  PREDICTED: receptor-like protein kinase FERONIA    129   1e-30   Populus euphratica
gb|ABT18099.1|  FERONIA receptor-like kinase                            126   2e-29   Cardamine flexuosa
ref|XP_010683454.1|  PREDICTED: receptor-like protein kinase FERONIA    123   2e-28   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004499818.1|  PREDICTED: receptor-like protein kinase FERO...    118   3e-28   
ref|XP_004499646.1|  PREDICTED: receptor-like protein kinase FERO...    123   3e-28   
ref|XP_004499645.1|  PREDICTED: receptor-like protein kinase FERO...    118   1e-27   
ref|XP_004499647.1|  PREDICTED: receptor-like protein kinase FERO...    119   1e-27   Cicer arietinum [garbanzo]
ref|XP_004514615.1|  PREDICTED: uncharacterized protein LOC101497599    120   2e-27   
ref|XP_010667956.1|  PREDICTED: receptor-like protein kinase FERONIA    115   1e-26   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009118021.1|  PREDICTED: receptor-like protein kinase FERO...    117   3e-26   Brassica rapa
ref|XP_008660180.1|  PREDICTED: receptor-like protein kinase FERONIA    114   2e-25   Zea mays [maize]
ref|XP_010246590.1|  PREDICTED: receptor-like protein kinase FERONIA    114   3e-25   Nelumbo nucifera [Indian lotus]
ref|XP_010247768.1|  PREDICTED: receptor-like protein kinase FERONIA    114   4e-25   Nelumbo nucifera [Indian lotus]
ref|XP_004984479.1|  PREDICTED: receptor-like protein kinase FERO...    113   4e-25   Setaria italica
ref|XP_002467915.1|  hypothetical protein SORBIDRAFT_01g036260          113   6e-25   Sorghum bicolor [broomcorn]
emb|CDP15786.1|  unnamed protein product                                111   7e-25   Coffea canephora [robusta coffee]
gb|KJB10568.1|  hypothetical protein B456_001G207900                    111   2e-24   Gossypium raimondii
emb|CBI27305.3|  unnamed protein product                                111   2e-24   Vitis vinifera
ref|XP_002273707.2|  PREDICTED: receptor-like protein kinase FERONIA    111   2e-24   Vitis vinifera
gb|EMT17007.1|  Receptor-like protein kinase FERONIA                    111   3e-24   
tpg|DAA45217.1|  TPA: putative receptor-like protein kinase famil...    110   7e-24   
ref|XP_009391670.1|  PREDICTED: receptor-like protein kinase FERONIA    110   8e-24   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY26624.1|  BnaA09g46530D                                          110   8e-24   Brassica napus [oilseed rape]
gb|EEC75192.1|  hypothetical protein OsI_11431                          109   1e-23   Oryza sativa Indica Group [Indian rice]
ref|NP_001050022.1|  Os03g0333200                                       109   1e-23   
gb|KDP27676.1|  hypothetical protein JCGZ_20096                         109   1e-23   Jatropha curcas
ref|XP_010250338.1|  PREDICTED: receptor-like protein kinase FERONIA    108   1e-23   Nelumbo nucifera [Indian lotus]
ref|XP_008810848.1|  PREDICTED: receptor-like protein kinase FERONIA    108   2e-23   Phoenix dactylifera
ref|XP_010938035.1|  PREDICTED: receptor-like protein kinase FERONIA    108   3e-23   Elaeis guineensis
ref|XP_011021061.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    108   3e-23   Populus euphratica
gb|KDP24662.1|  hypothetical protein JCGZ_26521                         107   3e-23   Jatropha curcas
gb|KDP27678.1|  hypothetical protein JCGZ_20098                         105   4e-23   Jatropha curcas
gb|KDP24658.1|  hypothetical protein JCGZ_26517                         103   4e-23   Jatropha curcas
ref|XP_003557976.1|  PREDICTED: receptor-like protein kinase FERONIA    107   6e-23   Brachypodium distachyon [annual false brome]
ref|XP_006373375.1|  hypothetical protein POPTR_0017s13190g             107   7e-23   
ref|XP_006373380.1|  hypothetical protein POPTR_0017s13240g             107   8e-23   
ref|XP_006373370.1|  hypothetical protein POPTR_0017s13150g             107   9e-23   
gb|EAY75971.1|  hypothetical protein OsI_03893                          106   9e-23   Oryza sativa Indica Group [Indian rice]
ref|NP_001044372.1|  Os01g0769700                                       106   1e-22   
gb|EMT27425.1|  Receptor-like protein kinase FERONIA                    106   2e-22   
emb|CDP05401.1|  unnamed protein product                                105   3e-22   Coffea canephora [robusta coffee]
gb|KDP24661.1|  hypothetical protein JCGZ_26520                         105   3e-22   Jatropha curcas
ref|XP_009414253.1|  PREDICTED: receptor-like protein kinase FERONIA    105   4e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006373383.1|  hypothetical protein POPTR_0017s13270g             105   4e-22   
ref|XP_011009252.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    104   5e-22   Populus euphratica
ref|XP_011009253.1|  PREDICTED: receptor-like protein kinase FERONIA    104   6e-22   Populus euphratica
ref|XP_008813242.1|  PREDICTED: receptor-like protein kinase FERONIA    104   8e-22   Phoenix dactylifera
ref|XP_007032827.1|  Malectin/receptor-like protein kinase family...    103   1e-21   
ref|XP_010921463.1|  PREDICTED: receptor-like protein kinase ANXUR2     103   2e-21   Elaeis guineensis
ref|XP_010921184.1|  PREDICTED: receptor-like protein kinase FERONIA    103   2e-21   Elaeis guineensis
ref|XP_010660576.1|  PREDICTED: receptor-like protein kinase FERONIA    102   2e-21   
ref|XP_007032832.1|  Malectin/receptor-like protein kinase family...    102   2e-21   
ref|XP_010660578.1|  PREDICTED: receptor-like protein kinase FERONIA    102   2e-21   Vitis vinifera
gb|EYU44219.1|  hypothetical protein MIMGU_mgv11b013480mg             95.9    2e-21   Erythranthe guttata [common monkey flower]
ref|XP_009412649.1|  PREDICTED: receptor-like protein kinase FERONIA    102   3e-21   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB10595.1|  hypothetical protein B456_001G210100                    102   3e-21   Gossypium raimondii
emb|CAN77538.1|  hypothetical protein VITISV_025026                     102   3e-21   Vitis vinifera
ref|XP_002277584.3|  PREDICTED: receptor-like protein kinase FERONIA    102   4e-21   Vitis vinifera
emb|CBI21192.3|  unnamed protein product                                102   4e-21   Vitis vinifera
gb|KDP24278.1|  hypothetical protein JCGZ_25574                         101   5e-21   Jatropha curcas
gb|KDP27270.1|  hypothetical protein JCGZ_19969                         101   5e-21   Jatropha curcas
gb|KJB42940.1|  hypothetical protein B456_007G175600                    101   6e-21   Gossypium raimondii
emb|CDP20271.1|  unnamed protein product                                100   1e-20   Coffea canephora [robusta coffee]
emb|CDP19885.1|  unnamed protein product                                100   1e-20   Coffea canephora [robusta coffee]
ref|XP_009588433.1|  PREDICTED: receptor-like protein kinase FERONIA    100   1e-20   Nicotiana tomentosiformis
ref|XP_008464587.1|  PREDICTED: receptor-like protein kinase FERONIA    100   1e-20   Cucumis melo [Oriental melon]
ref|XP_006654205.1|  PREDICTED: receptor-like protein kinase FERO...    100   2e-20   Oryza brachyantha
emb|CDP19887.1|  unnamed protein product                                100   2e-20   Coffea canephora [robusta coffee]
ref|XP_009416326.1|  PREDICTED: receptor-like protein kinase FERONIA    100   2e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004137258.1|  PREDICTED: receptor-like protein kinase FERO...  99.8    2e-20   Cucumis sativus [cucumbers]
ref|XP_004154760.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  99.8    2e-20   
ref|XP_002530995.1|  kinase, putative                                 99.8    3e-20   Ricinus communis
ref|XP_006427852.1|  hypothetical protein CICLE_v10024830mg           99.8    3e-20   Citrus clementina [clementine]
gb|KDO53394.1|  hypothetical protein CISIN_1g002533mg                 99.8    3e-20   Citrus sinensis [apfelsine]
ref|XP_008809255.1|  PREDICTED: receptor-like protein kinase ANXUR1   99.4    3e-20   Phoenix dactylifera
ref|XP_009118022.1|  PREDICTED: receptor-like protein kinase FERO...  99.0    4e-20   Brassica rapa
ref|XP_006842554.1|  hypothetical protein AMTR_s00077p00138840        99.0    5e-20   
ref|XP_007032799.1|  Malectin/receptor protein kinase family prot...  99.0    5e-20   
ref|XP_011099030.1|  PREDICTED: receptor-like protein kinase FERONIA  98.6    6e-20   Sesamum indicum [beniseed]
ref|XP_007032796.1|  Malectin/receptor-like protein kinase family...  92.8    6e-20   
ref|XP_002870806.1|  predicted protein                                97.1    7e-20   
ref|XP_009419820.1|  PREDICTED: receptor-like protein kinase FERO...  96.7    1e-19   
ref|XP_007045781.1|  Malectin/receptor-like protein kinase family...  97.8    1e-19   
gb|EMT04378.1|  Receptor-like protein kinase FERONIA                  97.8    1e-19   
ref|XP_009419819.1|  PREDICTED: receptor-like protein kinase FERO...  96.7    1e-19   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB75372.1|  hypothetical protein B456_012G038800                  97.4    1e-19   Gossypium raimondii
ref|XP_006405671.1|  hypothetical protein EUTSA_v10027636mg           97.4    1e-19   Eutrema salsugineum [saltwater cress]
ref|NP_198719.1|  putative receptor-like protein kinase               97.4    1e-19   Arabidopsis thaliana [mouse-ear cress]
gb|KJB10602.1|  hypothetical protein B456_001G210700                  97.4    2e-19   Gossypium raimondii
ref|NP_198718.1|  putative receptor-like protein kinase               97.4    2e-19   Arabidopsis thaliana [mouse-ear cress]
dbj|BAK06468.1|  predicted protein                                    97.4    2e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS48200.1|  Receptor-like protein kinase HERK 1                   96.7    2e-19   Triticum urartu
gb|KJB10597.1|  hypothetical protein B456_001G210300                  97.1    2e-19   Gossypium raimondii
emb|CDP17056.1|  unnamed protein product                              97.1    2e-19   Coffea canephora [robusta coffee]
ref|XP_006844774.1|  hypothetical protein AMTR_s00016p00259140        97.1    2e-19   
ref|NP_001055089.1|  Os05g0280700                                     96.7    3e-19   
ref|XP_007045784.1|  Malectin/receptor-like protein kinase family...  96.3    3e-19   Theobroma cacao [chocolate]
ref|XP_009115877.1|  PREDICTED: putative receptor-like protein ki...  96.3    4e-19   Brassica rapa
emb|CDY36996.1|  BnaC06g12670D                                        96.3    4e-19   Brassica napus [oilseed rape]
ref|XP_003614252.1|  Kinase-like protein                              95.9    5e-19   
gb|KDP27267.1|  hypothetical protein JCGZ_19966                       95.9    5e-19   Jatropha curcas
dbj|BAK00988.1|  predicted protein                                    94.7    6e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003520131.2|  PREDICTED: receptor-like protein kinase FERO...  95.5    7e-19   Glycine max [soybeans]
gb|KHN29954.1|  Receptor-like protein kinase FERONIA                  95.5    7e-19   Glycine soja [wild soybean]
ref|XP_004962493.1|  PREDICTED: receptor-like protein kinase ANXU...  95.5    7e-19   Setaria italica
emb|CDX78036.1|  BnaA09g32310D                                        95.5    7e-19   
emb|CDX67422.1|  BnaA07g14620D                                        94.7    9e-19   
ref|XP_009790514.1|  PREDICTED: receptor-like protein kinase FERONIA  95.1    1e-18   Nicotiana sylvestris
ref|XP_009125099.1|  PREDICTED: putative receptor-like protein ki...  94.7    1e-18   Brassica rapa
ref|NP_198715.1|  putative receptor-like protein kinase               94.7    1e-18   Arabidopsis thaliana [mouse-ear cress]
gb|AAM10331.1|  AT5g38990/K15E6_170                                   94.7    1e-18   Arabidopsis thaliana [mouse-ear cress]
emb|CDP21458.1|  unnamed protein product                              88.6    1e-18   Coffea canephora [robusta coffee]
ref|XP_008368476.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  94.4    2e-18   
ref|XP_008341792.1|  PREDICTED: receptor-like protein kinase FERONIA  94.4    2e-18   
ref|XP_003614249.1|  Kinase-like protein                              94.0    2e-18   Medicago truncatula
ref|XP_007153476.1|  hypothetical protein PHAVU_003G038800g           94.0    2e-18   Phaseolus vulgaris [French bean]
ref|XP_009385155.1|  PREDICTED: receptor-like protein kinase ANXUR2   94.0    2e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007032823.1|  Malectin/receptor-like protein kinase family...  94.0    3e-18   
ref|XP_007032831.1|  Malectin/receptor-like protein kinase family...  93.6    3e-18   
ref|NP_198716.1|  putative receptor-like protein kinase               93.6    3e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002439522.1|  hypothetical protein SORBIDRAFT_09g009320        93.6    3e-18   Sorghum bicolor [broomcorn]
ref|XP_008341797.1|  PREDICTED: receptor-like protein kinase FERONIA  93.2    4e-18   
ref|XP_009388012.1|  PREDICTED: receptor-like protein kinase FERONIA  92.0    5e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003568703.1|  PREDICTED: receptor-like protein kinase ANXUR1   92.8    5e-18   Brachypodium distachyon [annual false brome]
gb|KJB11637.1|  hypothetical protein B456_001G269100                  92.8    6e-18   Gossypium raimondii
ref|XP_006338349.1|  PREDICTED: receptor-like protein kinase FERO...  92.4    7e-18   
gb|EMT01093.1|  hypothetical protein F775_16963                       91.3    8e-18   
gb|AFW77551.1|  putative receptor-like protein kinase family protein  92.4    9e-18   
ref|XP_010914574.1|  PREDICTED: receptor-like protein kinase ANXUR2   91.7    1e-17   Elaeis guineensis
ref|XP_002519226.1|  ATP binding protein, putative                    91.7    1e-17   Ricinus communis
ref|XP_010660597.1|  PREDICTED: receptor-like protein kinase FERONIA  90.5    2e-17   Vitis vinifera
ref|XP_009365970.1|  PREDICTED: receptor-like protein kinase FERONIA  90.9    2e-17   
ref|XP_004306057.1|  PREDICTED: receptor-like protein kinase FERONIA  91.3    2e-17   Fragaria vesca subsp. vesca
ref|XP_003633771.1|  PREDICTED: receptor-like protein kinase FERONIA  91.3    2e-17   
ref|XP_010243447.1|  PREDICTED: receptor-like protein kinase FERONIA  90.9    2e-17   Nelumbo nucifera [Indian lotus]
gb|KJB80425.1|  hypothetical protein B456_013G096400                  90.1    2e-17   Gossypium raimondii
gb|EMT03407.1|  Receptor-like protein kinase FERONIA                  90.9    2e-17   
ref|XP_007227151.1|  hypothetical protein PRUPE_ppa026453mg           90.9    2e-17   Prunus persica
gb|EMS66619.1|  hypothetical protein TRIUR3_14353                     89.7    3e-17   Triticum urartu
ref|XP_002272797.2|  PREDICTED: receptor-like protein kinase ANXUR1   90.5    3e-17   Vitis vinifera
emb|CBI21198.3|  unnamed protein product                              90.5    3e-17   Vitis vinifera
ref|XP_010552466.1|  PREDICTED: putative receptor-like protein ki...  90.5    4e-17   Tarenaya hassleriana [spider flower]
emb|CDY37884.1|  BnaC04g31220D                                        90.1    4e-17   Brassica napus [oilseed rape]
gb|EYU46822.1|  hypothetical protein MIMGU_mgv1a022107mg              90.1    4e-17   Erythranthe guttata [common monkey flower]
ref|XP_008223394.1|  PREDICTED: receptor-like protein kinase ANXUR1   90.1    5e-17   Prunus mume [ume]
ref|XP_006488842.1|  PREDICTED: receptor-like protein kinase ANXU...  90.1    5e-17   Citrus sinensis [apfelsine]
ref|XP_011099029.1|  PREDICTED: receptor-like protein kinase FERONIA  90.1    5e-17   Sesamum indicum [beniseed]
ref|XP_006419383.1|  hypothetical protein CICLE_v10004295mg           90.1    5e-17   Citrus clementina [clementine]
gb|KDO71938.1|  hypothetical protein CISIN_1g041565mg                 89.7    5e-17   Citrus sinensis [apfelsine]
ref|XP_004154759.1|  PREDICTED: receptor-like protein kinase FERO...  89.4    7e-17   
gb|KDP37883.1|  hypothetical protein JCGZ_05765                       87.8    8e-17   Jatropha curcas
ref|XP_004137257.1|  PREDICTED: receptor-like protein kinase FERO...  89.4    8e-17   Cucumis sativus [cucumbers]
gb|EMT13360.1|  hypothetical protein F775_08521                       88.6    8e-17   
gb|KJB48087.1|  hypothetical protein B456_008G053200                  89.4    8e-17   Gossypium raimondii
ref|XP_002512045.1|  conserved hypothetical protein                   89.0    9e-17   
emb|CDP05402.1|  unnamed protein product                              89.4    1e-16   Coffea canephora [robusta coffee]
gb|ACA25095.1|  serine/threonine protein kinase A                     84.0    1e-16   Populus tremula [European aspen]
emb|CDY37883.1|  BnaC04g31230D                                        88.6    1e-16   Brassica napus [oilseed rape]
ref|XP_011079535.1|  PREDICTED: receptor-like protein kinase ANXUR1   88.6    2e-16   Sesamum indicum [beniseed]
ref|XP_002277565.2|  PREDICTED: receptor-like protein kinase FERONIA  88.2    2e-16   Vitis vinifera
ref|XP_004499644.1|  PREDICTED: uncharacterized protein LOC101500653  87.8    2e-16   
ref|XP_010660579.1|  PREDICTED: receptor-like protein kinase FERONIA  87.0    2e-16   Vitis vinifera
dbj|BAJ88190.1|  predicted protein                                    87.8    3e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACA25089.1|  serine/threonine protein kinase A                     83.2    3e-16   Populus tremula [European aspen]
gb|ACA25088.1|  serine/threonine protein kinase A                     82.8    3e-16   Populus tremula [European aspen]
ref|XP_009373799.1|  PREDICTED: receptor-like protein kinase FERONIA  87.8    3e-16   
gb|ACA25086.1|  serine/threonine protein kinase A                     82.8    3e-16   Populus tremula [European aspen]
ref|XP_011013067.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  87.4    3e-16   Populus euphratica
gb|ACA25096.1|  serine/threonine protein kinase A                     82.8    4e-16   Populus tremula [European aspen]
ref|XP_003580431.1|  PREDICTED: receptor-like protein kinase FERONIA  86.3    4e-16   Brachypodium distachyon [annual false brome]
ref|XP_008464586.1|  PREDICTED: receptor-like protein kinase FERONIA  87.0    4e-16   Cucumis melo [Oriental melon]
ref|NP_001238536.1|  receptor-like kinase                             87.4    5e-16   Glycine max [soybeans]
ref|NP_001055184.1|  Os05g0318700                                     87.0    5e-16   
gb|EAY97521.1|  hypothetical protein OsI_19449                        87.0    5e-16   Oryza sativa Indica Group [Indian rice]
gb|EEE63237.1|  hypothetical protein OsJ_18047                        87.0    5e-16   Oryza sativa Japonica Group [Japonica rice]
gb|EYU38427.1|  hypothetical protein MIMGU_mgv1a001092mg              87.0    5e-16   Erythranthe guttata [common monkey flower]
ref|XP_002530992.1|  kinase, putative                                 87.0    5e-16   
gb|ACA25098.1|  serine/threonine protein kinase A                     82.4    6e-16   Populus tremula [European aspen]
ref|XP_006593699.1|  PREDICTED: receptor-like protein kinase FERO...  86.7    6e-16   
gb|KHN07116.1|  Receptor-like protein kinase FERONIA                  86.7    6e-16   Glycine soja [wild soybean]
ref|XP_009799586.1|  PREDICTED: receptor-like protein kinase ANXUR1   86.7    6e-16   Nicotiana sylvestris
ref|XP_003568697.1|  PREDICTED: receptor-like protein kinase FERONIA  86.7    6e-16   Brachypodium distachyon [annual false brome]
ref|XP_006387808.1|  hypothetical protein POPTR_0554s00200g           86.7    6e-16   
gb|KHN07118.1|  Receptor-like protein kinase FERONIA                  86.7    6e-16   Glycine soja [wild soybean]
ref|XP_010441030.1|  PREDICTED: putative receptor-like protein ki...  84.0    6e-16   
ref|XP_003543886.1|  PREDICTED: receptor-like protein kinase FERO...  86.7    7e-16   
ref|XP_010660595.1|  PREDICTED: receptor-like protein kinase FERONIA  86.3    7e-16   Vitis vinifera
ref|XP_006358215.1|  PREDICTED: receptor-like protein kinase ANXU...  86.7    7e-16   Solanum tuberosum [potatoes]
gb|ACA25099.1|  serine/threonine protein kinase A                     82.0    7e-16   Populus tremula [European aspen]
gb|ACA25100.1|  serine/threonine protein kinase A                     82.0    8e-16   Populus tremula [European aspen]
gb|EMT27556.1|  Receptor-like protein kinase ANXUR1                   86.7    8e-16   
gb|ACA25082.1|  serine/threonine protein kinase A                     81.6    8e-16   Populus tremula [European aspen]
ref|XP_011071382.1|  PREDICTED: receptor-like protein kinase ANXUR1   86.3    8e-16   Sesamum indicum [beniseed]
gb|ACA25085.1|  serine/threonine protein kinase A                     81.6    8e-16   Populus tremula [European aspen]
gb|ACA25090.1|  serine/threonine protein kinase A                     81.6    8e-16   Populus tremula [European aspen]
gb|ACA25092.1|  serine/threonine protein kinase A                     81.6    9e-16   Populus tremula [European aspen]
gb|ACA25081.1|  serine/threonine protein kinase A                     81.6    9e-16   Populus tremula [European aspen]
gb|ACA25101.1|  serine/threonine protein kinase A                     81.6    9e-16   Populus tremula [European aspen]
ref|XP_009139818.1|  PREDICTED: putative receptor-like protein ki...  85.9    1e-15   Brassica rapa
gb|EMS52253.1|  Receptor-like protein kinase FERONIA                  85.9    1e-15   Triticum urartu
emb|CDX74491.1|  BnaA04g08980D                                        85.9    1e-15   
gb|ACA25080.1|  serine/threonine protein kinase A                     81.6    1e-15   Populus tremula [European aspen]
ref|XP_006644001.1|  PREDICTED: receptor-like protein kinase ANXU...  85.9    1e-15   
ref|XP_007217058.1|  hypothetical protein PRUPE_ppa001157mg           85.9    1e-15   
ref|XP_004232151.1|  PREDICTED: receptor-like protein kinase FERONIA  85.9    1e-15   Solanum lycopersicum
ref|XP_010441032.1|  PREDICTED: probable receptor-like protein ki...  85.9    1e-15   
ref|NP_001238431.1|  FERONIA receptor-like kinase precursor           85.9    1e-15   Glycine max [soybeans]
ref|XP_006593316.1|  PREDICTED: FERONIA receptor-like kinase isof...  85.9    1e-15   
gb|EMT28751.1|  Receptor-like protein kinase FERONIA                  85.5    1e-15   
ref|XP_009790513.1|  PREDICTED: receptor-like protein kinase FERONIA  85.9    1e-15   Nicotiana sylvestris
gb|KDP41347.1|  hypothetical protein JCGZ_15754                       84.7    1e-15   Jatropha curcas
gb|KHN07112.1|  Receptor-like protein kinase FERONIA                  85.5    1e-15   
gb|ACA25079.1|  serine/threonine protein kinase A                     80.9    2e-15   
ref|XP_010441031.1|  PREDICTED: probable receptor-like protein ki...  85.5    2e-15   
gb|EMT16871.1|  Receptor-like protein kinase FERONIA                  85.5    2e-15   
ref|XP_009372137.1|  PREDICTED: receptor-like protein kinase ANXUR1   85.5    2e-15   
ref|XP_002316044.1|  Pto-like kinase OGw family protein               85.1    2e-15   
gb|ACA25084.1|  serine/threonine protein kinase A                     80.9    2e-15   
ref|XP_004976623.1|  PREDICTED: receptor-like protein kinase FERO...  84.3    2e-15   
gb|ACA25097.1|  serine/threonine protein kinase A                     80.5    2e-15   
ref|XP_007215522.1|  hypothetical protein PRUPE_ppa003761mg           84.3    2e-15   
ref|XP_006602953.1|  PREDICTED: receptor-like protein kinase FERO...  85.1    2e-15   
ref|XP_008390536.1|  PREDICTED: receptor-like protein kinase ANXUR1   85.1    2e-15   
gb|ACA25102.1|  serine/threonine protein kinase A                     80.5    2e-15   
ref|XP_006595251.1|  PREDICTED: receptor-like protein kinase FERO...  84.7    2e-15   
ref|XP_007032792.1|  Malectin/receptor protein kinase family protein  82.8    2e-15   
ref|XP_006593700.1|  PREDICTED: receptor-like protein kinase FERO...  84.7    2e-15   
ref|XP_002319081.1|  kinase family protein                            85.1    2e-15   
ref|XP_008231015.1|  PREDICTED: receptor-like protein kinase FERONIA  84.0    3e-15   
ref|XP_010684237.1|  PREDICTED: receptor-like protein kinase ANXUR1   84.7    3e-15   
ref|XP_008231019.1|  PREDICTED: receptor-like protein kinase FERONIA  83.2    3e-15   
ref|XP_008341791.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  84.7    3e-15   
ref|XP_009602553.1|  PREDICTED: receptor-like protein kinase ANXUR1   84.7    3e-15   
ref|XP_004243035.1|  PREDICTED: receptor-like protein kinase ANXUR1   84.7    3e-15   
gb|KFK33632.1|  hypothetical protein AALP_AA5G038800                  84.7    3e-15   
ref|XP_010230703.1|  PREDICTED: receptor-like protein kinase ANXUR1   84.7    4e-15   
gb|KHN37920.1|  Receptor-like protein kinase FERONIA                  84.3    4e-15   
ref|XP_011009251.1|  PREDICTED: receptor-like protein kinase FERONIA  84.3    4e-15   
ref|XP_007217617.1|  hypothetical protein PRUPE_ppa016279mg           84.0    4e-15   
gb|ACA25087.1|  serine/threonine protein kinase A                     79.7    5e-15   
gb|KHN47259.1|  Receptor-like protein kinase FERONIA                  84.0    5e-15   
ref|XP_006585798.1|  PREDICTED: receptor-like protein kinase FERO...  84.0    5e-15   
gb|ACA25083.1|  serine/threonine protein kinase A                     79.7    5e-15   
ref|XP_011038554.1|  PREDICTED: receptor-like protein kinase ANXUR1   84.0    5e-15   
ref|XP_009385224.1|  PREDICTED: receptor-like protein kinase ANXUR1   84.0    5e-15   
ref|XP_008230906.1|  PREDICTED: receptor-like protein kinase FERONIA  84.0    5e-15   
ref|XP_011015035.1|  PREDICTED: receptor-like protein kinase FERONIA  84.0    6e-15   
ref|XP_010319813.1|  PREDICTED: receptor-like protein kinase ANXUR1   84.0    6e-15   
ref|XP_003518179.1|  PREDICTED: receptor-like protein kinase FERO...  83.6    6e-15   
ref|XP_010450843.1|  PREDICTED: putative receptor-like protein ki...  83.6    6e-15   
gb|KHN37921.1|  Receptor-like protein kinase FERONIA                  83.6    6e-15   
gb|KEH43006.1|  malectin/receptor-like kinase family protein          83.6    7e-15   
gb|KHN04378.1|  Receptor-like protein kinase FERONIA                  83.6    7e-15   
ref|XP_002870808.1|  hypothetical protein ARALYDRAFT_916421           83.6    8e-15   
emb|CDX74492.1|  BnaA04g08970D                                        83.6    8e-15   
ref|XP_002271113.1|  PREDICTED: receptor-like protein kinase ANXUR1   83.6    8e-15   
ref|XP_009139815.1|  PREDICTED: putative receptor-like protein ki...  83.6    8e-15   
ref|XP_009139816.1|  PREDICTED: putative receptor-like protein ki...  83.6    8e-15   
ref|XP_008379865.1|  PREDICTED: receptor-like protein kinase FERONIA  83.2    9e-15   
ref|NP_001241448.1|  receptor-like protein kinase FERONIA-like pr...  83.6    9e-15   
ref|XP_003633768.2|  PREDICTED: receptor-like protein kinase FERONIA  83.2    9e-15   
ref|XP_003552590.2|  PREDICTED: receptor-like protein kinase FERO...  83.2    9e-15   
emb|CAN76103.1|  hypothetical protein VITISV_015218                   83.2    9e-15   
ref|XP_002884459.1|  kinase family protein                            83.2    1e-14   
gb|KDP41349.1|  hypothetical protein JCGZ_15756                       82.4    1e-14   
gb|KJB80427.1|  hypothetical protein B456_013G096600                  82.8    1e-14   
ref|XP_006285765.1|  hypothetical protein CARUB_v10007239mg           82.8    1e-14   
ref|NP_187120.1|  receptor-like protein kinase ANXUR1                 82.8    1e-14   
ref|XP_002447000.1|  hypothetical protein SORBIDRAFT_06g026735        81.6    1e-14   
gb|EYU19262.1|  hypothetical protein MIMGU_mgv1a024030mg              80.9    2e-14   
ref|XP_006654257.1|  PREDICTED: receptor-like protein kinase FERO...  82.4    2e-14   
ref|XP_002311383.2|  hypothetical protein POPTR_0008s10500g           82.4    2e-14   
dbj|BAJ93584.1|  predicted protein                                    82.4    2e-14   
gb|AAV44117.1|  unknown protein                                       81.6    2e-14   
ref|XP_002457574.1|  hypothetical protein SORBIDRAFT_03g009660        82.4    2e-14   
ref|XP_011032387.1|  PREDICTED: receptor-like protein kinase ANXUR1   82.4    2e-14   
ref|XP_004240568.1|  PREDICTED: receptor-like protein kinase ANXUR1   82.4    2e-14   
gb|KHN37916.1|  Receptor-like protein kinase FERONIA                  82.4    2e-14   
gb|KFK33213.1|  hypothetical protein AALP_AA6G345300                  82.4    2e-14   
ref|XP_010660577.1|  PREDICTED: receptor-like protein kinase FERONIA  82.0    2e-14   
ref|XP_002323908.2|  Pto-like kinase OGw family protein               82.0    2e-14   
ref|NP_001055179.1|  Os05g0317700                                     82.0    2e-14   
ref|XP_006382811.1|  serine-threonine kinase family protein           82.0    2e-14   
ref|XP_007216899.1|  hypothetical protein PRUPE_ppa019630mg           82.0    2e-14   
ref|XP_009601576.1|  PREDICTED: receptor-like protein kinase ANXUR1   82.0    2e-14   
ref|XP_002512044.1|  conserved hypothetical protein                   82.0    2e-14   
ref|XP_006405669.1|  hypothetical protein EUTSA_v10028032mg           81.3    2e-14   
ref|XP_010435806.1|  PREDICTED: putative receptor-like protein ki...  82.0    2e-14   
gb|EAY97520.1|  hypothetical protein OsI_19448                        81.6    3e-14   
emb|CDO99857.1|  unnamed protein product                              82.0    3e-14   
gb|KJB28740.1|  hypothetical protein B456_005G067100                  81.6    3e-14   
gb|KFK33634.1|  hypothetical protein AALP_AA5G039100                  81.3    3e-14   
ref|XP_008230912.1|  PREDICTED: receptor-like protein kinase FERONIA  81.6    3e-14   
ref|XP_007151356.1|  hypothetical protein PHAVU_004G039600g           81.6    3e-14   
ref|XP_010242732.1|  PREDICTED: receptor-like protein kinase ANXUR1   81.6    3e-14   
gb|EAY95324.1|  hypothetical protein OsI_17151                        80.5    4e-14   
ref|XP_008655515.1|  PREDICTED: receptor-like protein kinase ANXUR1   81.3    4e-14   
ref|NP_001053685.1|  Os04g0586500                                     80.5    4e-14   
ref|XP_008341790.1|  PREDICTED: receptor-like protein kinase FERONIA  81.3    4e-14   
gb|KHN07117.1|  Receptor-like protein kinase FERONIA                  81.3    4e-14   
ref|XP_007151348.1|  hypothetical protein PHAVU_004G038800g           81.3    4e-14   
ref|XP_004306059.2|  PREDICTED: receptor-like protein kinase FERO...  81.3    4e-14   
ref|XP_008230911.1|  PREDICTED: receptor-like protein kinase FERONIA  81.3    5e-14   
gb|KHN37917.1|  Putative receptor-like protein kinase                 78.6    5e-14   
ref|XP_009360627.1|  PREDICTED: receptor-like protein kinase FERONIA  80.9    5e-14   
ref|XP_011467877.1|  PREDICTED: receptor-like protein kinase FERO...  80.9    5e-14   
ref|XP_008668826.1|  PREDICTED: receptor-like protein kinase FERONIA  80.9    5e-14   
ref|XP_006388667.1|  hypothetical protein POPTR_0125s00210g           80.9    5e-14   
ref|XP_009785956.1|  PREDICTED: receptor-like protein kinase ANXUR1   80.9    6e-14   
ref|XP_006285704.1|  hypothetical protein CARUB_v10007175mg           80.9    6e-14   
ref|XP_011019995.1|  PREDICTED: receptor-like protein kinase ANXUR1   80.9    6e-14   
gb|EMT17367.1|  Receptor-like protein kinase FERONIA                  80.5    6e-14   
ref|XP_008379440.1|  PREDICTED: receptor-like protein kinase FERONIA  80.9    6e-14   
gb|KDP27915.1|  hypothetical protein JCGZ_18995                       80.5    6e-14   
ref|XP_006408164.1|  hypothetical protein EUTSA_v10020050mg           80.5    7e-14   
ref|XP_004962463.1|  PREDICTED: receptor-like protein kinase FERO...  80.1    9e-14   
gb|KHN07113.1|  Receptor-like protein kinase FERONIA                  80.1    9e-14   
ref|XP_003552594.2|  PREDICTED: receptor-like protein kinase FERO...  80.1    1e-13   
ref|XP_010660596.1|  PREDICTED: receptor-like protein kinase FERONIA  80.1    1e-13   
tpg|DAA53962.1|  TPA: putative receptor-like protein kinase famil...  80.1    1e-13   
ref|NP_001055180.1|  Os05g0317900                                     79.7    1e-13   
ref|XP_004967845.1|  PREDICTED: receptor-like protein kinase FERO...  79.7    1e-13   
gb|EEE63232.1|  hypothetical protein OsJ_18042                        79.7    1e-13   
ref|XP_007032808.1|  Malectin/receptor-like protein kinase family...  79.7    1e-13   
ref|XP_009365907.1|  PREDICTED: receptor-like protein kinase FERONIA  79.7    1e-13   
gb|EEC78971.1|  hypothetical protein OsI_19445                        79.7    1e-13   
ref|XP_002531275.1|  ATP binding protein, putative                    79.7    1e-13   
emb|CDO98765.1|  unnamed protein product                              79.7    1e-13   
ref|XP_007035799.1|  Malectin/receptor-like protein kinase family...  79.7    1e-13   
ref|XP_009140101.1|  PREDICTED: probable receptor-like protein ki...  79.3    1e-13   
ref|XP_010485852.1|  PREDICTED: receptor-like protein kinase ANXUR1   79.3    2e-13   
ref|XP_009372136.1|  PREDICTED: receptor-like protein kinase ANXUR2   78.6    2e-13   
ref|XP_008390575.1|  PREDICTED: receptor-like protein kinase ANXUR1   78.6    2e-13   
ref|XP_007147183.1|  hypothetical protein PHAVU_006G102700g           79.3    2e-13   
ref|XP_010258502.1|  PREDICTED: receptor-like protein kinase ANXUR1   79.3    2e-13   
gb|KJB10587.1|  hypothetical protein B456_001G208900                  78.6    2e-13   
ref|XP_006604845.1|  PREDICTED: receptor-like protein kinase ANXU...  79.0    2e-13   
ref|XP_010417830.1|  PREDICTED: receptor-like protein kinase ANXUR1   79.0    2e-13   
ref|XP_008388681.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  79.0    2e-13   
ref|XP_010463957.1|  PREDICTED: receptor-like protein kinase ANXUR1   79.0    2e-13   
ref|XP_004306058.2|  PREDICTED: receptor-like protein kinase FERONIA  79.0    3e-13   
ref|XP_007216888.1|  hypothetical protein PRUPE_ppa020589mg           78.6    3e-13   
gb|KHN31469.1|  Receptor-like protein kinase ANXUR2                   78.6    3e-13   
ref|XP_008218280.1|  PREDICTED: receptor-like protein kinase ANXUR1   78.6    3e-13   
ref|XP_003520841.1|  PREDICTED: receptor-like protein kinase ANXU...  78.6    3e-13   
ref|XP_010097803.1|  Receptor-like protein kinase FERONIA             78.6    3e-13   
ref|XP_006646366.1|  PREDICTED: receptor-like protein kinase FERO...  78.6    3e-13   
gb|KEH25125.1|  carbohydrate-binding protein of the ER protein        78.2    4e-13   
ref|XP_007032798.1|  Malectin/receptor protein kinase family protein  78.6    4e-13   
ref|XP_007139451.1|  hypothetical protein PHAVU_008G030700g           78.2    4e-13   
ref|XP_008367132.1|  PREDICTED: uncharacterized protein LOC103430767  78.6    4e-13   
ref|XP_007208221.1|  hypothetical protein PRUPE_ppa018611mg           78.2    4e-13   
ref|XP_008231022.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  78.2    4e-13   
ref|XP_010099331.1|  hypothetical protein L484_018194                 77.4    4e-13   
emb|CDO99859.1|  unnamed protein product                              78.2    5e-13   
ref|XP_004304217.1|  PREDICTED: receptor-like protein kinase FERONIA  77.8    5e-13   
ref|XP_004156217.1|  PREDICTED: receptor-like protein kinase FERO...  77.8    5e-13   
ref|XP_010435808.1|  PREDICTED: probable receptor-like protein ki...  77.8    5e-13   
ref|XP_010450844.1|  PREDICTED: putative receptor-like protein ki...  77.8    5e-13   
ref|XP_009373821.1|  PREDICTED: putative receptor-like protein ki...  77.8    6e-13   
ref|XP_004141590.1|  PREDICTED: receptor-like protein kinase FERO...  77.8    6e-13   
dbj|BAD81103.1|  putative receptor-like protein kinase                77.4    7e-13   
ref|XP_008370712.1|  PREDICTED: receptor-like protein kinase ANXUR2   77.4    7e-13   
ref|XP_007032813.1|  Malectin/receptor-like protein kinase family...  76.6    8e-13   
ref|XP_009365908.1|  PREDICTED: receptor-like protein kinase FERONIA  77.4    8e-13   
ref|XP_008245502.1|  PREDICTED: receptor-like protein kinase FERONIA  76.3    8e-13   
gb|KDP27273.1|  hypothetical protein JCGZ_19972                       77.4    8e-13   
ref|XP_009365903.1|  PREDICTED: receptor-like protein kinase FERO...  77.4    8e-13   
gb|EYU44212.1|  hypothetical protein MIMGU_mgv1a020440mg              77.0    8e-13   
ref|XP_009365902.1|  PREDICTED: receptor-like protein kinase FERO...  77.4    8e-13   
ref|XP_006482014.1|  PREDICTED: receptor-like protein kinase FERO...  77.0    8e-13   
ref|XP_010099322.1|  Receptor-like protein kinase FERONIA             77.0    9e-13   
ref|XP_006482013.1|  PREDICTED: receptor-like protein kinase FERO...  77.0    9e-13   
ref|XP_009365906.1|  PREDICTED: receptor-like protein kinase FERO...  77.0    9e-13   
gb|EEC70333.1|  hypothetical protein OsI_01206                        77.4    9e-13   
gb|EEE54251.1|  hypothetical protein OsJ_01126                        77.4    1e-12   
ref|XP_010097778.1|  Receptor-like protein kinase                     77.0    1e-12   
gb|EMS57312.1|  Receptor-like protein kinase FERONIA                  76.6    1e-12   
ref|XP_007151354.1|  hypothetical protein PHAVU_004G039400g           76.6    1e-12   
ref|XP_008231018.1|  PREDICTED: receptor-like protein kinase FERONIA  76.6    1e-12   
ref|XP_004495609.1|  PREDICTED: receptor-like protein kinase ANXU...  76.6    1e-12   
ref|XP_009364589.1|  PREDICTED: receptor-like protein kinase ANXUR2   76.3    2e-12   
ref|XP_004494710.1|  PREDICTED: receptor-like protein kinase ANXU...  76.3    2e-12   
ref|XP_010519979.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  76.3    2e-12   
ref|XP_007151359.1|  hypothetical protein PHAVU_004G039900g           76.3    2e-12   
gb|KGN52521.1|  hypothetical protein Csa_5G640550                     75.9    2e-12   
ref|XP_010550913.1|  PREDICTED: receptor-like protein kinase ANXUR2   76.3    2e-12   
ref|XP_006286236.1|  hypothetical protein CARUB_v10007805mg           76.3    2e-12   
ref|XP_006395027.1|  hypothetical protein EUTSA_v10003639mg           76.3    2e-12   
emb|CDX88223.1|  BnaA06g28140D                                        75.9    2e-12   
ref|XP_010099328.1|  Receptor-like protein kinase FERONIA             75.9    3e-12   
ref|XP_004306062.1|  PREDICTED: receptor-like protein kinase FERONIA  75.5    3e-12   
ref|XP_003535370.1|  PREDICTED: receptor-like protein kinase ANXU...  75.5    3e-12   
gb|KHN14703.1|  Receptor-like protein kinase ANXUR1                   75.1    3e-12   
gb|KHN18064.1|  Receptor-like protein kinase ANXUR2                   75.5    3e-12   
ref|XP_008230910.1|  PREDICTED: receptor-like protein kinase FERONIA  75.5    3e-12   
ref|XP_007151369.1|  hypothetical protein PHAVU_004G040900g           75.5    3e-12   
ref|XP_007151363.1|  hypothetical protein PHAVU_004G040300g           75.5    3e-12   
ref|XP_006606937.1|  PREDICTED: receptor-like protein kinase ANXU...  75.5    3e-12   
ref|XP_006430474.1|  hypothetical protein CICLE_v10011056mg           75.5    3e-12   
ref|XP_010025009.1|  PREDICTED: receptor-like protein kinase ANXUR1   75.1    4e-12   
ref|XP_008230415.1|  PREDICTED: receptor-like protein kinase FERONIA  75.1    4e-12   
ref|XP_010034409.1|  PREDICTED: receptor-like protein kinase FERONIA  75.1    4e-12   
ref|XP_008348094.1|  PREDICTED: receptor-like protein kinase FERONIA  75.1    5e-12   
ref|XP_004507304.1|  PREDICTED: receptor-like protein kinase FERO...  75.1    5e-12   
gb|EYU40180.1|  hypothetical protein MIMGU_mgv1a022123mg              74.7    5e-12   
gb|KGN53791.1|  hypothetical protein Csa_4G129570                     74.7    5e-12   
ref|XP_004154761.1|  PREDICTED: receptor-like protein kinase FERO...  74.7    5e-12   
ref|XP_006289663.1|  hypothetical protein CARUB_v10003221mg           74.7    5e-12   
ref|XP_007153475.1|  hypothetical protein PHAVU_003G038700g           74.7    5e-12   
ref|XP_006354974.1|  PREDICTED: receptor-like protein kinase FERO...  75.1    5e-12   
ref|XP_009151130.1|  PREDICTED: probable receptor-like protein ki...  74.7    5e-12   
ref|XP_007139448.1|  hypothetical protein PHAVU_008G030400g           74.7    6e-12   
gb|EMS60533.1|  Receptor-like protein kinase FERONIA                  74.7    6e-12   
gb|KJB10624.1|  hypothetical protein B456_001G211900                  74.7    6e-12   
emb|CDO99867.1|  unnamed protein product                              74.7    6e-12   
gb|EYU38426.1|  hypothetical protein MIMGU_mgv1a026661mg              73.6    6e-12   
ref|XP_008459392.1|  PREDICTED: receptor-like protein kinase FERO...  74.3    7e-12   
ref|XP_010034429.1|  PREDICTED: receptor-like protein kinase FERONIA  74.3    7e-12   
ref|XP_008459393.1|  PREDICTED: receptor-like protein kinase FERO...  74.3    7e-12   
ref|XP_004137259.1|  PREDICTED: probable receptor-like protein ki...  74.7    7e-12   
ref|XP_002874434.1|  kinase family protein                            74.3    7e-12   
gb|KCW52041.1|  hypothetical protein EUGRSUZ_J01482                   74.3    7e-12   
ref|XP_010435807.1|  PREDICTED: putative receptor-like protein ki...  74.3    7e-12   
gb|EYU20621.1|  hypothetical protein MIMGU_mgv1a018196mg              74.3    8e-12   
ref|XP_007151355.1|  hypothetical protein PHAVU_004G039500g           74.3    8e-12   
ref|XP_008223395.1|  PREDICTED: receptor-like protein kinase ANXUR2   73.6    8e-12   
ref|XP_007144836.1|  hypothetical protein PHAVU_007G188300g           74.3    8e-12   
ref|XP_010034437.1|  PREDICTED: receptor-like protein kinase FERONIA  74.3    8e-12   
ref|XP_007139452.1|  hypothetical protein PHAVU_008G030800g           73.9    9e-12   
ref|XP_011099165.1|  PREDICTED: receptor-like protein kinase FERONIA  74.3    9e-12   
ref|XP_006354973.1|  PREDICTED: receptor-like protein kinase FERO...  74.3    1e-11   



>ref|XP_011095158.1| PREDICTED: receptor-like protein kinase FERONIA [Sesamum indicum]
Length=883

 Score =   177 bits (448),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            DYVPTDKI LNCGGP   TD D RKWT+D+GSKF L T KSST++A  QKPSVP+VP+MT
Sbjct  29   DYVPTDKIFLNCGGPPDSTDSDGRKWTSDIGSKFALSTTKSSTATAAIQKPSVPEVPYMT  88

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR FQSEFTYSFPVASGRKF+RLYFYPASYNGLNA+N++FSV  G YT
Sbjct  89   ARIFQSEFTYSFPVASGRKFVRLYFYPASYNGLNASNAIFSVTSGAYT  136



>ref|XP_006341293.1| PREDICTED: receptor-like protein kinase FERONIA-like [Solanum 
tuberosum]
Length=889

 Score =   171 bits (432),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 93/108 (86%), Gaps = 1/108 (1%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            +YVP D ILLNCGGPD + D D RKW TD+GSK++LG+ KSSTS A  QKPSVPQVPFM+
Sbjct  29   NYVPGDDILLNCGGPDNLPDADGRKWGTDIGSKYMLGS-KSSTSDAADQKPSVPQVPFMS  87

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR FQSEFTYSFPVASGRKF+RLYFYP+SYN LNATN++F+V  G+YT
Sbjct  88   ARVFQSEFTYSFPVASGRKFVRLYFYPSSYNKLNATNAIFNVASGQYT  135



>ref|XP_004246282.1| PREDICTED: receptor-like protein kinase FERONIA [Solanum lycopersicum]
Length=889

 Score =   169 bits (427),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 91/108 (84%), Gaps = 1/108 (1%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            +YVP D ILLNCGGPD + D D RKW TDVGSK++LG+ KSS S A  QKPSVPQVPFM+
Sbjct  29   NYVPGDDILLNCGGPDNLPDADGRKWGTDVGSKYMLGS-KSSISDAADQKPSVPQVPFMS  87

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR FQSEFTYSFPVASGRKF+RLYFYP+SYN LNATN++F V  G+YT
Sbjct  88   ARVFQSEFTYSFPVASGRKFVRLYFYPSSYNKLNATNAIFDVASGQYT  135



>ref|XP_009791682.1| PREDICTED: receptor-like protein kinase FERONIA [Nicotiana sylvestris]
Length=888

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 88/105 (84%), Gaps = 1/105 (1%)
 Frame = +1

Query  313  PTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTART  492
            P D ILLNCGGPDG+ D D RKW +D+GS +L G+ KSSTS A  QKPSVPQVPFM+AR 
Sbjct  32   PGDDILLNCGGPDGLKDADGRKWGSDIGSTYLKGS-KSSTSDAADQKPSVPQVPFMSARV  90

Query  493  FQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            F+SEFTYSFPVA GRKF+RLYFYP+SYN LNATN++FSV VG Y+
Sbjct  91   FESEFTYSFPVAPGRKFVRLYFYPSSYNKLNATNAIFSVTVGPYS  135



>ref|XP_009617447.1| PREDICTED: receptor-like protein kinase FERONIA [Nicotiana tomentosiformis]
Length=888

 Score =   160 bits (405),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 87/105 (83%), Gaps = 1/105 (1%)
 Frame = +1

Query  313  PTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTART  492
            P D ILLNCGGPDG+ D D RKW +D+GS +L G+ KSSTS A  QKPSVPQVPFM+AR 
Sbjct  32   PGDDILLNCGGPDGLKDADGRKWGSDIGSTYLKGS-KSSTSDAADQKPSVPQVPFMSARV  90

Query  493  FQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            FQSEFTYSFPVA GRKF+RLYFYP+SYN LNATN++F V VG Y+
Sbjct  91   FQSEFTYSFPVAPGRKFVRLYFYPSSYNKLNATNAIFGVTVGPYS  135



>gb|KJB38065.1| hypothetical protein B456_006G235700 [Gossypium raimondii]
Length=895

 Score =   159 bits (401),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            DYVPT+KILLNCG    ++D DNRKWT DVGSKFL GT KS TS A SQ P+VP+VP+MT
Sbjct  31   DYVPTEKILLNCGEKSDLSDNDNRKWTPDVGSKFLTGTEKSVTSPASSQDPAVPEVPYMT  90

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR F S FTYSFPV SGRKF+RLYFY  SY+G NATN++FSV  G YT
Sbjct  91   ARVFHSNFTYSFPVVSGRKFVRLYFYANSYDGQNATNALFSVTSGSYT  138



>gb|KJB29840.1| hypothetical protein B456_005G120700 [Gossypium raimondii]
Length=889

 Score =   157 bits (397),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            DYVPT+KILLNCGG    TD DNRKWT DVGSKFLLG+G S  S A +Q P+VP+VP+MT
Sbjct  27   DYVPTEKILLNCGGKSEATDNDNRKWTPDVGSKFLLGSGNSVASQAATQDPAVPEVPYMT  86

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR F+S FTYSFPV  GRKFLRLYFY  SY+G  A N++FSV  G YT
Sbjct  87   ARVFRSNFTYSFPVVPGRKFLRLYFYANSYDGQIAANALFSVTCGSYT  134



>ref|XP_009337788.1| PREDICTED: receptor-like protein kinase FERONIA [Pyrus x bretschneideri]
Length=893

 Score =   156 bits (394),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            +YVP+DKI LNCGGP   TD D  KWT+DVGSKF  G   S+TS+A +Q P+VP VPFMT
Sbjct  26   NYVPSDKIFLNCGGPPETTDSDGLKWTSDVGSKFASGGNSSTTSAAATQDPAVPDVPFMT  85

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR F+S+FTY FPVASGRKF+RLYFYPASY+GLNA+N+VF+V    YT
Sbjct  86   ARVFRSKFTYKFPVASGRKFIRLYFYPASYSGLNASNAVFTVTAQSYT  133



>ref|XP_010244547.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=890

 Score =   156 bits (394),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  486
            Y PTDKILLNCG     TD D RKWT DVGSKF      + TS+A +Q PSVP VP+MTA
Sbjct  32   YFPTDKILLNCGAAQESTDSDGRKWTGDVGSKFAPAAANTLTSTAATQDPSVPDVPYMTA  91

Query  487  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            R F+SEFTYSFPVASGRKF+RLYFYPASYNGLNA+N++FSV  G YT
Sbjct  92   RVFRSEFTYSFPVASGRKFVRLYFYPASYNGLNASNALFSVTSGPYT  138



>ref|XP_009115840.1| PREDICTED: receptor-like protein kinase FERONIA [Brassica rapa]
 ref|XP_009115841.1| PREDICTED: receptor-like protein kinase FERONIA [Brassica rapa]
Length=895

 Score =   155 bits (393),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            DY PTDKILLNCGG   +TD DNR W  DV SKFL  +G S TS A +Q PSVP VP+M+
Sbjct  30   DYTPTDKILLNCGGSSDLTDTDNRTWIQDVKSKFLSSSGDSKTSPAATQDPSVPTVPYMS  89

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR F+S FTYSFPVASGRKF+RLYFYP SY+GLNATNS+FS+  G YT
Sbjct  90   ARIFRSPFTYSFPVASGRKFVRLYFYPNSYDGLNATNSLFSLSSGPYT  137



>ref|XP_006403905.1| hypothetical protein EUTSA_v10010114mg [Eutrema salsugineum]
 gb|ESQ45358.1| hypothetical protein EUTSA_v10010114mg [Eutrema salsugineum]
Length=891

 Score =   155 bits (393),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            DY PTDKILLNCGG     D DNR W  DV SKFL  +G S TS A +Q PSVP+VPFMT
Sbjct  30   DYTPTDKILLNCGGSSDSADTDNRTWIPDVKSKFLSSSGDSKTSPAATQDPSVPEVPFMT  89

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR F+S FTY+FPVA+GRKF+RLYFYP SY+GLNATNS+FSV  G YT
Sbjct  90   ARIFRSPFTYTFPVAAGRKFVRLYFYPNSYDGLNATNSLFSVSSGSYT  137



>emb|CDX78012.1| BnaA09g32070D [Brassica napus]
Length=851

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            DY PTDKILLNCGG   +TD DNR W  DV SKFL  +G S TS A +Q PSVP VP+M+
Sbjct  30   DYTPTDKILLNCGGSSDLTDTDNRTWIPDVKSKFLSSSGDSKTSPAATQDPSVPTVPYMS  89

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR F+S FTYSFPVASGRKF+RLYFYP SY+GLNATNS+FS+  G YT
Sbjct  90   ARIFRSPFTYSFPVASGRKFVRLYFYPNSYDGLNATNSLFSLSSGPYT  137



>emb|CDX73714.1| BnaC08g22890D [Brassica napus]
Length=1176

 Score =   155 bits (393),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            DY PTDKILLNCGG   +TD DNR W  DV SKFL  +G S TS A +Q PSVP VP+M+
Sbjct  342  DYTPTDKILLNCGGSSDLTDTDNRTWIPDVKSKFLSSSGDSKTSPAATQDPSVPTVPYMS  401

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR F+S FTYSFPVASGRKF+RLYFYP SY+GLNATNS+FS+  G YT
Sbjct  402  ARIFRSPFTYSFPVASGRKFVRLYFYPNSYDGLNATNSLFSLSSGPYT  449



>gb|AHZ44752.1| CrRLK1L-like protein, partial [Platanus x acerifolia]
Length=774

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            D++P DKILLNCG      D D RKWTTD+GSKF+     S  SSA +Q PSVP VPFMT
Sbjct  71   DFIPGDKILLNCGSAPETVDTDGRKWTTDIGSKFVAAGDNSLASSAATQDPSVPDVPFMT  130

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR F+SEFTYSFPV SGRKF+RLYFYPASY+ LNA+N++FSV  G YT
Sbjct  131  ARIFRSEFTYSFPVVSGRKFVRLYFYPASYDNLNASNAIFSVTSGSYT  178



>ref|XP_009370899.1| PREDICTED: receptor-like protein kinase FERONIA [Pyrus x bretschneideri]
 ref|XP_009370904.1| PREDICTED: receptor-like protein kinase FERONIA [Pyrus x bretschneideri]
Length=892

 Score =   154 bits (389),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            +YVP+DKI LNCGGP   TD +  KWT+DVGSKF  G   S+TS A +Q P+VP+VPFMT
Sbjct  26   NYVPSDKIFLNCGGPAETTDSNGVKWTSDVGSKFASGGNSSTTSPAATQDPAVPEVPFMT  85

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR F+S+FTY FPVASGRKF+RLYFYPASY GLNA+N+VF+V    YT
Sbjct  86   ARVFRSQFTYKFPVASGRKFIRLYFYPASYAGLNASNAVFTVAAQSYT  133



>ref|XP_010252026.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=886

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  486
            YVPTDKILLNCG     TD D +KWT DVGSKF   T  +  S+A +Q PSVP VP+MTA
Sbjct  29   YVPTDKILLNCGSTSETTDTDGQKWTGDVGSKFAPSTANTLISTAATQGPSVPDVPYMTA  88

Query  487  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            R F+SEFTY+FPVASGRKF+RLYFYPASYNGLNA+N++FSV  G YT
Sbjct  89   RIFRSEFTYTFPVASGRKFVRLYFYPASYNGLNASNALFSVTSGPYT  135



>emb|CDX90645.1| BnaA03g41360D [Brassica napus]
Length=814

 Score =   153 bits (386),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            DY PTDKILLNCGG   +TD DNR W  DV SKFL  +G S TS A +Q PSVP+VP+MT
Sbjct  30   DYTPTDKILLNCGGSSDLTDTDNRTWIPDVKSKFLSSSGDSKTSPAATQDPSVPEVPYMT  89

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVG  618
            AR F+S FTYSFPVASGRKF+RLYF+P SY+GLNAT S+FSV +G
Sbjct  90   ARIFRSPFTYSFPVASGRKFVRLYFHPNSYDGLNATTSLFSVTLG  134



>gb|ABT18097.1| FERONIA receptor-like kinase [Cardamine flexuosa]
Length=891

 Score =   153 bits (386),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            DY PTDKILLNCGG   + D DNR W +DV SKFL  +G S TS A +Q PSV QVP+MT
Sbjct  30   DYSPTDKILLNCGGVSDLVDTDNRTWISDVKSKFLSSSGDSKTSPAATQDPSVSQVPYMT  89

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR F+S FTYSFPVA+GRKF+RLYFYP +Y+GLNATN++FSV  G YT
Sbjct  90   ARVFRSPFTYSFPVAAGRKFVRLYFYPNTYDGLNATNALFSVSFGPYT  137



>gb|EPS73118.1| hypothetical protein M569_01631 [Genlisea aurea]
Length=873

 Score =   152 bits (385),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 86/109 (79%), Gaps = 1/109 (1%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSS-TSSADSQKPSVPQVPFM  480
            +YVPTDKI LNCGGP   TD DN+ WTTDV SKFL     +S T+SA  Q P VPQVP+M
Sbjct  27   NYVPTDKIFLNCGGPAVSTDSDNQTWTTDVLSKFLSSPSTNSLTASASVQLPDVPQVPYM  86

Query  481  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            TAR F+SEFTYSFP+A+GRKFLRLYFYPASY GLNA+N +FSV  G YT
Sbjct  87   TARIFKSEFTYSFPLAAGRKFLRLYFYPASYAGLNASNGIFSVSSGGYT  135



>ref|XP_009136619.1| PREDICTED: receptor-like protein kinase FERONIA [Brassica rapa]
Length=896

 Score =   152 bits (385),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            DY PTDKILLNCGG   +TD DNR W  DV SKFL  +G S TS A +Q PSVP+VP+MT
Sbjct  29   DYTPTDKILLNCGGSSDLTDTDNRTWIPDVKSKFLSSSGDSKTSPAATQDPSVPEVPYMT  88

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVG  618
            AR F+S FTYSFPVASGRKF+RLYF+P SY+GLNAT S+FSV +G
Sbjct  89   ARIFRSPFTYSFPVASGRKFVRLYFHPNSYDGLNATTSLFSVTLG  133



>emb|CDY29022.1| BnaC07g32280D [Brassica napus]
Length=803

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 83/105 (79%), Gaps = 0/105 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            DY PTDKILLNCGG   +TD DNR W  DV SK    +G S TS A +Q PSVP+VP+MT
Sbjct  27   DYTPTDKILLNCGGSSDLTDTDNRTWIPDVKSKLFSSSGDSKTSPAATQDPSVPEVPYMT  86

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVG  618
            AR F+S FTYSFPVASGRKF+RLYF+P SY+GLNATNS+FSV +G
Sbjct  87   ARIFRSPFTYSFPVASGRKFVRLYFHPNSYDGLNATNSLFSVTLG  131



>ref|XP_008244701.1| PREDICTED: receptor-like protein kinase FERONIA [Prunus mume]
Length=891

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 86/108 (80%), Gaps = 1/108 (1%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            +Y+P+DKI LNCGGP   TD D  KWT+D+GSKF  G   S+TS A +Q P+VP+VPFMT
Sbjct  28   NYIPSDKIFLNCGGPPETTDSDGLKWTSDIGSKFASG-ANSTTSPAATQDPAVPEVPFMT  86

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR F+SE+TY FPVASGRKF+RLYFYPASY GLNA+N++F+V    YT
Sbjct  87   ARVFRSEYTYKFPVASGRKFIRLYFYPASYAGLNASNAIFTVTAQSYT  134



>gb|ABT18095.1| FERONIA receptor-like kinase [Cardamine flexuosa]
Length=891

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            DY PTDKILLNCGG   + D DNR W +DV SKFL  +G S TS A +Q PSV QVP+MT
Sbjct  30   DYSPTDKILLNCGGASDLVDTDNRTWISDVKSKFLSSSGDSKTSPAATQDPSVSQVPYMT  89

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR F+S FTY FPVA+GRKF+RLYFYP +Y+GLNATN++FSV  G YT
Sbjct  90   ARVFRSPFTYPFPVAAGRKFVRLYFYPNTYDGLNATNALFSVSFGPYT  137



>emb|CDP06378.1| unnamed protein product [Coffea canephora]
Length=889

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            +YVPTDKILL+CGGP   TD D RKW +D+GSKF L +  SS   A  QKPSVPQVP+M 
Sbjct  29   NYVPTDKILLSCGGPSQSTDIDGRKWYSDIGSKFALASSNSSVFPAAVQKPSVPQVPYMN  88

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEY  624
            AR FQS +TY FPVA GRKF+RLYFYP SY GLNA+N++FSV  G +
Sbjct  89   ARIFQSNYTYRFPVAPGRKFIRLYFYPTSYGGLNASNAIFSVTAGRF  135



>gb|EYU42039.1| hypothetical protein MIMGU_mgv1a001343mg [Erythranthe guttata]
Length=837

 Score =   150 bits (378),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            DYV TD+  LNCGGP   TD D RKWT+D+GSKF L T KSSTS A +QKPSVP+VP+MT
Sbjct  27   DYVATDQFFLNCGGPPDSTDPDGRKWTSDIGSKFALSTTKSSTSPAATQKPSVPEVPYMT  86

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNAT  591
            AR FQSEFTYSFPVA GRKF+RLYFYPA+YN LN T
Sbjct  87   ARIFQSEFTYSFPVAPGRKFVRLYFYPATYNVLNVT  122



>ref|XP_010431249.1| PREDICTED: receptor-like protein kinase FERONIA [Camelina sativa]
Length=490

 Score =   147 bits (371),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 85/109 (78%), Gaps = 1/109 (1%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLG-TGKSSTSSADSQKPSVPQVPFM  480
            DY PT+KILLNCGG   + D DNR W +DV SKFL   +G S TS A +Q PSVP+VP+M
Sbjct  29   DYSPTEKILLNCGGASDLVDTDNRTWISDVKSKFLSSPSGDSKTSPALTQDPSVPEVPYM  88

Query  481  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            TAR F+S FTY+FPVASGRKF+RLYFYP SY+ LNATNS+FSV  G YT
Sbjct  89   TARVFRSPFTYTFPVASGRKFVRLYFYPNSYDSLNATNSLFSVSSGPYT  137



>ref|XP_010252025.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=886

 Score =   150 bits (378),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  486
            YVPTDKILLNCG     TD D +KW+ DVGSKFL  +  + TS A +Q PSVP+VP+MTA
Sbjct  29   YVPTDKILLNCGAASETTDTDGQKWSGDVGSKFLPSSDNTLTSRAATQGPSVPEVPYMTA  88

Query  487  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            R F SEFTY+FPV SGRKF+RLYFYP SYNGLN +N++FSV  G YT
Sbjct  89   RIFHSEFTYTFPVTSGRKFVRLYFYPTSYNGLNESNALFSVTSGPYT  135



>ref|XP_008370279.1| PREDICTED: receptor-like protein kinase FERONIA [Malus domestica]
Length=891

 Score =   150 bits (378),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            +YVP+DKI LNCGGP   TD    KWT+DVGSKF  G   S+TS A +Q P+VP+VPFMT
Sbjct  26   NYVPSDKIFLNCGGPAETTDSXGVKWTSDVGSKFASGGNSSTTSPAATQDPAVPEVPFMT  85

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR F+S+FTY FPVASGRKF+RLYFYPASY  LNA+N+VF+V    YT
Sbjct  86   ARVFRSQFTYKFPVASGRKFIRLYFYPASYAELNASNAVFTVTAQSYT  133



>ref|XP_007208402.1| hypothetical protein PRUPE_ppa001164mg [Prunus persica]
 gb|EMJ09601.1| hypothetical protein PRUPE_ppa001164mg [Prunus persica]
Length=891

 Score =   150 bits (378),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 86/108 (80%), Gaps = 1/108 (1%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            +Y+P+DKI LNCGGP   TD +  KWT+D+GSKF  G   S+TS A +Q P+VP+VPFMT
Sbjct  28   NYIPSDKIFLNCGGPPETTDSNGLKWTSDIGSKFASG-ANSTTSPAATQDPAVPEVPFMT  86

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR F+SE+TY FPVASGRKF+RLYFYPASY GLNA+N++F+V    YT
Sbjct  87   ARVFRSEYTYKFPVASGRKFIRLYFYPASYAGLNASNAIFTVTAQSYT  134



>gb|KDO64141.1| hypothetical protein CISIN_1g036624mg [Citrus sinensis]
Length=893

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            DY+P+++ILLNCG    ++D D R WT D+GSKFLL T  S+TS A +Q PS P +P+MT
Sbjct  29   DYIPSEQILLNCGESSILSDDDKRSWTPDIGSKFLLSTKDSTTSKAATQDPSTPTIPYMT  88

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR F+SEFTYSFPV +GRKF+RLYFYP SYN LNAT+++FSV  G YT
Sbjct  89   ARVFRSEFTYSFPVVAGRKFVRLYFYPNSYNRLNATDALFSVSTGPYT  136



>ref|XP_007033491.1| Malectin/receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY04417.1| Malectin/receptor-like protein kinase family protein [Theobroma 
cacao]
Length=892

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 86/109 (79%), Gaps = 1/109 (1%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSST-SSADSQKPSVPQVPFM  480
            DYVPT+KILLNCG    +TD DNRKWT DVGSKFL+G G +S  S A +Q P+VP+VP++
Sbjct  28   DYVPTEKILLNCGEKSELTDDDNRKWTPDVGSKFLVGGGTNSVPSQAATQDPAVPEVPYL  87

Query  481  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            TAR F S FTYSFPV +GRKF+RLYF+  SY+G NATN++FSV  G YT
Sbjct  88   TARVFLSNFTYSFPVVAGRKFVRLYFHANSYDGQNATNALFSVTCGSYT  136



>gb|KJB71482.1| hypothetical protein B456_011G124900 [Gossypium raimondii]
Length=893

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            DYVPT+KILLNCG    +TD DNRKWT D GSKFL+GTG S  S A +Q P+VP+VP++T
Sbjct  31   DYVPTEKILLNCGEKSELTDNDNRKWTPDFGSKFLVGTGNSVISRAATQDPAVPEVPYLT  90

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR F+S FTYSFPV +GRKF+RLYFY  SY+  N++N++FSV  G YT
Sbjct  91   ARVFRSNFTYSFPVVAGRKFVRLYFYANSYDDRNSSNALFSVTSGSYT  138



>ref|XP_006429617.1| hypothetical protein CICLE_v10011034mg [Citrus clementina]
 ref|XP_006481221.1| PREDICTED: receptor-like protein kinase FERONIA-like [Citrus 
sinensis]
 gb|ESR42857.1| hypothetical protein CICLE_v10011034mg [Citrus clementina]
Length=895

 Score =   148 bits (373),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            DY+P+++ILLNCG    ++D D R WT D+GSKFLL T  S+TS A +Q PS P +P+MT
Sbjct  31   DYIPSEQILLNCGESSILSDDDKRSWTPDIGSKFLLSTKDSTTSKAATQDPSTPTIPYMT  90

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR F+SEFTYSFPV +GRKF+RLYFYP SYN LNAT+++FSV  G +T
Sbjct  91   ARVFRSEFTYSFPVVAGRKFVRLYFYPNSYNRLNATDALFSVSTGPFT  138



>emb|CDY33271.1| BnaA01g19380D [Brassica napus]
Length=856

 Score =   147 bits (371),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            DY PTD  LLNCGG   + D DNR W  DV SKFL  +  S TS A +Q PSVP VP+MT
Sbjct  27   DYSPTDNFLLNCGGSSDLPDTDNRTWIPDVKSKFLSSSADSKTSPAATQDPSVPDVPYMT  86

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR F+S FTYSFPV+SGRKF+RL+FYP SY+GLNATNS+FSV +G YT
Sbjct  87   ARIFRSPFTYSFPVSSGRKFVRLHFYPNSYDGLNATNSLFSVSLGSYT  134



>ref|XP_010426729.1| PREDICTED: receptor-like protein kinase FERONIA [Camelina sativa]
Length=894

 Score =   147 bits (372),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 85/109 (78%), Gaps = 1/109 (1%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLG-TGKSSTSSADSQKPSVPQVPFM  480
            DY PT+KILLNCGG   + D DNR W +DV SKFL   +G S TS A +Q PSVP+VP+M
Sbjct  29   DYSPTEKILLNCGGASDLVDTDNRTWISDVKSKFLSSPSGDSKTSPALTQDPSVPEVPYM  88

Query  481  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            TAR F+S FTY+FPVASGRKF+RLYFYP SY+ LNATNS+FSV  G YT
Sbjct  89   TARVFRSPFTYTFPVASGRKFVRLYFYPNSYDSLNATNSLFSVSSGPYT  137



>ref|XP_002528705.1| kinase, putative [Ricinus communis]
 gb|EEF33694.1| kinase, putative [Ricinus communis]
Length=891

 Score =   147 bits (371),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            +YVPTDKILL+CG      D D +KWT D  SKFLL +  S+ SSA +Q P+V Q+PFMT
Sbjct  26   NYVPTDKILLDCGATSDNADDDGQKWTADKNSKFLLSSDNSTISSAATQDPAVSQIPFMT  85

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR F S FTYSFP+A+GRKF+RLYFYPASY+GLNA++++FSV  G YT
Sbjct  86   ARVFHSNFTYSFPLAAGRKFVRLYFYPASYSGLNASDALFSVTAGSYT  133



>ref|XP_009148931.1| PREDICTED: receptor-like protein kinase FERONIA [Brassica rapa]
Length=899

 Score =   147 bits (370),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            DY PTD  LLNCGG   + D DNR W  DV SKFL  +  S TS A +Q PSVP VP+MT
Sbjct  31   DYSPTDNFLLNCGGSSDLPDTDNRTWIPDVKSKFLSSSADSKTSPAATQDPSVPDVPYMT  90

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR F+S FTYSFPV+SGRKF+RL+FYP SY+GLNATNS+FSV +G YT
Sbjct  91   ARIFRSPFTYSFPVSSGRKFVRLHFYPNSYDGLNATNSLFSVSLGSYT  138



>ref|XP_004492579.1| PREDICTED: receptor-like protein kinase FERONIA-like [Cicer arietinum]
Length=896

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            D+ PTDKILLNCGGP   +D D R+WTTD GSKF   TGKS+TS A +Q P+VPQVPFMT
Sbjct  28   DFKPTDKILLNCGGPAVSSDPDGREWTTDNGSKFGSLTGKSTTSQAAAQDPAVPQVPFMT  87

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR FQS++TYSFPVASG KFLRLYFY ASY+GLN +++ F V    Y+
Sbjct  88   ARIFQSQYTYSFPVASGWKFLRLYFYAASYSGLNVSDARFGVTSQSYS  135



>ref|XP_010503851.1| PREDICTED: receptor-like protein kinase FERONIA [Camelina sativa]
Length=895

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 84/109 (77%), Gaps = 1/109 (1%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLG-TGKSSTSSADSQKPSVPQVPFM  480
            DY PT+KILLNCGG   + D D R W  DV SKFL   +G S TS A +Q PSVP+VP+M
Sbjct  30   DYSPTEKILLNCGGASDLEDTDKRTWIPDVKSKFLSSPSGDSKTSPALTQDPSVPEVPYM  89

Query  481  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            TAR F+S FTY+FPVASGRKF+RLYFYP SY+GLNATNS+FSV  G YT
Sbjct  90   TARVFRSPFTYTFPVASGRKFVRLYFYPNSYDGLNATNSLFSVSSGPYT  138



>ref|XP_010515573.1| PREDICTED: receptor-like protein kinase FERONIA [Camelina sativa]
Length=896

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 84/109 (77%), Gaps = 1/109 (1%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLG-TGKSSTSSADSQKPSVPQVPFM  480
            DY PT+KILLNCGG   + D D R W  DV SKFL   +G S TS A +Q PSVP+VP+M
Sbjct  31   DYSPTEKILLNCGGASDLDDADKRTWIPDVKSKFLSSPSGDSKTSPALTQDPSVPEVPYM  90

Query  481  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            TAR F+S FTY+FPVASGRKF+RLYFYP SY+GLNATNS+FSV  G YT
Sbjct  91   TARVFRSPFTYTFPVASGRKFVRLYFYPNSYDGLNATNSLFSVSSGPYT  139



>gb|KEH32083.1| feronia receptor-like kinase [Medicago truncatula]
Length=701

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            D+ PTDKILLNCGGP   TD D R+WTTD GSKF     KS+TS A +Q P+VPQ+PFMT
Sbjct  31   DFKPTDKILLNCGGPAVSTDPDGREWTTDNGSKFGSSAVKSTTSQAATQDPAVPQIPFMT  90

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR FQS +TYSFPVASG KFLRLYFY ASY GLNA+++ F V    YT
Sbjct  91   ARVFQSPYTYSFPVASGWKFLRLYFYSASYGGLNASDARFGVTAQSYT  138



>emb|CDY16299.1| BnaC01g23340D [Brassica napus]
Length=866

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            DY PTD  LLNCGG   + D DNR W  DV SKFL  +  S TS A +Q PSVP VP+MT
Sbjct  31   DYSPTDNFLLNCGGSSDLPDTDNRTWIPDVKSKFLSSSADSKTSPAATQDPSVPDVPYMT  90

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR F+S FTYSFPVA+GRKF+R +FYP SY+GLNATNS+FSV +G YT
Sbjct  91   ARIFRSPFTYSFPVAAGRKFVRFHFYPNSYDGLNATNSLFSVSLGSYT  138



>gb|ABT18094.1| FERONIA receptor-like kinase [Brassica oleracea]
Length=895

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            DY PTD   LNCGG   + D DNR W  DV SKFL  +  S TS A +Q PSVP VP+MT
Sbjct  29   DYSPTDNFFLNCGGSSDLPDTDNRTWIPDVKSKFLSSSADSKTSPAATQDPSVPDVPYMT  88

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR F+S FTYSFPVA+GRKF+RL+FYP SY+GLNATNS+FSV +G YT
Sbjct  89   ARIFRSPFTYSFPVAAGRKFVRLHFYPNSYDGLNATNSLFSVSLGSYT  136



>gb|KEH23293.1| feronia receptor-like kinase [Medicago truncatula]
Length=899

 Score =   145 bits (365),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            D+ PTDKILLNCGGP   TD D R+WTTD GSKF     KS+TS A +Q P+VPQ+PFMT
Sbjct  31   DFKPTDKILLNCGGPAVSTDPDGREWTTDNGSKFGSSAVKSTTSQAATQDPAVPQIPFMT  90

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR FQS +TYSFPVASG KFLRLYFY ASY GLNA+++ F V    YT
Sbjct  91   ARVFQSPYTYSFPVASGWKFLRLYFYSASYGGLNASDARFGVTAQSYT  138



>ref|XP_003609098.1| FERONIA receptor-like kinase [Medicago truncatula]
Length=893

 Score =   145 bits (365),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            D+ PTDKILLNCGGP   TD D R+WTTD GSKF     KS+TS A +Q P+VPQ+PFMT
Sbjct  25   DFKPTDKILLNCGGPAVSTDPDGREWTTDNGSKFGSSAVKSTTSQAATQDPAVPQIPFMT  84

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR FQS +TYSFPVASG KFLRLYFY ASY GLNA+++ F V    YT
Sbjct  85   ARVFQSPYTYSFPVASGWKFLRLYFYSASYGGLNASDARFGVTAQSYT  132



>ref|NP_001238686.1| receptor-like kinase [Glycine max]
 gb|ACM89482.1| receptor-like kinase [Glycine max]
Length=883

 Score =   145 bits (365),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            D+ P DKILLNCGGP   TD D R+WTTDVGSKF   T KS+TS A +Q P+VPQVP+MT
Sbjct  17   DFEPKDKILLNCGGPPSSTDTDGREWTTDVGSKFGSSTAKSATSPAATQDPAVPQVPYMT  76

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR F + +TY+FPVASG KFLRL+FY ASY+ LNA++++F+V    YT
Sbjct  77   ARVFHAPYTYTFPVASGWKFLRLHFYSASYSSLNASDALFAVAANSYT  124



>ref|XP_004302537.1| PREDICTED: receptor-like protein kinase FERONIA [Fragaria vesca 
subsp. vesca]
Length=883

 Score =   144 bits (364),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 83/108 (77%), Gaps = 1/108 (1%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            +Y+P+DKI LNCGGP   TD D +KWT+DVGSKF  G   S+TS A +Q PSVP+ PFMT
Sbjct  21   NYIPSDKIFLNCGGPQESTDADGQKWTSDVGSKFASG-ANSTTSPAATQDPSVPETPFMT  79

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR F S++TY FPVASGR F+RL FYPASY GLNA+ +VFSV V  YT
Sbjct  80   ARVFHSDYTYKFPVASGRIFVRLSFYPASYAGLNASGAVFSVMVESYT  127



>ref|XP_010529939.1| PREDICTED: receptor-like protein kinase FERONIA [Tarenaya hassleriana]
Length=892

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 80/108 (74%), Gaps = 0/108 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            D+ P DK LLNCG      D DNR W  DV SKFL  +G S  S A +Q PSVPQVP+MT
Sbjct  26   DFSPPDKFLLNCGESSEAFDTDNRTWIPDVKSKFLSSSGDSKASPASTQDPSVPQVPYMT  85

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR F+S FTYSFPVASGRKF+RLYFYP SY+GLNAT+++FSV  G YT
Sbjct  86   ARVFRSSFTYSFPVASGRKFVRLYFYPNSYDGLNATDALFSVSFGPYT  133



>gb|KHN29489.1| Receptor-like protein kinase FERONIA [Glycine soja]
Length=896

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            D+ PTDKILLNCGGP   TD D R+WTTD GSKF   T KS+TS A +Q P+VPQVP+MT
Sbjct  29   DFQPTDKILLNCGGPPSSTDTDGREWTTDNGSKFGSSTAKSATSPAATQDPAVPQVPYMT  88

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR F + +TY+FPVASG KFLRL+FY ASY+ LNA++++F+V    YT
Sbjct  89   ARVFHAPYTYTFPVASGWKFLRLHFYSASYSSLNASDALFAVAANSYT  136



>ref|NP_001237656.1| FERONIA receptor-like kinase precursor [Glycine max]
 gb|ACM89524.1| FERONIA receptor-like kinase [Glycine max]
Length=892

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            D+ PTDKILLNCGGP   TD D R+WTTD GSKF   T KS+TS A +Q P+VPQVP+MT
Sbjct  25   DFQPTDKILLNCGGPPSSTDTDGREWTTDNGSKFGSSTAKSATSPAATQDPAVPQVPYMT  84

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR F + +TY+FPVASG KFLRL+FY ASY+ LNA++++F+V    YT
Sbjct  85   ARVFHAPYTYTFPVASGWKFLRLHFYSASYSSLNASDALFAVAANSYT  132



>gb|KHN40613.1| Receptor-like protein kinase FERONIA [Glycine soja]
Length=894

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            D+ P DKILLNCGGP   TD D R+WTTDVGSKF   T KS+TS A +Q P+VPQVP+MT
Sbjct  28   DFEPKDKILLNCGGPPSSTDTDGREWTTDVGSKFGSSTAKSATSPAATQDPAVPQVPYMT  87

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR F + +TY+FPVASG KFLRL+FY ASY+ LNA++++F++    YT
Sbjct  88   ARVFHAPYTYTFPVASGWKFLRLHFYSASYSSLNASDALFAMAANSYT  135



>ref|XP_006290584.1| hypothetical protein CARUB_v10016673mg [Capsella rubella]
 gb|EOA23482.1| hypothetical protein CARUB_v10016673mg [Capsella rubella]
Length=892

 Score =   142 bits (358),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 85/109 (78%), Gaps = 1/109 (1%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSS-ADSQKPSVPQVPFM  480
            DY PT+KILLNCGG   + D DNR W +DV SKFL  +   S +S A +Q PSVP+VP+M
Sbjct  27   DYSPTEKILLNCGGASDLRDTDNRTWISDVKSKFLSSSSGDSKTSPALTQDPSVPEVPYM  86

Query  481  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            TAR F+S FTY+FPVASGRKF+RLYFYP SY+GLNATNS+FSV  G YT
Sbjct  87   TARVFRSPFTYTFPVASGRKFVRLYFYPNSYDGLNATNSLFSVSFGPYT  135



>ref|XP_002279218.3| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
Length=893

 Score =   142 bits (357),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            +YV TDKILLNCG     TD D   WTTD+GSKF++    S TS AD+Q PSVP VP+MT
Sbjct  27   NYVATDKILLNCGASSSTTDTDGLVWTTDIGSKFMVAAENSLTSEADTQDPSVPTVPYMT  86

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR  +SEF+Y FP+A GRKF+RLYFYPASY+ L+A++++FSV  G YT
Sbjct  87   ARISKSEFSYRFPLAMGRKFVRLYFYPASYSNLSASDALFSVTAGSYT  134



>ref|XP_004142677.1| PREDICTED: receptor-like protein kinase FERONIA-like [Cucumis 
sativus]
 ref|XP_004161706.1| PREDICTED: receptor-like protein kinase FERONIA-like [Cucumis 
sativus]
 gb|KGN54458.1| hypothetical protein Csa_4G334690 [Cucumis sativus]
Length=897

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            +Y+P D ILL+CGGP    D DNRKW TD  SKF+  TG SS S A +Q PSVP +PFMT
Sbjct  33   NYIPRDVILLDCGGPSTANDIDNRKWNTDDKSKFVPATGDSSVSKAATQDPSVPDIPFMT  92

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR F S FTYSFPVA  R F+RLYFYP+SY GL+A++++FSV    YT
Sbjct  93   ARVFSSSFTYSFPVAPSRLFVRLYFYPSSYGGLDASDALFSVSTQSYT  140



>gb|AAK59558.1| putative receptor-protein kinase [Arabidopsis thaliana]
Length=895

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 87/110 (79%), Gaps = 2/110 (2%)
 Frame = +1

Query  304  DYVPTDKILLNCGG-PDGVTDQDNRKWTTDVGSKFLLGTGKSSTSS-ADSQKPSVPQVPF  477
            DY PT+KILLNCGG    +TD DNR W +DV SKFL  + + S +S A +Q PSVP+VP+
Sbjct  29   DYSPTEKILLNCGGGASNLTDTDNRIWISDVKSKFLSSSSEDSKTSPALTQDPSVPEVPY  88

Query  478  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            MTAR F+S FTY+FPVASGRKF+RLYFYP SY+GLNATNS+FSV  G YT
Sbjct  89   MTARVFRSPFTYTFPVASGRKFVRLYFYPNSYDGLNATNSLFSVSFGPYT  138



>ref|NP_190723.1| receptor-like protein kinase FERONIA [Arabidopsis thaliana]
 sp|Q9SCZ4.1|FERON_ARATH RecName: Full=Receptor-like protein kinase FERONIA; AltName: 
Full=Protein SIRENE; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB63019.1| receptor-protein kinase-like protein [Arabidopsis thaliana]
 gb|AEE78805.1| receptor-like protein kinase FERONIA [Arabidopsis thaliana]
Length=895

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 87/110 (79%), Gaps = 2/110 (2%)
 Frame = +1

Query  304  DYVPTDKILLNCGG-PDGVTDQDNRKWTTDVGSKFLLGTGKSSTSS-ADSQKPSVPQVPF  477
            DY PT+KILLNCGG    +TD DNR W +DV SKFL  + + S +S A +Q PSVP+VP+
Sbjct  29   DYSPTEKILLNCGGGASNLTDTDNRIWISDVKSKFLSSSSEDSKTSPALTQDPSVPEVPY  88

Query  478  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            MTAR F+S FTY+FPVASGRKF+RLYFYP SY+GLNATNS+FSV  G YT
Sbjct  89   MTARVFRSPFTYTFPVASGRKFVRLYFYPNSYDGLNATNSLFSVSFGPYT  138



>gb|ABT18100.1| FERONIA receptor-like kinase [Arabidopsis thaliana]
Length=893

 Score =   139 bits (351),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 87/110 (79%), Gaps = 2/110 (2%)
 Frame = +1

Query  304  DYVPTDKILLNCGG-PDGVTDQDNRKWTTDVGSKFLLGTGKSSTSS-ADSQKPSVPQVPF  477
            DY PT+KILLNCGG    +TD DNR W +DV SKFL  + + S +S A +Q PSVP+VP+
Sbjct  27   DYSPTEKILLNCGGGASNLTDTDNRIWISDVKSKFLSSSSEDSKTSPALTQDPSVPEVPY  86

Query  478  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            MTAR F+S FTY+FPVASGRKF+RLYFYP SY+GLNATNS+FSV  G YT
Sbjct  87   MTARVFRSPFTYTFPVASGRKFVRLYFYPNSYDGLNATNSLFSVSFGPYT  136



>ref|XP_007140079.1| hypothetical protein PHAVU_008G082400g [Phaseolus vulgaris]
 gb|ESW12073.1| hypothetical protein PHAVU_008G082400g [Phaseolus vulgaris]
Length=898

 Score =   139 bits (350),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 83/109 (76%), Gaps = 1/109 (1%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSST-SSADSQKPSVPQVPFM  480
            D+ PTD ILL+CGGP   TD D R WTTDVGSKF   + KS+T S A +Q P+VPQVP+M
Sbjct  28   DFQPTDNILLDCGGPSSSTDTDGRVWTTDVGSKFDSSSAKSTTVSPAATQDPAVPQVPYM  87

Query  481  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            TAR F + FTY+FPVASG KFLRL+FYPASY+ LNA+++ F+V    YT
Sbjct  88   TARVFHAPFTYAFPVASGWKFLRLHFYPASYSNLNASDARFAVTANSYT  136



>ref|XP_010043538.1| PREDICTED: receptor-like protein kinase FERONIA [Eucalyptus grandis]
 ref|XP_010043545.1| PREDICTED: receptor-like protein kinase FERONIA [Eucalyptus grandis]
 gb|KCW88392.1| hypothetical protein EUGRSUZ_A00782 [Eucalyptus grandis]
Length=897

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            DY P D+ILL+CG     TD D + WT+++GSK    T  +  ++A +Q PSVPQVP+MT
Sbjct  31   DYKPADRILLDCGAASQTTDADGQVWTSEIGSKIPASTANAIMATAATQDPSVPQVPYMT  90

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR FQS FTYSFPVASGRKF+RLYFYP+ YN  NA+N++FSV    YT
Sbjct  91   ARIFQSNFTYSFPVASGRKFVRLYFYPSVYNTYNASNAIFSVSAEGYT  138



>ref|XP_010098025.1| Receptor-like protein kinase FERONIA [Morus notabilis]
 gb|EXB74408.1| Receptor-like protein kinase FERONIA [Morus notabilis]
Length=888

 Score =   136 bits (342),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 80/108 (74%), Gaps = 2/108 (2%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            +YVP ++I LNCGGP    + D +KWT+D GS +L    KS+TS A SQ PSV  +PFMT
Sbjct  30   NYVPAEQIFLNCGGP--TEEADGKKWTSDKGSLYLSKAAKSTTSEASSQDPSVSTIPFMT  87

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR FQS+FTYS  VA GRKF+RLYFYP+SY+GLNA+N+VF V    YT
Sbjct  88   ARVFQSDFTYSISVAPGRKFIRLYFYPSSYSGLNASNAVFDVTAQSYT  135



>gb|ABT18098.1| FERONIA receptor-like kinase [Cardamine flexuosa]
Length=892

 Score =   135 bits (341),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 82/108 (76%), Gaps = 1/108 (1%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            DY+PTDKILLNCG     +D D R W+ D  +KFL  +G S TS A +Q PSV ++P+MT
Sbjct  32   DYIPTDKILLNCGASSNSSDADKRAWSADNINKFL-SSGDSKTSPAATQDPSVSEIPYMT  90

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR  +S FTYSFPVA+GRKF+RLYFYP +Y+GLNAT+++FSV  G YT
Sbjct  91   ARVSRSPFTYSFPVATGRKFVRLYFYPNTYDGLNATDALFSVSFGPYT  138



>ref|XP_008463270.1| PREDICTED: receptor-like protein kinase FERONIA [Cucumis melo]
 ref|XP_008463271.1| PREDICTED: receptor-like protein kinase FERONIA [Cucumis melo]
 ref|XP_008463272.1| PREDICTED: receptor-like protein kinase FERONIA [Cucumis melo]
Length=897

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 78/108 (72%), Gaps = 0/108 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            +Y+P D ILL+CGGP    D D+RKW TD  SKF+   G S+ S A +Q PSVP +PFMT
Sbjct  33   NYIPRDVILLDCGGPSTANDIDSRKWNTDDKSKFVPAAGDSTVSKAATQDPSVPDIPFMT  92

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR F S FTYSFPVA  R F+RLYFYP+SY GL+A++++FSV    YT
Sbjct  93   ARVFSSNFTYSFPVAPSRLFVRLYFYPSSYGGLDASDALFSVSTQSYT  140



>ref|XP_002877809.1| hypothetical protein ARALYDRAFT_485507 [Arabidopsis lyrata subsp. 
lyrata]
 gb|ABT18096.1| FERONIA receptor-like kinase [Arabidopsis lyrata]
 gb|EFH54068.1| hypothetical protein ARALYDRAFT_485507 [Arabidopsis lyrata subsp. 
lyrata]
Length=891

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 85/109 (78%), Gaps = 1/109 (1%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSS-ADSQKPSVPQVPFM  480
            DY PT+KILLNCGG   + D DNR W +DV SKFL  +   S +S A +Q PSVP+VP+M
Sbjct  26   DYSPTEKILLNCGGASDLVDTDNRTWISDVKSKFLSSSSSDSKTSPALTQDPSVPEVPYM  85

Query  481  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            TAR F+S FTY+FPVASGRKF+RLYFYP SY+GLNATNS+FSV  G YT
Sbjct  86   TARVFRSPFTYTFPVASGRKFVRLYFYPNSYDGLNATNSLFSVSFGPYT  134



>ref|XP_002308259.1| kinase family protein [Populus trichocarpa]
 gb|EEE91782.1| kinase family protein [Populus trichocarpa]
Length=893

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            +YVPT+KILL+CG     +D D R WT+D GS FL  +  SST++A +Q PSVPQVP++T
Sbjct  26   NYVPTEKILLDCGANSDQSDSDGRDWTSDRGSSFLSSSTNSSTATASTQDPSVPQVPYLT  85

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR F+S FTYSFPV SGRKF+RLYFYP+SY+GLNA+N++FSV  G YT
Sbjct  86   ARIFRSSFTYSFPVVSGRKFIRLYFYPSSYSGLNASNALFSVTAGSYT  133



>ref|XP_002323088.2| kinase family protein [Populus trichocarpa]
 gb|EEF04849.2| kinase family protein [Populus trichocarpa]
Length=894

 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            +YVPT+K LL+CG    + D D R WT+D GS FL  +GKSST++A +Q P+VPQVP++T
Sbjct  29   NYVPTEKTLLDCGANSDLPDSDGRGWTSDKGSSFLSSSGKSSTATASTQDPAVPQVPYLT  88

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR FQS FTYSFPV SG KF+RLYFYP+SYNGLNA++++FSV  G YT
Sbjct  89   ARIFQSSFTYSFPVVSGHKFVRLYFYPSSYNGLNASDALFSVTAGSYT  136



>ref|XP_010553161.1| PREDICTED: receptor-like protein kinase FERONIA [Tarenaya hassleriana]
Length=852

 Score =   130 bits (326),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 73/107 (68%), Gaps = 1/107 (1%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            DY P DKI L+CG     TD D R+W  DV SKFL   G S  + A +Q P VPQVPFMT
Sbjct  34   DYSPIDKIFLSCGESSQRTDSDQRQWIPDVNSKFL-SPGSSKPAKAATQDPGVPQVPFMT  92

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEY  624
            AR F S FTYSFPV  GRKFLRLYFY  SY+ LNAT+++FSV  G Y
Sbjct  93   ARIFHSAFTYSFPVEPGRKFLRLYFYANSYDALNATDALFSVSSGPY  139



>ref|XP_011001679.1| PREDICTED: receptor-like protein kinase FERONIA [Populus euphratica]
Length=894

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            +YVPT+K LL+CG      D D R WT+D GS FL  +GKSST++A +Q P+VPQVP++T
Sbjct  29   NYVPTEKTLLDCGANSDRPDSDGRDWTSDKGSSFLSSSGKSSTATASTQDPAVPQVPYLT  88

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR FQS FTYSFPV SG KF+RLYFYP+SYNGLNA++++FSV  G YT
Sbjct  89   ARIFQSNFTYSFPVISGHKFVRLYFYPSSYNGLNASDALFSVTAGSYT  136



>ref|XP_007140062.1| hypothetical protein PHAVU_008G081000g [Phaseolus vulgaris]
 gb|ESW12056.1| hypothetical protein PHAVU_008G081000g [Phaseolus vulgaris]
Length=899

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 85/109 (78%), Gaps = 1/109 (1%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSS-ADSQKPSVPQVPFM  480
            D+ PTD ILL+CGGP   TD D R+WTTDVGSKF   + KS+T S A +Q P+VPQVP+M
Sbjct  28   DFQPTDNILLDCGGPPSSTDTDGREWTTDVGSKFDSSSSKSTTVSPAATQDPAVPQVPYM  87

Query  481  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            TAR F + FTY+FPVASG KFLRL+FYPASY+ LNA+N++F+V    YT
Sbjct  88   TARVFHAPFTYAFPVASGWKFLRLHFYPASYSNLNASNALFAVTANSYT  136



>ref|XP_011016728.1| PREDICTED: receptor-like protein kinase FERONIA [Populus euphratica]
Length=893

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            +YVPT+KILL+CG      D D R WT+D GS FL  +  SST++A +Q PSVPQVP++T
Sbjct  26   NYVPTEKILLDCGANSDQPDSDGRDWTSDRGSSFLSSSANSSTATASTQDPSVPQVPYLT  85

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR F+S FTYSFPV SGRKF+RLYFYP+SY+GLNA+N++FSV  G YT
Sbjct  86   ARIFRSNFTYSFPVVSGRKFIRLYFYPSSYSGLNASNALFSVTSGSYT  133



>gb|ABT18099.1| FERONIA receptor-like kinase [Cardamine flexuosa]
Length=898

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 77/108 (71%), Gaps = 0/108 (0%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            +Y PTD+ILLNCG     +D D R W+ D  +KFL  +G S TS A +Q  SV ++P+MT
Sbjct  32   NYTPTDQILLNCGASSNSSDADKRAWSADDNNKFLSSSGDSKTSPAATQGSSVSEIPYMT  91

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR  QS FTYSF VA+GRK +RLYFYP++Y+GLNAT+ +FS   G YT
Sbjct  92   ARISQSPFTYSFSVAAGRKIVRLYFYPSTYDGLNATDGLFSFSFGPYT  139



>ref|XP_010683454.1| PREDICTED: receptor-like protein kinase FERONIA [Beta vulgaris 
subsp. vulgaris]
Length=881

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 74/108 (69%), Gaps = 1/108 (1%)
 Frame = +1

Query  307  YVPTDKILLNCGGPD-GVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            Y P D ILLNCG  D   TD D R W +D GSKF+  T  SS ++A +Q P V +VP+MT
Sbjct  23   YTPHDNILLNCGASDRQSTDVDGRNWNSDDGSKFMSTTRGSSMATAATQAPDVGEVPYMT  82

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR F S FTYS  VA GRKFLRLYFYP +Y+G N+TN +FSV  G +T
Sbjct  83   ARIFDSNFTYSIAVAPGRKFLRLYFYPNTYSGRNSTNGIFSVTAGPFT  130



>ref|XP_004499818.1| PREDICTED: receptor-like protein kinase FERONIA-like [Cicer arietinum]
Length=312

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 74/108 (69%), Gaps = 4/108 (4%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            ++ PT++ILLNCGG     D D R W+TD  S F  GTGKS+ S      P+VPQ+PFMT
Sbjct  23   NFKPTNEILLNCGGAS--LDLDGRSWSTDRASNF--GTGKSTMSEVAINDPAVPQIPFMT  78

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR F+S +TYSFPVASG  FLRLYFY ASY GLN +++ F V    YT
Sbjct  79   ARIFESPYTYSFPVASGWIFLRLYFYAASYPGLNISDARFGVTSQSYT  126



>ref|XP_004499646.1| PREDICTED: receptor-like protein kinase FERONIA-like [Cicer arietinum]
Length=1333

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 76/108 (70%), Gaps = 2/108 (2%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            D+ PTD+ILLNCGGP    D D R W+TD GS F  G+GKS+     +  P++PQVPFMT
Sbjct  18   DFKPTDEILLNCGGPILSLDLDGRSWSTDRGSNF--GSGKSNMLEVATNDPALPQVPFMT  75

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
             + F+S +TYSFPVASG  FLRLYFY ASY+GLN +++ F V    YT
Sbjct  76   VQIFESPYTYSFPVASGWIFLRLYFYLASYSGLNISDARFGVTSQSYT  123


 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 59/107 (55%), Gaps = 27/107 (25%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGV-------------------------TDQDNRKWTTDVGSKFL  408
            D+ PTD+ILLNCGGP  V                          D D R W+TD GS F 
Sbjct  633  DFKPTDEILLNCGGPILVWILMAVHGPLIVARILVLENPPCQSLDLDGRSWSTDRGSNF-  691

Query  409  LGTGKSSTSSADSQKPSVPQVPFMTARTFQSEFTYSFPVASGRKFLR  549
             G+GKS+ S   S  P+VPQ PFMTAR F+S +TYSFPVAS   FLR
Sbjct  692  -GSGKSTMSEVASNDPAVPQNPFMTARIFESPYTYSFPVASDWIFLR  737


 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 54/81 (67%), Gaps = 2/81 (2%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            D+ PT +ILL+CGGP    D D R  + D GS F  G+GKS+ S   +  P VPQVPFMT
Sbjct  354  DFKPTHEILLHCGGPILSLDLDGRSMSIDRGSNF--GSGKSTMSEVATNDPPVPQVPFMT  411

Query  484  ARTFQSEFTYSFPVASGRKFL  546
            AR F+S +TYSF VASG  FL
Sbjct  412  ARIFESPYTYSFLVASGWIFL  432



>ref|XP_004499645.1| PREDICTED: receptor-like protein kinase FERONIA-like [Cicer arietinum]
Length=415

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 70/98 (71%), Gaps = 2/98 (2%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            D+ PTD+ILLNCGGP    D D   W+TD GS F  G+GKS+ S   +  P+VPQVPF+T
Sbjct  295  DFKPTDEILLNCGGPILSLDLDGSSWSTDRGSNF--GSGKSTMSEVATNDPAVPQVPFVT  352

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNS  597
            AR  +S +TYSFPV SG  FL LYFYPASY+ LN +N+
Sbjct  353  ARIIESPYTYSFPVVSGWTFLMLYFYPASYSSLNISNT  390


 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +1

Query  445  SQKPSVPQVPFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLN  585
            +  P+VPQVPFMTAR F+S +TYSFPVASG  FL  +  P +  G N
Sbjct  25   TNDPAVPQVPFMTARIFESLYTYSFPVASGWIFLMNFSVPKTTLGSN  71



>ref|XP_004499647.1| PREDICTED: receptor-like protein kinase FERONIA-like [Cicer arietinum]
Length=575

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 75/108 (69%), Gaps = 2/108 (2%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            D+ PTD+ILL CGGP    + D R W+TD GS F   +GKS+ S   +  P VPQVPFMT
Sbjct  316  DFKPTDEILLYCGGPFLSLNLDGRSWSTDRGSNF--RSGKSTMSEVATNDPPVPQVPFMT  373

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            A+ F+S +TYSFPV SG  FLRLYFYPASY+GLN +++ F V    YT
Sbjct  374  AQIFESPYTYSFPVPSGWIFLRLYFYPASYSGLNISDTRFGVTSQSYT  421


 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 57/78 (73%), Gaps = 2/78 (3%)
 Frame = +1

Query  394  GSKFLLGTGKSSTSSADSQKPSVPQVPFMTARTFQSEFTYSFPVASGRKFLRLYFYPASY  573
            GS F  G+GKS+ S   +  P++PQVPFMTAR F+S +TYSF V+SG  FLRLYFYPASY
Sbjct  5    GSNF--GSGKSTMSVVATNDPAIPQVPFMTARIFESPYTYSFLVSSGWIFLRLYFYPASY  62

Query  574  NGLNATNSVFSVRVGEYT  627
            +GLN +++ F V    YT
Sbjct  63   SGLNISDARFGVTSQSYT  80



>ref|XP_004514615.1| PREDICTED: uncharacterized protein LOC101497599, partial [Cicer 
arietinum]
Length=1088

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 74/108 (69%), Gaps = 2/108 (2%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            D+  TD+ILLNCGGP    D D R W+TD GS F  G+GKS+ S   +   +VPQVPFMT
Sbjct  845  DFKHTDEILLNCGGPILSLDLDGRSWSTDRGSNF--GSGKSTMSEVATNDHAVPQVPFMT  902

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR F+S + YSF VA G  FLRLYFYPASY+GLN +++ F V    YT
Sbjct  903  ARIFESPYIYSFLVACGWIFLRLYFYPASYSGLNISDARFGVTSQSYT  950


 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 72/108 (67%), Gaps = 2/108 (2%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            D+ PTD+I+LNCG P    + D R W+T  GS F  G+GKS      +  P+VPQ PFMT
Sbjct  135  DFKPTDEIILNCGDPILSLNLDGRSWSTGCGSNF--GSGKSIMLEVATNDPAVPQNPFMT  192

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR F++ +TYSFPVASG  FLRLYFY ASY+ LN +++ F V    YT
Sbjct  193  ARIFETPYTYSFPVASGWIFLRLYFYMASYSSLNISDARFGVTSQFYT  240



>ref|XP_010667956.1| PREDICTED: receptor-like protein kinase FERONIA [Beta vulgaris 
subsp. vulgaris]
Length=412

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 72/109 (66%), Gaps = 1/109 (1%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDG-VTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFM  480
            D++  D ILLNCG  D   TD D R WT+D GSKFL  +  S  +SA ++ P V  +P+M
Sbjct  22   DFIAKDNILLNCGSFDAKTTDSDGRNWTSDNGSKFLQSSKGSFRASATTEAPDVGNIPYM  81

Query  481  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            +AR F S  TYSFPV+ GR FLRLYFYP  Y+  N+ N+VFSV  G YT
Sbjct  82   SARIFHSNATYSFPVSPGRIFLRLYFYPNVYSRSNSANAVFSVTAGPYT  130



>ref|XP_009118021.1| PREDICTED: receptor-like protein kinase FERONIA isoform X1 [Brassica 
rapa]
Length=808

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 74/104 (71%), Gaps = 1/104 (1%)
 Frame = +1

Query  319  DKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSV-PQVPFMTARTF  495
            +++LL CGG   V    NR W  D   K L  +G+S TS A +Q PSV P VP+M+AR F
Sbjct  22   EEVLLYCGGRVSVIGVGNRTWMPDQLFKCLSTSGESKTSPALTQDPSVVPSVPYMSARVF  81

Query  496  QSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            +S FTYSFPVASGRKFLRLYFYP SY+GLNAT S+FS+  G YT
Sbjct  82   KSPFTYSFPVASGRKFLRLYFYPNSYDGLNATLSLFSLSSGPYT  125



>ref|XP_008660180.1| PREDICTED: receptor-like protein kinase FERONIA [Zea mays]
 gb|AFW88468.1| putative receptor-like protein kinase family protein [Zea mays]
Length=888

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 69/104 (66%), Gaps = 0/104 (0%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  486
            +VP D ILL+CG      D D R WT D GSKF      +S +SA  Q PSVPQVP++TA
Sbjct  27   FVPRDDILLDCGAKGQGNDTDGRVWTGDAGSKFAPPDNLASVASASGQDPSVPQVPYLTA  86

Query  487  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVG  618
            R   S FTYSFP+  GRKFLRL+FYPA+Y+  +A + +FSV V 
Sbjct  87   RVSASPFTYSFPLGPGRKFLRLHFYPANYSNHDAADGLFSVSVA  130



>ref|XP_010246590.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=836

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 73/110 (66%), Gaps = 4/110 (4%)
 Frame = +1

Query  307  YVPTDKILLNCGGP-DGVTDQDNRKWTTDVGSKF--LLGTGKSSTSSADSQKPSVPQVPF  477
            Y P ++ILLNCG P   +  QD R WT DVGS F  +     S+TS+A  Q  SVPQ+P+
Sbjct  38   YTP-EEILLNCGSPLKSIQSQDGRNWTGDVGSNFAPMDRFNLSTTSTASQQDSSVPQIPY  96

Query  478  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            MTAR F S F Y+F V  G KF+RLYFYPASY+GL+ TN+ F V  G YT
Sbjct  97   MTARVFHSPFVYTFLVQPGPKFIRLYFYPASYSGLDKTNAFFDVYAGSYT  146



>ref|XP_010247768.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=876

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 74/110 (67%), Gaps = 3/110 (3%)
 Frame = +1

Query  307  YVPTDKILLNCGGP-DGVTDQDNRKWTTDVGSKF--LLGTGKSSTSSADSQKPSVPQVPF  477
            Y P+DKI LNCG P + +T QD R WT D+GSK   L      S+ S  +Q PSVPQ+P+
Sbjct  26   YDPSDKIFLNCGAPPEVITAQDGRNWTGDIGSKLAPLASLINISSISQATQGPSVPQIPY  85

Query  478  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            +TAR F + FTY FPV++G KF+RL+F+PASY   N T ++F V  G YT
Sbjct  86   LTARIFYAPFTYKFPVSAGPKFIRLHFFPASYAVANRTKALFDVSAGPYT  135



>ref|XP_004984479.1| PREDICTED: receptor-like protein kinase FERONIA-like [Setaria 
italica]
Length=884

 Score =   113 bits (283),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 71/107 (66%), Gaps = 0/107 (0%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  486
            +VP D ILL+CG      D D R W  D GSK+   +  ++ + A  Q PSVPQVP++TA
Sbjct  30   FVPRDDILLDCGAKGQGNDTDGRMWGGDEGSKYAPPSNLAAAAPASGQDPSVPQVPYLTA  89

Query  487  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            R   S FTYSFP+  GRKFLRL+FYPA+Y+  +A + VFSV VG+ T
Sbjct  90   RVSASPFTYSFPLGPGRKFLRLHFYPANYSNRDAADGVFSVSVGKLT  136



>ref|XP_002467915.1| hypothetical protein SORBIDRAFT_01g036260 [Sorghum bicolor]
 gb|EER94913.1| hypothetical protein SORBIDRAFT_01g036260 [Sorghum bicolor]
Length=895

 Score =   113 bits (282),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 69/104 (66%), Gaps = 0/104 (0%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  486
            +VP D ILL+CG      D D R WT D GSK+      +S +SA  Q PSVPQVP++TA
Sbjct  34   FVPRDDILLDCGAKGQGNDTDGRVWTGDAGSKYAPPDNLASVASASGQDPSVPQVPYLTA  93

Query  487  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVG  618
            R   S FTYSFP+  GRKFLRL+FYPA+Y+  +A + +FSV V 
Sbjct  94   RVSASPFTYSFPLGPGRKFLRLHFYPANYSNRDAADGLFSVSVA  137



>emb|CDP15786.1| unnamed protein product [Coffea canephora]
Length=517

 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 70/110 (64%), Gaps = 3/110 (3%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLG--TGKSSTSSADSQKPSVPQVPFM  480
            Y PTD IL+NCG     T  D R W  DVGSKFL       S   +A  Q  SV Q+PF+
Sbjct  26   YTPTDYILINCGSSSNATSTDGRHWEGDVGSKFLPNDVANISLADTATEQHSSVTQIPFL  85

Query  481  TARTFQSEFTYSFPVASGRKFLRLYFYPASY-NGLNATNSVFSVRVGEYT  627
            TAR  +S+F+Y+FPV+ G KFLRLYFYP+SY +GLN + S F+V    YT
Sbjct  86   TARIIRSQFSYTFPVSPGEKFLRLYFYPSSYSSGLNTSESFFTVTANNYT  135



>gb|KJB10568.1| hypothetical protein B456_001G207900 [Gossypium raimondii]
Length=794

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 66/107 (62%), Gaps = 2/107 (2%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  486
            Y+PTD ILLNCG     T  D R W  D     L     S +S+A  Q PSV QVP+MTA
Sbjct  24   YIPTDYILLNCGASSNTTSYDGRNWVAD--DDHLYANTSSFSSTASYQDPSVTQVPYMTA  81

Query  487  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            R F+ EFTY FP++ G KFLRLYFYP  Y GL+ T+S FSV    YT
Sbjct  82   RFFRGEFTYKFPLSPGPKFLRLYFYPNQYPGLDITSSFFSVAANNYT  128



>emb|CBI27305.3| unnamed protein product [Vitis vinifera]
Length=762

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 72/107 (67%), Gaps = 0/107 (0%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  486
            Y P + I L+CG     T  D RKWT+D GSKF+     +S+ S  S + SVP VP+MTA
Sbjct  139  YTPVENIALDCGSHGHSTAPDGRKWTSDTGSKFICSQLNASSISMASTQDSVPLVPYMTA  198

Query  487  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            R F S+FTY+FP++ G KFLRL+F+PASY+ L+ +++ FSV    YT
Sbjct  199  RIFTSQFTYAFPLSPGPKFLRLHFHPASYSNLDPSHAFFSVTANHYT  245



>ref|XP_002273707.2| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
Length=924

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 72/107 (67%), Gaps = 0/107 (0%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  486
            Y P + I L+CG     T  D RKWT+D GSKF+     +S+ S  S + SVP VP+MTA
Sbjct  95   YTPVENIALDCGSHGHSTAPDGRKWTSDTGSKFICSQLNASSISMASTQDSVPLVPYMTA  154

Query  487  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            R F S+FTY+FP++ G KFLRL+F+PASY+ L+ +++ FSV    YT
Sbjct  155  RIFTSQFTYAFPLSPGPKFLRLHFHPASYSNLDPSHAFFSVTANHYT  201



>gb|EMT17007.1| Receptor-like protein kinase FERONIA [Aegilops tauschii]
Length=890

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 71/103 (69%), Gaps = 2/103 (2%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  486
            +VP D ILL+CG      D D R+W  D GSK+     K +++SA +Q PSVPQVP++TA
Sbjct  38   FVPRDDILLDCGATGKGNDTDGRQWDGDAGSKY--APPKLASASAGAQDPSVPQVPYLTA  95

Query  487  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRV  615
            R   + FTYSFP+  GRKFLRL+FYPA+Y+  NA ++ FSV V
Sbjct  96   RVSAAPFTYSFPLGPGRKFLRLHFYPANYSNRNAADAFFSVSV  138



>tpg|DAA45217.1| TPA: putative receptor-like protein kinase family protein [Zea 
mays]
Length=886

 Score =   110 bits (274),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 67/104 (64%), Gaps = 0/104 (0%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  486
            +VP D I L+CG      D D R WT D GSK+      +S +SA  Q PSVPQVP++TA
Sbjct  27   FVPRDDIRLDCGAKGQGNDTDGRVWTGDAGSKYAPPDNLASVASASGQDPSVPQVPYLTA  86

Query  487  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVG  618
            R   S FTYSFP+  GRKFLRL+FYPA+Y   +A + +FSV V 
Sbjct  87   RVSASPFTYSFPLGPGRKFLRLHFYPANYTDRDAADGLFSVSVA  130



>ref|XP_009391670.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
Length=887

 Score =   110 bits (274),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 73/110 (66%), Gaps = 7/110 (6%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSK---FLLGTGKSSTSSADSQKPSVPQVPF  477
            YVP D ILL+CG     TD + R WT D GSK   FL G G     +A  Q  SVPQVP+
Sbjct  34   YVPRDHILLDCGASGQATDANGRSWTADSGSKYAPFLNGGG----FTAPLQDSSVPQVPY  89

Query  478  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            +TAR F S +TYSFP+ +GRKF+RL+FYP++Y+   A+++ FSV  G YT
Sbjct  90   LTARVFTSPYTYSFPLGAGRKFIRLHFYPSNYSNHAASDAFFSVTAGPYT  139



>emb|CDY26624.1| BnaA09g46530D [Brassica napus]
Length=1432

 Score =   110 bits (275),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 72/105 (69%), Gaps = 1/105 (1%)
 Frame = +1

Query  316  TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSV-PQVPFMTART  492
             +++LL C G   V    NR W  D   K L  +G+S TS A +Q  SV P VP+M+AR 
Sbjct  12   CEEVLLYCSGGVSVIGVGNRTWMPDQLFKCLSTSGESKTSPALTQDSSVVPSVPYMSARV  71

Query  493  FQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            F+S FTYSFPVASGRKFLRLYFYP SY+GLNAT S+FS+  G YT
Sbjct  72   FKSPFTYSFPVASGRKFLRLYFYPNSYDGLNATLSLFSLSSGPYT  116



>gb|EEC75192.1| hypothetical protein OsI_11431 [Oryza sativa Indica Group]
Length=893

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 72/103 (70%), Gaps = 2/103 (2%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  486
            +VP D ILL+CG      D D R WT D GSK+L      + ++A +Q PSVPQVP++TA
Sbjct  41   FVPRDNILLDCGATGQANDTDGRLWTGDTGSKYL--PANLAAAAATAQDPSVPQVPYLTA  98

Query  487  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRV  615
            R   + FTYSFPV +GRKFLRL+FYPA+Y+  NA +++FSV +
Sbjct  99   RFSAAPFTYSFPVGAGRKFLRLHFYPANYSNRNAADALFSVSI  141



>ref|NP_001050022.1| Os03g0333200 [Oryza sativa Japonica Group]
 gb|ABF95782.1| protein kinase family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11936.1| Os03g0333200 [Oryza sativa Japonica Group]
 gb|EEE59005.1| hypothetical protein OsJ_10725 [Oryza sativa Japonica Group]
Length=893

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 72/103 (70%), Gaps = 2/103 (2%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  486
            +VP D ILL+CG      D D R WT D GSK+L      + ++A +Q PSVPQVP++TA
Sbjct  41   FVPRDNILLDCGATGQANDTDGRLWTGDTGSKYL--PANLAAAAATAQDPSVPQVPYLTA  98

Query  487  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRV  615
            R   + FTYSFPV +GRKFLRL+FYPA+Y+  NA +++FSV +
Sbjct  99   RFSAAPFTYSFPVGAGRKFLRLHFYPANYSNRNAADALFSVSI  141



>gb|KDP27676.1| hypothetical protein JCGZ_20096 [Jatropha curcas]
Length=838

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 71/110 (65%), Gaps = 3/110 (3%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVG--SKFL-LGTGKSSTSSADSQKPSVPQVPF  477
            Y PTD+ILLN G PDG    D R W +D    SK+  + +  S+ S A  Q PSV QVP+
Sbjct  27   YTPTDRILLNSGAPDGEQSMDGRNWESDADQQSKYCPMNSETSAASKASQQDPSVTQVPY  86

Query  478  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            MTAR  +S++T  FPV+ G KF+RLYFYP SY+GL+ + S FSV    YT
Sbjct  87   MTARIIRSKYTCMFPVSMGPKFIRLYFYPNSYSGLDTSTSFFSVTANGYT  136



>ref|XP_010250338.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=790

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 69/111 (62%), Gaps = 4/111 (4%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFL----LGTGKSSTSSADSQKPSVPQVP  474
            Y P ++ILL+CG      D D R WT DVGS F       T   ST+ A  Q  SVP +P
Sbjct  39   YTPNEQILLDCGSSALKADGDGRNWTGDVGSDFATSARFNTSTVSTALALYQGSSVPLIP  98

Query  475  FMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            ++TAR F S FTY+FPVA+G K +RLYFYP SY+GL+ T + F V  G YT
Sbjct  99   YVTARIFHSPFTYTFPVAAGPKLIRLYFYPVSYSGLDKTKAFFDVSAGPYT  149



>ref|XP_008810848.1| PREDICTED: receptor-like protein kinase FERONIA [Phoenix dactylifera]
Length=891

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 72/110 (65%), Gaps = 7/110 (6%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKF---LLGTGKSSTSSADSQKPSVPQVPF  477
            YVP D ILLNCG      D D R WT D GSK+   + G G +    A SQ  SVPQVP+
Sbjct  35   YVPRDNILLNCGASGQDKDTDGRIWTADAGSKYAPSINGVGLT----ASSQDSSVPQVPY  90

Query  478  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            +TAR F S +TY+FP+ +GRKF+RLYFYP++Y+G  A+++ FSV     T
Sbjct  91   LTARFFTSPYTYTFPLGAGRKFIRLYFYPSNYSGHAASDAFFSVTAASST  140



>ref|XP_010938035.1| PREDICTED: receptor-like protein kinase FERONIA [Elaeis guineensis]
Length=891

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 73/110 (66%), Gaps = 7/110 (6%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKF---LLGTGKSSTSSADSQKPSVPQVPF  477
            YVP D ILLNCG      D D R WT D GSK+   + G G +    A SQ  SVPQVP+
Sbjct  36   YVPRDNILLNCGASGQDKDTDGRIWTGDAGSKYAPSINGVGLT----APSQDSSVPQVPY  91

Query  478  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            +TAR F S +TY+FP+ +GRKF+RLYFYP++Y+   A+++ FSV  G +T
Sbjct  92   LTARFFTSPYTYTFPLGAGRKFIRLYFYPSNYSDRAASDAFFSVTAGSHT  141



>ref|XP_011021061.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
FERONIA, partial [Populus euphratica]
Length=834

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 66/106 (62%), Gaps = 1/106 (1%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  486
            Y PTD ILLNCG    ++  D R W  D  SKF   +     S  DSQ PSV QVP+MTA
Sbjct  44   YSPTDLILLNCGASSNLSSPDGRSWDGDSQSKFA-ASNPPEASXCDSQDPSVNQVPYMTA  102

Query  487  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEY  624
            R F S+FTY+FPV  G KF+RLYFYPAS + L+ + S FS+    Y
Sbjct  103  RIFHSKFTYTFPVLPGPKFVRLYFYPASDSNLDISTSYFSISANNY  148



>gb|KDP24662.1| hypothetical protein JCGZ_26521 [Jatropha curcas]
Length=740

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 70/109 (64%), Gaps = 2/109 (2%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSS--ADSQKPSVPQVPFM  480
            Y P D ILLNCG     T  D R W +D  SKF   T ++S+ +  A  Q  SV QVP+M
Sbjct  44   YTPPDIILLNCGESSLTTSPDGRNWVSDARSKFGASTSQNSSFAFKASRQDTSVTQVPYM  103

Query  481  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            TAR F S+FTYSFPV+ G KF+RLYFYP +Y+ L+ + S FSV   +YT
Sbjct  104  TARIFLSKFTYSFPVSLGSKFVRLYFYPVAYSNLDISKSFFSVEANDYT  152



>gb|KDP27678.1| hypothetical protein JCGZ_20098 [Jatropha curcas]
Length=464

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 69/110 (63%), Gaps = 3/110 (3%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVG--SKFL-LGTGKSSTSSADSQKPSVPQVPF  477
            Y PTD ILLN G P G    D RKW  D    SK+  + +  SS S A  Q PSV QVP+
Sbjct  27   YTPTDLILLNSGAPSGDQSMDRRKWEGDADQQSKYCPMNSETSSASKASQQDPSVTQVPY  86

Query  478  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            MTAR  +S++T  FPV+ G KF+RLYFYP SY+GL+ + S FSV    YT
Sbjct  87   MTARIIRSKYTCMFPVSMGPKFIRLYFYPNSYSGLDTSTSFFSVTANGYT  136



>gb|KDP24658.1| hypothetical protein JCGZ_26517 [Jatropha curcas]
Length=264

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 67/109 (61%), Gaps = 2/109 (2%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTS--SADSQKPSVPQVPFM  480
            Y PT+  LLNCG     T  D R W +D  SKFL    + S+   +A  Q PSV QVPFM
Sbjct  44   YDPTEIFLLNCGASFDTTSLDGRNWVSDFNSKFLAFNSQISSLEYTASLQDPSVTQVPFM  103

Query  481  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            TAR  QS+F Y FPV+ G KF+RLYFYP + + L+ + S FSV   +YT
Sbjct  104  TARISQSKFIYVFPVSPGSKFVRLYFYPVASSNLDISKSFFSVEANDYT  152



>ref|XP_003557976.1| PREDICTED: receptor-like protein kinase FERONIA [Brachypodium 
distachyon]
Length=898

 Score =   107 bits (267),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 68/103 (66%), Gaps = 2/103 (2%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  486
            +VP D ILL+CG      D D R+W  D GSK+        ++ A +Q PSVPQVP++TA
Sbjct  45   FVPRDDILLDCGATGNGNDTDGREWGGDAGSKY--APANLGSAIAGAQDPSVPQVPYLTA  102

Query  487  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRV  615
            R   + FTYSFP+  GRKFLRL+FYPA+Y+  NA ++ FSV V
Sbjct  103  RVSAAPFTYSFPLGPGRKFLRLHFYPANYSNRNAADAFFSVTV  145



>ref|XP_006373375.1| hypothetical protein POPTR_0017s13190g, partial [Populus trichocarpa]
 gb|ERP51172.1| hypothetical protein POPTR_0017s13190g, partial [Populus trichocarpa]
Length=855

 Score =   107 bits (266),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 69/106 (65%), Gaps = 2/106 (2%)
 Frame = +1

Query  313  PTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTS--SADSQKPSVPQVPFMTA  486
            PTD ILLNCG    ++  D R W  D  SKF       ++S  +A +Q PSV QVP+MTA
Sbjct  33   PTDLILLNCGASSNLSSPDGRSWDGDSQSKFAASNPPETSSVFAASNQDPSVNQVPYMTA  92

Query  487  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEY  624
            R F S+FTY+FPV  G KF+RLYFYPASY+ L+ + S FS+   +Y
Sbjct  93   RIFHSKFTYTFPVLPGPKFVRLYFYPASYSNLDISTSYFSLSANDY  138



>ref|XP_006373380.1| hypothetical protein POPTR_0017s13240g [Populus trichocarpa]
 gb|ERP51177.1| hypothetical protein POPTR_0017s13240g [Populus trichocarpa]
Length=879

 Score =   107 bits (266),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 67/105 (64%), Gaps = 2/105 (2%)
 Frame = +1

Query  316  TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGT--GKSSTSSADSQKPSVPQVPFMTAR  489
            TD ILLNCG    ++  D R W  D  SKF        SS  +A +Q PSV QVP+MTAR
Sbjct  33   TDLILLNCGASSNLSSPDGRGWDGDSQSKFAASNPPEASSVFAASNQDPSVNQVPYMTAR  92

Query  490  TFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEY  624
             F S+FTY+FPV  G KF+RLYFYPASY+ L+ + S FS+R   Y
Sbjct  93   IFHSKFTYTFPVLPGPKFVRLYFYPASYSNLDISTSYFSIRANNY  137



>ref|XP_006373370.1| hypothetical protein POPTR_0017s13150g [Populus trichocarpa]
 gb|ERP51167.1| hypothetical protein POPTR_0017s13150g [Populus trichocarpa]
Length=855

 Score =   107 bits (266),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 66/108 (61%), Gaps = 2/108 (2%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGT--GKSSTSSADSQKPSVPQVPFM  480
            Y PTD ILLNCG    +   D R W  D  SKF        SS   A +Q PSV QVP+M
Sbjct  29   YSPTDLILLNCGASSNLLSPDGRGWDGDSQSKFAASNPPEASSVFEASNQDPSVNQVPYM  88

Query  481  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEY  624
            TAR F S+FTY+FPV  G KF+RLYFYPASY+ L+ + S FS+    Y
Sbjct  89   TARIFHSKFTYTFPVLPGPKFVRLYFYPASYSNLDISTSYFSLSANNY  136



>gb|EAY75971.1| hypothetical protein OsI_03893 [Oryza sativa Indica Group]
Length=859

 Score =   106 bits (265),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 69/103 (67%), Gaps = 2/103 (2%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  486
            +VP D ILL+CG      D D R W+ D GSK+        ++SA  Q PSVPQVP++TA
Sbjct  44   FVPRDDILLDCGATGKGNDTDGRVWSGDAGSKY--APASLGSASAAGQDPSVPQVPYLTA  101

Query  487  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRV  615
            R   + FTYSFP+ +GRKFLRL+FYPA+Y+  +A ++ FSV V
Sbjct  102  RVSAAPFTYSFPLGAGRKFLRLHFYPANYSSRDAADARFSVSV  144



>ref|NP_001044372.1| Os01g0769700 [Oryza sativa Japonica Group]
 dbj|BAB56062.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAD53342.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAF06286.1| Os01g0769700 [Oryza sativa Japonica Group]
 gb|EEE55446.1| hypothetical protein OsJ_03602 [Oryza sativa Japonica Group]
Length=896

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 69/103 (67%), Gaps = 2/103 (2%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  486
            +VP D ILL+CG      D D R W+ D GSK+        ++SA  Q PSVPQVP++TA
Sbjct  44   FVPRDDILLDCGATGKGNDTDGRVWSGDAGSKY--APASLGSASAAGQDPSVPQVPYLTA  101

Query  487  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRV  615
            R   + FTYSFP+ +GRKFLRL+FYPA+Y+  +A ++ FSV V
Sbjct  102  RVSAAPFTYSFPLGAGRKFLRLHFYPANYSSRDAADARFSVSV  144



>gb|EMT27425.1| Receptor-like protein kinase FERONIA [Aegilops tauschii]
Length=841

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 69/103 (67%), Gaps = 2/103 (2%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  486
            +VP D ILL+CG      D D R+W  D GSK+       +++ A +Q PSVPQVP++TA
Sbjct  22   FVPRDDILLDCGATGKGNDTDGREWRGDAGSKY--APPNLASADAGAQDPSVPQVPYLTA  79

Query  487  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRV  615
            R   + FTYSFP+  GRKFLRL+FYPA+Y+  +A ++ FSV V
Sbjct  80   RVSAAAFTYSFPLGPGRKFLRLHFYPANYSNRDAADAFFSVSV  122



>emb|CDP05401.1| unnamed protein product [Coffea canephora]
Length=888

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 67/108 (62%), Gaps = 1/108 (1%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  486
            Y PTD IL+NCG     T  D R W  D GSKF      S +S+  +  PSV   PF+TA
Sbjct  26   YSPTDYILINCGTSSNATSADGRNWYGDAGSKFSPNDMASISSAVTATAPSVSGAPFLTA  85

Query  487  RTFQSEFTYSFPVASGRKFLRLYFYPASYNG-LNATNSVFSVRVGEYT  627
            R  +S F+Y+FPV+ G+KF+RLYFYPASY+   NAT S F+V    YT
Sbjct  86   RIIRSNFSYTFPVSPGKKFVRLYFYPASYSSDFNATESFFAVMANNYT  133



>gb|KDP24661.1| hypothetical protein JCGZ_26520 [Jatropha curcas]
Length=978

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 69/111 (62%), Gaps = 6/111 (5%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSS----ADSQKPSVPQVP  474
            Y PT+ ILL+CG     T  D R W +D  SKF  G   S  SS    A  Q  SV QVP
Sbjct  205  YTPTEIILLSCGASSLTTSPDGRNWVSDARSKF--GASISLNSSFAFKASGQDTSVTQVP  262

Query  475  FMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            +MTAR F S+FTYSFPV+ G KF+RLYFYP +Y+ L+ + S FSV   +YT
Sbjct  263  YMTARIFLSKFTYSFPVSPGSKFVRLYFYPVAYSNLDISKSFFSVEANDYT  313



>ref|XP_009414253.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
 ref|XP_009414254.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
Length=887

 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 70/110 (64%), Gaps = 8/110 (7%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKF---LLGTGKSSTSSADSQKPSVPQVPF  477
            Y P D ILLNCG    VTD D   WT D GSK+   L G G     SA  Q PSV  VP+
Sbjct  33   YKPRDHILLNCGASGQVTDLDGLNWTGDAGSKYAPSLNGGG-----SAARQDPSVSSVPY  87

Query  478  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            +TAR F S +TY+FP+ +GR F+RL+FYP +Y+  +A+++ FSV  G YT
Sbjct  88   LTARVFTSPYTYTFPLGAGRIFIRLHFYPTTYSNHSASDAFFSVTSGHYT  137



>ref|XP_006373383.1| hypothetical protein POPTR_0017s13270g [Populus trichocarpa]
 gb|ERP51180.1| hypothetical protein POPTR_0017s13270g [Populus trichocarpa]
Length=829

 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 65/106 (61%), Gaps = 2/106 (2%)
 Frame = +1

Query  313  PTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGT--GKSSTSSADSQKPSVPQVPFMTA  486
            PTD ILLNCG    ++  D R W  D  SKF        SS   A +  PSV QVP+MTA
Sbjct  41   PTDLILLNCGASSNLSSPDGRSWDGDSQSKFAASKPPEASSVFEASNHDPSVNQVPYMTA  100

Query  487  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEY  624
            R F S+FTY+FPV  G KF+RLYFYPASY+ L+ + S FS+    Y
Sbjct  101  RIFHSKFTYTFPVLPGPKFVRLYFYPASYSNLDISTSYFSISANNY  146



>ref|XP_011009252.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
FERONIA [Populus euphratica]
Length=744

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 65/106 (61%), Gaps = 1/106 (1%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  486
            Y PTD ILLNCG    ++  D R W  D  SKF   +     SS   Q PSV QVP+MTA
Sbjct  44   YSPTDLILLNCGASSNLSSPDGRSWDGDSQSKFA-ASNPPEASSVTXQDPSVNQVPYMTA  102

Query  487  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEY  624
            R F S+FTY+FPV  G KF+RLYFY ASY+ L+ + S FS+    Y
Sbjct  103  RIFHSKFTYTFPVLPGPKFVRLYFYRASYSNLDISTSYFSLSANNY  148



>ref|XP_011009253.1| PREDICTED: receptor-like protein kinase FERONIA [Populus euphratica]
Length=833

 Score =   104 bits (259),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 67/108 (62%), Gaps = 2/108 (2%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGT--GKSSTSSADSQKPSVPQVPFM  480
            Y PTD+ILLNCG    +T  D R W  D  SKF        SS  +A +Q PS  QVP+M
Sbjct  45   YSPTDQILLNCGASSNLTSPDGRSWDGDSQSKFAASNPPEASSVFAASTQGPSGDQVPYM  104

Query  481  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEY  624
            TAR F S+FTY+FPV  G KF+RLYFY ASY+ L+ + S FS+    Y
Sbjct  105  TARIFHSKFTYTFPVLPGPKFVRLYFYRASYSNLDISTSYFSLSANNY  152



>ref|XP_008813242.1| PREDICTED: receptor-like protein kinase FERONIA [Phoenix dactylifera]
Length=894

 Score =   104 bits (259),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 70/110 (64%), Gaps = 7/110 (6%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKF---LLGTGKSSTSSADSQKPSVPQVPF  477
            Y   DKI LNCG    VTD D   WT D GSK+   + G G    +SA SQ  SVPQ+P+
Sbjct  38   YNARDKIFLNCGASGQVTDTDGLNWTGDAGSKYAPSINGAG----ASASSQDSSVPQIPY  93

Query  478  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            MTAR F S +TY+FP+  G KF+RLYFYP++Y+   A+++ FSV  G  T
Sbjct  94   MTARVFTSPYTYTFPLGPGGKFVRLYFYPSNYSSRAASDAFFSVTAGSNT  143



>ref|XP_007032827.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
 gb|EOY03753.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
Length=866

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 69/110 (63%), Gaps = 3/110 (3%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDV-GSKFLLGTGKSST--SSADSQKPSVPQVPF  477
            Y+PTD ILL+CG     T  D R W  D   SKF     ++++  S+A  Q  SV ++P+
Sbjct  27   YIPTDNILLDCGAQSNTTSSDGRSWEADSDHSKFSAPNRENASFVSTASQQDSSVTRIPY  86

Query  478  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            MTAR F+SEFTY+FPV+ G KFLRLYFY A + GLN T S FSV     T
Sbjct  87   MTARIFRSEFTYNFPVSPGPKFLRLYFYSAEFPGLNVTTSFFSVNANNST  136



>ref|XP_010921463.1| PREDICTED: receptor-like protein kinase ANXUR2 [Elaeis guineensis]
Length=870

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 68/103 (66%), Gaps = 2/103 (2%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMT  483
            Y P+D  L+NCG      D D RKW+ D  SKF + T  S+T++A SQ PS+P  VP+MT
Sbjct  26   YTPSDSFLVNCGSSSDAADADGRKWSADDTSKFGVSTKNSATATAASQDPSLPSAVPYMT  85

Query  484  ARTFQSEFTYSFPV-ASGRKFLRLYFYPASYNGLNATNSVFSV  609
            AR F SE TY F V  + R ++RL+FYP++YNGL   NS F+V
Sbjct  86   ARVFTSESTYKFSVNKTARHWIRLHFYPSTYNGLAPENSYFAV  128



>ref|XP_010921184.1| PREDICTED: receptor-like protein kinase FERONIA [Elaeis guineensis]
Length=895

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 69/107 (64%), Gaps = 1/107 (1%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  486
            Y P DKILLNCG      D D R WT D  SK+      ++ + A SQ  SVPQVP+++ 
Sbjct  35   YQPRDKILLNCGFSGTANDTDGRTWTGDAASKYAPSMNGAAVT-ATSQDSSVPQVPYLSG  93

Query  487  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            R F S +TY+FP+ +GRKF+RLYFYP++Y+   A+++ F+V    YT
Sbjct  94   RVFTSPYTYTFPLGAGRKFIRLYFYPSNYSTHAASDAFFTVTADSYT  140



>ref|XP_010660576.1| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
Length=875

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 67/113 (59%), Gaps = 9/113 (8%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSS------ADSQKPSVPQ  468
            Y PTD ILL+CG        D R W  D GSKF   +G S   +      A  Q PSV Q
Sbjct  35   YRPTDNILLDCGSSISKMSPDGRTWQGDQGSKF---SGTSDVQNSSSSSNAFRQDPSVEQ  91

Query  469  VPFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            VP+MTAR F S FTYSFPV+SG KF+R YFYP +Y+G N +   FSV  G YT
Sbjct  92   VPYMTARIFNSSFTYSFPVSSGPKFVRFYFYPTAYSGHNESEFFFSVTSGVYT  144



>ref|XP_007032832.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
 gb|EOY03758.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
Length=807

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 64/109 (59%), Gaps = 2/109 (2%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTS--SADSQKPSVPQVPFM  480
            Y PTD ILLNCG     T  D R W  D   K+     K+S+    A   +PSV +VP+M
Sbjct  26   YTPTDHILLNCGTSSNTTSLDGRNWVGDADYKYSSSISKASSFASKASDLEPSVTEVPYM  85

Query  481  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            TAR F  +FTY FPV+ G KFLRLYFYP  Y GL+ T S FSV    YT
Sbjct  86   TARIFHGKFTYKFPVSPGPKFLRLYFYPNEYPGLDITTSFFSVTANNYT  134



>ref|XP_010660578.1| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
Length=900

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 68/111 (61%), Gaps = 4/111 (4%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKF----LLGTGKSSTSSADSQKPSVPQVP  474
            Y PTD ILLNCG     T  D+R W  DVGSKF    LL     S  +  S   S+  VP
Sbjct  46   YYPTDIILLNCGSFGNSTALDDRGWMGDVGSKFTSSRLLNQTSVSAKAPHSHGFSIDPVP  105

Query  475  FMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            +MT R F+S+FTY+F V  G+KF+RL+FYPAS+ G   + + FSV+ G YT
Sbjct  106  YMTVRFFRSQFTYTFHVKPGQKFIRLHFYPASFPGFERSEAFFSVKAGPYT  156



>gb|EYU44219.1| hypothetical protein MIMGU_mgv11b013480mg [Erythranthe guttata]
Length=133

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 66/109 (61%), Gaps = 2/109 (2%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGK--SSTSSADSQKPSVPQVPFM  480
            ++ TD ILLNCG    + D  +R W+ D GS++        SS S A    PSV  VP+ 
Sbjct  24   FIATDFILLNCGASSSLNDSSSRIWSGDAGSRYAPPNADTVSSASKASRMLPSVAPVPYE  83

Query  481  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            TAR  QS FTYSFPV  GRKF+RLYFYP +Y+G + +N  FSV    +T
Sbjct  84   TARVLQSPFTYSFPVLEGRKFVRLYFYPDTYSGADTSNFFFSVTANSFT  132



>ref|XP_009412649.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412650.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
Length=889

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 69/107 (64%), Gaps = 1/107 (1%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  486
            YVP D ILLNCG      D D+R WT D GSK+      +  + A  Q  SVPQVP+MTA
Sbjct  33   YVPRDNILLNCGASGQAKDTDSRIWTGDTGSKYGPSLNVAGLT-ASLQDSSVPQVPYMTA  91

Query  487  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            R F S +T+SFP+  GRK++RL+FYP +Y+   A++++FSV    +T
Sbjct  92   RVFTSPYTFSFPLGPGRKYIRLHFYPCNYSTHAASDALFSVTSDSHT  138



>gb|KJB10595.1| hypothetical protein B456_001G210100 [Gossypium raimondii]
Length=868

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKF---LLGTGKSSTSSADSQKPSVPQVPF  477
            YVPTD I LNCG P  +   D R W  D  S F        KS    AD+Q  S   VP+
Sbjct  26   YVPTDNITLNCGAPTDLLANDGRSWAADKTSNFGPFESSHNKSQAYEADTQDGS-ETVPY  84

Query  478  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            MTAR  +SEF Y+FPV SG+KF+RLYF+PASY G + + + FSV+ G +T
Sbjct  85   MTARVSRSEFKYTFPVTSGQKFVRLYFHPASYEGNDRSKAFFSVKAGSFT  134



>emb|CAN77538.1| hypothetical protein VITISV_025026 [Vitis vinifera]
Length=853

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 67/113 (59%), Gaps = 9/113 (8%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSS------ADSQKPSVPQ  468
            Y PTD ILL+CG        D R W  D GSKF   +G S   +      A  Q PSV Q
Sbjct  27   YRPTDNILLDCGSSINTKSPDGRTWQGDQGSKF---SGTSDVQNSSSSSKAFRQDPSVDQ  83

Query  469  VPFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            VP+MTAR F S FTYSFPV++G KF+R YFYP +Y+G N +   FSV  G YT
Sbjct  84   VPYMTARIFNSSFTYSFPVSAGPKFVRFYFYPTAYSGHNESEFFFSVTSGVYT  136



>ref|XP_002277584.3| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
Length=895

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 67/113 (59%), Gaps = 9/113 (8%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSS------ADSQKPSVPQ  468
            Y PTD ILL+CG        D R W  D GSKF   +G S   +      A  Q PSV Q
Sbjct  35   YRPTDNILLDCGSSINTKSPDGRTWQGDQGSKF---SGTSDVQNSSSSSKAFRQDPSVDQ  91

Query  469  VPFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            VP+MTAR F S FTYSFPV++G KF+R YFYP +Y+G N +   FSV  G YT
Sbjct  92   VPYMTARIFNSSFTYSFPVSAGPKFVRFYFYPTAYSGHNESEFFFSVTSGVYT  144



>emb|CBI21192.3| unnamed protein product [Vitis vinifera]
Length=974

 Score =   102 bits (254),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 67/113 (59%), Gaps = 9/113 (8%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSS------ADSQKPSVPQ  468
            Y PTD ILL+CG        D R W  D GSKF   +G S   +      A  Q PSV Q
Sbjct  117  YRPTDNILLDCGSSINTKSPDGRTWQGDQGSKF---SGTSDVQNSSSSSKAFRQDPSVDQ  173

Query  469  VPFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            VP+MTAR F S FTYSFPV++G KF+R YFYP +Y+G N +   FSV  G YT
Sbjct  174  VPYMTARIFNSSFTYSFPVSAGPKFVRFYFYPTAYSGHNESEFFFSVTSGVYT  226



>gb|KDP24278.1| hypothetical protein JCGZ_25574 [Jatropha curcas]
Length=845

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 69/110 (63%), Gaps = 3/110 (3%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVG--SKFL-LGTGKSSTSSADSQKPSVPQVPF  477
            Y PTD ILLN G P G    D RKW +D    SK+  + +  SS S A  Q PSV  VP+
Sbjct  27   YTPTDLILLNSGAPYGKQSMDGRKWESDADKQSKYCPVNSETSSASKASQQDPSVTPVPY  86

Query  478  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            MTAR  +S++T  FPV+ G  F+RLYFYP +Y+GL+ + S FSV   +YT
Sbjct  87   MTARIIRSKYTCMFPVSVGPNFIRLYFYPTTYSGLDTSTSFFSVTANDYT  136



>gb|KDP27270.1| hypothetical protein JCGZ_19969 [Jatropha curcas]
Length=831

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 71/112 (63%), Gaps = 5/112 (4%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKF----LLGTGKSSTSSADSQKPSVPQVP  474
            YVPTD IL NCG     T  D RKWT D+ SKF       + KS ++ A  Q  SV  VP
Sbjct  33   YVPTDIILSNCGSSGQTTTGDGRKWTGDLNSKFGPVDHSNSTKSVSAIALRQGSSVASVP  92

Query  475  FMTARTFQSEFTYSFPVASGRKFLRLYFYPASYN-GLNATNSVFSVRVGEYT  627
            +MTAR  Q++FTY+FPV +G+KF+RL+FYP++Y  G N +   F V+ G +T
Sbjct  93   YMTARISQTQFTYTFPVTAGQKFIRLFFYPSNYQGGFNKSKDFFDVKTGPFT  144



>gb|KJB42940.1| hypothetical protein B456_007G175600 [Gossypium raimondii]
Length=891

 Score =   101 bits (252),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 67/105 (64%), Gaps = 4/105 (4%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDG--VTDQDNRKWTTDVGSKFLLGTGKSSTSS--ADSQKPSVPQVP  474
            Y PTD ILL+CG P    +  +D RKW TD  SKF     ++++S+  A  Q  SV +VP
Sbjct  23   YTPTDYILLDCGAPSSSSLVSEDGRKWITDERSKFATSNSENASSNFRATRQDHSVTRVP  82

Query  475  FMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSV  609
            +MTAR F  +FTYSFPV++G KFLR YFYP   +G +   S FSV
Sbjct  83   YMTARVFHDKFTYSFPVSAGLKFLRFYFYPVQDSGFDGATSFFSV  127



>emb|CDP20271.1| unnamed protein product [Coffea canephora]
Length=886

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 68/110 (62%), Gaps = 3/110 (3%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLG--TGKSSTSSADSQKPSVPQVPFM  480
            Y PTD IL+NCG     T  D RKW  DVGSKF        SS  +A     SV  VPF 
Sbjct  27   YTPTDYILINCGSSSNSTSVDGRKWDGDVGSKFSPNDMANISSAVTATELDSSVSGVPFS  86

Query  481  TARTFQSEFTYSFPVASGRKFLRLYFYPASYN-GLNATNSVFSVRVGEYT  627
            +AR  +S+F+Y+FPV+ G+KFLRLYFYP SY+ GLN   S F+V+   +T
Sbjct  87   SARIIRSQFSYTFPVSLGKKFLRLYFYPTSYSGGLNTMESFFNVKANNFT  136



>emb|CDP19885.1| unnamed protein product [Coffea canephora]
Length=895

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 68/111 (61%), Gaps = 5/111 (5%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFL---LGTGKSSTSSADSQKPSVPQVPF  477
            Y PTD IL+NCG     T  D R W  D GSKF    + T  SS  +A  Q PSV   P+
Sbjct  26   YSPTDYILINCGTSSNATSADGRNWYGDAGSKFSPNDMAT-ISSAVTAIEQDPSVSGAPY  84

Query  478  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNG-LNATNSVFSVRVGEYT  627
            + AR  +S F+Y+FPV+ G+KF+RLYFYPASY+   NAT S F+V    YT
Sbjct  85   LNARIIRSNFSYTFPVSPGKKFVRLYFYPASYSSDFNATESFFAVMANNYT  135



>ref|XP_009588433.1| PREDICTED: receptor-like protein kinase FERONIA [Nicotiana tomentosiformis]
Length=882

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 72/111 (65%), Gaps = 3/111 (3%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGT--GKSSTSSADSQKPSVPQVPF  477
            +Y  T   LLNCG   G T +DNR W TD+    LL +     ST++  S++ S+ +VP+
Sbjct  27   EYNATVHFLLNCGASSGATAEDNRLWNTDIHFTNLLPSNFATISTTAIASEQGSLTRVPY  86

Query  478  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYN-GLNATNSVFSVRVGEYT  627
            M AR F+S+FTY+FPV+ G KFLRLYF+PA+Y+ G N + S FSV    +T
Sbjct  87   MNARIFKSQFTYTFPVSPGTKFLRLYFHPANYSGGFNKSESFFSVTANHFT  137



>ref|XP_008464587.1| PREDICTED: receptor-like protein kinase FERONIA [Cucumis melo]
Length=908

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 69/113 (61%), Gaps = 6/113 (5%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQ--DNRKWTTDVGSKFL----LGTGKSSTSSADSQKPSVPQ  468
            Y P D I L CG    +++   D R W  D+ SKF        G S TS AD+Q  SV  
Sbjct  33   YQPIDNIPLVCGSHGNLSNSYLDGRIWVGDIDSKFFPSDHQQNGASMTSKADAQSTSVTT  92

Query  469  VPFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            VP+MTAR  +S+FTYSFPV+ G KF+RLYFY A+Y   + + +VFSVR G +T
Sbjct  93   VPYMTARLSRSQFTYSFPVSPGHKFIRLYFYSANYQQFDRSKAVFSVRAGRFT  145



>ref|XP_006654205.1| PREDICTED: receptor-like protein kinase FERONIA-like [Oryza brachyantha]
Length=868

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 68/103 (66%), Gaps = 2/103 (2%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSST-SSADSQKPSVPQ-VPFM  480
            Y PT+ IL++CG      D D RKW +D  SK+L+  GKSS  ++AD Q PS+P  VP+M
Sbjct  26   YKPTESILVDCGADKEGQDVDGRKWVSDKDSKWLVDGGKSSIMANADFQDPSLPSPVPYM  85

Query  481  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSV  609
            +AR F  E  Y+FP+   R ++RL+FYPASY+ L A N  FSV
Sbjct  86   SARVFTKEAAYNFPIGEDRHWVRLHFYPASYHDLPAENFFFSV  128



>emb|CDP19887.1| unnamed protein product [Coffea canephora]
Length=825

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 68/111 (61%), Gaps = 5/111 (5%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFL---LGTGKSSTSSADSQKPSVPQVPF  477
            Y PTD IL+NCG     T  D R W  D GSKF    + T  SS  +A  Q  SV   P+
Sbjct  26   YSPTDYILINCGSSSNATSADGRNWYGDAGSKFSPNDMAT-ISSAVTATEQDSSVSGAPY  84

Query  478  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNG-LNATNSVFSVRVGEYT  627
            +TAR  +S F+Y+FPV+ G+KF+RLYFYPASY+   NAT S F+V    YT
Sbjct  85   LTARIIRSNFSYTFPVSPGKKFVRLYFYPASYSSDFNATESFFAVMANNYT  135



>ref|XP_009416326.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416327.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
Length=882

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 71/110 (65%), Gaps = 7/110 (6%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTS---SADSQKPSVPQVPF  477
            YVP D ILLNCG      D D++ WT D GSK+    G S  +   +A  Q  SVP+VP+
Sbjct  28   YVPRDYILLNCGASGKAIDTDSQTWTGDAGSKY----GPSLNAVGFTAPQQDSSVPEVPY  83

Query  478  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            +TAR F S +TYSFPV  GRK++RL+FYP++Y+   A+++ FSV    +T
Sbjct  84   LTARVFTSPYTYSFPVGPGRKYVRLHFYPSNYSNHVASDAFFSVTSDTHT  133



>ref|XP_004137258.1| PREDICTED: receptor-like protein kinase FERONIA-like [Cucumis 
sativus]
 gb|KGN53792.1| hypothetical protein Csa_4G129580 [Cucumis sativus]
Length=910

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 71/113 (63%), Gaps = 6/113 (5%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTD--QDNRKWTTDVGSKFL----LGTGKSSTSSADSQKPSVPQ  468
            Y P D I L+CG    ++   +++R W  D+ SK+        G S TS AD+Q  SV  
Sbjct  33   YEPIDNITLDCGSDANLSSFYENDRIWVGDIDSKYFPSDHQQNGASMTSKADAQSTSVTT  92

Query  469  VPFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            VP+MTAR  +S+FTYSFPV  G+KF+RLYFY A+Y   + + +VFSVR G +T
Sbjct  93   VPYMTARLSRSQFTYSFPVTPGQKFIRLYFYSANYQQFDRSKAVFSVRAGLFT  145



>ref|XP_004154760.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
FERONIA-like [Cucumis sativus]
Length=910

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 71/113 (63%), Gaps = 6/113 (5%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTD--QDNRKWTTDVGSKFL----LGTGKSSTSSADSQKPSVPQ  468
            Y P D I L+CG    ++   +++R W  D+ SK+        G S TS AD+Q  SV  
Sbjct  33   YEPIDNITLDCGSDANLSSFYENDRIWVGDIDSKYFPSDHQQNGASMTSKADAQSTSVTT  92

Query  469  VPFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            VP+MTAR  +S+FTYSFPV  G+KF+RLYFY A+Y   + + +VFSVR G +T
Sbjct  93   VPYMTARLSRSQFTYSFPVTPGQKFIRLYFYSANYQQFDRSKAVFSVRAGLFT  145



>ref|XP_002530995.1| kinase, putative [Ricinus communis]
 gb|EEF31383.1| kinase, putative [Ricinus communis]
Length=888

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 64/107 (60%), Gaps = 2/107 (2%)
 Frame = +1

Query  313  PTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSST--SSADSQKPSVPQVPFMTA  486
            P D ILLNCG     T  D R W  D  SKFL    ++++   SA  + PS  +VP+M A
Sbjct  25   PADLILLNCGTSSSATSLDGRGWDGDAQSKFLASNSETASYGCSASQRDPSATEVPYMDA  84

Query  487  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            R  QS+FTY FPV+ G KF+RLYFYP  Y+ L  + S FSV   +YT
Sbjct  85   RVSQSKFTYLFPVSPGSKFVRLYFYPTKYSDLEISKSFFSVTANDYT  131



>ref|XP_006427852.1| hypothetical protein CICLE_v10024830mg [Citrus clementina]
 ref|XP_006464563.1| PREDICTED: putative receptor-like protein kinase At5g39000-like 
[Citrus sinensis]
 gb|ESR41092.1| hypothetical protein CICLE_v10024830mg [Citrus clementina]
Length=911

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 70/119 (59%), Gaps = 12/119 (10%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTG--KSSTSSADSQKPSVPQVPFM  480
            Y+PTD IL+ CG     T  D R W  D  SKF       KS TS A  Q+ SVPQVP+M
Sbjct  29   YIPTDYILIICGESSNTTSSDGRNWDGDAHSKFSSSNSATKSFTSRASFQENSVPQVPYM  88

Query  481  TARTFQSEFTYSFPVASGRKFLRLYFYPASY------NGLNATNSV----FSVRVGEYT  627
            TAR F  EFTY+FPV+ G KFLRL+FYPA Y       GL+  +++    F+V   +YT
Sbjct  89   TARVFPEEFTYTFPVSPGPKFLRLHFYPAPYLLGQQQGGLDNNDTISTSFFTVSANKYT  147



>gb|KDO53394.1| hypothetical protein CISIN_1g002533mg [Citrus sinensis]
Length=911

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 70/119 (59%), Gaps = 12/119 (10%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTG--KSSTSSADSQKPSVPQVPFM  480
            Y+PTD IL+ CG     T  D R W  D  SKF       KS TS A  Q+ SVPQVP+M
Sbjct  29   YIPTDYILIICGESSNTTSSDGRNWDGDAHSKFSSSNSATKSFTSRASFQENSVPQVPYM  88

Query  481  TARTFQSEFTYSFPVASGRKFLRLYFYPASY------NGLNATNSV----FSVRVGEYT  627
            TAR F  EFTY+FPV+ G KFLRL+FYPA Y       GL+  +++    F+V   +YT
Sbjct  89   TARVFPEEFTYTFPVSPGPKFLRLHFYPAPYLLGQQQGGLDNNDTISTSFFTVSANKYT  147



>ref|XP_008809255.1| PREDICTED: receptor-like protein kinase ANXUR1 [Phoenix dactylifera]
Length=865

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 68/105 (65%), Gaps = 3/105 (3%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMT  483
            Y PTD ILLNCG     TD DNRKW  D GSK L  +G S+ + A  Q PS+   VP+MT
Sbjct  29   YTPTDSILLNCGSSADGTDADNRKWAADNGSK-LRPSGNSAAAQAAFQDPSLLSPVPYMT  87

Query  484  ARTFQSEFTYSFPVA-SGRKFLRLYFYPASYNGLNATNSVFSVRV  615
            AR F SE TY F V+   R ++RL+FYP++YN LN  ++ FSV V
Sbjct  88   ARIFTSESTYKFAVSDKDRHWIRLHFYPSTYNNLNPEDAYFSVTV  132



>ref|XP_009118022.1| PREDICTED: receptor-like protein kinase FERONIA isoform X2 [Brassica 
rapa]
Length=766

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 61/77 (79%), Gaps = 1/77 (1%)
 Frame = +1

Query  400  KFLLGTGKSSTSSADSQKPSV-PQVPFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYN  576
            K L  +G+S TS A +Q PSV P VP+M+AR F+S FTYSFPVASGRKFLRLYFYP SY+
Sbjct  7    KCLSTSGESKTSPALTQDPSVVPSVPYMSARVFKSPFTYSFPVASGRKFLRLYFYPNSYD  66

Query  577  GLNATNSVFSVRVGEYT  627
            GLNAT S+FS+  G YT
Sbjct  67   GLNATLSLFSLSSGPYT  83



>ref|XP_006842554.1| hypothetical protein AMTR_s00077p00138840 [Amborella trichopoda]
 gb|ERN04229.1| hypothetical protein AMTR_s00077p00138840 [Amborella trichopoda]
Length=899

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 67/108 (62%), Gaps = 1/108 (1%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVP-QVPFMT  483
            ++P D ILL+CG      D DNR WT D  S+F   +  +    A +Q  S+P + P+MT
Sbjct  38   FIPKDVILLDCGTDSDSNDADNRHWTGDANSRFAPASQNTLPVQASNQDTSLPSKTPYMT  97

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR F S FTY+FPV  GR ++RLYFYP+ Y   N+T ++FSV  G ++
Sbjct  98   ARIFNSNFTYTFPVTPGRHWVRLYFYPSDYKPHNSTAALFSVTSGPFS  145



>ref|XP_007032799.1| Malectin/receptor protein kinase family protein, putative [Theobroma 
cacao]
 gb|EOY03725.1| Malectin/receptor protein kinase family protein, putative [Theobroma 
cacao]
Length=888

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 68/113 (60%), Gaps = 8/113 (7%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTS------SADSQKPSVPQ  468
            YVPTD I LNCG        D R W  D  SKF  G  +SS +       AD+Q  SV  
Sbjct  30   YVPTDNITLNCGALSDSHGSDGRFWAGDKSSKF--GPVESSRTIPSAPYEADNQGGSVET  87

Query  469  VPFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            VP+MTAR   SEF YSFPV+ G+KF+RL+FYPASY   + + + FSV+ G +T
Sbjct  88   VPYMTARVSSSEFKYSFPVSPGQKFVRLHFYPASYKKFDRSKAFFSVKAGSFT  140



>ref|XP_011099030.1| PREDICTED: receptor-like protein kinase FERONIA [Sesamum indicum]
Length=886

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 66/109 (61%), Gaps = 2/109 (2%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLL--GTGKSSTSSADSQKPSVPQVPFM  480
            Y  TD ILLNCG    + D  +R W +D  S +        S +S A +  PSV QVP+ 
Sbjct  29   YTATDLILLNCGSLSNLNDTSSRSWDSDERSSYAPPNAASISLSSMASTMAPSVFQVPYQ  88

Query  481  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            TAR F+S FTY+FPV +G KFLRLYFYP +Y+G N + S FSV    +T
Sbjct  89   TARVFRSSFTYAFPVLTGAKFLRLYFYPDTYSGFNTSQSFFSVTANGFT  137



>ref|XP_007032796.1| Malectin/receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY03722.1| Malectin/receptor-like protein kinase family protein [Theobroma 
cacao]
Length=155

 Score = 92.8 bits (229),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 68/112 (61%), Gaps = 5/112 (4%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQ--DNRKWTTDVGSKFLL---GTGKSSTSSADSQKPSVPQV  471
            Y P D I L+CG            RKWT D  SK  L    + KS  ++A SQ  S+ +V
Sbjct  27   YTPPDNIALDCGSSTSGNSAVPGGRKWTGDKDSKVALIEESSSKSVFATALSQSSSILRV  86

Query  472  PFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            P++TAR   S+FTY FPV +G+KF+RL+FYPA Y G + + + FSV+VG Y+
Sbjct  87   PYLTARISISQFTYVFPVTAGQKFIRLHFYPAQYQGFDRSKNFFSVKVGSYS  138



>ref|XP_002870806.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47065.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=478

 Score = 97.1 bits (240),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 65/110 (59%), Gaps = 4/110 (4%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLG--TGKSSTSSADSQKPSVPQVPFM  480
            +VPTD  L NCG      D + R WT +   K L       S TS A  QK  V ++P+M
Sbjct  23   FVPTDVFLFNCGDTSNNVDNNGRNWTAE-DRKILSSNLVNASYTSEASYQKTGVSRIPYM  81

Query  481  TARTFQSEFTYSFPVASGRKFLRLYFYPASY-NGLNATNSVFSVRVGEYT  627
             AR F+SEFTYSFPV  G KFLRLYFYP  Y +G +A NS  SV+V  +T
Sbjct  82   KARIFRSEFTYSFPVTPGWKFLRLYFYPTQYKSGFDAVNSFVSVKVSGFT  131



>ref|XP_009419820.1| PREDICTED: receptor-like protein kinase FERONIA isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=531

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 67/110 (61%), Gaps = 7/110 (6%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKF---LLGTGKSSTSSADSQKPSVPQVPF  477
            YVP D ILLNCG     +  D R WT D G+++   L G G      A  Q PSV  VP+
Sbjct  31   YVPRDDILLNCGASGQASSFDGRSWTGDTGTRYAPSLNGDGFD----ALRQDPSVSTVPY  86

Query  478  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
             TAR F S FTY FP+++GRKF+RL+FYP+ Y+    +++ FSV  G YT
Sbjct  87   STARVFTSPFTYRFPLSAGRKFIRLHFYPSDYSNHAVSDAFFSVTSGPYT  136



>ref|XP_007045781.1| Malectin/receptor-like protein kinase family protein, putative 
isoform 1 [Theobroma cacao]
 ref|XP_007045782.1| Malectin/receptor-like protein kinase family protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY01613.1| Malectin/receptor-like protein kinase family protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY01614.1| Malectin/receptor-like protein kinase family protein, putative 
isoform 1 [Theobroma cacao]
Length=832

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 71/109 (65%), Gaps = 2/109 (2%)
 Frame = +1

Query  307  YVPTDKILLNCGG-PDGVTDQDNRKWTTDVGSKF-LLGTGKSSTSSADSQKPSVPQVPFM  480
            YVP+++I L+CG   +     D R W++D+GS F    +  +ST S+ S   +VP+VP+M
Sbjct  43   YVPSEQIFLDCGSSAEKSLLFDGRNWSSDIGSDFTAYNSDSNSTVSSASIGTAVPRVPYM  102

Query  481  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            TAR F S+F+Y+F V  G KF+RLYFYP SY GLN + S  +V  G YT
Sbjct  103  TARLFYSKFSYTFNVTPGPKFIRLYFYPDSYRGLNVSESFLTVTSGHYT  151



>gb|EMT04378.1| Receptor-like protein kinase FERONIA [Aegilops tauschii]
Length=833

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 68/104 (65%), Gaps = 3/104 (3%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSST-SSADSQKPSVPQ-VPFM  480
            Y PTD IL++CG      D+D RKWT D  SK+L   GKSS   +AD   PS+P  VP+M
Sbjct  29   YKPTDSILVHCGSDKDGQDEDGRKWTADKDSKWLPDGGKSSVMGTADVPAPSLPSPVPYM  88

Query  481  TARTFQSEFTYSFPVASG-RKFLRLYFYPASYNGLNATNSVFSV  609
            TAR F  E  Y+FPVA   R ++RL+FYPA+Y+G+ A +  FSV
Sbjct  89   TARVFPKETAYTFPVADADRHWVRLHFYPAAYHGIPADHFFFSV  132



>ref|XP_009419819.1| PREDICTED: receptor-like protein kinase FERONIA isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=545

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 67/110 (61%), Gaps = 7/110 (6%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKF---LLGTGKSSTSSADSQKPSVPQVPF  477
            YVP D ILLNCG     +  D R WT D G+++   L G G      A  Q PSV  VP+
Sbjct  45   YVPRDDILLNCGASGQASSFDGRSWTGDTGTRYAPSLNGDGFD----ALRQDPSVSTVPY  100

Query  478  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
             TAR F S FTY FP+++GRKF+RL+FYP+ Y+    +++ FSV  G YT
Sbjct  101  STARVFTSPFTYRFPLSAGRKFIRLHFYPSDYSNHAVSDAFFSVTSGPYT  150



>gb|KJB75372.1| hypothetical protein B456_012G038800 [Gossypium raimondii]
Length=853

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 66/109 (61%), Gaps = 2/109 (2%)
 Frame = +1

Query  307  YVPTDKILLNCGGPD--GVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFM  480
            Y+P D I L+CG       T  D R+WT D  S F     +S ++S +    S   VP+M
Sbjct  21   YIPADNIALDCGSSTSGNSTAPDGREWTGDNMSWFAESGSQSVSASVEKHNSSFHVVPYM  80

Query  481  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            TAR  +SEFTY FPV +G+KF+RLYF PA YNG + +   FSV+VG YT
Sbjct  81   TARISKSEFTYMFPVTAGQKFIRLYFNPARYNGFDTSVYFFSVKVGPYT  129



>ref|XP_006405671.1| hypothetical protein EUTSA_v10027636mg [Eutrema salsugineum]
 gb|ESQ47124.1| hypothetical protein EUTSA_v10027636mg [Eutrema salsugineum]
Length=876

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 66/110 (60%), Gaps = 4/110 (4%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADS--QKPSVPQVPFM  480
            Y PTD  L NCG      D   R WT +   K L     +++  ++S  Q   VPQVP+ 
Sbjct  27   YTPTDVFLFNCGATSDTVDNTGRNWTAE-NRKILSSNPVNASFPSESSFQDSGVPQVPYT  85

Query  481  TARTFQSEFTYSFPVASGRKFLRLYFYPASYN-GLNATNSVFSVRVGEYT  627
            TAR F+SEFTYSFPV+ G KFLRLY YP SY  G +A NS+FSV V  +T
Sbjct  86   TARIFRSEFTYSFPVSPGDKFLRLYIYPTSYKPGFDAVNSLFSVTVNGFT  135



>ref|NP_198719.1| putative receptor-like protein kinase [Arabidopsis thaliana]
 sp|Q9FID5.1|Y5393_ARATH RecName: Full=Probable receptor-like protein kinase At5g39030; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB10827.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AED94389.1| putative receptor-like protein kinase [Arabidopsis thaliana]
Length=806

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 68/110 (62%), Gaps = 3/110 (3%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPS--VPQVPFM  480
            Y P D  L+NCG  D   D   R WT +  +     +  +S SS  S K    +PQVP+M
Sbjct  21   YKPDDVFLINCGETDVPFDNHGRTWTQEEKNILPKNSDNASFSSVVSYKEESGIPQVPYM  80

Query  481  TARTFQSEFTYSFPVASGRKFLRLYFYPASY-NGLNATNSVFSVRVGEYT  627
            TAR F+S+FTYSFPV+ G KFLRLYFYP SY +G +A NS  SV V ++T
Sbjct  81   TARIFRSDFTYSFPVSPGWKFLRLYFYPTSYKSGFDAVNSFVSVTVNDFT  130



>gb|KJB10602.1| hypothetical protein B456_001G210700 [Gossypium raimondii]
Length=856

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 65/110 (59%), Gaps = 4/110 (4%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKF---LLGTGKSSTSSADSQKPSVPQVPF  477
            YVPTD I LNCG P  +   D R W  D  S F        KS    AD+Q  S   VP+
Sbjct  26   YVPTDNITLNCGAPTDLLANDGRYWAADKTSNFGPFESSHNKSQAYEADTQDGS-ETVPY  84

Query  478  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            MTAR  +SEF Y+FPV SG+KF+RLYF+PASY   + + + FSV+ G  T
Sbjct  85   MTARVSRSEFKYTFPVTSGQKFVRLYFHPASYEENDRSKAFFSVKAGSVT  134



>ref|NP_198718.1| putative receptor-like protein kinase [Arabidopsis thaliana]
 sp|Q9FID6.1|Y5392_ARATH RecName: Full=Probable receptor-like protein kinase At5g39020; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB10826.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AED94387.1| putative receptor-like protein kinase [Arabidopsis thaliana]
Length=813

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 66/111 (59%), Gaps = 6/111 (5%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTG---KSSTSSADSQKPSVPQVPF  477
            Y PTD  L NCG      D   R WT  V S+ +L +     S TS A  QK  V ++P+
Sbjct  23   YHPTDVFLFNCGDTSNNVDNSGRNWT--VESRQILSSNLVNASFTSEASYQKAGVSRIPY  80

Query  478  MTARTFQSEFTYSFPVASGRKFLRLYFYPASY-NGLNATNSVFSVRVGEYT  627
            M AR F+SEFTYSFPV  G  FLRLYFYP  Y +G +A NS FSV+V  +T
Sbjct  81   MKARIFRSEFTYSFPVTPGSIFLRLYFYPTQYKSGFDAVNSFFSVKVNGFT  131



>dbj|BAK06468.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=891

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 69/104 (66%), Gaps = 3/104 (3%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSS-TSSADSQKPSVP-QVPFM  480
            Y PTD IL++CG      D+D RKWT+D  SKFL   GKSS T++AD   PS+P  VP+M
Sbjct  29   YKPTDSILVDCGSDKEGQDEDGRKWTSDKDSKFLPDGGKSSITATADINDPSLPSSVPYM  88

Query  481  TARTFQSEFTYSFPVASG-RKFLRLYFYPASYNGLNATNSVFSV  609
            TAR F  E  Y+FPV+   R ++RL+FYPASY+ +   +  FSV
Sbjct  89   TARVFPKETAYTFPVSDADRHWVRLHFYPASYHDIPTDHFFFSV  132



>gb|EMS48200.1| Receptor-like protein kinase HERK 1 [Triticum urartu]
Length=807

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 68/104 (65%), Gaps = 3/104 (3%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSST-SSADSQKPSVPQ-VPFM  480
            Y PTD IL++CG      D+D RKWTTD  SK+L   GKSS   +A    PS+P  VP+M
Sbjct  28   YKPTDSILVHCGSDKDGQDEDGRKWTTDKDSKWLPDGGKSSIMGTAAVADPSLPSPVPYM  87

Query  481  TARTFQSEFTYSFPVASG-RKFLRLYFYPASYNGLNATNSVFSV  609
            TAR F  E  Y+FPVA   R ++RL+FYPA+Y+G+ A +  FSV
Sbjct  88   TARVFPKETAYTFPVADADRHWVRLHFYPAAYHGIPADHFFFSV  131



>gb|KJB10597.1| hypothetical protein B456_001G210300 [Gossypium raimondii]
Length=869

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 65/110 (59%), Gaps = 4/110 (4%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKF---LLGTGKSSTSSADSQKPSVPQVPF  477
            Y+PTD I LNCG    +   D R W  D  SKF        KS    AD+Q  S   VP+
Sbjct  26   YIPTDDITLNCGATTDLVANDGRSWAEDNNSKFGPFESSHNKSQAYEADTQDGS-ETVPY  84

Query  478  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            MTAR  +SEF Y+FPV  G+KF+RLYF+PASY   + + + FSV+ G +T
Sbjct  85   MTARVSRSEFKYTFPVTPGQKFVRLYFHPASYKEYDRSKAFFSVKAGSFT  134



>emb|CDP17056.1| unnamed protein product [Coffea canephora]
Length=881

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 68/104 (65%), Gaps = 6/104 (6%)
 Frame = +1

Query  319  DKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTG-KSSTSSADSQKPSVP-QVPFMTART  492
            + ++L+CG  DG TD D RKW  D  +K+L+ +  KS  S AD+Q PS+P  VP+MTAR 
Sbjct  30   NALVLDCGSSDGGTDADGRKWEAD--AKYLVNSNDKSIASKADNQDPSLPSDVPYMTARI  87

Query  493  FQSEFTYSFPVASG--RKFLRLYFYPASYNGLNATNSVFSVRVG  618
            F SE  Y FPVA+   R  LRL+FYPASY   N ++S FSV  G
Sbjct  88   FTSEAIYQFPVANATDRVLLRLHFYPASYPNFNISDSYFSVSAG  131



>ref|XP_006844774.1| hypothetical protein AMTR_s00016p00259140 [Amborella trichopoda]
 gb|ERN06449.1| hypothetical protein AMTR_s00016p00259140 [Amborella trichopoda]
Length=856

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 69/105 (66%), Gaps = 2/105 (2%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDV-GSKFLLGTGKSSTSSADSQKPSVPQ-VPF  477
            +Y P+D IL+NCG      D D R W  DV GS++ L +  +  + A++Q PS+P  +P+
Sbjct  35   NYAPSDAILVNCGSSSDGVDADGRSWKGDVHGSRYTLDSENTVPARAETQDPSLPSTIPY  94

Query  478  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVR  612
            M+AR F S  TY F V  GR ++RL+FYP+SY+GL+  +++FSV 
Sbjct  95   MSARIFSSRSTYEFSVTPGRHWVRLHFYPSSYSGLSPDDALFSVE  139



>ref|NP_001055089.1| Os05g0280700 [Oryza sativa Japonica Group]
 gb|AAS98512.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAF17003.1| Os05g0280700 [Oryza sativa Japonica Group]
 gb|EAY97366.1| hypothetical protein OsI_19288 [Oryza sativa Indica Group]
 gb|EEE63092.1| hypothetical protein OsJ_17900 [Oryza sativa Japonica Group]
Length=869

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 66/103 (64%), Gaps = 2/103 (2%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSST-SSADSQKPSVPQ-VPFM  480
            Y PT+ IL+NCG      D D RKW +D  SK+L+   KSS  ++AD Q PS+P  VP+M
Sbjct  26   YKPTESILVNCGSDKEGQDIDGRKWLSDKDSKWLIDGEKSSIMANADFQDPSLPSPVPYM  85

Query  481  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSV  609
            TAR F  E  Y+F V   R ++RL+FYPASY+ L A N  FSV
Sbjct  86   TARVFTKETMYNFSVGEERHWVRLHFYPASYHDLPAENFFFSV  128



>ref|XP_007045784.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
 gb|EOY01616.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
Length=822

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 66/110 (60%), Gaps = 3/110 (3%)
 Frame = +1

Query  307  YVPTDKILLNCGG-PDGVTDQDNRKWTTDVGSKFLLGTGKSS--TSSADSQKPSVPQVPF  477
            Y P + ILL+CG         D R W++D+ S F+     SS   S A S   SVP+VP+
Sbjct  42   YFPLENILLDCGSLASQAVSYDGRNWSSDIRSHFVASNPDSSFTVSRASSAGTSVPEVPY  101

Query  478  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            MTAR F S+FTYSF V+ G KF+RL+FY  SY  LNA+ +  SV  G +T
Sbjct  102  MTARLFHSQFTYSFNVSPGPKFIRLHFYDDSYMSLNASKAFLSVTAGHFT  151



>ref|XP_009115877.1| PREDICTED: putative receptor-like protein kinase At5g39000 [Brassica 
rapa]
Length=875

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 66/109 (61%), Gaps = 2/109 (2%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSS-ADSQKPSVPQVPFMT  483
            Y PTD  L NCG     TD   RKWT +           +S SS A SQ+  VPQVP++ 
Sbjct  26   YDPTDLFLFNCGATSDNTDNTGRKWTAENRQTLSSNAVNASFSSDASSQESGVPQVPYLK  85

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASY-NGLNATNSVFSVRVGEYT  627
            AR F+S+FTYSFPV+ G K+LRLYFYP  Y +G +A  S FSV V  +T
Sbjct  86   ARIFRSDFTYSFPVSPGWKYLRLYFYPTRYESGFDAVASFFSVTVNGFT  134



>emb|CDY36996.1| BnaC06g12670D [Brassica napus]
Length=872

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 68/109 (62%), Gaps = 3/109 (3%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSS-ADSQKPSVPQVPFMT  483
            YVP D  L NCG    V+D+  R WT +        +G +S SS A  Q+  VP VP+ T
Sbjct  26   YVPIDLFLFNCGANSDVSDR-GRNWTAENRKTLPSNSGDASFSSDASFQESGVPLVPYKT  84

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASY-NGLNATNSVFSVRVGEYT  627
            AR F+S+FTYSFPV+ G KFLRLYFYP  Y +G +A NS FSV V  +T
Sbjct  85   ARIFRSDFTYSFPVSPGWKFLRLYFYPTRYGSGFDAVNSFFSVNVNGFT  133



>ref|XP_003614252.1| Kinase-like protein [Medicago truncatula]
 gb|AES97210.1| feronia receptor-like kinase [Medicago truncatula]
Length=817

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 67/112 (60%), Gaps = 5/112 (4%)
 Frame = +1

Query  307  YVPTDKILLNCG-GPDGVTDQDNRKWTTDVGSKFLLG----TGKSSTSSADSQKPSVPQV  471
            YVP++ I+LNCG     +   D R W  D+ S ++        KS T+ A S   S+P+V
Sbjct  28   YVPSENIVLNCGSNTSELVQYDGRIWNGDIDSPYVPSYEEIINKSLTAKAPSNLQSIPEV  87

Query  472  PFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            P+MTAR FQS+FTY F V SG KF+RL+FYP SY   N + +  SV  G +T
Sbjct  88   PYMTARIFQSQFTYRFNVTSGPKFIRLHFYPFSYLNFNISKAFLSVTAGNFT  139



>gb|KDP27267.1| hypothetical protein JCGZ_19966 [Jatropha curcas]
Length=858

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 69/112 (62%), Gaps = 5/112 (4%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKF----LLGTGKSSTSSADSQKPSVPQVP  474
            Y PTD IL NCG     T  D  KWT D+ SKF       + KS ++ A  Q  SV  VP
Sbjct  31   YTPTDIILSNCGFSGQTTAPDGSKWTGDLNSKFGPVDHSNSTKSVSAIALRQGSSVASVP  90

Query  475  FMTARTFQSEFTYSFPVASGRKFLRLYFYPASYN-GLNATNSVFSVRVGEYT  627
            +MTAR  Q++FTY+FPV +G+KF+RL+FYP++Y  G N +   F V+ G +T
Sbjct  91   YMTARISQTQFTYTFPVTAGQKFIRLFFYPSNYQGGFNKSKDFFDVKTGPFT  142



>dbj|BAK00988.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=507

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 60/103 (58%), Gaps = 1/103 (1%)
 Frame = +1

Query  322  KILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQ  498
            ++ L+CG P   TD D R W  D  SKFL  T     + A  Q PS+P  VP++TAR F 
Sbjct  36   QVRLSCGAPASATDSDGRAWDGDSASKFLPSTNAGVAARASYQDPSLPSSVPYVTARVFA  95

Query  499  SEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            S  TY+FP+  GR FLRLYFYPA Y   +A  ++F V  G  T
Sbjct  96   SSHTYTFPLRPGRVFLRLYFYPADYGNHSAYGALFGVTAGGVT  138



>ref|XP_003520131.2| PREDICTED: receptor-like protein kinase FERONIA-like [Glycine 
max]
Length=847

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 69/111 (62%), Gaps = 4/111 (4%)
 Frame = +1

Query  307  YVPTDKILLNCGG--PDGVTDQDNRKWTTDVGSKFLLGTG--KSSTSSADSQKPSVPQVP  474
            YVP++ I+LNCG    + V   D R W+ D+ S ++      K   + A +   S+P+VP
Sbjct  34   YVPSENIVLNCGSNVSNVVEYVDGRNWSGDIASPYMPSDADTKFLVARAPNTLQSIPEVP  93

Query  475  FMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            +MTAR FQS+FTY+F V  G KF+RL+FYPASY  LN +N+  SV    +T
Sbjct  94   YMTARIFQSQFTYTFNVTPGPKFIRLHFYPASYLNLNLSNAFLSVSAANFT  144



>gb|KHN29954.1| Receptor-like protein kinase FERONIA [Glycine soja]
Length=841

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 69/111 (62%), Gaps = 4/111 (4%)
 Frame = +1

Query  307  YVPTDKILLNCGG--PDGVTDQDNRKWTTDVGSKFLLGTG--KSSTSSADSQKPSVPQVP  474
            YVP++ I+LNCG    + V   D R W+ D+ S ++      K   + A +   S+P+VP
Sbjct  29   YVPSENIVLNCGSNVSNVVEYVDGRNWSGDIASPYMPSDADTKFLVARAPNTLQSIPEVP  88

Query  475  FMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            +MTAR FQS+FTY+F V  G KF+RL+FYPASY  LN +N+  SV    +T
Sbjct  89   YMTARIFQSQFTYTFNVTPGPKFIRLHFYPASYLNLNLSNAFLSVSAANFT  139



>ref|XP_004962493.1| PREDICTED: receptor-like protein kinase ANXUR1-like [Setaria 
italica]
Length=869

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 66/104 (63%), Gaps = 3/104 (3%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSST-SSADSQKPSVPQ-VPFM  480
            Y P + IL+NCG      D D RKW TD  SK+L+  GKSS  + AD Q PS+P  VP+M
Sbjct  26   YKPPESILVNCGSAKEGLDADGRKWMTDQDSKWLIDGGKSSIMADADVQDPSLPSPVPYM  85

Query  481  TARTFQSEFTYSFPV-ASGRKFLRLYFYPASYNGLNATNSVFSV  609
            +AR F  E  Y+F V  + R +LRL+FYPA+Y+GL A    FSV
Sbjct  86   SARVFTKETVYNFSVDETDRHWLRLHFYPAAYHGLPAEQFFFSV  129



>emb|CDX78036.1| BnaA09g32310D [Brassica napus]
Length=867

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 69/110 (63%), Gaps = 4/110 (4%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADS--QKPSVPQVPFM  480
            Y PTD  L NCG     TD   RKWT +   + L     +++ S+D+  Q+  VPQVP+M
Sbjct  26   YDPTDLFLFNCGATSDNTDNTGRKWTAE-NRQTLSSNAVNASFSSDASFQESGVPQVPYM  84

Query  481  TARTFQSEFTYSFPVASGRKFLRLYFYPASY-NGLNATNSVFSVRVGEYT  627
             AR F+S+FTYSFPV+ G K+LRLYFYP  Y +G +A  S FSV V  +T
Sbjct  85   KARIFRSDFTYSFPVSPGWKYLRLYFYPTRYESGFDAVASFFSVTVNGFT  134



>emb|CDX67422.1| BnaA07g14620D [Brassica napus]
Length=722

 Score = 94.7 bits (234),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 67/109 (61%), Gaps = 3/109 (3%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADS-QKPSVPQVPFMT  483
            YVP D  L NCG    VTD   R WT +        +G +S SS  S Q+  VP VP+ T
Sbjct  26   YVPVDLFLFNCGANSDVTDS-GRSWTAENRKTLPSNSGDASFSSEASFQESGVPLVPYKT  84

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASY-NGLNATNSVFSVRVGEYT  627
            AR F+S+FTYSFPV+ G KFLRLYFYP  Y +G +A +S FSV V  +T
Sbjct  85   ARIFRSDFTYSFPVSPGWKFLRLYFYPTRYGSGFDAVSSFFSVNVNGFT  133



>ref|XP_009790514.1| PREDICTED: receptor-like protein kinase FERONIA [Nicotiana sylvestris]
Length=879

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 68/111 (61%), Gaps = 4/111 (4%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKS--STSSADSQKPSVPQVPFM  480
            Y  T   LLNCG     TD+D+R W TD+    LL +  +  ST +  S++ SV  VP+M
Sbjct  28   YNATVHFLLNCGASSDATDEDDRLWNTDIHFTNLLPSNFTTISTPAIASEQGSVTTVPYM  87

Query  481  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNG--LNATNSVFSVRVGEYT  627
             AR F+S+FTY+FPV+ G KFLRLYF+PA Y+G   N + S FSV     T
Sbjct  88   NARIFKSQFTYTFPVSPGTKFLRLYFHPADYSGGRFNKSESFFSVTANHVT  138



>ref|XP_009125099.1| PREDICTED: putative receptor-like protein kinase At5g39000 [Brassica 
rapa]
Length=873

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 67/109 (61%), Gaps = 3/109 (3%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADS-QKPSVPQVPFMT  483
            YVP D  L NCG    VTD   R WT +        +G +S SS  S Q+  VP VP+ T
Sbjct  26   YVPVDLFLFNCGANSDVTDS-GRSWTAENRKTLPSNSGDASFSSEASFQESGVPLVPYKT  84

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASY-NGLNATNSVFSVRVGEYT  627
            AR F+S+FTYSFPV+ G KFLRLYFYP  Y +G +A +S FSV V  +T
Sbjct  85   ARIFRSDFTYSFPVSPGWKFLRLYFYPTRYGSGFDAVSSFFSVNVNGFT  133



>ref|NP_198715.1| putative receptor-like protein kinase [Arabidopsis thaliana]
 sp|Q9FID9.1|Y5389_ARATH RecName: Full=Probable receptor-like protein kinase At5g38990; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB10823.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AED94384.1| malectin/receptor-like protein kinase family protein [Arabidopsis 
thaliana]
Length=880

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 66/111 (59%), Gaps = 5/111 (5%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTG---KSSTSSADSQKPSVPQVPF  477
            Y PTD  L+NCG      D   R WTT+   KF+        S TSSA  Q+  +PQVP+
Sbjct  23   YEPTDVFLINCGDTSNNMDYSGRNWTTE-NPKFMSSNAVDDASFTSSASYQESGIPQVPY  81

Query  478  MTARTFQSEFTYSFPVASGRKFLRLYFYPASY-NGLNATNSVFSVRVGEYT  627
            + AR F+ +FTYSFPV+ G KFLRLYFYP  Y +  +A  S FSV V  +T
Sbjct  82   LKARIFRYDFTYSFPVSPGWKFLRLYFYPTRYGSDFDAVKSFFSVNVNRFT  132



>gb|AAM10331.1| AT5g38990/K15E6_170 [Arabidopsis thaliana]
 gb|AAN18200.1| At5g38990/K15E6_170 [Arabidopsis thaliana]
Length=880

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 66/111 (59%), Gaps = 5/111 (5%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTG---KSSTSSADSQKPSVPQVPF  477
            Y PTD  L+NCG      D   R WTT+   KF+        S TSSA  Q+  +PQVP+
Sbjct  23   YEPTDVFLINCGDTSNNMDYSGRNWTTE-NPKFMSSNAVDDASFTSSASYQESGIPQVPY  81

Query  478  MTARTFQSEFTYSFPVASGRKFLRLYFYPASY-NGLNATNSVFSVRVGEYT  627
            + AR F+ +FTYSFPV+ G KFLRLYFYP  Y +  +A  S FSV V  +T
Sbjct  82   LKARIFRYDFTYSFPVSPGWKFLRLYFYPTRYGSDFDAVKSFFSVNVNRFT  132



>emb|CDP21458.1| unnamed protein product [Coffea canephora]
Length=132

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 67/104 (64%), Gaps = 3/104 (3%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLG--TGKSSTSSADSQKPSVPQVPFM  480
            Y PTD IL++CG     T  D RKW  DVGSKF        SS  +A    PSV + PF 
Sbjct  27   YTPTDYILISCGSSSNSTSVDGRKWDGDVGSKFSPNDMANISSAVTATELGPSVSRAPFS  86

Query  481  TARTFQSEFTYSFPVASGRKFLRLYFYPASYN-GLNATNSVFSV  609
            +AR  +S+F+Y+FPV+ G+KFLRLYFYP SY+ GLN T S F+V
Sbjct  87   SARIIRSQFSYTFPVSLGKKFLRLYFYPTSYSGGLNTTESFFNV  130



>ref|XP_008368476.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
FERONIA [Malus domestica]
Length=892

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 66/111 (59%), Gaps = 4/111 (4%)
 Frame = +1

Query  307  YVPTDKILLNCG-GPDGVTDQDNRKWTTDVGSKF--LLGTGKSSTSSADSQKPSVPQVPF  477
            Y P D I L CG   D V  QD R W+ D+ SKF      G SS   A +   S  QVP+
Sbjct  29   YKPVDDITLQCGFSGDQVNQQDGRTWSGDINSKFSPFQAAGSSSVYKAATPIXSSSQVPY  88

Query  478  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNG-LNATNSVFSVRVGEYT  627
             TAR  +SEFTY+FP+ SG+KF+RLYFYP SY    + + S+FSV  G +T
Sbjct  89   TTARLSRSEFTYTFPLTSGQKFIRLYFYPTSYAAEFDRSKSLFSVEAGGFT  139



>ref|XP_008341792.1| PREDICTED: receptor-like protein kinase FERONIA [Malus domestica]
Length=892

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 66/111 (59%), Gaps = 4/111 (4%)
 Frame = +1

Query  307  YVPTDKILLNCG-GPDGVTDQDNRKWTTDVGSKF--LLGTGKSSTSSADSQKPSVPQVPF  477
            Y P D I L CG   D V  QD R W+ D+ SKF      G SS   A +   S  QVP+
Sbjct  29   YKPVDDITLQCGFSGDQVNQQDGRTWSGDINSKFSPFQAAGSSSVYKAATPIXSSSQVPY  88

Query  478  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNG-LNATNSVFSVRVGEYT  627
             TAR  +SEFTY+FP+ SG+KF+RLYFYP SY    + + S+FSV  G +T
Sbjct  89   TTARLSRSEFTYTFPLTSGQKFIRLYFYPTSYAAEFDRSKSLFSVEAGGFT  139



>ref|XP_003614249.1| Kinase-like protein [Medicago truncatula]
 gb|AES97207.1| feronia receptor-like kinase [Medicago truncatula]
Length=833

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 50/113 (44%), Positives = 67/113 (59%), Gaps = 6/113 (5%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDG-VTDQDNRKWTTDVGSKFLLG----TGKSSTSSA-DSQKPSVPQ  468
            YVP++ I+LNCG     +   D R W  D+ S ++        KS T+ A  S   S+P+
Sbjct  28   YVPSENIVLNCGSNTSELVQYDGRIWNGDIDSPYVPSYEDIINKSLTAKALSSNLESIPE  87

Query  469  VPFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            VP+MTAR FQS+FTY F V SG KF+RL+FYP SY   N + +  SV  G +T
Sbjct  88   VPYMTARIFQSQFTYRFNVTSGPKFIRLHFYPFSYLDFNISKAFLSVTAGNFT  140



>ref|XP_007153476.1| hypothetical protein PHAVU_003G038800g [Phaseolus vulgaris]
 gb|ESW25470.1| hypothetical protein PHAVU_003G038800g [Phaseolus vulgaris]
Length=840

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 66/110 (60%), Gaps = 3/110 (3%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQ-DNRKWTTDVGSKFLLGTG--KSSTSSADSQKPSVPQVPF  477
            YVPT+ I+LNCG       Q D R W+ D+ S ++      KS    A +   S+P+ P+
Sbjct  29   YVPTENIVLNCGSSTSEFVQYDGRNWSGDIVSPYVPSNADTKSLVVRAPNTLQSIPEAPY  88

Query  478  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            MTAR F S+FTY+F V  G KF+RL+FYPASY  LN +N+  SV    +T
Sbjct  89   MTARIFHSQFTYTFNVTPGPKFIRLHFYPASYMDLNISNAFLSVSAANFT  138



>ref|XP_009385155.1| PREDICTED: receptor-like protein kinase ANXUR2 [Musa acuminata 
subsp. malaccensis]
Length=852

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 67/103 (65%), Gaps = 2/103 (2%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMT  483
            Y+P+D ILLNCG     TD D RKW  D  SK  L +  S+ ++A  Q P++P  VP+M+
Sbjct  23   YLPSDSILLNCGFSSEATDADGRKWLADSTSKSSLTSKNSAPATALYQDPALPSTVPYMS  82

Query  484  ARTFQSEFTYSFPV-ASGRKFLRLYFYPASYNGLNATNSVFSV  609
            AR F SE TY F V  S R ++RL+FYP++YNGL   NS FSV
Sbjct  83   ARVFNSESTYKFAVNGSERHWVRLHFYPSAYNGLPPENSFFSV  125



>ref|XP_007032823.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
 gb|EOY03749.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
Length=894

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 66/111 (59%), Gaps = 4/111 (4%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKF---LLGTGKSSTSSADSQKPS-VPQVP  474
            Y+P + I ++CG P+  T  D R WT D   KF        +S  S A  Q PS V QVP
Sbjct  42   YIPIENITIDCGSPNDNTALDGRSWTRDNTPKFSPIESQNNQSVYSEAPQQPPSGVGQVP  101

Query  475  FMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            F+TAR  ++EF Y FP+ SG+KF+RLYFYP SY   +   + FSV  GE+T
Sbjct  102  FITARVSKAEFIYVFPLTSGQKFVRLYFYPTSYPPFDPLKAFFSVNTGEFT  152



>ref|XP_007032831.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
 gb|EOY03757.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
Length=884

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 61/109 (56%), Gaps = 2/109 (2%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSST--SSADSQKPSVPQVPFM  480
            Y P D ILL+CG       +D RKW  D  SKF      +S+  S+A  Q  +V QVP+M
Sbjct  26   YSPIDYILLSCGASLNSISEDGRKWIPDEKSKFSTSNSVNSSFASTASRQDHAVTQVPYM  85

Query  481  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            TAR F+  FTYSFPV+ G KFLR YFYP  Y+  +     FSV    Y 
Sbjct  86   TARVFRDIFTYSFPVSPGLKFLRFYFYPVKYSDFDGHTFFFSVTANNYV  134



>ref|NP_198716.1| putative receptor-like protein kinase [Arabidopsis thaliana]
 sp|Q9FID8.1|Y5900_ARATH RecName: Full=Putative receptor-like protein kinase At5g39000; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB10824.1| receptor-like protein kinase [Arabidopsis thaliana]
 gb|AED94385.1| putative receptor-like protein kinase [Arabidopsis thaliana]
Length=873

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 61/110 (55%), Gaps = 4/110 (4%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLG--TGKSSTSSADSQKPSVPQVPFM  480
            Y PTD  L NCG      D   R WT +   K L       S T+ A  Q+  V Q+P+M
Sbjct  26   YEPTDVFLFNCGDTSNNVDVSGRNWTAE-NQKILSSNLVNASFTAQASYQESGVSQIPYM  84

Query  481  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNG-LNATNSVFSVRVGEYT  627
            TAR F+SEFTYSFPV  G  FLRLYFYP  Y    NA  S FSV+V  +T
Sbjct  85   TARIFRSEFTYSFPVTPGSNFLRLYFYPTRYGSQFNAVKSFFSVKVNGFT  134



>ref|XP_002439522.1| hypothetical protein SORBIDRAFT_09g009320 [Sorghum bicolor]
 gb|EES17952.1| hypothetical protein SORBIDRAFT_09g009320 [Sorghum bicolor]
Length=870

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 66/104 (63%), Gaps = 3/104 (3%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSST-SSADSQKPSVPQ-VPFM  480
            Y P + IL++CG      D D RKW TD GS +L+  GKSS  + AD Q PS+P  VP+M
Sbjct  27   YKPPESILVDCGSAKEGQDADGRKWVTDQGSNWLIDGGKSSIMADADVQDPSLPSPVPYM  86

Query  481  TARTFQSEFTYSFPVA-SGRKFLRLYFYPASYNGLNATNSVFSV  609
            +AR F  E  Y+F +  + R +LRL+FYPA+Y+G+ A    FSV
Sbjct  87   SARVFTKEAVYNFSIGDTDRHWLRLHFYPAAYHGVPAEQFFFSV  130



>ref|XP_008341797.1| PREDICTED: receptor-like protein kinase FERONIA [Malus domestica]
Length=892

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 66/111 (59%), Gaps = 4/111 (4%)
 Frame = +1

Query  307  YVPTDKILLNCG-GPDGVTDQDNRKWTTDVGSKF--LLGTGKSSTSSADSQKPSVPQVPF  477
            Y P + I L CG   D V  QD R W+ D+ SKF      G SS   A +   S  QVP+
Sbjct  29   YKPVBBITLQCGFSGDQVNQQDGRTWSGDINSKFSPFQAAGSSSVYKAATPIYSSSQVPY  88

Query  478  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNG-LNATNSVFSVRVGEYT  627
             TAR  +SEFTY+FP+ SG+KF+RLYFYP SY    + + S+FSV  G +T
Sbjct  89   TTARLSRSEFTYTFPLTSGQKFIRLYFYPTSYAAEFDRSKSLFSVEAGGFT  139



>ref|XP_009388012.1| PREDICTED: receptor-like protein kinase FERONIA, partial [Musa 
acuminata subsp. malaccensis]
Length=532

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 62/106 (58%), Gaps = 0/106 (0%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  486
            YVP D ILLNCG     +  D R WT D G+++      S    A    PSV  VP+ TA
Sbjct  45   YVPRDDILLNCGASGQASSFDRRSWTGDTGTRYAPSLNGSGGFDALRLDPSVSTVPYSTA  104

Query  487  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEY  624
            R F S FTY FP+++G  F+RL+FYP+ Y+   A+++ FSV  G Y
Sbjct  105  RVFTSPFTYRFPLSAGPIFIRLHFYPSDYSNHAASDAFFSVTSGPY  150



>ref|XP_003568703.1| PREDICTED: receptor-like protein kinase ANXUR1 [Brachypodium 
distachyon]
Length=871

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 66/104 (63%), Gaps = 3/104 (3%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSS-TSSADSQKPSVPQ-VPFM  480
            Y PT+ IL++CG      D   RKW  D  SK+L   GKSS  ++AD+Q PS+P  VP+M
Sbjct  28   YEPTETILVDCGSEKDGQDAQGRKWVMDKDSKWLGDGGKSSMMAAADAQDPSLPSPVPYM  87

Query  481  TARTFQSEFTYSFPVASG-RKFLRLYFYPASYNGLNATNSVFSV  609
            +AR F  E  Y+FPVA   R ++RL+FYPA+Y+ L A    FSV
Sbjct  88   SARVFTKEAVYTFPVADADRHWVRLHFYPAAYHDLPAEQFFFSV  131



>gb|KJB11637.1| hypothetical protein B456_001G269100 [Gossypium raimondii]
Length=889

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 68/111 (61%), Gaps = 4/111 (4%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKS--STSSADSQKP--SVPQVP  474
            + PT+ I ++CG P+     D R WT D   K  L   K+  S SS   Q+P  S+ QVP
Sbjct  33   FTPTESITIDCGSPNDNIGLDGRVWTGDSMPKLSLVESKNNKSVSSKAFQQPPSSLGQVP  92

Query  475  FMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            F TAR   SEFTY  P+ SG+KF+RLYF+P SY   +A+ ++FSV+ G+ T
Sbjct  93   FATARASNSEFTYVIPLTSGQKFIRLYFFPTSYPSFDASKALFSVKAGDIT  143



>ref|XP_006338349.1| PREDICTED: receptor-like protein kinase FERONIA-like [Solanum 
tuberosum]
Length=856

 Score = 92.4 bits (228),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 66/111 (59%), Gaps = 4/111 (4%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGT---GKSSTSSADSQKPSVPQVPF  477
            Y  T  +LLNCG     TD+ +R+W TD      L +     S+T++A  Q PSV +VP+
Sbjct  26   YNATVYVLLNCGAQSATTDETDRRWDTDTHFPNFLPSDFSNISTTATASEQDPSVNRVPY  85

Query  478  MT-ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
             T AR  +S FTY+F V+ G KFLRLYFYPA+Y+G N   S FSV     T
Sbjct  86   TTGARIMKSRFTYTFRVSPGAKFLRLYFYPANYSGFNKAESFFSVTANHLT  136



>gb|EMT01093.1| hypothetical protein F775_16963 [Aegilops tauschii]
Length=509

 Score = 91.3 bits (225),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 59/106 (56%), Gaps = 1/106 (1%)
 Frame = +1

Query  313  PTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTAR  489
            P  ++ L+CG     TD D R W  D  S FL  T     + A  Q PS+P  VP+MTAR
Sbjct  35   PAGQVRLSCGSSASATDSDGRAWDGDSASMFLPSTNAGVAARASYQDPSLPSTVPYMTAR  94

Query  490  TFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
             F S  TY+F V  GR FLRLYFYPA Y   +A+ ++F V  G  T
Sbjct  95   VFASSHTYTFLVRPGRVFLRLYFYPADYGNRSASGALFGVTAGGVT  140



>gb|AFW77551.1| putative receptor-like protein kinase family protein [Zea mays]
Length=870

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 62/104 (60%), Gaps = 3/104 (3%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSST-SSADSQKPSVPQ-VPFM  480
            Y PT+ IL+NCG      D D RKW  D    +L+  GKSS    AD Q PS+P  VP+M
Sbjct  26   YKPTESILVNCGSAKEGKDVDGRKWAADQDKSWLVDAGKSSIMGDADVQDPSLPSPVPYM  85

Query  481  TARTFQSEFTYSFPVASG-RKFLRLYFYPASYNGLNATNSVFSV  609
            TAR F  E  Y+F V    R +LRL+FYPA+Y+G+ A    FSV
Sbjct  86   TARVFTKEAMYNFSVGDADRHWLRLHFYPAAYHGVPAEQFFFSV  129



>ref|XP_010914574.1| PREDICTED: receptor-like protein kinase ANXUR2 [Elaeis guineensis]
Length=865

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 66/103 (64%), Gaps = 3/103 (3%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMT  483
            Y PTD ILL+CG     TD D+RKW  D  SKF   +G S+T+ A  Q PS+   VP+MT
Sbjct  29   YTPTDSILLDCGSSADGTDADHRKWAADDSSKF-RPSGNSTTAPAAFQDPSLLSPVPYMT  87

Query  484  ARTFQSEFTYSFPVA-SGRKFLRLYFYPASYNGLNATNSVFSV  609
            AR F SE TY F V+     ++RL+FYP++YN LN  ++ FSV
Sbjct  88   ARIFTSESTYKFAVSDKDHHWIRLHFYPSTYNSLNPEDAYFSV  130



>ref|XP_002519226.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF43090.1| ATP binding protein, putative [Ricinus communis]
Length=854

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 67/99 (68%), Gaps = 4/99 (4%)
 Frame = +1

Query  319  DKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTF  495
            D  +L CG  +  TD D RKW  D  +K++  +G S  ++AD+Q PS+P  VP+MT R F
Sbjct  29   DSYVLACGASNAGTDGDGRKWEPD--TKYVKSSGNSIMATADNQDPSLPSTVPYMTGRLF  86

Query  496  QSEFTYSFPV-ASGRKFLRLYFYPASYNGLNATNSVFSV  609
             S FTY+FPV A GR ++RL+FYP++Y+ L+  N+ FSV
Sbjct  87   TSAFTYTFPVPAKGRLWVRLHFYPSTYSSLDPNNAYFSV  125



>ref|XP_010660597.1| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
 emb|CAN76104.1| hypothetical protein VITISV_015219 [Vitis vinifera]
Length=511

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 66/109 (61%), Gaps = 2/109 (2%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKF-LLGTGKSST-SSADSQKPSVPQVPFM  480
            Y PTD   ++CG    +   DNR W  D  S+F L+   K+S  S A    PSV  VPF 
Sbjct  40   YNPTDIYTVDCGASGNLKAWDNRIWIGDTNSRFSLIEKNKASIISKAAKTSPSVDPVPFA  99

Query  481  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            TAR  + +F Y FPV +G+KF+RL+FYP+S  G + + + FSV++G YT
Sbjct  100  TARLSRFQFAYIFPVTTGQKFIRLHFYPSSVAGFDRSKAFFSVKIGGYT  148



>ref|XP_009365970.1| PREDICTED: receptor-like protein kinase FERONIA [Pyrus x bretschneideri]
Length=659

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 68/114 (60%), Gaps = 7/114 (6%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQ-DNRKWTTDVGSKFL---LGTGKSSTSSADSQKP---SVP  465
            Y P + I +NCGG   + ++ D R W  D+ SKF    L     S +S   + P   SVP
Sbjct  26   YTPVEDITVNCGGSGLLFNKYDQRNWNGDISSKFTPIDLHRAAGSNTSMSKEAPRSFSVP  85

Query  466  QVPFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            Q+P+ T R  +SEFTY F + +G+KF+RLYFYP SY   + + ++FSV+ G +T
Sbjct  86   QIPYTTVRLSRSEFTYRFNLTAGQKFIRLYFYPVSYPDFDRSEALFSVKAGGFT  139



>ref|XP_004306057.1| PREDICTED: receptor-like protein kinase FERONIA [Fragaria vesca 
subsp. vesca]
Length=885

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 70/112 (63%), Gaps = 7/112 (6%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPS--VPQVPFM  480
            Y PTD+I LNCG  D V   +++ W  D+ SK       S++   D+ + S    QVP+ 
Sbjct  27   YTPTDEINLNCGSSDDVV-YESQTWNGDINSKLSPIEVGSASKVMDAPRSSSTAGQVPYT  85

Query  481  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNA----TNSVFSVRVGEY  624
            TAR  +SEFTY  PV+ G+KF+RLYFYPASY  +NA    + S+FSV++G Y
Sbjct  86   TARLSRSEFTYRIPVSPGQKFIRLYFYPASYKAVNANFDRSKSLFSVKLGGY  137



>ref|XP_003633771.1| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
Length=894

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 67/105 (64%), Gaps = 3/105 (3%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFL-LGTGKSSTSSADSQKPSVPQVPFMT  483
            Y PT+   +NCG  +   D   R WT DVGSKF  L  GK ST+S  + KPS   V + T
Sbjct  36   YTPTENFAINCGSSENWQDL-GRNWTGDVGSKFSPLEKGKLSTTS-QADKPSSSSVLYST  93

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVG  618
            AR  + EFTYSFP+ +G+KF+RL+FYP+SY   + + + FSV+ G
Sbjct  94   ARLSRYEFTYSFPLTAGQKFIRLHFYPSSYGEFDGSKAFFSVKTG  138



>ref|XP_010243447.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=825

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 66/109 (61%), Gaps = 3/109 (3%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTD-QDNRKWTTDVGSKFL-LGTGKSSTSSADSQKPSVPQVPFM  480
            YV T ++ ++CG    VT+  D R WT D G K+      + ST     Q  SVPQ+P+M
Sbjct  32   YVTTYQVFVDCGSHGEVTESHDGRNWTGDFGGKYKPYANIRGSTFVVSVQGISVPQIPYM  91

Query  481  TARTFQSEFTYSFP-VASGRKFLRLYFYPASYNGLNATNSVFSVRVGEY  624
            TAR F+S  TY F  V++G KF+RLYFYPASY+ LN + + F V  G Y
Sbjct  92   TARIFRSHLTYKFSDVSAGPKFIRLYFYPASYSNLNQSYAFFDVSAGPY  140



>gb|KJB80425.1| hypothetical protein B456_013G096400 [Gossypium raimondii]
Length=519

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 63/110 (57%), Gaps = 4/110 (4%)
 Frame = +1

Query  307  YVPTDKILLNCGGPD-GVTDQDNRKWTTDVGSKFLLGTGKSS--TSSADSQKPSVPQVPF  477
            Y P + ILL+CG         D R WT D  S F     +SS   S A  ++ SV +VP+
Sbjct  24   YFPLETILLDCGSSALRALSYDGRNWTND-SSHFGASNSESSFAMSRASLEETSVAEVPY  82

Query  478  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            MTAR F S FTY+F V  G KF+RL+FYP SY  LNA+ S  +V  G YT
Sbjct  83   MTARLFHSRFTYTFNVTPGSKFIRLHFYPDSYMNLNASKSFLTVTAGNYT  132



>gb|EMT03407.1| Receptor-like protein kinase FERONIA [Aegilops tauschii]
Length=778

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 59/99 (60%), Gaps = 2/99 (2%)
 Frame = +1

Query  316  TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVP-QVPFMTART  492
            T  ILLNCG      D   R W  D GSKF     K   ++A  Q PS+P + PFMTAR 
Sbjct  32   TGLILLNCGASSQNIDDSGRTWDGDSGSKFTPSV-KGVATNASYQDPSLPSRTPFMTARI  90

Query  493  FQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSV  609
            F S +TYSFPV+ GR FLRLYFYP +Y     +++VF V
Sbjct  91   FTSSYTYSFPVSPGRTFLRLYFYPIAYGNYTVSDAVFRV  129



>ref|XP_007227151.1| hypothetical protein PRUPE_ppa026453mg [Prunus persica]
 gb|EMJ28350.1| hypothetical protein PRUPE_ppa026453mg [Prunus persica]
Length=860

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 69/106 (65%), Gaps = 4/106 (4%)
 Frame = +1

Query  316  TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVP-QVPFMTART  492
            TD  +++CG   G TD D RKW +D  S+FL  + KS+T++A  Q PS+P QVP+M+AR 
Sbjct  28   TDSYVISCGSSSGGTDSDGRKWASD--SQFLTSSYKSNTATAQYQDPSLPSQVPYMSARI  85

Query  493  FQSEFTYSFPVASGRKFL-RLYFYPASYNGLNATNSVFSVRVGEYT  627
            F S  +Y F V+  ++ L RL+FYP SYN L+ +NS F V    +T
Sbjct  86   FNSASSYKFSVSPKQRLLVRLHFYPTSYNSLDPSNSYFDVVANGFT  131



>gb|EMS66619.1| hypothetical protein TRIUR3_14353 [Triticum urartu]
Length=503

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 60/103 (58%), Gaps = 1/103 (1%)
 Frame = +1

Query  322  KILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQ  498
            ++ L+CG     TD D R W  D  SKFL  T     + A  Q PS+P  VP++TAR F 
Sbjct  31   QVRLSCGASAPATDSDGRAWEGDSTSKFLASTNAGVAARASYQDPSLPSSVPYVTARVFA  90

Query  499  SEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            S  TY+F V+ GR FLRLYFYPA Y   +A+ ++F V  G  T
Sbjct  91   SSHTYTFLVSPGRVFLRLYFYPADYGNRSASGALFGVTAGGVT  133



>ref|XP_002272797.2| PREDICTED: receptor-like protein kinase ANXUR1 [Vitis vinifera]
 emb|CBI22880.3| unnamed protein product [Vitis vinifera]
Length=857

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 67/102 (66%), Gaps = 4/102 (4%)
 Frame = +1

Query  328  LLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQSE  504
            +L+CG   G  D D RKW  D  +KFL   GKS +++A  Q PS+P  VP+M+AR F SE
Sbjct  36   ILSCGDSSGGADADGRKWVPD--TKFLASPGKSISATAQLQDPSLPSPVPYMSARIFTSE  93

Query  505  FTYSFPVA-SGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
             TY F V+   R ++RL+FYP+ Y+ LNA++S FSV  G +T
Sbjct  94   STYQFSVSPKNRLWVRLHFYPSFYSALNASDSFFSVTAGGFT  135



>emb|CBI21198.3| unnamed protein product [Vitis vinifera]
Length=932

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 66/109 (61%), Gaps = 2/109 (2%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKF-LLGTGKSST-SSADSQKPSVPQVPFM  480
            Y PTD   ++CG    +   DNR W  D  S+F L+   K+S  S A    PSV  VPF 
Sbjct  61   YNPTDIYTVDCGASGNLKAWDNRIWIGDTNSRFSLIEKNKASIISKAAKTSPSVDPVPFA  120

Query  481  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            TAR  + +F Y FPV +G+KF+RL+FYP+S  G + + + FSV++G YT
Sbjct  121  TARLSRFQFAYIFPVTTGQKFIRLHFYPSSVAGFDRSKAFFSVKIGGYT  169



>ref|XP_010552466.1| PREDICTED: putative receptor-like protein kinase At5g39000 [Tarenaya 
hassleriana]
Length=964

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 70/112 (63%), Gaps = 7/112 (6%)
 Frame = +1

Query  307  YVPTDKILLNCGGP-DGVTDQDNRKWTTDVGSKFLLGT---GKSSTSSADSQKPSVPQVP  474
            Y  TD +L+NCG     + DQ  R W+ +   + LL     G S  ++A  Q+PSV QVP
Sbjct  85   YNATDLLLVNCGATGSNIADQSGRIWSAE--DRRLLSANSNGSSFPATASVQEPSVEQVP  142

Query  475  FMTARTFQSEFTYSFPVASGRKFLRLYFYPASY-NGLNATNSVFSVRVGEYT  627
            +MTAR F+S+F YSFPV+ G KF+RLYFYP  Y +  +A NS F+V V  ++
Sbjct  143  YMTARIFRSDFRYSFPVSPGWKFVRLYFYPTRYGSDFDAVNSYFAVTVNGFS  194



>emb|CDY37884.1| BnaC04g31220D [Brassica napus]
Length=867

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 61/110 (55%), Gaps = 3/110 (3%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSS-TSSADSQKPSVPQVPFMT  483
            YVPTD  L NCG      D   R W  +  +        +S  S A  Q   VPQVP+MT
Sbjct  44   YVPTDIFLFNCGETSNQMDISGRNWMAEQPNILPSNAAIASFVSHASFQGSGVPQVPYMT  103

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNG--LNATNSVFSVRVGEYT  627
            AR F+ +FTYSFPV+ G KFLRLYFYP  Y+     A NS FSV V  +T
Sbjct  104  ARIFRHDFTYSFPVSPGWKFLRLYFYPTRYSSDLEAAVNSYFSVTVNGFT  153



>gb|EYU46822.1| hypothetical protein MIMGU_mgv1a022107mg [Erythranthe guttata]
Length=886

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 68/110 (62%), Gaps = 6/110 (5%)
 Frame = +1

Query  310  VPTDKILLNCGGPD-GVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMT  483
             P   ++L CG  D G  D D RKW  D   K+++   K++ + AD Q PS+   +P+MT
Sbjct  25   APNPPLVLTCGSSDAGGNDPDGRKWDPD--DKYIISGDKTTAAKADYQDPSLSSTIPYMT  82

Query  484  ARTFQSEFTYSFPV--ASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR FQSE TY FP+  ++ R  LRL+FYP+SY   N +NS FSV  G++T
Sbjct  83   ARIFQSETTYQFPLQNSTSRTLLRLHFYPSSYPNFNISNSYFSVVAGKFT  132



>ref|XP_008223394.1| PREDICTED: receptor-like protein kinase ANXUR1 [Prunus mume]
Length=860

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 68/106 (64%), Gaps = 4/106 (4%)
 Frame = +1

Query  316  TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVP-QVPFMTART  492
            +D  +++CG   G TD D RKW +D  S+FL  + KS+T++A  Q PS+P QVP+M+AR 
Sbjct  28   SDSYVISCGSSSGGTDSDGRKWASD--SQFLTSSDKSNTATAQYQDPSLPSQVPYMSARI  85

Query  493  FQSEFTYSFPVASGRKFL-RLYFYPASYNGLNATNSVFSVRVGEYT  627
            F S  +Y F V+  ++ L RL+FYP SYN L  +NS F V    +T
Sbjct  86   FNSASSYKFSVSPKQRLLVRLHFYPTSYNSLEPSNSYFDVVANGFT  131



>ref|XP_006488842.1| PREDICTED: receptor-like protein kinase ANXUR1-like [Citrus sinensis]
Length=862

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 68/102 (67%), Gaps = 4/102 (4%)
 Frame = +1

Query  328  LLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQSE  504
            +L CG     TD ++RKWT+D  SKFL  +G S T++A SQ  S+P  +P+MTAR F+S 
Sbjct  37   VLACGASSDGTDSNDRKWTSD--SKFLTNSGNSITATAQSQDSSLPSTIPYMTARIFKST  94

Query  505  FTYSFPVASGRKF-LRLYFYPASYNGLNATNSVFSVRVGEYT  627
             +Y F V+S  +F LRL+FYPASY  L+ +N+ FSV    +T
Sbjct  95   SSYKFTVSSKDRFWLRLHFYPASYGNLDPSNAYFSVNANGFT  136



>ref|XP_011099029.1| PREDICTED: receptor-like protein kinase FERONIA [Sesamum indicum]
Length=885

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 67/109 (61%), Gaps = 2/109 (2%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLL--GTGKSSTSSADSQKPSVPQVPFM  480
            Y  TD ILLNCG P  + D  +R W +D  S++        S +S A S  PSV  VP+ 
Sbjct  29   YTATDLILLNCGSPSNLNDTSSRSWDSDERSRYAPPNAASISLSSMASSMAPSVFHVPYQ  88

Query  481  TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            TAR F+S FTY+FPV +G KFLRLYFYP +Y+G N + S FSV    +T
Sbjct  89   TARVFRSSFTYAFPVLTGPKFLRLYFYPDTYSGFNTSQSFFSVTANGFT  137



>ref|XP_006419383.1| hypothetical protein CICLE_v10004295mg [Citrus clementina]
 gb|ESR32623.1| hypothetical protein CICLE_v10004295mg [Citrus clementina]
Length=862

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 68/102 (67%), Gaps = 4/102 (4%)
 Frame = +1

Query  328  LLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQSE  504
            +L CG     TD ++RKWT+D  SKFL  +G S T++A SQ  S+P  +P+MTAR F+S 
Sbjct  37   VLACGASSDGTDSNDRKWTSD--SKFLTNSGNSITATAQSQDSSLPSTIPYMTARIFKST  94

Query  505  FTYSFPVASGRKF-LRLYFYPASYNGLNATNSVFSVRVGEYT  627
             +Y F V+S  +F LRL+FYPASY  L+ +N+ FSV    +T
Sbjct  95   SSYKFTVSSKDRFWLRLHFYPASYGNLDPSNAYFSVNANGFT  136



>gb|KDO71938.1| hypothetical protein CISIN_1g041565mg [Citrus sinensis]
Length=862

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 68/102 (67%), Gaps = 4/102 (4%)
 Frame = +1

Query  328  LLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQSE  504
            +L CG     TD ++RKWT+D  SKFL  +G S T++A SQ  S+P  +P+MTAR F+S 
Sbjct  37   VLACGASSDGTDSNDRKWTSD--SKFLTNSGNSITATAQSQDSSLPSTIPYMTARIFKST  94

Query  505  FTYSFPVASGRKF-LRLYFYPASYNGLNATNSVFSVRVGEYT  627
             +Y F V+S  +F LRL+FYPASY  L+ +N+ FSV    +T
Sbjct  95   SSYKFTVSSKDRFWLRLHFYPASYGNLDPSNAYFSVNANGFT  136



>ref|XP_004154759.1| PREDICTED: receptor-like protein kinase FERONIA-like [Cucumis 
sativus]
Length=892

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 63/107 (59%), Gaps = 5/107 (5%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQ-DNRKWTTDVGSKFL----LGTGKSSTSSADSQKPSVPQV  471
            Y P D ILLNCG  + ++   DNR WT DV SKF          S TS AD+Q  S   V
Sbjct  33   YKPIDDILLNCGTSETLSASGDNRPWTGDVQSKFFPSDFHQNRASVTSQADTQSSSPNVV  92

Query  472  PFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVR  612
            P+ TAR   S FTYSFPV+ G KF+RLYFY A Y   +   +VFSV+
Sbjct  93   PYSTARLSHSNFTYSFPVSPGPKFIRLYFYSAFYLNFDRYKAVFSVK  139



>gb|KDP37883.1| hypothetical protein JCGZ_05765 [Jatropha curcas]
Length=441

 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 65/111 (59%), Gaps = 7/111 (6%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQ-DNRKWTTDVGSKFLLGTGKSSTSS---ADSQKPSVPQVP  474
            Y P + I L+CG PD  T   D R WT+D      +   KS+ +    + S +P VPQVP
Sbjct  11   YEPLENIALDCGSPDLRTLPFDGRNWTSDAS---FISQSKSTVAPIMVSSSIEPGVPQVP  67

Query  475  FMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            + TAR F SEFTY+F +  G KFLRL+FYP SY G +A+    SV  G +T
Sbjct  68   YKTARLFFSEFTYTFNLTPGPKFLRLHFYPTSYPGFDASKEFLSVMEGNHT  118



>ref|XP_004137257.1| PREDICTED: receptor-like protein kinase FERONIA-like [Cucumis 
sativus]
 gb|KGN53794.1| hypothetical protein Csa_4G129600 [Cucumis sativus]
Length=892

 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 63/107 (59%), Gaps = 5/107 (5%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQ-DNRKWTTDVGSKFL----LGTGKSSTSSADSQKPSVPQV  471
            Y P D ILLNCG  + ++   DNR WT DV SKF          S TS AD+Q  S   V
Sbjct  33   YKPIDDILLNCGTSETLSASGDNRPWTGDVQSKFFPSDFHQNRASVTSQADTQSSSPNVV  92

Query  472  PFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVR  612
            P+ TAR   S FTYSFPV+ G KF+RLYFY A Y   +   +VFSV+
Sbjct  93   PYSTARLSHSNFTYSFPVSPGPKFIRLYFYSAFYLNFDRYKAVFSVK  139



>gb|EMT13360.1| hypothetical protein F775_08521 [Aegilops tauschii]
Length=499

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 57/103 (55%), Gaps = 1/103 (1%)
 Frame = +1

Query  322  KILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQ  498
            ++ L+CG     TD D R W  D  SKFL        + A  Q PS+P  VP+M AR F 
Sbjct  33   QVRLSCGASASATDSDGRAWDGDSASKFLTSANAGVAARASYQDPSLPSSVPYMMARVFA  92

Query  499  SEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            S  TY+F V  GR FLRL+FYP  Y   NA++++F V  G  T
Sbjct  93   SSHTYTFLVRPGRAFLRLFFYPTDYGNRNASSALFGVTAGGVT  135



>gb|KJB48087.1| hypothetical protein B456_008G053200 [Gossypium raimondii]
Length=851

 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 64/112 (57%), Gaps = 5/112 (4%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDV--GSKFLLGTGKSSTS---SADSQKPSVPQV  471
            +   + I LNCG      D + R+W  D   GSKF+     + TS    A +  PS+  V
Sbjct  22   FTDAENIFLNCGSSSNSIDLNGREWAGDSTPGSKFIASHQPNETSIVSKATNLNPSIDPV  81

Query  472  PFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            P++TAR FQS FTYSFPV  G KFLRL+F P++Y+G  +    F+V  G +T
Sbjct  82   PYLTARIFQSPFTYSFPVTPGHKFLRLFFNPSAYHGFQSPGDFFTVTAGPFT  133



>ref|XP_002512045.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50714.1| conserved hypothetical protein [Ricinus communis]
Length=839

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 68/111 (61%), Gaps = 6/111 (5%)
 Frame = +1

Query  307  YVPTDKILLNCGGP-DGVTDQ-DNRKWTTDVGSKFLLGTGKS----STSSADSQKPSVPQ  468
            Y P + I L+CG   D  T   D R WT DVGSKF      S    ST+S   +   +P+
Sbjct  36   YAPLENIALDCGSSFDSQTLSFDGRNWTGDVGSKFTAFNSHSNSTLSTASFFDEAIGIPE  95

Query  469  VPFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGE  621
            VP+ TAR F S+FTY+F V  G KF+RL+FYP+SY+GLNA+ +  SV  G+
Sbjct  96   VPYKTARLFYSKFTYTFNVTPGPKFVRLHFYPSSYSGLNASRAFLSVIDGD  146



>emb|CDP05402.1| unnamed protein product [Coffea canephora]
Length=892

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 63/108 (58%), Gaps = 2/108 (2%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  486
            Y P D IL+NCG     T  D R W  D GSKF      ++ S A +       VP++TA
Sbjct  26   YSPIDYILINCGLSSNATSADGRNWYGDAGSKFT-PIDMANISLAVTATEQGLSVPYLTA  84

Query  487  RTFQSEFTYSFPVASGRKFLRLYFYPASYNG-LNATNSVFSVRVGEYT  627
            R  +S F+Y+FPV+ G+KF+RLYF PASY+   NAT S F+V    YT
Sbjct  85   RIIRSNFSYTFPVSPGKKFVRLYFNPASYSSDFNATESFFAVMANNYT  132



>gb|ACA25095.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 65/106 (61%), Gaps = 4/106 (4%)
 Frame = +1

Query  316  TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTART  492
            +D  +L CG     TD D R W  D  +K +   G S TS+A++Q PS+P  +P+MTAR 
Sbjct  34   SDSYILACGASGAGTDSDGRDWQPD--AKHINSPGNSITSTAENQDPSLPSTIPYMTARI  91

Query  493  FQSEFTYSFPVAS-GRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            F SE TY F V +  R ++RL+FYP++Y+ L+  NS FSV    +T
Sbjct  92   FTSESTYKFSVPTKSRLWVRLHFYPSTYSSLDPNNSYFSVTANSFT  137



>emb|CDY37883.1| BnaC04g31230D [Brassica napus]
Length=793

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 61/108 (56%), Gaps = 1/108 (1%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  486
            Y PTD  L+NCG      D  ++ WT+D            S SS  S +  VPQVP+ TA
Sbjct  25   YKPTDLFLINCGTSSDTIDSQSQTWTSDQQHLLTSNLDNVSFSSNASYQEEVPQVPYTTA  84

Query  487  RTFQSEFTYSFPVASGRKFLRLYFYPASY-NGLNATNSVFSVRVGEYT  627
            R F S   YSFPV+ G K+LRLYFYP  Y +G +A +S FSV V  +T
Sbjct  85   RVFLSNVDYSFPVSPGWKYLRLYFYPTRYESGFDAASSFFSVTVNGFT  132



>ref|XP_011079535.1| PREDICTED: receptor-like protein kinase ANXUR1 [Sesamum indicum]
Length=894

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 62/104 (60%), Gaps = 5/104 (5%)
 Frame = +1

Query  325  ILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQS  501
            ++LNCG      D D R W TD   K++L   K   + +D+Q PS+P  VP+MTAR F+S
Sbjct  40   LILNCGSSASEKDADERTWETD--EKYILSPDKGVMTKSDTQDPSLPSTVPYMTARIFKS  97

Query  502  EFTYSFPV--ASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            E  Y  P+  ++ R  LRL+FYP+SY   N +NS FSV  G  T
Sbjct  98   ETAYLLPLQNSTSRTLLRLHFYPSSYPNFNISNSYFSVTAGRVT  141



>ref|XP_002277565.2| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
Length=892

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 63/107 (59%), Gaps = 2/107 (2%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  486
            Y PTD+ILL+ G     T  D R W+ D GSKF         + AD +  S   VP+ TA
Sbjct  59   YPPTDEILLDTGSSGNSTGDDGRPWSGDNGSKFAPSPQSKEATLADPR--SAIGVPYSTA  116

Query  487  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            R  +S FTY+FPV  G KF+RLYFYP SY+ L  + ++FSV  G YT
Sbjct  117  RFSRSRFTYTFPVTDGPKFVRLYFYPTSYSELEGSKALFSVSSGPYT  163



>ref|XP_004499644.1| PREDICTED: uncharacterized protein LOC101500653 [Cicer arietinum]
Length=672

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 54/80 (68%), Gaps = 2/80 (3%)
 Frame = +1

Query  304  DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  483
            D+ PTD+ILLNCG P    D D R  +TD G  F  G+G S+ S   +   +VPQVPFMT
Sbjct  534  DFKPTDQILLNCGDPILSLDLDGRSCSTDRGLNF--GSGNSTMSEVATNDLAVPQVPFMT  591

Query  484  ARTFQSEFTYSFPVASGRKF  543
            AR F+S +TYSFPVASG+K 
Sbjct  592  ARIFESPYTYSFPVASGKKI  611



>ref|XP_010660579.1| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
Length=522

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 69/111 (62%), Gaps = 7/111 (6%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGK----SSTSSADSQKPSVPQVP  474
            Y PTD I L+CG     T  D R WT D+GS  +L T +    +  + A  Q P V  +P
Sbjct  39   YNPTDNIALDCGSSGNSTASDGRAWTGDIGS--ILATLQPLDTTIAARAIRQGP-VEGIP  95

Query  475  FMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            ++TAR   S+FTY+F V++G KF+RLYFYP+ Y G + + ++FSV+ G +T
Sbjct  96   YLTARMSSSQFTYTFLVSAGLKFVRLYFYPSWYPGFDRSKALFSVKSGPFT  146



>dbj|BAJ88190.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96628.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=825

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 62/101 (61%), Gaps = 4/101 (4%)
 Frame = +1

Query  325  ILLNCGGPDGVTDQDN--RKWTTDVGSKFLLGTGKSSTSSADSQKPSVP-QVPFMTARTF  495
            ILLNCGG +   D D+  R W  D  SKF    G  + +SA  + PS+P  VP+MTAR F
Sbjct  33   ILLNCGGSNQYDDDDSGGRTWDGDTTSKFTPSVGGVA-ASATYRDPSLPSMVPYMTARIF  91

Query  496  QSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVG  618
             S  TYSFP+  GR FLRLYFYPA+Y     +++ F+V  G
Sbjct  92   TSNSTYSFPITPGRMFLRLYFYPAAYGNYAVSDASFAVTAG  132



>gb|ACA25089.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 65/106 (61%), Gaps = 4/106 (4%)
 Frame = +1

Query  316  TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTART  492
            +D  +L CG     TD D R W  D  +K +   G S TS+A++Q PS+P  +P+MTAR 
Sbjct  34   SDSYILACGASGAGTDSDGRDWQPD--AKHINSPGNSITSTAENQDPSLPSTIPYMTARI  91

Query  493  FQSEFTYSFPVAS-GRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            F +E TY F V +  R ++RL+FYP++Y+ L+  NS FSV    +T
Sbjct  92   FTTESTYKFSVPTKSRLWVRLHFYPSTYSSLDPNNSYFSVTANSFT  137



>gb|ACA25088.1| serine/threonine protein kinase A, partial [Populus tremula]
 gb|ACA25091.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 64/106 (60%), Gaps = 4/106 (4%)
 Frame = +1

Query  316  TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTART  492
            +D  +L CG     TD D R W  D  +K +   G S TS+A++Q PS P  +P+MTAR 
Sbjct  34   SDSYILACGASGAGTDSDGRDWQPD--AKHINSPGNSITSTAENQDPSFPSTIPYMTARI  91

Query  493  FQSEFTYSFPVAS-GRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            F SE TY F V +  R ++RL+FYP++Y+ L+  NS FSV    +T
Sbjct  92   FTSESTYKFSVPTKSRLWVRLHFYPSTYSSLDPNNSYFSVTANSFT  137



>ref|XP_009373799.1| PREDICTED: receptor-like protein kinase FERONIA [Pyrus x bretschneideri]
Length=890

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 64/111 (58%), Gaps = 4/111 (4%)
 Frame = +1

Query  307  YVPTDKILLNCG-GPDGVTDQDNRKWTTDVGSKFL--LGTGKSSTSSADSQKPSVPQVPF  477
            Y P D I L CG   D V  QD R W+ D+ SKF      G SS   A +   S  QVP+
Sbjct  29   YKPVDDITLQCGFSGDQVNQQDGRTWSGDINSKFSPSQAAGSSSVLKAATPISSSSQVPY  88

Query  478  MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNG-LNATNSVFSVRVGEYT  627
             TAR  +SEFTY+FP+ SG+KF+RL FYP  Y    + + S+FSV  G +T
Sbjct  89   TTARLSRSEFTYTFPLTSGQKFIRLSFYPTFYAAEFDRSKSLFSVEAGGFT  139



>gb|ACA25086.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 64/106 (60%), Gaps = 4/106 (4%)
 Frame = +1

Query  316  TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTART  492
            +D  +L CG     TD D R W  D  +K +   G S TS+A++Q PS P  +P+MTAR 
Sbjct  34   SDSYILACGASGAGTDSDGRDWQPD--AKHINSPGNSITSTAENQDPSFPSTIPYMTARI  91

Query  493  FQSEFTYSFPVAS-GRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            F SE TY F V +  R ++RL+FYP++Y+ L+  NS FSV    +T
Sbjct  92   FTSESTYKFSVPTKSRLWVRLHFYPSTYSSLDPNNSYFSVTANSFT  137



>ref|XP_011013067.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
FERONIA [Populus euphratica]
Length=905

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 63/108 (58%), Gaps = 2/108 (2%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  486
            YVP D I L+CG       +D R WT D+ SK  L    S +++  +   S   VP+ TA
Sbjct  50   YVPLDSIALDCGSSADSVGKD-RNWTADINSKVALQVQDSPSTNLTANGASTSSVPYYTA  108

Query  487  RTFQSEFTYSFPV-ASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            R   S+FTY+FPV  +G KF+RL+F PASY G N + + FSV  G YT
Sbjct  109  RVSLSQFTYTFPVTTTGPKFVRLHFNPASYTGFNRSKASFSVTTGRYT  156



>gb|ACA25096.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 82.8 bits (203),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 64/106 (60%), Gaps = 4/106 (4%)
 Frame = +1

Query  316  TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTART  492
            +D  +L CG     TD D R W  D  +K +   G S TS+A++Q PS P  +P+MTAR 
Sbjct  34   SDSYILACGASGAGTDSDGRDWQPD--AKHINSPGNSITSTAENQDPSFPSTIPYMTARI  91

Query  493  FQSEFTYSFPVAS-GRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            F SE TY F V +  R ++RL+FYP++Y+ L+  NS FSV    +T
Sbjct  92   FTSESTYKFSVPTKSRLWVRLHFYPSTYSSLDPNNSYFSVTANSFT  137



>ref|XP_003580431.1| PREDICTED: receptor-like protein kinase FERONIA [Brachypodium 
distachyon]
Length=514

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 61/104 (59%), Gaps = 2/104 (2%)
 Frame = +1

Query  322  KILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTF-  495
            +I LNCG     TD D R W  D  SKF      ++ +SA  + PS+P  VP+ TAR F 
Sbjct  34   QIRLNCGESGSATDADGRAWAGDAASKFAPSMPDAAAASASYKDPSLPSLVPYTTARVFA  93

Query  496  QSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
             S +TYSF V  GR FLRLYFYP++Y    A++++F V  G  T
Sbjct  94   SSSYTYSFLVRPGRAFLRLYFYPSNYGTHAASDALFGVTAGGVT  137



>ref|XP_008464586.1| PREDICTED: receptor-like protein kinase FERONIA [Cucumis melo]
Length=914

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 64/107 (60%), Gaps = 5/107 (5%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTD-QDNRKWTTDVGSKFL----LGTGKSSTSSADSQKPSVPQV  471
            Y P D ILLNCG  + ++    NR WT DV SKF          S T  A++Q  S+  V
Sbjct  55   YKPIDDILLNCGTSETLSVFGQNRPWTGDVQSKFFPSDFHQNRASVTLQANTQSSSLNVV  114

Query  472  PFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVR  612
            P+ TAR   S FTYSFPV+SG KF+RLYFY A Y+  +   +VFSV+
Sbjct  115  PYSTARLSHSNFTYSFPVSSGPKFIRLYFYSAFYSNFDRYKAVFSVK  161



>ref|NP_001238536.1| receptor-like kinase [Glycine max]
 gb|ACM89485.1| receptor-like kinase [Glycine max]
Length=1123

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 65/107 (61%), Gaps = 2/107 (2%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  486
            Y P + + +NCG     + +D R WT D+   FL+   + ++ +A +  P+  + P+  A
Sbjct  279  YSPDELLSINCGSSSNFSSRDGRNWTVDI--NFLIAESRVNSVAAPALTPTTQEGPYTYA  336

Query  487  RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            R  +S+FTYSFPV +G KFLRL+F+  SY+  +  N+ FSV+ G YT
Sbjct  337  RLSRSQFTYSFPVTAGPKFLRLFFHSTSYHNFDRPNAYFSVKAGSYT  383



>ref|NP_001055184.1| Os05g0318700 [Oryza sativa Japonica Group]
 dbj|BAF17098.1| Os05g0318700, partial [Oryza sativa Japonica Group]
Length=798

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 60/97 (62%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  ILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQS  501
            I LNCG      D  NR W  D  SKF     K + + A  Q PS+P  VP+MTAR F S
Sbjct  35   IFLNCGASGVQPDSYNRSWDGDASSKFAPSV-KGNVARASYQDPSLPSPVPYMTARFFTS  93

Query  502  EFTYSFPVASGRKFLRLYFYPASYNG-LNATNSVFSV  609
             +TYSFPV+ GR F+RL+FYP +YNG L++ N+ F V
Sbjct  94   NYTYSFPVSPGRMFVRLHFYPTNYNGNLDSANAYFGV  130



>gb|EAY97521.1| hypothetical protein OsI_19449 [Oryza sativa Indica Group]
Length=859

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 60/97 (62%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  ILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQS  501
            I LNCG      D  NR W  D  SKF     K + + A  Q PS+P  VP+MTAR F S
Sbjct  13   IFLNCGASGVQPDSYNRSWDGDASSKFAPSV-KGNVARASYQDPSLPSPVPYMTARFFTS  71

Query  502  EFTYSFPVASGRKFLRLYFYPASYNG-LNATNSVFSV  609
             +TYSFPV+ GR F+RL+FYP +YNG L++ N+ F V
Sbjct  72   NYTYSFPVSPGRMFVRLHFYPTNYNGNLDSANAYFGV  108



>gb|EEE63237.1| hypothetical protein OsJ_18047 [Oryza sativa Japonica Group]
Length=859

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 60/97 (62%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  ILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQS  501
            I LNCG      D  NR W  D  SKF     K + + A  Q PS+P  VP+MTAR F S
Sbjct  13   IFLNCGASGVQPDSYNRSWDGDASSKFAPSV-KGNVARASYQDPSLPSPVPYMTARFFTS  71

Query  502  EFTYSFPVASGRKFLRLYFYPASYNG-LNATNSVFSV  609
             +TYSFPV+ GR F+RL+FYP +YNG L++ N+ F V
Sbjct  72   NYTYSFPVSPGRMFVRLHFYPTNYNGNLDSANAYFGV  108



>gb|EYU38427.1| hypothetical protein MIMGU_mgv1a001092mg [Erythranthe guttata]
Length=892

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 68/104 (65%), Gaps = 6/104 (6%)
 Frame = +1

Query  319  DKILLNCGGPDGVTDQ-DNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQV-PFMTART  492
            + ++L+CG  D + D+ D   W  D  +K+L+   KS++  A+ Q PS+P V P+MTART
Sbjct  36   NSLVLSCGSSDAIKDESDGSTWQPD--AKYLVVDDKSTSVKAEIQDPSLPSVIPYMTART  93

Query  493  FQSEFTYSFPV--ASGRKFLRLYFYPASYNGLNATNSVFSVRVG  618
            FQS+ TY FP+  ++ R  LRL+FYP+SY   N +NS FSV  G
Sbjct  94   FQSQSTYQFPLQNSTSRTLLRLHFYPSSYPNFNISNSYFSVVAG  137



>ref|XP_002530992.1| kinase, putative [Ricinus communis]
 gb|EEF31380.1| kinase, putative [Ricinus communis]
Length=904

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSAD--SQKPSVPQVPFM  480
            Y+P D I L+CG P    D ++R W  D  + F L    S+   A+  + +  +  VP+ 
Sbjct  44   YIPLDNIALDCGSPSNGPDMNHRNWIADT-NFFDLQHNASTPLQANESASRKGLDSVPYA  102

Query  481  TARTFQSEFTYSFPVA-SGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            TAR   S+FTYSFP+  +G KF+RLYFYPASY+  + +N+ FSV+ G YT
Sbjct  103  TARLSFSQFTYSFPITTAGPKFVRLYFYPASYSDFDMSNAYFSVQAGRYT  152



>gb|ACA25098.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 82.4 bits (202),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 63/106 (59%), Gaps = 4/106 (4%)
 Frame = +1

Query  316  TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTART  492
            +D  +L CG     TD D R W  D  +K +   G S TS+A+ Q PS P  +P+MTAR 
Sbjct  34   SDSYILACGASGAGTDSDGRDWQPD--AKHINSPGNSITSTAEKQDPSFPSTIPYMTARI  91

Query  493  FQSEFTYSFPVAS-GRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            F SE TY F V +  R ++RL+FYP++Y+ L+  NS FSV    +T
Sbjct  92   FTSESTYKFSVPTKSRLWVRLHFYPSTYSSLDPNNSYFSVTANSFT  137



>ref|XP_006593699.1| PREDICTED: receptor-like protein kinase FERONIA-like [Glycine 
max]
Length=702

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 65/108 (60%), Gaps = 2/108 (2%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLG-TGKSSTSSADSQKPSVPQVPFMT  483
            Y P D   ++CG   G+     R WT D  +K+L G  G +  + A +Q PSV QVP+ T
Sbjct  25   YTPEDNFTISCG-TTGIVFDGQRTWTGDADTKYLSGGQGSTVLTQAATQDPSVNQVPYTT  83

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR   S+F YSFPV++G KF+RL+FYPA Y     T++ FSV+   +T
Sbjct  84   ARLSPSQFNYSFPVSAGPKFVRLFFYPADYPSFPRTDASFSVQSNGFT  131



>gb|KHN07116.1| Receptor-like protein kinase FERONIA [Glycine soja]
Length=869

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 65/108 (60%), Gaps = 2/108 (2%)
 Frame = +1

Query  307  YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLG-TGKSSTSSADSQKPSVPQVPFMT  483
            Y P D   ++CG   G+     R WT D  +K+L G  G +  + A +Q PSV QVP+ T
Sbjct  25   YTPEDNFTISCG-TTGIVFDGQRTWTGDADTKYLSGGQGSTVLTQAATQDPSVNQVPYTT  83

Query  484  ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
            AR   S+F YSFPV++G KF+RL+FYPA Y     T++ FSV+   +T
Sbjct  84   ARLSPSQFNYSFPVSAGPKFVRLFFYPADYPSFPRTHASFSVQSNGFT  131



>ref|XP_009799586.1| PREDICTED: receptor-like protein kinase ANXUR1 [Nicotiana sylvestris]
Length=860

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 64/102 (63%), Gaps = 5/102 (5%)
 Frame = +1

Query  328  LLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPS-VPQVPFMTARTFQSE  504
            +L CG     TD D R W+ D      L +G S TS A  Q PS V  +P+MTAR F+++
Sbjct  36   VLACGATSNATDADGRIWSPDSTH---LPSGNSITSKAKYQDPSLVSDIPYMTARIFKTQ  92

Query  505  FTYSFPVA-SGRKFLRLYFYPASYNGLNATNSVFSVRVGEYT  627
             TYSFPV+   R ++RL+FYP++Y+  N +NS FSV VG +T
Sbjct  93   TTYSFPVSPKSRHWIRLHFYPSTYDNFNCSNSFFSVTVGGFT  134



>ref|XP_003568697.1| PREDICTED: receptor-like protein kinase FERONIA [Brachypodium 
distachyon]
Length=878

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = +1

Query  322  KILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQ  498
             + LNCG      D + R W  D  SKF     K  T+ A  Q PS+P  VPFMTAR F 
Sbjct  32   HVALNCGASGQNNDDNGRTWDGDTSSKFAPLV-KGVTAPASYQHPSLPSTVPFMTARIFT  90

Query  499  SEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSV  609
            S +TYSFPV++GR F+RLYFYP +Y     +++ FSV
Sbjct  91   SNYTYSFPVSAGRMFVRLYFYPIAYGNYAVSDAFFSV  127



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250