BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS074F11

Length=617
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004245626.1|  PREDICTED: uncharacterized protein LOC101264...    113   9e-25   Solanum lycopersicum
ref|XP_010325421.1|  PREDICTED: uncharacterized protein LOC101264...    113   1e-24   Solanum lycopersicum
ref|XP_010325420.1|  PREDICTED: uncharacterized protein LOC101264...    113   1e-24   Solanum lycopersicum
emb|CDP09782.1|  unnamed protein product                                110   4e-24   Coffea canephora [robusta coffee]
ref|XP_006358896.1|  PREDICTED: uncharacterized protein LOC102587...    110   8e-24   Solanum tuberosum [potatoes]
ref|XP_006358894.1|  PREDICTED: uncharacterized protein LOC102587...    110   9e-24   Solanum tuberosum [potatoes]
ref|XP_006358895.1|  PREDICTED: uncharacterized protein LOC102587...    110   1e-23   Solanum tuberosum [potatoes]
ref|XP_011072312.1|  PREDICTED: uncharacterized protein LOC105157...  97.4    1e-19   Sesamum indicum [beniseed]
ref|XP_011072316.1|  PREDICTED: uncharacterized protein LOC105157...  97.4    1e-19   Sesamum indicum [beniseed]
ref|XP_009589208.1|  PREDICTED: uncharacterized protein LOC104086...  97.8    1e-19   Nicotiana tomentosiformis
ref|XP_009589209.1|  PREDICTED: uncharacterized protein LOC104086...  97.8    2e-19   Nicotiana tomentosiformis
ref|XP_007209689.1|  hypothetical protein PRUPE_ppa012392mg           90.5    7e-19   
ref|XP_009782390.1|  PREDICTED: uncharacterized protein LOC104231...  95.1    1e-18   Nicotiana sylvestris
ref|XP_009782391.1|  PREDICTED: uncharacterized protein LOC104231...  95.1    1e-18   Nicotiana sylvestris
ref|XP_009782392.1|  PREDICTED: uncharacterized protein LOC104231...  95.1    1e-18   Nicotiana sylvestris
ref|XP_008238911.1|  PREDICTED: uncharacterized protein LOC103337528  90.1    3e-17   
ref|XP_010661051.1|  PREDICTED: methyl-CpG-binding domain-contain...  85.5    8e-16   Vitis vinifera
ref|XP_008351681.1|  PREDICTED: uncharacterized protein LOC103415104  83.6    6e-15   
ref|XP_008392616.1|  PREDICTED: uncharacterized protein LOC103454798  83.2    1e-14   
ref|XP_010255468.1|  PREDICTED: uncharacterized protein LOC104596...  80.5    4e-14   Nelumbo nucifera [Indian lotus]
ref|XP_010255467.1|  PREDICTED: uncharacterized protein LOC104596...  80.5    5e-14   Nelumbo nucifera [Indian lotus]
ref|XP_009369054.1|  PREDICTED: uncharacterized protein LOC103958513  78.6    3e-13   
ref|XP_009375788.1|  PREDICTED: methyl-CpG-binding domain-contain...  78.6    3e-13   Pyrus x bretschneideri [bai li]
ref|XP_009375787.1|  PREDICTED: uncharacterized protein LOC103964...  78.6    4e-13   
gb|KDO55594.1|  hypothetical protein CISIN_1g0013392mg                74.7    6e-13   Citrus sinensis [apfelsine]
ref|XP_008437227.1|  PREDICTED: uncharacterized protein LOC103482...  77.0    7e-13   Cucumis melo [Oriental melon]
ref|XP_008437229.1|  PREDICTED: transcriptional regulator ATRX ho...  77.0    7e-13   Cucumis melo [Oriental melon]
gb|KDP25474.1|  hypothetical protein JCGZ_20630                       76.3    2e-12   Jatropha curcas
ref|XP_010676506.1|  PREDICTED: uncharacterized protein LOC104892...  74.7    6e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010676507.1|  PREDICTED: uncharacterized protein LOC104892...  74.7    6e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010676508.1|  PREDICTED: uncharacterized protein LOC104892...  74.7    6e-12   
ref|XP_007040167.1|  Uncharacterized protein TCM_016211               73.6    1e-11   
ref|XP_010089148.1|  Methyl-CpG-binding domain-containing protein 5   68.2    5e-11   
ref|XP_011463824.1|  PREDICTED: uncharacterized protein LOC101312...  69.3    3e-10   Fragaria vesca subsp. vesca
ref|XP_011463825.1|  PREDICTED: uncharacterized protein LOC101312...  69.3    3e-10   Fragaria vesca subsp. vesca
ref|XP_007158477.1|  hypothetical protein PHAVU_002G155600g           68.9    4e-10   Phaseolus vulgaris [French bean]
ref|XP_007158475.1|  hypothetical protein PHAVU_002G155600g           68.9    4e-10   Phaseolus vulgaris [French bean]
ref|XP_007158478.1|  hypothetical protein PHAVU_002G155600g           68.9    4e-10   Phaseolus vulgaris [French bean]
ref|XP_007158476.1|  hypothetical protein PHAVU_002G155600g           68.6    5e-10   Phaseolus vulgaris [French bean]
ref|XP_006580605.1|  PREDICTED: uncharacterized protein LOC100782433  66.6    3e-09   Glycine max [soybeans]
gb|KHN23667.1|  Methyl-CpG-binding domain-containing protein 13       66.2    3e-09   Glycine soja [wild soybean]
ref|XP_008796741.1|  PREDICTED: uncharacterized protein LOC103712...  65.9    3e-09   Phoenix dactylifera
ref|XP_008796740.1|  PREDICTED: uncharacterized protein LOC103712...  65.9    3e-09   Phoenix dactylifera
ref|XP_008796737.1|  PREDICTED: uncharacterized protein LOC103712...  65.9    3e-09   Phoenix dactylifera
ref|XP_008796736.1|  PREDICTED: uncharacterized protein LOC103712...  65.9    3e-09   Phoenix dactylifera
ref|XP_008796735.1|  PREDICTED: uncharacterized protein LOC103712...  65.9    3e-09   Phoenix dactylifera
ref|XP_008796738.1|  PREDICTED: uncharacterized protein LOC103712...  65.9    3e-09   Phoenix dactylifera
ref|XP_008796743.1|  PREDICTED: uncharacterized protein LOC103712...  65.9    3e-09   Phoenix dactylifera
emb|CBI31785.3|  unnamed protein product                              65.5    4e-09   Vitis vinifera
ref|XP_003532403.1|  PREDICTED: methyl-CpG-binding domain-contain...  65.9    4e-09   Glycine max [soybeans]
ref|XP_010662494.1|  PREDICTED: uncharacterized protein LOC100263...  65.9    4e-09   Vitis vinifera
gb|KHN16846.1|  Methyl-CpG-binding domain-containing protein 13       65.9    4e-09   Glycine soja [wild soybean]
emb|CAN74037.1|  hypothetical protein VITISV_023406                   65.1    6e-09   Vitis vinifera
ref|XP_010273135.1|  PREDICTED: methyl-CpG-binding domain-contain...  62.8    3e-08   Nelumbo nucifera [Indian lotus]
ref|XP_008796742.1|  PREDICTED: uncharacterized protein LOC103712...  62.8    3e-08   Phoenix dactylifera
ref|XP_002509754.1|  hypothetical protein RCOM_1685990                62.8    4e-08   
ref|XP_010918513.1|  PREDICTED: methyl-CpG-binding domain-contain...  61.6    6e-08   
ref|XP_006440583.1|  hypothetical protein CICLE_v10018609mg           62.0    6e-08   
ref|XP_010918514.1|  PREDICTED: methyl-CpG-binding domain-contain...  61.6    6e-08   
ref|XP_006440582.1|  hypothetical protein CICLE_v10018609mg           62.0    7e-08   Citrus clementina [clementine]
ref|XP_006440581.1|  hypothetical protein CICLE_v10018609mg           62.0    7e-08   Citrus clementina [clementine]
gb|KDO55595.1|  hypothetical protein CISIN_1g0013392mg                60.5    7e-08   Citrus sinensis [apfelsine]
gb|KDO55591.1|  hypothetical protein CISIN_1g0013392mg                60.5    1e-07   Citrus sinensis [apfelsine]
ref|XP_007160033.1|  hypothetical protein PHAVU_002G287000g           61.2    1e-07   Phaseolus vulgaris [French bean]
ref|XP_004143925.1|  PREDICTED: uncharacterized protein LOC101223188  60.8    1e-07   Cucumis sativus [cucumbers]
ref|XP_010661063.1|  PREDICTED: methyl-CpG-binding domain-contain...  60.5    2e-07   Vitis vinifera
ref|XP_010661055.1|  PREDICTED: methyl-CpG-binding domain-contain...  60.5    2e-07   Vitis vinifera
ref|XP_006477436.1|  PREDICTED: uncharacterized protein LOC102622266  60.5    2e-07   
ref|XP_008437228.1|  PREDICTED: uncharacterized protein LOC103482...  60.1    2e-07   Cucumis melo [Oriental melon]
ref|XP_006827729.1|  hypothetical protein AMTR_s00009p00261370        60.1    3e-07   Amborella trichopoda
emb|CBI34715.3|  unnamed protein product                              59.7    4e-07   Vitis vinifera
ref|XP_004503754.1|  PREDICTED: uncharacterized protein LOC101511357  59.7    4e-07   Cicer arietinum [garbanzo]
gb|KEH21030.1|  methyl-CpG-binding domain protein                     58.5    1e-06   Medicago truncatula
ref|XP_009418270.1|  PREDICTED: uncharacterized protein LOC103998...  57.4    1e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390529.1|  PREDICTED: uncharacterized protein LOC103976...  57.0    3e-06   
ref|XP_009390518.1|  PREDICTED: uncharacterized protein LOC103976...  56.6    3e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390512.1|  PREDICTED: uncharacterized protein LOC103976...  56.6    3e-06   
emb|CBI16127.3|  unnamed protein product                              53.9    3e-06   Vitis vinifera
gb|KDP34493.1|  hypothetical protein JCGZ_11043                       55.5    4e-06   Jatropha curcas
ref|XP_002532846.1|  DNA binding protein, putative                    55.5    4e-06   
emb|CDP05220.1|  unnamed protein product                              55.8    5e-06   Coffea canephora [robusta coffee]
ref|XP_009345985.1|  PREDICTED: methyl-CpG-binding domain-contain...  54.3    9e-06   Pyrus x bretschneideri [bai li]
ref|XP_009353664.1|  PREDICTED: methyl-CpG-binding domain-contain...  54.3    9e-06   Pyrus x bretschneideri [bai li]
ref|XP_002314180.1|  methyl-CpG-binding domain-containing family ...  53.9    9e-06   
ref|XP_004294545.1|  PREDICTED: methyl-CpG-binding domain-contain...  53.9    9e-06   Fragaria vesca subsp. vesca
ref|XP_009345984.1|  PREDICTED: methyl-CpG-binding domain-contain...  54.3    1e-05   Pyrus x bretschneideri [bai li]
ref|XP_006369524.1|  hypothetical protein POPTR_0001s24690g           53.1    1e-05   
ref|XP_011042705.1|  PREDICTED: methyl-CpG-binding domain-contain...  53.9    1e-05   Populus euphratica
ref|XP_010934847.1|  PREDICTED: uncharacterized protein LOC105054...  54.7    1e-05   
ref|XP_010934846.1|  PREDICTED: uncharacterized protein LOC105054...  54.7    1e-05   Elaeis guineensis
ref|XP_010934848.1|  PREDICTED: uncharacterized protein LOC105054...  54.7    1e-05   Elaeis guineensis
ref|XP_009364396.1|  PREDICTED: methyl-CpG-binding domain-contain...  53.9    1e-05   Pyrus x bretschneideri [bai li]
ref|XP_008357235.1|  PREDICTED: methyl-CpG-binding domain-contain...  53.9    1e-05   Malus domestica [apple tree]
ref|XP_010934849.1|  PREDICTED: uncharacterized protein LOC105054...  54.7    1e-05   
ref|XP_006369523.1|  hypothetical protein POPTR_0001s24690g           52.4    1e-05   
ref|XP_003632148.1|  PREDICTED: methyl-CpG-binding domain-contain...  53.5    2e-05   Vitis vinifera
emb|CDP06874.1|  unnamed protein product                              52.8    4e-05   Coffea canephora [robusta coffee]
ref|XP_008234128.1|  PREDICTED: methyl-CpG-binding domain-contain...  52.8    6e-05   Prunus mume [ume]
ref|XP_002299872.1|  methyl-CpG-binding domain-containing family ...  52.0    6e-05   Populus trichocarpa [western balsam poplar]
ref|XP_008791903.1|  PREDICTED: uncharacterized protein LOC103708650  52.4    7e-05   Phoenix dactylifera
ref|XP_011015295.1|  PREDICTED: methyl-CpG-binding domain-contain...  51.2    7e-05   Populus euphratica
ref|XP_007514055.1|  predicted protein                                52.4    8e-05   Bathycoccus prasinos
gb|KHG28622.1|  Methyl-CpG-binding domain-containing 13 -like pro...  52.4    9e-05   Gossypium arboreum [tree cotton]
gb|KJB52811.1|  hypothetical protein B456_008G278300                  52.4    9e-05   Gossypium raimondii
gb|KJB39637.1|  hypothetical protein B456_007G022700                  52.4    1e-04   Gossypium raimondii
ref|XP_008223622.1|  PREDICTED: methyl-CpG-binding domain-contain...  51.2    1e-04   Prunus mume [ume]
emb|CDY33033.1|  BnaA10g12390D                                        51.6    1e-04   Brassica napus [oilseed rape]
gb|KHF99779.1|  Methyl-CpG-binding domain-containing 6 -like protein  50.4    2e-04   Gossypium arboreum [tree cotton]
gb|KJB83777.1|  hypothetical protein B456_013G263700                  50.4    2e-04   Gossypium raimondii
ref|XP_010106481.1|  Methyl-CpG-binding domain-containing protein 6   50.4    2e-04   Morus notabilis
ref|XP_009126698.1|  PREDICTED: methyl-CpG-binding domain-contain...  50.4    2e-04   Brassica rapa
emb|CDY53445.1|  BnaA02g07070D                                        50.4    2e-04   Brassica napus [oilseed rape]
emb|CDX80274.1|  BnaC09g34680D                                        50.8    3e-04   
emb|CDY48687.1|  BnaC02g09990D                                        50.1    3e-04   Brassica napus [oilseed rape]
emb|CDY59223.1|  BnaCnng34510D                                        50.1    3e-04   Brassica napus [oilseed rape]
ref|XP_010541402.1|  PREDICTED: methyl-CpG-binding domain-contain...  49.7    4e-04   Tarenaya hassleriana [spider flower]
ref|XP_010541401.1|  PREDICTED: methyl-CpG-binding domain-contain...  49.7    4e-04   Tarenaya hassleriana [spider flower]
ref|XP_006400967.1|  hypothetical protein EUTSA_v10014530mg           49.7    4e-04   Eutrema salsugineum [saltwater cress]
gb|KFK27467.1|  hypothetical protein AALP_AA8G387100                  49.3    4e-04   Arabis alpina [alpine rockcress]
ref|XP_007038658.1|  Methyl-CPG-binding domain protein 13, putati...  50.1    5e-04   
gb|KFK27470.1|  hypothetical protein AALP_AA8G387500                  49.3    6e-04   Arabis alpina [alpine rockcress]
ref|XP_009604783.1|  PREDICTED: methyl-CpG-binding domain-contain...  49.3    6e-04   Nicotiana tomentosiformis
ref|NP_200746.1|  methyl-CpG-binding domain-containing protein 6      49.3    6e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009787915.1|  PREDICTED: methyl-CpG-binding domain-contain...  49.3    6e-04   Nicotiana sylvestris
ref|XP_007038659.1|  Methyl-CPG-binding domain protein 13, putati...  49.7    7e-04   
ref|XP_002864630.1|  hypothetical protein ARALYDRAFT_919168           48.9    7e-04   Arabidopsis lyrata subsp. lyrata
ref|XP_009371320.1|  PREDICTED: methyl-CpG-binding domain-contain...  49.3    9e-04   Pyrus x bretschneideri [bai li]



>ref|XP_004245626.1| PREDICTED: uncharacterized protein LOC101264354 isoform X1 [Solanum 
lycopersicum]
Length=1886

 Score =   113 bits (282),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 91/177 (51%), Gaps = 15/177 (8%)
 Frame = +2

Query  38   IVAGKSPEPLPPGWIEHVQVKNGRTIKYYTNGENGKKFYSRKAVINLVKAGDVNYGQNQG  217
            +    SP+  PPGW E V+V  GR IKYYTNGE GKKFYS+K V   +K  D      Q 
Sbjct  1    MAVEDSPDWPPPGWTEDVKVSKGRKIKYYTNGETGKKFYSKKEVARYLKTKDTCDDVTQA  60

Query  218  INNGETqiqgigngdgqnqginngdVPNQEtpkpesrrskrsttspspsskLASNT----  385
            +N                   N  D+ NQ+    +   S+        S    S T    
Sbjct  61   MN----------IQGKSFSENNVSDMDNQDGSFAKDNGSQMDNQDNCCSENNVSQTVGKP  110

Query  386  NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSN  553
            N S +WLPPGW VELKTR +GSH G +YK YI PS G KFYSK +VS++L +   +N
Sbjct  111  NNSHEWLPPGWIVELKTRKSGSHAGLSYKVYIDPSTGSKFYSKPEVSKYLKTMKQNN  167



>ref|XP_010325421.1| PREDICTED: uncharacterized protein LOC101264354 isoform X3 [Solanum 
lycopersicum]
Length=1846

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 91/177 (51%), Gaps = 15/177 (8%)
 Frame = +2

Query  38   IVAGKSPEPLPPGWIEHVQVKNGRTIKYYTNGENGKKFYSRKAVINLVKAGDVNYGQNQG  217
            +    SP+  PPGW E V+V  GR IKYYTNGE GKKFYS+K V   +K  D      Q 
Sbjct  1    MAVEDSPDWPPPGWTEDVKVSKGRKIKYYTNGETGKKFYSKKEVARYLKTKDTCDDVTQA  60

Query  218  INNGETqiqgigngdgqnqginngdVPNQEtpkpesrrskrsttspspsskLASNT----  385
            +N                   N  D+ NQ+    +   S+        S    S T    
Sbjct  61   MN----------IQGKSFSENNVSDMDNQDGSFAKDNGSQMDNQDNCCSENNVSQTVGKP  110

Query  386  NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSN  553
            N S +WLPPGW VELKTR +GSH G +YK YI PS G KFYSK +VS++L +   +N
Sbjct  111  NNSHEWLPPGWIVELKTRKSGSHAGLSYKVYIDPSTGSKFYSKPEVSKYLKTMKQNN  167



>ref|XP_010325420.1| PREDICTED: uncharacterized protein LOC101264354 isoform X2 [Solanum 
lycopersicum]
Length=1852

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 91/177 (51%), Gaps = 15/177 (8%)
 Frame = +2

Query  38   IVAGKSPEPLPPGWIEHVQVKNGRTIKYYTNGENGKKFYSRKAVINLVKAGDVNYGQNQG  217
            +    SP+  PPGW E V+V  GR IKYYTNGE GKKFYS+K V   +K  D      Q 
Sbjct  1    MAVEDSPDWPPPGWTEDVKVSKGRKIKYYTNGETGKKFYSKKEVARYLKTKDTCDDVTQA  60

Query  218  INNGETqiqgigngdgqnqginngdVPNQEtpkpesrrskrsttspspsskLASNT----  385
            +N                   N  D+ NQ+    +   S+        S    S T    
Sbjct  61   MN----------IQGKSFSENNVSDMDNQDGSFAKDNGSQMDNQDNCCSENNVSQTVGKP  110

Query  386  NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSN  553
            N S +WLPPGW VELKTR +GSH G +YK YI PS G KFYSK +VS++L +   +N
Sbjct  111  NNSHEWLPPGWIVELKTRKSGSHAGLSYKVYIDPSTGSKFYSKPEVSKYLKTMKQNN  167



>emb|CDP09782.1| unnamed protein product [Coffea canephora]
Length=819

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 63/168 (38%), Positives = 84/168 (50%), Gaps = 33/168 (20%)
 Frame = +2

Query  38   IVAGKSPEPLPPGWIEHVQVKNGRTIKYYTNGENGKKFYSRKAVINLVKAGDVNYGQNQG  217
            +V GKSP+ LPPGW EHV+V NGR IKYYT+   G KFYS+K VIN V+  D   G    
Sbjct  1    MVHGKSPDELPPGWKEHVKVSNGRKIKYYTDDVTGLKFYSKKRVINFVQTKDACQGTPHS  60

Query  218  INNGETqiqgigngdgqnqginngdVPNQEtpkpesrrskrsttspspsskLASNTNQSS  397
            +++ + +                   P+Q                      +    N S 
Sbjct  61   VSDHDLKSSCSKTEAS----------PSQ----------------------VVVEKNSSL  88

Query  398  DWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNS  538
            +WLP GW +E + R +G+  GS YK Y+ P +G KFYSK QV Q+L S
Sbjct  89   EWLPQGWIIESRYRKSGATAGSVYKTYVDPLTGSKFYSKPQVMQYLES  136



>ref|XP_006358896.1| PREDICTED: uncharacterized protein LOC102587100 isoform X3 [Solanum 
tuberosum]
Length=1801

 Score =   110 bits (275),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 92/173 (53%), Gaps = 17/173 (10%)
 Frame = +2

Query  53   SPEPLPPGWIEHVQVKNGRTIKYYTNGENGKKFYSRKAVINLV----KAGDVNYGQN-QG  217
            SP+  PPGW E V+V NGR IKYYTNG+ GKKFYS+K V   +       DV      QG
Sbjct  6    SPDWPPPGWTEDVKVSNGRKIKYYTNGQTGKKFYSKKEVARYLNTKDTCDDVTQAMTIQG  65

Query  218  INNGETqiqgigngdgqnqginngdVPNQEtpkpesrrskrsttspspsskLASNTNQSS  397
             N  E  +  + N D      N   + N +    E+  S+                N S 
Sbjct  66   KNCSENNVSHMDNQDESFSKDNVSQMDNLDKSCSENNVSEA-----------VGRPNNSH  114

Query  398  DWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSN  553
            +WLPPGW VELKTR +GSH G+ YK YI PS G KFYSK +VS++L +   +N
Sbjct  115  EWLPPGWIVELKTRKSGSHAGTPYKVYIDPSTGSKFYSKPEVSKYLKTMKQNN  167



>ref|XP_006358894.1| PREDICTED: uncharacterized protein LOC102587100 isoform X1 [Solanum 
tuberosum]
Length=1845

 Score =   110 bits (275),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 92/173 (53%), Gaps = 17/173 (10%)
 Frame = +2

Query  53   SPEPLPPGWIEHVQVKNGRTIKYYTNGENGKKFYSRKAVINLV----KAGDVNYGQN-QG  217
            SP+  PPGW E V+V NGR IKYYTNG+ GKKFYS+K V   +       DV      QG
Sbjct  6    SPDWPPPGWTEDVKVSNGRKIKYYTNGQTGKKFYSKKEVARYLNTKDTCDDVTQAMTIQG  65

Query  218  INNGETqiqgigngdgqnqginngdVPNQEtpkpesrrskrsttspspsskLASNTNQSS  397
             N  E  +  + N D      N   + N +    E+  S+                N S 
Sbjct  66   KNCSENNVSHMDNQDESFSKDNVSQMDNLDKSCSENNVSEA-----------VGRPNNSH  114

Query  398  DWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSN  553
            +WLPPGW VELKTR +GSH G+ YK YI PS G KFYSK +VS++L +   +N
Sbjct  115  EWLPPGWIVELKTRKSGSHAGTPYKVYIDPSTGSKFYSKPEVSKYLKTMKQNN  167



>ref|XP_006358895.1| PREDICTED: uncharacterized protein LOC102587100 isoform X2 [Solanum 
tuberosum]
Length=1805

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 92/173 (53%), Gaps = 17/173 (10%)
 Frame = +2

Query  53   SPEPLPPGWIEHVQVKNGRTIKYYTNGENGKKFYSRKAVINLV----KAGDVNYGQN-QG  217
            SP+  PPGW E V+V NGR IKYYTNG+ GKKFYS+K V   +       DV      QG
Sbjct  6    SPDWPPPGWTEDVKVSNGRKIKYYTNGQTGKKFYSKKEVARYLNTKDTCDDVTQAMTIQG  65

Query  218  INNGETqiqgigngdgqnqginngdVPNQEtpkpesrrskrsttspspsskLASNTNQSS  397
             N  E  +  + N D      N   + N +    E+  S+                N S 
Sbjct  66   KNCSENNVSHMDNQDESFSKDNVSQMDNLDKSCSENNVSEA-----------VGRPNNSH  114

Query  398  DWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSN  553
            +WLPPGW VELKTR +GSH G+ YK YI PS G KFYSK +VS++L +   +N
Sbjct  115  EWLPPGWIVELKTRKSGSHAGTPYKVYIDPSTGSKFYSKPEVSKYLKTMKQNN  167



>ref|XP_011072312.1| PREDICTED: uncharacterized protein LOC105157598 isoform X1 [Sesamum 
indicum]
Length=645

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 87/176 (49%), Gaps = 39/176 (22%)
 Frame = +2

Query  38   IVAGKSPEPLPPGWIEHVQVKNGRTIKYYTNGENGKKFYSRKAVINLVKA--GDVNYGQN  211
            +VAGKSP+ LPPG+ E V+ KNGR IKYY N   G K++S+K V++   A  G +   + 
Sbjct  1    MVAGKSPDWLPPGFTEKVKYKNGRKIKYYYNVATGAKYHSKKEVLSCATAENGLLGTPET  60

Query  212  QGINNGETqiqgigngdgqnqginngdVPNQEtpkpesrrskrsttspspsskLASNTNQ  391
              +NN                        N+E                     +   TN 
Sbjct  61   TKVNNSGLSS-------------------NKEVDTQ-----------------ILDKTND  84

Query  392  SSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNT  556
            S  WLP GWT+E KTR +GS  GS YK Y    SG +FYS+A V+++LN+  +SNT
Sbjct  85   SPGWLPSGWTMEEKTRQSGSRKGSVYKVYTDLSSGSRFYSRAAVTRYLNTVDHSNT  140



>ref|XP_011072316.1| PREDICTED: uncharacterized protein LOC105157598 isoform X2 [Sesamum 
indicum]
Length=644

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 87/176 (49%), Gaps = 40/176 (23%)
 Frame = +2

Query  38   IVAGKSPEPLPPGWIEHVQVKNGRTIKYYTNGENGKKFYSRKAVINLVKA--GDVNYGQN  211
            +VAGKSP+ LPPG+ E V+ KNGR IKYY N   G K++S+K V++   A  G +   + 
Sbjct  1    MVAGKSPDWLPPGFTEKVKYKNGRKIKYYYNVATGAKYHSKKEVLSCATAENGLLGTPET  60

Query  212  QGINNGETqiqgigngdgqnqginngdVPNQEtpkpesrrskrsttspspsskLASNTNQ  391
              +NN                        N+E                     +   TN 
Sbjct  61   TKVNNSGLSS-------------------NKEVDT------------------ILDKTND  83

Query  392  SSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNT  556
            S  WLP GWT+E KTR +GS  GS YK Y    SG +FYS+A V+++LN+  +SNT
Sbjct  84   SPGWLPSGWTMEEKTRQSGSRKGSVYKVYTDLSSGSRFYSRAAVTRYLNTVDHSNT  139



>ref|XP_009589208.1| PREDICTED: uncharacterized protein LOC104086600 isoform X1 [Nicotiana 
tomentosiformis]
Length=2010

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 87/163 (53%), Gaps = 8/163 (5%)
 Frame = +2

Query  68   PPGWIEHVQVKNGRTIKYYTNGENGKKFYSRKAVINLVKAGDVNYGQNQGINNGETqiqg  247
            PPGW E V++ +GR  KYYTN E GKKFYS+K V   +   D  +   Q +N  ++  Q 
Sbjct  12   PPGWTEDVKITSGRKTKYYTNVETGKKFYSKKEVTRYMNTKDTCHDVTQVLNQDKSSSQN  71

Query  248  igngdgqnqginngdVPNQEtpkpesrrskrsttspspsskLASNTNQSSDWLPPGWTVE  427
              +         + +  +Q          +  + S +  S++   T +S +WLP GW VE
Sbjct  72   NVSQMNHQDKSFSENNVSQ-------MNYQDRSCSENNVSQIVEETKKSPEWLPAGWIVE  124

Query  428  LKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSN  553
            L+ R +GSH G  YK YI PS G KFYS+ +VS++L +   +N
Sbjct  125  LRNRKSGSHAGLAYKVYIDPSTGNKFYSRPEVSKYLKTMKQNN  167



>ref|XP_009589209.1| PREDICTED: uncharacterized protein LOC104086600 isoform X2 [Nicotiana 
tomentosiformis]
Length=1739

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 91/174 (52%), Gaps = 9/174 (5%)
 Frame = +2

Query  38   IVAGKSPEPLPP-GWIEHVQVKNGRTIKYYTNGENGKKFYSRKAVINLVKAGDVNYGQNQ  214
            +  G SP   PP GW E V++ +GR  KYYTN E GKKFYS+K V   +   D  +   Q
Sbjct  1    MTVGDSPADWPPPGWTEDVKITSGRKTKYYTNVETGKKFYSKKEVTRYMNTKDTCHDVTQ  60

Query  215  GINNGETqiqgigngdgqnqginngdVPNQEtpkpesrrskrsttspspsskLASNTNQS  394
             +N  ++  Q   +         + +  +Q          +  + S +  S++   T +S
Sbjct  61   VLNQDKSSSQNNVSQMNHQDKSFSENNVSQ-------MNYQDRSCSENNVSQIVEETKKS  113

Query  395  SDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSN  553
             +WLP GW VEL+ R +GSH G  YK YI PS G KFYS+ +VS++L +   +N
Sbjct  114  PEWLPAGWIVELRNRKSGSHAGLAYKVYIDPSTGNKFYSRPEVSKYLKTMKQNN  167



>ref|XP_007209689.1| hypothetical protein PRUPE_ppa012392mg [Prunus persica]
 gb|EMJ10888.1| hypothetical protein PRUPE_ppa012392mg [Prunus persica]
Length=171

 Score = 90.5 bits (223),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 57/170 (34%), Positives = 79/170 (46%), Gaps = 38/170 (22%)
 Frame = +2

Query  38   IVAGKSPEPLPPGWIEHVQV-KNGRTIKYYTNGENGKKFYSRKAVINLVKAGDVNYGQNQ  214
            +VA  SP+ LP GW    +V K GR I++YTN E GK F+S+  V+  +K    N G  Q
Sbjct  1    MVAKSSPDWLPAGWAVQFRVQKTGRKIEFYTNLETGKNFFSKDDVMRHIKMASTNGGNPQ  60

Query  215  GINNGETqiqgigngdgqnqginngdVPNQEtpkpesrrskrsttspspsskLASNTNQS  394
                              +   ++  +P+Q                      L  NT + 
Sbjct  61   PTT--------------LHNQHHSEKIPSQ----------------------LVVNTTEY  84

Query  395  SDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSA  541
             +WLP GW VE++TR TG H G  YKCYI PS    FYSK +V ++L + 
Sbjct  85   PEWLPKGWKVEVRTRKTGVHVGKEYKCYIDPSTECSFYSKPEVFRYLKTV  134



>ref|XP_009782390.1| PREDICTED: uncharacterized protein LOC104231139 isoform X1 [Nicotiana 
sylvestris]
Length=1884

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 86/158 (54%), Gaps = 8/158 (5%)
 Frame = +2

Query  68   PPGWIEHVQVKNGRTIKYYTNGENGKKFYSRKAVINLVKAGDVNYGQNQGINNGETqiqg  247
            PPGW E V++ +GR  KYYT+ E GKKFYS+K V   +   D  +   Q +N  ++  + 
Sbjct  12   PPGWTEDVKITSGRKTKYYTHVETGKKFYSKKEVTRYMNTKDTCHDVAQVLNQDKSSTEN  71

Query  248  igngdgqnqginngdVPNQEtpkpesrrskrsttspspsskLASNTNQSSDWLPPGWTVE  427
              +         + +  +Q          +  + S +  S++   T +S +WLP GW VE
Sbjct  72   NVSQMNHQDKSFSENNVSQ-------MNYQDRSCSENNVSQIVEETKKSPEWLPAGWIVE  124

Query  428  LKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNS  538
            LKTR +GS+ G  YK YI PS G KFYS+ +VS++L +
Sbjct  125  LKTRKSGSNAGLAYKVYIDPSTGNKFYSRPEVSKYLKT  162



>ref|XP_009782391.1| PREDICTED: uncharacterized protein LOC104231139 isoform X2 [Nicotiana 
sylvestris]
Length=1881

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 86/158 (54%), Gaps = 8/158 (5%)
 Frame = +2

Query  68   PPGWIEHVQVKNGRTIKYYTNGENGKKFYSRKAVINLVKAGDVNYGQNQGINNGETqiqg  247
            PPGW E V++ +GR  KYYT+ E GKKFYS+K V   +   D  +   Q +N  ++  + 
Sbjct  12   PPGWTEDVKITSGRKTKYYTHVETGKKFYSKKEVTRYMNTKDTCHDVAQVLNQDKSSTEN  71

Query  248  igngdgqnqginngdVPNQEtpkpesrrskrsttspspsskLASNTNQSSDWLPPGWTVE  427
              +         + +  +Q          +  + S +  S++   T +S +WLP GW VE
Sbjct  72   NVSQMNHQDKSFSENNVSQ-------MNYQDRSCSENNVSQIVEETKKSPEWLPAGWIVE  124

Query  428  LKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNS  538
            LKTR +GS+ G  YK YI PS G KFYS+ +VS++L +
Sbjct  125  LKTRKSGSNAGLAYKVYIDPSTGNKFYSRPEVSKYLKT  162



>ref|XP_009782392.1| PREDICTED: uncharacterized protein LOC104231139 isoform X3 [Nicotiana 
sylvestris]
Length=1613

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 86/158 (54%), Gaps = 8/158 (5%)
 Frame = +2

Query  68   PPGWIEHVQVKNGRTIKYYTNGENGKKFYSRKAVINLVKAGDVNYGQNQGINNGETqiqg  247
            PPGW E V++ +GR  KYYT+ E GKKFYS+K V   +   D  +   Q +N  ++  + 
Sbjct  12   PPGWTEDVKITSGRKTKYYTHVETGKKFYSKKEVTRYMNTKDTCHDVAQVLNQDKSSTEN  71

Query  248  igngdgqnqginngdVPNQEtpkpesrrskrsttspspsskLASNTNQSSDWLPPGWTVE  427
              +         + +  +Q          +  + S +  S++   T +S +WLP GW VE
Sbjct  72   NVSQMNHQDKSFSENNVSQ-------MNYQDRSCSENNVSQIVEETKKSPEWLPAGWIVE  124

Query  428  LKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNS  538
            LKTR +GS+ G  YK YI PS G KFYS+ +VS++L +
Sbjct  125  LKTRKSGSNAGLAYKVYIDPSTGNKFYSRPEVSKYLKT  162



>ref|XP_008238911.1| PREDICTED: uncharacterized protein LOC103337528 [Prunus mume]
Length=623

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 57/170 (34%), Positives = 80/170 (47%), Gaps = 38/170 (22%)
 Frame = +2

Query  38   IVAGKSPEPLPPGWIEHVQV-KNGRTIKYYTNGENGKKFYSRKAVINLVKAGDVNYGQNQ  214
            +VA  SP+ LP GW    +V K GR I++YTN E GK F+S+  V+  +K    N G  Q
Sbjct  1    MVAKSSPDWLPAGWAVQFRVQKTGRKIEFYTNLETGKNFFSKDDVMCHIKMASTNGGNPQ  60

Query  215  GINNGETqiqgigngdgqnqginngdVPNQEtpkpesrrskrsttspspsskLASNTNQS  394
                              +   ++ ++P+Q                      L  NT + 
Sbjct  61   PTT--------------LHNQHHSEEIPSQ----------------------LVVNTTEY  84

Query  395  SDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSA  541
             +WLP GW VE++TR TG H G  YKCYI PS    FYSK +V ++L + 
Sbjct  85   PEWLPKGWKVEVRTRKTGVHVGKEYKCYIDPSTESSFYSKPEVFRYLKTV  134



>ref|XP_010661051.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X1 [Vitis vinifera]
Length=544

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 54/164 (33%), Positives = 77/164 (47%), Gaps = 38/164 (23%)
 Frame = +2

Query  53   SPEPLPPGWIEHVQV-KNGRTIKYYTNGENGKKFYSRKAVINLVKAGDVNYGQNQGINNG  229
            SP+ +P GW   V++ KNGR +KYY N + G+KF+S+  +I  VK G ++   +Q IN  
Sbjct  5    SPDWIPEGWTVQVKLAKNGRNVKYYFNSKTGQKFFSKNDIIRYVKRGSIHCDTSQPIN--  62

Query  230  ETqiqgigngdgqnqginngdVPNQEtpkpesrrskrsttspspsskLASNTNQSSDWLP  409
                                                    S +    L   T +  DWLP
Sbjct  63   ----------------------------------MLNKRRSQNKIMPLGIKTKKFPDWLP  88

Query  410  PGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNS  538
             GW +ELKT+ +GS  G  YKCY+ PS G +FYSK  V ++L +
Sbjct  89   NGWILELKTQRSGSCVGKQYKCYLDPSTGYRFYSKPDVFRYLKT  132



>ref|XP_008351681.1| PREDICTED: uncharacterized protein LOC103415104 [Malus domestica]
Length=746

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 54/170 (32%), Positives = 80/170 (47%), Gaps = 38/170 (22%)
 Frame = +2

Query  38   IVAGKSPEPLPPGW-IEHVQVKNGRTIKYYTNGENGKKFYSRKAVINLVKAGDVNYGQNQ  214
            +VA  SP+ LPPGW ++    K GR I++YT+ E GKKF+S+   +  +K  +    + Q
Sbjct  1    MVARSSPDWLPPGWSVQSRSQKRGRKIEFYTHLETGKKFFSKDDAMRYIKMQNTRGEKPQ  60

Query  215  GINNGETqiqgigngdgqnqginngdVPNQEtpkpesrrskrsttspspsskLASNTNQS  394
                              N   ++ +VP+Q                      L  +  + 
Sbjct  61   --------------PTLVNIPDHSEEVPSQ----------------------LEVDPTEC  84

Query  395  SDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSA  541
             +WLP GW VEL+TR +G   G  YKCYI PSG   FYSK +V ++L + 
Sbjct  85   PEWLPNGWKVELRTRQSGVQVGKEYKCYIDPSGECTFYSKPEVFRYLKTV  134



>ref|XP_008392616.1| PREDICTED: uncharacterized protein LOC103454798 [Malus domestica]
Length=1228

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/169 (32%), Positives = 80/169 (47%), Gaps = 38/169 (22%)
 Frame = +2

Query  38   IVAGKSPEPLPPGW-IEHVQVKNGRTIKYYTNGENGKKFYSRKAVINLVKAGDVNYGQNQ  214
            +VA  SP+ LPPGW ++    K GR I++YT+ E GKKF+S+   +  +K  +    + Q
Sbjct  1    MVARSSPDWLPPGWSVQSRSQKRGRKIEFYTHLETGKKFFSKDDAMRYIKMQNTRGEKPQ  60

Query  215  GINNGETqiqgigngdgqnqginngdVPNQEtpkpesrrskrsttspspsskLASNTNQS  394
                              N   ++ +VP+Q                      L  +  + 
Sbjct  61   --------------PTLVNIPDHSEEVPSQ----------------------LEVDPTEC  84

Query  395  SDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNS  538
             +WLP GW VEL+TR +G   G  YKCYI PSG   FYSK +V ++L +
Sbjct  85   PEWLPNGWKVELRTRQSGVQVGKEYKCYIDPSGECTFYSKPEVFRYLKT  133



>ref|XP_010255468.1| PREDICTED: uncharacterized protein LOC104596134 isoform X2 [Nelumbo 
nucifera]
Length=572

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 58/167 (35%), Positives = 82/167 (49%), Gaps = 18/167 (11%)
 Frame = +2

Query  38   IVAGKSPEPLPPGWIEHVQV-KNGRTIKYYTNGENGKKFYSRKAVINLVKAGDVNYGQNQ  214
            + A KSP+ LP GW+  V+V K G+  KYY + + G+KF S+  V+  ++ G+ +     
Sbjct  1    MAAEKSPDWLPDGWVMDVKVRKTGQKDKYYIHLKTGRKFRSKDGVLRYIETGESHNCMPL  60

Query  215  GINNGETqiqgigngdgqnqginngdVPNQEtpkpesrrskrsttspspsskLASNTNQS  394
             I                N   ++ DVPN       S +   +T S      L      S
Sbjct  61   QIER------------QANTCSSDKDVPN----TCSSDKDMPNTCSRDKDMPLEMPMEDS  104

Query  395  SDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFL  532
             DWLP GW VE+KTR  GS  G  YKCYI+P +G + YSK  V ++L
Sbjct  105  PDWLPAGWVVEIKTRRGGSKVGQKYKCYIAPITGCRLYSKRDVYRYL  151



>ref|XP_010255467.1| PREDICTED: uncharacterized protein LOC104596134 isoform X1 [Nelumbo 
nucifera]
Length=577

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 58/167 (35%), Positives = 82/167 (49%), Gaps = 18/167 (11%)
 Frame = +2

Query  38   IVAGKSPEPLPPGWIEHVQV-KNGRTIKYYTNGENGKKFYSRKAVINLVKAGDVNYGQNQ  214
            + A KSP+ LP GW+  V+V K G+  KYY + + G+KF S+  V+  ++ G+ +     
Sbjct  1    MAAEKSPDWLPDGWVMDVKVRKTGQKDKYYIHLKTGRKFRSKDGVLRYIETGESHNCMPL  60

Query  215  GINNGETqiqgigngdgqnqginngdVPNQEtpkpesrrskrsttspspsskLASNTNQS  394
             I                N   ++ DVPN       S +   +T S      L      S
Sbjct  61   QIER------------QANTCSSDKDVPN----TCSSDKDMPNTCSRDKDMPLEMPMEDS  104

Query  395  SDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFL  532
             DWLP GW VE+KTR  GS  G  YKCYI+P +G + YSK  V ++L
Sbjct  105  PDWLPAGWVVEIKTRRGGSKVGQKYKCYIAPITGCRLYSKRDVYRYL  151



>ref|XP_009369054.1| PREDICTED: uncharacterized protein LOC103958513 [Pyrus x bretschneideri]
Length=1208

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 77/169 (46%), Gaps = 38/169 (22%)
 Frame = +2

Query  38   IVAGKSPEPLPPGW-IEHVQVKNGRTIKYYTNGENGKKFYSRKAVINLVKAGDVNYGQNQ  214
            +VA  SP+ LPPGW ++    K GR I++Y + E GKKF+S+   +  +K  +    + Q
Sbjct  1    MVAKSSPDWLPPGWSVQSRDQKRGRKIEFYIHLETGKKFFSKDDAVRFIKMENTRGKKPQ  60

Query  215  GINNGETqiqgigngdgqnqginngdVPNQEtpkpesrrskrsttspspsskLASNTNQS  394
              +                       +PN                S    S+L  +  + 
Sbjct  61   PTS---------------------VQIPNH---------------SEEVPSQLEVDPTEY  84

Query  395  SDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNS  538
             +WLP GW VEL+ R +G+  G  YKCYI PS    FYSK +V ++L +
Sbjct  85   PEWLPNGWKVELRIRQSGAQVGREYKCYIDPSRECTFYSKPEVFRYLKT  133



>ref|XP_009375788.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Pyrus x bretschneideri]
Length=1172

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 52/175 (30%), Positives = 79/175 (45%), Gaps = 38/175 (22%)
 Frame = +2

Query  38   IVAGKSPEPLPPGW-IEHVQVKNGRTIKYYTNGENGKKFYSRKAVINLVKAGDVNYGQNQ  214
            +VA  SP+ LPPGW ++    K GR I +YT+ E GKKF+S+   +  +K  + +  + Q
Sbjct  1    MVARSSPDWLPPGWSVQSRSQKRGRKIVFYTHLETGKKFFSKDDAMRYIKMQNTHGERPQ  60

Query  215  GINNGETqiqgigngdgqnqginngdVPNQEtpkpesrrskrsttspspsskLASNTNQS  394
                                  ++ +VP+Q                      L  +  + 
Sbjct  61   --------------PTLVKISDHSEEVPSQ----------------------LEVDPMEC  84

Query  395  SDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNT  556
             +WLP GW VEL+TR +G   G  YKCYI P     FYSK +V ++L +    N+
Sbjct  85   PEWLPNGWKVELRTRQSGVQVGKEYKCYIDPFRECTFYSKPEVFRYLKTVKRKNS  139



>ref|XP_009375787.1| PREDICTED: uncharacterized protein LOC103964564 isoform X1 [Pyrus 
x bretschneideri]
Length=1224

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 52/175 (30%), Positives = 79/175 (45%), Gaps = 38/175 (22%)
 Frame = +2

Query  38   IVAGKSPEPLPPGW-IEHVQVKNGRTIKYYTNGENGKKFYSRKAVINLVKAGDVNYGQNQ  214
            +VA  SP+ LPPGW ++    K GR I +YT+ E GKKF+S+   +  +K  + +  + Q
Sbjct  1    MVARSSPDWLPPGWSVQSRSQKRGRKIVFYTHLETGKKFFSKDDAMRYIKMQNTHGERPQ  60

Query  215  GINNGETqiqgigngdgqnqginngdVPNQEtpkpesrrskrsttspspsskLASNTNQS  394
                                  ++ +VP+Q                      L  +  + 
Sbjct  61   --------------PTLVKISDHSEEVPSQ----------------------LEVDPMEC  84

Query  395  SDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNT  556
             +WLP GW VEL+TR +G   G  YKCYI P     FYSK +V ++L +    N+
Sbjct  85   PEWLPNGWKVELRTRQSGVQVGKEYKCYIDPFRECTFYSKPEVFRYLKTVKRKNS  139



>gb|KDO55594.1| hypothetical protein CISIN_1g0013392mg, partial [Citrus sinensis]
Length=273

 Score = 74.7 bits (182),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 57/179 (32%), Positives = 80/179 (45%), Gaps = 25/179 (14%)
 Frame = +2

Query  41   VAGKSPEPLPPGWIEHVQV-KNGRTIKYYTNGENGKKFYSRKAVINLVKAGDVNYGQ---  208
            +A KS E LP  W    +V KNGR  KYY N   G+KF+S++ ++  VK       +   
Sbjct  1    MAVKSEERLPTDWTAKFKVEKNGRKTKYYMNVRTGQKFFSKEDLLRYVKMKRTQLDEPSP  60

Query  209  --NQGINNGETqiqgigngdgqnqginngdVPNQEtpkpesrrskrsttspspsskLASN  382
              + G  + E     +   +             QE  + +     RS            +
Sbjct  61   TSSHGKRHLENSSSKLVAKEN-----------KQENSRSKRHSENRSMKP-------VVD  102

Query  383  TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNT  556
             N   DWLP GW V+LKTR +GS  G  YK YI P +G KF+S  +V + L S  N N+
Sbjct  103  ENNRPDWLPDGWVVDLKTRKSGSAVGRQYKVYIEPITGCKFFSMPEVLRHLESVKNRNS  161



>ref|XP_008437227.1| PREDICTED: uncharacterized protein LOC103482721 isoform X1 [Cucumis 
melo]
Length=635

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 82/174 (47%), Gaps = 44/174 (25%)
 Frame = +2

Query  38   IVAGKSPEPLPPGWIEHVQV-KNGRTIKYYTNGENGKKFYSRKAVINLVKAGDVNYGQ--  208
            +VA  SP+ LP GW    +V K GR I++YTN E GK FY +  V+  +K+      Q  
Sbjct  1    MVAKGSPDWLPSGWTVQYKVQKTGRKIRFYTNLETGKSFYYKDDVLGYIKSTQSQKSQPT  60

Query  209  NQGINNGETqiqgigngdgqnqginngdVPNQEtpkpesrrskrsttspspsskLASNTN  388
            ++GI                     +G+ P Q+T                        +N
Sbjct  61   SRGIKT------------------QSGNSPVQQTV----------------------KSN  80

Query  389  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  547
            +  +WLP GW VE +TR +GS+ G+ YKCYI P +  +FYSK +V + L +  N
Sbjct  81   EHPEWLPAGWKVESRTRMSGSNVGAVYKCYIDPVTDSRFYSKPEVFRHLRTVKN  134



>ref|XP_008437229.1| PREDICTED: transcriptional regulator ATRX homolog isoform X3 
[Cucumis melo]
Length=628

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 82/174 (47%), Gaps = 44/174 (25%)
 Frame = +2

Query  38   IVAGKSPEPLPPGWIEHVQV-KNGRTIKYYTNGENGKKFYSRKAVINLVKAGDVNYGQ--  208
            +VA  SP+ LP GW    +V K GR I++YTN E GK FY +  V+  +K+      Q  
Sbjct  1    MVAKGSPDWLPSGWTVQYKVQKTGRKIRFYTNLETGKSFYYKDDVLGYIKSTQSQKSQPT  60

Query  209  NQGINNGETqiqgigngdgqnqginngdVPNQEtpkpesrrskrsttspspsskLASNTN  388
            ++GI                     +G+ P Q+T                        +N
Sbjct  61   SRGIKT------------------QSGNSPVQQTV----------------------KSN  80

Query  389  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  547
            +  +WLP GW VE +TR +GS+ G+ YKCYI P +  +FYSK +V + L +  N
Sbjct  81   EHPEWLPAGWKVESRTRMSGSNVGAVYKCYIDPVTDSRFYSKPEVFRHLRTVKN  134



>gb|KDP25474.1| hypothetical protein JCGZ_20630 [Jatropha curcas]
Length=1044

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/169 (31%), Positives = 71/169 (42%), Gaps = 40/169 (24%)
 Frame = +2

Query  38   IVAGKSPEPLPPGWIEHVQV-KNGRTIKYYTNGENGKKFYSRKAVINLVKAGDVNYGQNQ  214
            + A  SPE LP GW     V K GR IKYY N   G+K++S    I   +       Q+ 
Sbjct  1    MTAEYSPEELPHGWTVQFNVLKTGRKIKYYLNSGTGQKYFSTDDFIRYFRGQGTQLDQHH  60

Query  215  GINNGETqiqgigngdgqnqginngdVPNQEtpkpesrrskrsttspspsskLASNTNQS  394
                                  +   +P+++                     L    N+ 
Sbjct  61   -------------------PSKSLIGLPSKKKQ-------------------LIEYANER  82

Query  395  SDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNS  538
             +WLP GW VELKTR +G  +G  YKCY+ PS G KFYSK  V ++L +
Sbjct  83   PEWLPNGWVVELKTRKSGDASGKVYKCYVDPSTGCKFYSKPAVVRYLET  131



>ref|XP_010676506.1| PREDICTED: uncharacterized protein LOC104892309 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=1022

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 47/158 (30%), Positives = 68/158 (43%), Gaps = 39/158 (25%)
 Frame = +2

Query  68   PPGWIEHVQVKNGRTIKYYTNGENGKKFYSRKAVINLVKAGDVNYGQNQGINNGETqiqg  247
            P GW    ++KNGR  KYY N +  +KFYS+ AV+  +K G V+  + Q +         
Sbjct  11   PAGWTVEFKIKNGRKTKYYINTKTHQKFYSKPAVLRFIKDGCVSNKKFQPV---------  61

Query  248  igngdgqnqginngdVPNQEtpkpesrrskrsttspspsskLASNTNQSSDWLPPGWTVE  427
                                              S      L    N  S+WLP GW +E
Sbjct  62   ---------------------------IEHAKKKSSEKIQHLVEANN--SEWLPSGWVME  92

Query  428  LKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNS  538
             + R +G+  G+ YKC+I PS G K +SK +V ++L S
Sbjct  93   TRFRKSGARVGTEYKCFIDPSTGTKLFSKPEVLRYLGS  130



>ref|XP_010676507.1| PREDICTED: uncharacterized protein LOC104892309 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=1021

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 47/158 (30%), Positives = 68/158 (43%), Gaps = 39/158 (25%)
 Frame = +2

Query  68   PPGWIEHVQVKNGRTIKYYTNGENGKKFYSRKAVINLVKAGDVNYGQNQGINNGETqiqg  247
            P GW    ++KNGR  KYY N +  +KFYS+ AV+  +K G V+  + Q +         
Sbjct  11   PAGWTVEFKIKNGRKTKYYINTKTHQKFYSKPAVLRFIKDGCVSNKKFQPV---------  61

Query  248  igngdgqnqginngdVPNQEtpkpesrrskrsttspspsskLASNTNQSSDWLPPGWTVE  427
                                              S      L    N  S+WLP GW +E
Sbjct  62   ---------------------------IEHAKKKSSEKIQHLVEANN--SEWLPSGWVME  92

Query  428  LKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNS  538
             + R +G+  G+ YKC+I PS G K +SK +V ++L S
Sbjct  93   TRFRKSGARVGTEYKCFIDPSTGTKLFSKPEVLRYLGS  130



>ref|XP_010676508.1| PREDICTED: uncharacterized protein LOC104892309 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=942

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 47/158 (30%), Positives = 68/158 (43%), Gaps = 39/158 (25%)
 Frame = +2

Query  68   PPGWIEHVQVKNGRTIKYYTNGENGKKFYSRKAVINLVKAGDVNYGQNQGINNGETqiqg  247
            P GW    ++KNGR  KYY N +  +KFYS+ AV+  +K G V+  + Q +         
Sbjct  11   PAGWTVEFKIKNGRKTKYYINTKTHQKFYSKPAVLRFIKDGCVSNKKFQPV---------  61

Query  248  igngdgqnqginngdVPNQEtpkpesrrskrsttspspsskLASNTNQSSDWLPPGWTVE  427
                                              S      L    N  S+WLP GW +E
Sbjct  62   ---------------------------IEHAKKKSSEKIQHLVEANN--SEWLPSGWVME  92

Query  428  LKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNS  538
             + R +G+  G+ YKC+I PS G K +SK +V ++L S
Sbjct  93   TRFRKSGARVGTEYKCFIDPSTGTKLFSKPEVLRYLGS  130



>ref|XP_007040167.1| Uncharacterized protein TCM_016211 [Theobroma cacao]
 gb|EOY24668.1| Uncharacterized protein TCM_016211 [Theobroma cacao]
Length=1028

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/168 (31%), Positives = 69/168 (41%), Gaps = 38/168 (23%)
 Frame = +2

Query  38   IVAGKSPEPLPPGWIEHVQV-KNGRTIKYYTNGENGKKFYSRKAVINLVKAGDVNYGQNQ  214
            + A  SP+ LP GW    +V K GR I +Y N   G+KF+++  +I   K G       Q
Sbjct  1    MTAKTSPDWLPAGWTLQFKVQKTGRRITHYVNLATGQKFFTKDDLIRYTKTGSTKCDDLQ  60

Query  215  GINNGETqiqgigngdgqnqginngdVPNQEtpkpesrrskrsttspspsskLASNTNQS  394
                                                    +      + S   A N N+ 
Sbjct  61   ------------------------------------PTLRQTKMPPANGSMDTAVNANER  84

Query  395  SDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLN  535
             +WLP  W +ELKTR +G   G  YK YI PS G +FYSK QV +FLN
Sbjct  85   PEWLPKNWFMELKTRKSGVRIGKHYKIYIDPSTGSRFYSKLQVFRFLN  132


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = +2

Query  386  NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNT  556
            ++  +WLP  W  ELKT  +G+  G +YK Y+ PS G +F+S+ +V +FL+     +T
Sbjct  159  HEHPEWLPKNWFTELKTYKSGAKFGKSYKIYVDPSTGLRFHSRPEVFRFLDKGEQKST  216



>ref|XP_010089148.1| Methyl-CpG-binding domain-containing protein 5 [Morus notabilis]
 gb|EXB37395.1| Methyl-CpG-binding domain-containing protein 5 [Morus notabilis]
Length=171

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 72/170 (42%), Gaps = 38/170 (22%)
 Frame = +2

Query  38   IVAGKSPEPLPPGWIEHVQV-KNGRTIKYYTNGENGKKFYSRKAVINLVKAGDVNYGQNQ  214
            +VA  S + LP GW    +V K+GR +  YTN E GK   S+  V  L+ AG     Q Q
Sbjct  1    MVANDSSDWLPSGWTVQFKVLKSGRKVGIYTNTETGKIVLSKHEVFQLISAGSSCSTQPQ  60

Query  215  GINNGETqiqgigngdgqnqginngdVPNQEtpkpesrrskrsttspspsskLASNTNQS  394
              N               +  +     P Q                        +  +  
Sbjct  61   TSNT--------------HVSLQAERTPLQP----------------------VNEKDLL  84

Query  395  SDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSA  541
             +WLP GW VE++TR +G+  G  YK YI P +G KFYSK +V ++L + 
Sbjct  85   PEWLPKGWKVEVRTRKSGTLAGKEYKSYIDPLNGSKFYSKLEVLRYLKTV  134



>ref|XP_011463824.1| PREDICTED: uncharacterized protein LOC101312827 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=1030

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 68/169 (40%), Gaps = 40/169 (24%)
 Frame = +2

Query  38   IVAGKSPEPLPPGWIEHVQVKN-GRTIKYYTNGENGKKFYSRKAVINLVKAGDVNYGQNQ  214
            +VA  SP+ LP GW    + +N GR    Y   E GKKF+S+  VI   K    N G+  
Sbjct  1    MVAASSPDWLPAGWSVQFRAQNRGRRSVIYIELETGKKFFSKDDVIRYTKKT-TNCGEEP  59

Query  215  GINNGETqiqgigngdgqnqginngdVPNQEtpkpesrrskrsttspspsskLASNTNQS  394
               N +                                              + +NT + 
Sbjct  60   KPTNTKNPSSKSHLQ-------------------------------------VVANTVEY  82

Query  395  SDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNS  538
             +WLP GW VEL+TR +G   G  YKCYI PS    FYSK +V + L +
Sbjct  83   PEWLPDGWKVELRTRKSGVQVGKEYKCYIDPSRECTFYSKPEVFRHLRT  131



>ref|XP_011463825.1| PREDICTED: uncharacterized protein LOC101312827 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=1009

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 52/169 (31%), Positives = 69/169 (41%), Gaps = 40/169 (24%)
 Frame = +2

Query  38   IVAGKSPEPLPPGWIEHVQVKN-GRTIKYYTNGENGKKFYSRKAVINLVKAGDVNYGQNQ  214
            +VA  SP+ LP GW    + +N GR    Y   E GKKF+S+  VI   K    N G+  
Sbjct  1    MVAASSPDWLPAGWSVQFRAQNRGRRSVIYIELETGKKFFSKDDVIRYTKKT-TNCGEEP  59

Query  215  GINNGETqiqgigngdgqnqginngdVPNQEtpkpesrrskrsttspspsskLASNTNQS  394
               N                                         S     ++ +NT + 
Sbjct  60   KPTN-------------------------------------TKNPSSKSHLQVVANTVEY  82

Query  395  SDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNS  538
             +WLP GW VEL+TR +G   G  YKCYI PS    FYSK +V + L +
Sbjct  83   PEWLPDGWKVELRTRKSGVQVGKEYKCYIDPSRECTFYSKPEVFRHLRT  131



>ref|XP_007158477.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
 gb|ESW30471.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
Length=1004

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = +2

Query  374  ASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSN  553
            A  +N+  +WLP GW VE KTR +G++ G  YKCYI P+G KFYSK +V ++L +  NSN
Sbjct  25   AEKSNEHPEWLPDGWIVESKTRKSGANMGCGYKCYIDPTGCKFYSKPEVLRYLET-VNSN  83

Query  554  T  556
            +
Sbjct  84   S  84



>ref|XP_007158475.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
 gb|ESW30469.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
Length=959

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = +2

Query  374  ASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSN  553
            A  +N+  +WLP GW VE KTR +G++ G  YKCYI P+G KFYSK +V ++L +  NSN
Sbjct  25   AEKSNEHPEWLPDGWIVESKTRKSGANMGCGYKCYIDPTGCKFYSKPEVLRYLET-VNSN  83

Query  554  T  556
            +
Sbjct  84   S  84



>ref|XP_007158478.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
 gb|ESW30472.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
Length=972

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = +2

Query  374  ASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSN  553
            A  +N+  +WLP GW VE KTR +G++ G  YKCYI P+G KFYSK +V ++L +  NSN
Sbjct  25   AEKSNEHPEWLPDGWIVESKTRKSGANMGCGYKCYIDPTGCKFYSKPEVLRYLET-VNSN  83

Query  554  T  556
            +
Sbjct  84   S  84



>ref|XP_007158476.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
 gb|ESW30470.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
Length=927

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = +2

Query  374  ASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSN  553
            A  +N+  +WLP GW VE KTR +G++ G  YKCYI P+G KFYSK +V ++L +  NSN
Sbjct  25   AEKSNEHPEWLPDGWIVESKTRKSGANMGCGYKCYIDPTGCKFYSKPEVLRYLET-VNSN  83

Query  554  T  556
            +
Sbjct  84   S  84



>ref|XP_006580605.1| PREDICTED: uncharacterized protein LOC100782433 [Glycine max]
Length=1209

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +2

Query  386  NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAAN  547
            N+  DWLP GW VE++TR +G H GS YKCYI P  R KF+SK +V ++L +  +
Sbjct  32   NEHPDWLPDGWNVEVRTRKSGVHMGSGYKCYIEPLKRYKFFSKPEVLRYLETVKD  86



>gb|KHN23667.1| Methyl-CpG-binding domain-containing protein 13 [Glycine soja]
Length=1188

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +2

Query  386  NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAAN  547
            N+  DWLP GW VE++TR +G H GS YKCYI P  R KF+SK +V ++L +  +
Sbjct  32   NEHPDWLPDGWNVEVRTRKSGVHMGSGYKCYIEPLKRYKFFSKPEVLRYLETVKD  86



>ref|XP_008796741.1| PREDICTED: uncharacterized protein LOC103712110 isoform X6 [Phoenix 
dactylifera]
Length=651

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = +2

Query  371  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  547
            LA       DWLP GW +E KTR +G+H G  YKCYI P +G +FYSK +V +++    +
Sbjct  29   LAEQIKDFPDWLPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDGMS  88

Query  548  SN  553
             N
Sbjct  89   CN  90



>ref|XP_008796740.1| PREDICTED: uncharacterized protein LOC103712110 isoform X5 [Phoenix 
dactylifera]
Length=652

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = +2

Query  371  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  547
            LA       DWLP GW +E KTR +G+H G  YKCYI P +G +FYSK +V +++    +
Sbjct  29   LAEQIKDFPDWLPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDGMS  88

Query  548  SN  553
             N
Sbjct  89   CN  90



>ref|XP_008796737.1| PREDICTED: uncharacterized protein LOC103712110 isoform X3 [Phoenix 
dactylifera]
Length=693

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = +2

Query  371  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  547
            LA       DWLP GW +E KTR +G+H G  YKCYI P +G +FYSK +V +++    +
Sbjct  72   LAEQIKDFPDWLPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDGMS  131

Query  548  SN  553
             N
Sbjct  132  CN  133



>ref|XP_008796736.1| PREDICTED: uncharacterized protein LOC103712110 isoform X2 [Phoenix 
dactylifera]
Length=694

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = +2

Query  371  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  547
            LA       DWLP GW +E KTR +G+H G  YKCYI P +G +FYSK +V +++    +
Sbjct  72   LAEQIKDFPDWLPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDGMS  131

Query  548  SN  553
             N
Sbjct  132  CN  133



>ref|XP_008796735.1| PREDICTED: uncharacterized protein LOC103712110 isoform X1 [Phoenix 
dactylifera]
Length=695

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = +2

Query  371  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  547
            LA       DWLP GW +E KTR +G+H G  YKCYI P +G +FYSK +V +++    +
Sbjct  72   LAEQIKDFPDWLPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDGMS  131

Query  548  SN  553
             N
Sbjct  132  CN  133



>ref|XP_008796738.1| PREDICTED: uncharacterized protein LOC103712110 isoform X4 [Phoenix 
dactylifera]
Length=692

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = +2

Query  371  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  547
            LA       DWLP GW +E KTR +G+H G  YKCYI P +G +FYSK +V +++    +
Sbjct  72   LAEQIKDFPDWLPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDGMS  131

Query  548  SN  553
             N
Sbjct  132  CN  133



>ref|XP_008796743.1| PREDICTED: uncharacterized protein LOC103712110 isoform X8 [Phoenix 
dactylifera]
Length=600

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = +2

Query  371  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  547
            LA       DWLP GW +E KTR +G+H G  YKCYI P +G +FYSK +V +++    +
Sbjct  29   LAEQIKDFPDWLPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDGMS  88

Query  548  SN  553
             N
Sbjct  89   CN  90



>emb|CBI31785.3| unnamed protein product [Vitis vinifera]
Length=560

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 36/51 (71%), Gaps = 5/51 (10%)
 Frame = +2

Query  392  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSA  541
            S DWLPPGW VE+K  STG      YKCYI PS G KFYSK +VS++LN A
Sbjct  6    SDDWLPPGWKVEMKLTSTGRK----YKCYIHPSRGLKFYSKPEVSRYLNKA  52



>ref|XP_003532403.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X1 [Glycine max]
 ref|XP_006584707.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Glycine max]
Length=1122

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +2

Query  386  NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  547
            N+  DWLP GW VE++TR +G H GS YKCYI P  G KF+SK +V ++L +  +
Sbjct  33   NEHPDWLPDGWNVEVRTRKSGVHMGSGYKCYIEPLKGYKFFSKPEVLRYLETVKD  87



>ref|XP_010662494.1| PREDICTED: uncharacterized protein LOC100263513 isoform X1 [Vitis 
vinifera]
Length=637

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 36/51 (71%), Gaps = 5/51 (10%)
 Frame = +2

Query  392  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSA  541
            S DWLPPGW VE+K  STG      YKCYI PS G KFYSK +VS++LN A
Sbjct  6    SDDWLPPGWKVEMKLTSTGRK----YKCYIHPSRGLKFYSKPEVSRYLNKA  52



>gb|KHN16846.1| Methyl-CpG-binding domain-containing protein 13 [Glycine soja]
Length=1122

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +2

Query  386  NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  547
            N+  DWLP GW VE++TR +G H GS YKCYI P  G KF+SK +V ++L +  +
Sbjct  33   NEHPDWLPDGWNVEVRTRKSGVHMGSGYKCYIEPLKGYKFFSKPEVLRYLETVKD  87



>emb|CAN74037.1| hypothetical protein VITISV_023406 [Vitis vinifera]
Length=730

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 36/51 (71%), Gaps = 5/51 (10%)
 Frame = +2

Query  392  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSA  541
            S DWLPPGW VE+K  ST    G  YKCYI PS G KFYSK +VS++LN A
Sbjct  6    SDDWLPPGWKVEMKLTST----GRKYKCYIHPSRGLKFYSKPEVSRYLNKA  52



>ref|XP_010273135.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 [Nelumbo 
nucifera]
 ref|XP_010273136.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 [Nelumbo 
nucifera]
Length=553

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = +2

Query  371  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLN  535
            L        +WLP GW VE+KTR +GS  G  YKCYI+PS G K YSK +V ++L+
Sbjct  20   LVVQMEDPPEWLPAGWVVEIKTRMSGSSAGQKYKCYIAPSTGCKLYSKKEVQRYLS  75



>ref|XP_008796742.1| PREDICTED: uncharacterized protein LOC103712110 isoform X7 [Phoenix 
dactylifera]
Length=644

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = +2

Query  371  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  547
            LA       DWLP GW +E KTR +G+H G  YKCYI P +G +FYSK +V +++    +
Sbjct  72   LAEQIKDFPDWLPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDGMS  131

Query  548  SN  553
             N
Sbjct  132  CN  133



>ref|XP_002509754.1| hypothetical protein RCOM_1685990 [Ricinus communis]
 gb|EEF51141.1| hypothetical protein RCOM_1685990 [Ricinus communis]
Length=978

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +2

Query  371  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNS  538
            L   TN+  +WLP GW VELK +++GS  G  YKCY+ PS G KFYSK +V + L +
Sbjct  3    LIEYTNERPEWLPHGWIVELKIKNSGSARGRKYKCYVEPSTGYKFYSKPEVFRHLET  59



>ref|XP_010918513.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X1 [Elaeis guineensis]
Length=514

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 37/62 (60%), Gaps = 1/62 (2%)
 Frame = +2

Query  371  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  547
            LA       DWLP GW +E KTR +G++ G  YKCYI P +G KFYSK +V +++     
Sbjct  72   LAEQIKDFPDWLPAGWGLEFKTRKSGTNAGRQYKCYIDPVTGYKFYSKNEVLRYIKDGIP  131

Query  548  SN  553
             N
Sbjct  132  RN  133



>ref|XP_006440583.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
 gb|ESR53823.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
Length=1065

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +2

Query  380  NTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNT  556
            + N   DWLP GW VELKTR +GS  G  YK YI P +G KF+S  +V + L S  N N+
Sbjct  125  DENNRPDWLPDGWVVELKTRKSGSAVGRQYKVYIEPITGCKFFSMPEVLRHLESVKNRNS  184



>ref|XP_010918514.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X2 [Elaeis guineensis]
Length=488

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 37/62 (60%), Gaps = 1/62 (2%)
 Frame = +2

Query  371  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  547
            LA       DWLP GW +E KTR +G++ G  YKCYI P +G KFYSK +V +++     
Sbjct  46   LAEQIKDFPDWLPAGWGLEFKTRKSGTNAGRQYKCYIDPVTGYKFYSKNEVLRYIKDGIP  105

Query  548  SN  553
             N
Sbjct  106  RN  107



>ref|XP_006440582.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
 gb|ESR53822.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
Length=1094

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +2

Query  380  NTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNT  556
            + N   DWLP GW VELKTR +GS  G  YK YI P +G KF+S  +V + L S  N N+
Sbjct  125  DENNRPDWLPDGWVVELKTRKSGSAVGRQYKVYIEPITGCKFFSMPEVLRHLESVKNRNS  184



>ref|XP_006440581.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
 gb|ESR53821.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
Length=1065

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +2

Query  380  NTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNT  556
            + N   DWLP GW VELKTR +GS  G  YK YI P +G KF+S  +V + L S  N N+
Sbjct  96   DENNRPDWLPDGWVVELKTRKSGSAVGRQYKVYIEPITGCKFFSMPEVLRHLESVKNRNS  155



>gb|KDO55595.1| hypothetical protein CISIN_1g0013392mg, partial [Citrus sinensis]
Length=267

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +2

Query  380  NTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNT  556
            + N   DWLP GW V+LKTR +GS  G  YK YI P +G KF+S  +V + L S  N N+
Sbjct  96   DENNRPDWLPDGWVVDLKTRKSGSAVGRQYKVYIEPITGCKFFSMPEVLRHLESVKNRNS  155



>gb|KDO55591.1| hypothetical protein CISIN_1g0013392mg, partial [Citrus sinensis]
 gb|KDO55592.1| hypothetical protein CISIN_1g0013392mg, partial [Citrus sinensis]
 gb|KDO55593.1| hypothetical protein CISIN_1g0013392mg, partial [Citrus sinensis]
Length=296

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +2

Query  380  NTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNT  556
            + N   DWLP GW V+LKTR +GS  G  YK YI P +G KF+S  +V + L S  N N+
Sbjct  125  DENNRPDWLPDGWVVDLKTRKSGSAVGRQYKVYIEPITGCKFFSMPEVLRHLESVKNRNS  184



>ref|XP_007160033.1| hypothetical protein PHAVU_002G287000g [Phaseolus vulgaris]
 gb|ESW32027.1| hypothetical protein PHAVU_002G287000g [Phaseolus vulgaris]
Length=1225

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 38/56 (68%), Gaps = 1/56 (2%)
 Frame = +2

Query  386  NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANS  550
            ++  +WLP GW +E++ R +G H GS YKCYI P  G KF+SK +V ++L +  +S
Sbjct  33   DEHPEWLPDGWNMEVRIRKSGLHMGSGYKCYIEPLKGYKFFSKPEVLRYLETVKDS  88



>ref|XP_004143925.1| PREDICTED: uncharacterized protein LOC101223188 [Cucumis sativus]
 ref|XP_004159962.1| PREDICTED: uncharacterized protein LOC101226976 [Cucumis sativus]
 gb|KGN50128.1| hypothetical protein Csa_5G154900 [Cucumis sativus]
Length=853

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 39/60 (65%), Gaps = 1/60 (2%)
 Frame = +2

Query  371  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  547
            L   +N+  +WLP GW VE +TR +GS+ G+ YKCYI P +  +FYSK +V + L +  N
Sbjct  75   LTVKSNEHPEWLPAGWKVESRTRMSGSNVGAVYKCYIDPVTDSRFYSKPEVFRHLRTVKN  134



>ref|XP_010661063.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X3 [Vitis vinifera]
Length=482

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +2

Query  371  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNS  538
            L   T +  DWLP GW +ELKT+ +GS  G  YKCY+ PS G +FYSK  V ++L +
Sbjct  14   LGIKTKKFPDWLPNGWILELKTQRSGSCVGKQYKCYLDPSTGYRFYSKPDVFRYLKT  70



>ref|XP_010661055.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X2 [Vitis vinifera]
Length=496

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +2

Query  371  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNS  538
            L   T +  DWLP GW +ELKT+ +GS  G  YKCY+ PS G +FYSK  V ++L +
Sbjct  28   LGIKTKKFPDWLPNGWILELKTQRSGSCVGKQYKCYLDPSTGYRFYSKPDVFRYLKT  84



>ref|XP_006477436.1| PREDICTED: uncharacterized protein LOC102622266 [Citrus sinensis]
Length=1096

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +2

Query  380  NTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNT  556
            + N   DWLP GW V+LKTR +GS  G  YK YI P +G KF+S  +V + L S  N N+
Sbjct  125  DENNRPDWLPDGWVVDLKTRKSGSAVGRQYKVYIEPITGCKFFSMPEVLRHLESVKNRNS  184



>ref|XP_008437228.1| PREDICTED: uncharacterized protein LOC103482721 isoform X2 [Cucumis 
melo]
Length=634

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 38/56 (68%), Gaps = 1/56 (2%)
 Frame = +2

Query  383  TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  547
            +N+  +WLP GW VE +TR +GS+ G+ YKCYI P +  +FYSK +V + L +  N
Sbjct  78   SNEHPEWLPAGWKVESRTRMSGSNVGAVYKCYIDPVTDSRFYSKPEVFRHLRTVKN  133



>ref|XP_006827729.1| hypothetical protein AMTR_s00009p00261370 [Amborella trichopoda]
 gb|ERM95145.1| hypothetical protein AMTR_s00009p00261370 [Amborella trichopoda]
Length=1239

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 75/180 (42%), Gaps = 41/180 (23%)
 Frame = +2

Query  65   LPPGWI-EHVQVKNGRT----IKYYTNGENGKKFYSRKAVINLVKAGDVN--------YG  205
            LP GWI E  + K+G T     KY+     G+ F S+  V+  +K               
Sbjct  10   LPDGWIMEQKRRKSGATKGLADKYFIEAATGRFFRSKLQVLRYLKTEKYTGKLWPVKLVS  69

Query  206  QNQGINNGETqiqgigngdgqnqginngdVPNQEtpkpesrrskrsttspspsskLASNT  385
             N+ + NGE+  +   +     + +     P                          S +
Sbjct  70   NNKELTNGESMEKETSSAKILQEKVQRTLSP--------------------------SES  103

Query  386  NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSA-ANSNTP  559
             QSSDWLPPGWT+E+KTR  G   G   K YI   +G+KF S+  V ++L    A+ +TP
Sbjct  104  GQSSDWLPPGWTIEIKTRKNGVSAGMREKFYIELATGKKFASRLAVLRYLTDGNASVSTP  163


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 32/51 (63%), Gaps = 1/51 (2%)
 Frame = +2

Query  389  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNS  538
            Q  +WLPPGWT+E+K R +G   G   K YI P+ GR F S+  + +++ +
Sbjct  652  QPPEWLPPGWTMEIKERKSGKSAGLREKYYIDPATGRSFRSRIAIVRYIEA  702



>emb|CBI34715.3| unnamed protein product [Vitis vinifera]
Length=1076

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 28/57 (49%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +2

Query  371  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNS  538
            L   T +  DWLP GW +ELKT+ +GS  G  YKCY+ PS G +FYSK  V ++L +
Sbjct  28   LGIKTKKFPDWLPNGWILELKTQRSGSCVGKQYKCYLDPSTGYRFYSKPDVFRYLKT  84



>ref|XP_004503754.1| PREDICTED: uncharacterized protein LOC101511357 [Cicer arietinum]
Length=1262

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +2

Query  374  ASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYI-SPSGRKFYSKAQVSQFLNSAANS  550
            A   N+  DWLP GW +E++TR +G   GS YKCYI S +G KFYSK +V ++L +   +
Sbjct  29   AEKGNEWPDWLPDGWDMEVRTRKSGPLMGSGYKCYIDSLNGNKFYSKPEVLRYLETTKGN  88

Query  551  N  553
            N
Sbjct  89   N  89



>gb|KEH21030.1| methyl-CpG-binding domain protein [Medicago truncatula]
Length=1325

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 35/52 (67%), Gaps = 1/52 (2%)
 Frame = +2

Query  386  NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNS  538
            ++  +WLP GW +E++TR +G   GS YKCYI PS   KFYSK +V + L +
Sbjct  33   DEHPEWLPNGWDIEVRTRQSGPAMGSAYKCYIDPSNTYKFYSKPEVLRHLET  84



>ref|XP_009418270.1| PREDICTED: uncharacterized protein LOC103998509 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=268

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 67/175 (38%), Gaps = 50/175 (29%)
 Frame = +2

Query  50   KSPEPLPPGWIEHVQV-KNGRTIKYYTNGENGKKFYSRKAVI---NLVKAGDVNYGQNQG  217
            K P+ LP GWI  V+  K G T +YYT   +   F S++ VI   N+V A        + 
Sbjct  5    KPPDWLPDGWIMEVRRGKKGFTYRYYTCPISEYTFCSKEEVIHYLNIVAAASHASEDTEC  64

Query  218  INNGETqiqgigngdgqnqginngdVPNQEtpkpesrrskrsttspspsskLASNTNQSS  397
              + +                                             +L      S 
Sbjct  65   FGDED--------------------------------------------QQLVHKVKDSL  80

Query  398  DWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTP  559
             WLP GW +E++TR  G+     YKCY+  S G  FYSK +V QF+  A N+  P
Sbjct  81   KWLPRGWIMEIRTRKIGAEAEERYKCYLHQSTGTVFYSKEEVLQFIE-AGNACGP  134



>ref|XP_009390529.1| PREDICTED: uncharacterized protein LOC103976890 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=569

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +2

Query  371  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNS  538
            L      S DWLP GW +E +T+  G++ G   KCY +PS G +FYSK QV + LN+
Sbjct  25   LVREVKDSPDWLPSGWVLETRTQKNGAYAGREIKCYYNPSTGSRFYSKKQVFRHLNA  81



>ref|XP_009390518.1| PREDICTED: uncharacterized protein LOC103976890 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=589

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +2

Query  371  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNS  538
            L      S DWLP GW +E +T+  G++ G   KCY +PS G +FYSK QV + LN+
Sbjct  25   LVREVKDSPDWLPSGWVLETRTQKNGAYAGREIKCYYNPSTGSRFYSKKQVFRHLNA  81



>ref|XP_009390512.1| PREDICTED: uncharacterized protein LOC103976890 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=593

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +2

Query  371  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNS  538
            L      S DWLP GW +E +T+  G++ G   KCY +PS G +FYSK QV + LN+
Sbjct  25   LVREVKDSPDWLPSGWVLETRTQKNGAYAGREIKCYYNPSTGSRFYSKKQVFRHLNA  81



>emb|CBI16127.3| unnamed protein product [Vitis vinifera]
Length=135

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = +2

Query  389  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTP  559
            +  DWLPPGW VE + RS+G+  GS  K +I P +GR+F SK +V  +L +      P
Sbjct  5    EREDWLPPGWIVEGRVRSSGASAGSRDKYFIEPITGRRFRSKKEVRYYLETGEVRKKP  62



>gb|KDP34493.1| hypothetical protein JCGZ_11043 [Jatropha curcas]
Length=237

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +2

Query  371  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNS  538
            +A  + +S+ WLPPGW VE + R++G+  G+  K YI P +GRKF SK +V  +L +
Sbjct  92   MAPGSAESASWLPPGWLVEDRVRTSGATAGTVDKYYIEPTTGRKFRSKREVQYYLET  148



>ref|XP_002532846.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF29524.1| DNA binding protein, putative [Ricinus communis]
Length=234

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = +2

Query  392  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNT  556
            S++WLPPGW VE + R++G+  G+  K YI P +GR+F SK +V  FL +     T
Sbjct  96   SANWLPPGWLVEDRVRASGATAGTVDKYYIEPVTGRRFRSKKEVQYFLETGTKKKT  151



>emb|CDP05220.1| unnamed protein product [Coffea canephora]
Length=480

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 32/48 (67%), Gaps = 5/48 (10%)
 Frame = +2

Query  392  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSG-RKFYSKAQVSQFL  532
            S DWLP GW VE++ R TG  +    KCY+ PS  RKFYSK +V ++L
Sbjct  7    SDDWLPAGWKVEVRVRKTGKKD----KCYVDPSNERKFYSKPEVLRYL  50



>ref|XP_009345985.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like 
[Pyrus x bretschneideri]
Length=234

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 36/53 (68%), Gaps = 1/53 (2%)
 Frame = +2

Query  383  TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNS  538
            T+    WLP GW+V+ K RS+G+  GST + YI P SGR+F SK +V +FL +
Sbjct  94   TDSMESWLPQGWSVQEKVRSSGATAGSTDRYYIDPVSGRRFRSKIEVLRFLET  146



>ref|XP_009353664.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like 
[Pyrus x bretschneideri]
Length=231

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 36/53 (68%), Gaps = 1/53 (2%)
 Frame = +2

Query  383  TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNS  538
            T+    WLP GW+V+ K RS+G+  GST + YI P SGR+F SK +V +FL +
Sbjct  91   TDSMESWLPQGWSVQEKVRSSGATAGSTDRYYIDPVSGRRFRSKIEVLRFLET  143



>ref|XP_002314180.1| methyl-CpG-binding domain-containing family protein [Populus 
trichocarpa]
 gb|EEE88135.1| methyl-CpG-binding domain-containing family protein [Populus 
trichocarpa]
Length=214

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = +2

Query  374  ASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNS  538
            +S T   + WLPPGW VE + R++G+  G+  K YI P SGRKF SK  V  +L +
Sbjct  64   SSETTIETSWLPPGWVVEDRIRTSGATAGTVDKYYIDPASGRKFRSKKDVQYYLET  119



>ref|XP_004294545.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like 
[Fragaria vesca subsp. vesca]
Length=209

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = +2

Query  392  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNS  538
            S DWLP GW VE K RS+G+  GST + Y  P SGR+F SK +V  FL +
Sbjct  71   SMDWLPAGWRVEYKVRSSGATAGSTDRYYHDPVSGRRFRSKKEVLHFLET  120



>ref|XP_009345984.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like 
[Pyrus x bretschneideri]
Length=234

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 36/53 (68%), Gaps = 1/53 (2%)
 Frame = +2

Query  383  TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNS  538
            T+    WLP GW+V+ K RS+G+  GST + YI P SGR+F SK +V +FL +
Sbjct  94   TDSMESWLPQGWSVQEKVRSSGATAGSTDRYYIDPVSGRRFRSKIEVLRFLET  146



>ref|XP_006369524.1| hypothetical protein POPTR_0001s24690g [Populus trichocarpa]
 gb|ERP66093.1| hypothetical protein POPTR_0001s24690g [Populus trichocarpa]
Length=167

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = +2

Query  377  SNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNS  538
            S T   + WLPPGW VE + R++G+  G+  K YI P SGR+F SK  V  +L +
Sbjct  65   SETAVDTSWLPPGWVVEDRVRTSGATAGTRDKYYIEPVSGRRFRSKKDVQYYLET  119



>ref|XP_011042705.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like 
[Populus euphratica]
Length=214

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = +2

Query  374  ASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNS  538
            +S T   + WLPPGW VE + R++G+  G+  K YI P SGRKF SK  V  +L +
Sbjct  64   SSETTIETSWLPPGWVVEDRIRTSGATAGTVDKYYIDPASGRKFRSKKDVQYYLET  119



>ref|XP_010934847.1| PREDICTED: uncharacterized protein LOC105054908 isoform X2 [Elaeis 
guineensis]
Length=654

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 30/47 (64%), Gaps = 1/47 (2%)
 Frame = +2

Query  401  WLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNS  538
            WLPPGW +E++T+  GS     YK Y  PS R +FYSK  V QF+ S
Sbjct  82   WLPPGWLLEIRTQRCGSKARQIYKSYFDPSTRSRFYSKGDVLQFVKS  128



>ref|XP_010934846.1| PREDICTED: uncharacterized protein LOC105054908 isoform X1 [Elaeis 
guineensis]
Length=687

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 30/47 (64%), Gaps = 1/47 (2%)
 Frame = +2

Query  401  WLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNS  538
            WLPPGW +E++T+  GS     YK Y  PS R +FYSK  V QF+ S
Sbjct  82   WLPPGWLLEIRTQRCGSKARQIYKSYFDPSTRSRFYSKGDVLQFVKS  128



>ref|XP_010934848.1| PREDICTED: uncharacterized protein LOC105054908 isoform X3 [Elaeis 
guineensis]
Length=638

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 30/47 (64%), Gaps = 1/47 (2%)
 Frame = +2

Query  401  WLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNS  538
            WLPPGW +E++T+  GS     YK Y  PS R +FYSK  V QF+ S
Sbjct  82   WLPPGWLLEIRTQRCGSKARQIYKSYFDPSTRSRFYSKGDVLQFVKS  128



>ref|XP_009364396.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like 
[Pyrus x bretschneideri]
Length=236

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = +2

Query  401  WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNS  538
            WLPPGW+V+ K RS+G   GST + Y  P SGR+F SK +V +FL +
Sbjct  101  WLPPGWSVQEKVRSSGLTAGSTDRYYFDPVSGRRFRSKIEVLRFLET  147



>ref|XP_008357235.1| PREDICTED: methyl-CpG-binding domain-containing protein 5 [Malus 
domestica]
Length=236

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = +2

Query  401  WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNS  538
            WLPPGW+V+ K RS+G   GST + Y  P SGR+F SK +V +FL +
Sbjct  101  WLPPGWSVQEKVRSSGLTAGSTDRYYFDPVSGRRFRSKIEVLRFLET  147



>ref|XP_010934849.1| PREDICTED: uncharacterized protein LOC105054908 isoform X4 [Elaeis 
guineensis]
Length=605

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 30/47 (64%), Gaps = 1/47 (2%)
 Frame = +2

Query  401  WLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNS  538
            WLPPGW +E++T+  GS     YK Y  PS R +FYSK  V QF+ S
Sbjct  82   WLPPGWLLEIRTQRCGSKARQIYKSYFDPSTRSRFYSKGDVLQFVKS  128



>ref|XP_006369523.1| hypothetical protein POPTR_0001s24690g [Populus trichocarpa]
 gb|ERP66092.1| hypothetical protein POPTR_0001s24690g [Populus trichocarpa]
Length=162

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = +2

Query  377  SNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNS  538
            S T   + WLPPGW VE + R++G+  G+  K YI P SGR+F SK  V  +L +
Sbjct  65   SETAVDTSWLPPGWVVEDRVRTSGATAGTRDKYYIEPVSGRRFRSKKDVQYYLET  119



>ref|XP_003632148.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like 
[Vitis vinifera]
Length=297

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 1/51 (2%)
 Frame = +2

Query  389  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNS  538
            +  DWLPPGW VE + RS+G+  GS  K +I P +GR+F SK +V  +L +
Sbjct  167  EREDWLPPGWIVEGRVRSSGASAGSRDKYFIEPITGRRFRSKKEVRYYLET  217



>emb|CDP06874.1| unnamed protein product [Coffea canephora]
Length=254

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  389  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNS  538
            +  DWLP  W +E++ R++G+  G++ + + SPSG KF SK +V +FL +
Sbjct  95   ERPDWLPDDWKIEVRVRTSGATAGTSDRYFFSPSGLKFRSKVEVLEFLET  144



>ref|XP_008234128.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X1 [Prunus mume]
Length=547

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 37/55 (67%), Gaps = 3/55 (5%)
 Frame = +2

Query  389  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSN  553
            +S DWLP GWTVE+K R+ G  +   Y    S SG KF SKA+VS++LN++  S+
Sbjct  5    KSEDWLPTGWTVEVKVRNNGKRDKYYYD---SASGHKFNSKAEVSRYLNTSQISD  56



>ref|XP_002299872.1| methyl-CpG-binding domain-containing family protein [Populus 
trichocarpa]
 gb|ABK93437.1| unknown [Populus trichocarpa]
 gb|EEE84677.1| methyl-CpG-binding domain-containing family protein [Populus 
trichocarpa]
Length=214

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = +2

Query  377  SNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNS  538
            S T   + WLPPGW VE + R++G+  G+  K YI P SGR+F SK  V  +L +
Sbjct  65   SETAVDTSWLPPGWVVEDRVRTSGATAGTRDKYYIEPVSGRRFRSKKDVQYYLET  119



>ref|XP_008791903.1| PREDICTED: uncharacterized protein LOC103708650 [Phoenix dactylifera]
Length=569

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 29/47 (62%), Gaps = 1/47 (2%)
 Frame = +2

Query  401  WLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNS  538
            WLPPGW +E++T+  GS     Y  Y  PS G +FYSK  V QF+ S
Sbjct  82   WLPPGWLLEIRTQRRGSKAQQIYMSYFEPSTGSRFYSKGDVLQFVKS  128



>ref|XP_011015295.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like, 
partial [Populus euphratica]
Length=182

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 33/55 (60%), Gaps = 1/55 (2%)
 Frame = +2

Query  377  SNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNS  538
            S T   + WLPPGW VE + RS+G+  G+  K Y  P SGR+F SK  V  +L +
Sbjct  53   SETAVDTSWLPPGWIVEDRVRSSGATAGTRDKYYFEPVSGRRFRSKKDVQYYLET  107



>ref|XP_007514055.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15492.1| predicted protein [Bathycoccus prasinos]
Length=872

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  404  LPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAAN  547
            L PGW V ++TR +G+  G T K Y SP GRK  SK +V +FL+S  +
Sbjct  23   LAPGWRVAIETRKSGATKGGTDKYYFSPDGRKLRSKTEVMRFLSSTTS  70



>gb|KHG28622.1| Methyl-CpG-binding domain-containing 13 -like protein [Gossypium 
arboreum]
Length=598

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 31/49 (63%), Gaps = 5/49 (10%)
 Frame = +2

Query  392  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLN  535
            S DWLPPGW VE++ R     NG   KCY +P G  +F S+A+V ++L 
Sbjct  6    SDDWLPPGWKVEVRQR----RNGKKDKCYYTPCGELRFISRAEVVRYLE  50



>gb|KJB52811.1| hypothetical protein B456_008G278300 [Gossypium raimondii]
Length=600

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 31/48 (65%), Gaps = 5/48 (10%)
 Frame = +2

Query  392  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFL  532
            S DWLPPGW VE++ R     NG   KCY +P G  +F S+A+V ++L
Sbjct  6    SDDWLPPGWKVEVRQR----RNGKKDKCYYAPCGELRFISRAEVVRYL  49



>gb|KJB39637.1| hypothetical protein B456_007G022700 [Gossypium raimondii]
Length=914

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 33/61 (54%), Gaps = 1/61 (2%)
 Frame = +2

Query  374  ASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANS  550
            A   N+  +WLP  W VE+KT  +G   G   K Y+ PS G +FYSK  V +FL  A   
Sbjct  82   AVKENECPEWLPKNWFVEVKTHKSGEFIGKRVKIYVDPSTGLRFYSKPAVFRFLKQAEQR  141

Query  551  N  553
            N
Sbjct  142  N  142



>ref|XP_008223622.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like 
[Prunus mume]
Length=244

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = +2

Query  401  WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNS  538
            WLP GW+VE + R++G+  GST + Y+ P SGR+F SK +V  FL +
Sbjct  107  WLPQGWSVEERVRASGATAGSTDRYYVDPVSGRRFRSKVEVLYFLET  153



>emb|CDY33033.1| BnaA10g12390D [Brassica napus]
Length=541

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 32/48 (67%), Gaps = 1/48 (2%)
 Frame = +2

Query  395  SDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLN  535
            S+WLPPGW VE K R++G+  GS  K Y  P +GRKF SK +V  +L 
Sbjct  387  SNWLPPGWRVEDKVRTSGATAGSVDKYYYEPITGRKFRSKTEVLYYLE  434



>gb|KHF99779.1| Methyl-CpG-binding domain-containing 6 -like protein [Gossypium 
arboreum]
Length=219

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 30/46 (65%), Gaps = 1/46 (2%)
 Frame = +2

Query  401  WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLN  535
            WLPPGW +E + R++G+  G   K Y+ P SGRKF SK +V  FL 
Sbjct  77   WLPPGWLIEDRVRTSGATAGLVDKYYVDPTSGRKFRSKKEVLYFLE  122



>gb|KJB83777.1| hypothetical protein B456_013G263700 [Gossypium raimondii]
Length=219

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 30/46 (65%), Gaps = 1/46 (2%)
 Frame = +2

Query  401  WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLN  535
            WLPPGW +E + R++G+  G   K Y+ P SGRKF SK +V  FL 
Sbjct  77   WLPPGWLIEDRVRTSGATAGLVDKYYVDPTSGRKFRSKKEVLYFLE  122



>ref|XP_010106481.1| Methyl-CpG-binding domain-containing protein 6 [Morus notabilis]
 gb|EXC10657.1| Methyl-CpG-binding domain-containing protein 6 [Morus notabilis]
Length=237

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = +2

Query  398  DWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNS  538
            DWLP GWTVE K RS+G+  GS  + Y  P SG KF SK +V  FL +
Sbjct  95   DWLPRGWTVEDKVRSSGATAGSKDRYYFDPVSGLKFRSKKEVLYFLET  142



>ref|XP_009126698.1| PREDICTED: methyl-CpG-binding domain-containing protein 6-like 
[Brassica rapa]
Length=229

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 31/46 (67%), Gaps = 1/46 (2%)
 Frame = +2

Query  401  WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLN  535
            WLPPGW VE K R++G+  GS  K Y+ P +GRKF S+ +V  +L 
Sbjct  87   WLPPGWRVEDKVRASGAKAGSVDKYYLEPITGRKFRSRTEVLYYLE  132



>emb|CDY53445.1| BnaA02g07070D [Brassica napus]
Length=229

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 31/46 (67%), Gaps = 1/46 (2%)
 Frame = +2

Query  401  WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLN  535
            WLPPGW VE K R++G+  GS  K Y+ P +GRKF S+ +V  +L 
Sbjct  87   WLPPGWRVEDKVRASGAKAGSVDKYYLEPITGRKFRSRTEVLYYLE  132



>emb|CDX80274.1| BnaC09g34680D [Brassica napus]
Length=549

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 32/48 (67%), Gaps = 1/48 (2%)
 Frame = +2

Query  395  SDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLN  535
            S+WLPPGW VE K R++G+  GS  K Y  P +GRKF S+ +V  +L 
Sbjct  394  SNWLPPGWRVEDKVRTSGATAGSVDKYYYEPITGRKFRSRTEVLYYLE  441



>emb|CDY48687.1| BnaC02g09990D [Brassica napus]
Length=229

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 31/46 (67%), Gaps = 1/46 (2%)
 Frame = +2

Query  401  WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLN  535
            WLPPGW VE K R++G+  GS  K Y+ P +GRKF S+ +V  +L 
Sbjct  87   WLPPGWRVEDKVRASGATAGSVDKYYLEPITGRKFRSRTEVLYYLE  132



>emb|CDY59223.1| BnaCnng34510D [Brassica napus]
Length=229

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 31/46 (67%), Gaps = 1/46 (2%)
 Frame = +2

Query  401  WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLN  535
            WLPPGW VE K R++G+  GS  K Y+ P +GRKF S+ +V  +L 
Sbjct  87   WLPPGWRVEDKVRASGATAGSVDKYYLEPITGRKFRSRTEVLYYLE  132



>ref|XP_010541402.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like 
isoform X2 [Tarenaya hassleriana]
Length=222

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 31/49 (63%), Gaps = 1/49 (2%)
 Frame = +2

Query  401  WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAA  544
            WLPPGW VE + R++G+  GS  K Y  P +GRKF SK +V  +L   A
Sbjct  80   WLPPGWRVEDRVRTSGATAGSVDKYYHEPGTGRKFRSKTEVMYYLEKGA  128



>ref|XP_010541401.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like 
isoform X1 [Tarenaya hassleriana]
Length=223

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 31/49 (63%), Gaps = 1/49 (2%)
 Frame = +2

Query  401  WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAA  544
            WLPPGW VE + R++G+  GS  K Y  P +GRKF SK +V  +L   A
Sbjct  80   WLPPGWRVEDRVRTSGATAGSVDKYYHEPGTGRKFRSKTEVMYYLEKGA  128



>ref|XP_006400967.1| hypothetical protein EUTSA_v10014530mg [Eutrema salsugineum]
 gb|ESQ42420.1| hypothetical protein EUTSA_v10014530mg [Eutrema salsugineum]
Length=241

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = +2

Query  395  SDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFL  532
            S+WLPPGW VE K R++G+  GS  K Y  P +GRKF S+ +V  +L
Sbjct  97   SNWLPPGWRVEDKVRTSGATAGSVDKYYYEPITGRKFRSRTEVLYYL  143



>gb|KFK27467.1| hypothetical protein AALP_AA8G387100 [Arabis alpina]
Length=205

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +2

Query  401  WLPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFL  532
            WLPPGW +E K R++G+  G   + Y SP G KF SK +V  +L
Sbjct  52   WLPPGWRIEDKVRTSGATAGIRDRYYYSPGGHKFRSKTEVLHYL  95



>ref|XP_007038658.1| Methyl-CPG-binding domain protein 13, putative isoform 1 [Theobroma 
cacao]
 gb|EOY23159.1| Methyl-CPG-binding domain protein 13, putative isoform 1 [Theobroma 
cacao]
Length=625

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 21/49 (43%), Positives = 32/49 (65%), Gaps = 1/49 (2%)
 Frame = +2

Query  392  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLN  535
            + DWLPPGW VE++ R  G  +     CY +P G  +F S+A+VS++L+
Sbjct  6    TDDWLPPGWKVEVRQRRNGKKDKLRVMCYYAPCGELRFISRAEVSRYLD  54



>gb|KFK27470.1| hypothetical protein AALP_AA8G387500 [Arabis alpina]
Length=226

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 28/45 (62%), Gaps = 0/45 (0%)
 Frame = +2

Query  401  WLPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLN  535
            WLPPGW +E K R++G+  G   + Y SP G KF SK +V  +L 
Sbjct  79   WLPPGWRIEDKVRTSGATAGIRDRYYYSPGGHKFRSKTEVLHYLE  123



>ref|XP_009604783.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like 
[Nicotiana tomentosiformis]
Length=251

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 34/53 (64%), Gaps = 1/53 (2%)
 Frame = +2

Query  383  TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNS  538
            T++   WLP  W +E++ R++G+  GST + +  P SGRKF SK +V  FL +
Sbjct  107  TSERPSWLPENWKIEMRVRTSGATAGSTDRYFFEPVSGRKFRSKVEVLYFLET  159



>ref|NP_200746.1| methyl-CpG-binding domain-containing protein 6 [Arabidopsis thaliana]
 sp|Q9LTJ1.1|MBD6_ARATH RecName: Full=Methyl-CpG-binding domain-containing protein 6; 
Short=AtMBD6; Short=MBD06; AltName: Full=Methyl-CpG-binding 
protein MBD6 [Arabidopsis thaliana]
 dbj|BAA97474.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAO42852.1| At5g59380 [Arabidopsis thaliana]
 dbj|BAE99559.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED97178.1| methyl-CpG-binding domain-containing protein 6 [Arabidopsis thaliana]
Length=225

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 30/45 (67%), Gaps = 1/45 (2%)
 Frame = +2

Query  401  WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFL  532
            WLPPGW VE K R++G+  GS  K Y  P +GRKF S+ +V  +L
Sbjct  80   WLPPGWRVEDKIRTSGATAGSVDKYYYEPNTGRKFRSRTEVLYYL  124



>ref|XP_009787915.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like 
[Nicotiana sylvestris]
Length=251

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 34/53 (64%), Gaps = 1/53 (2%)
 Frame = +2

Query  383  TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNS  538
            T++   WLP  W +E++ R++G+  GST + +  P SGRKF SK +V  FL +
Sbjct  107  TSERPSWLPENWKIEMRVRTSGATAGSTDRYFFEPVSGRKFRSKVEVLYFLET  159



>ref|XP_007038659.1| Methyl-CPG-binding domain protein 13, putative isoform 2 [Theobroma 
cacao]
 gb|EOY23160.1| Methyl-CPG-binding domain protein 13, putative isoform 2 [Theobroma 
cacao]
Length=621

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 23/49 (47%), Positives = 33/49 (67%), Gaps = 5/49 (10%)
 Frame = +2

Query  392  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLN  535
            + DWLPPGW VE++ R     NG   KCY +P G  +F S+A+VS++L+
Sbjct  6    TDDWLPPGWKVEVRQR----RNGKKDKCYYAPCGELRFISRAEVSRYLD  50



>ref|XP_002864630.1| hypothetical protein ARALYDRAFT_919168 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40889.1| hypothetical protein ARALYDRAFT_919168 [Arabidopsis lyrata subsp. 
lyrata]
Length=233

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 30/45 (67%), Gaps = 1/45 (2%)
 Frame = +2

Query  401  WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFL  532
            WLPPGW VE K R++G+  GS  K Y  P +GRKF S+ +V  +L
Sbjct  87   WLPPGWRVEDKIRTSGATAGSVDKYYYEPNTGRKFRSRTEVLYYL  131



>ref|XP_009371320.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X2 [Pyrus x bretschneideri]
Length=572

 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 37/54 (69%), Gaps = 3/54 (6%)
 Frame = +2

Query  392  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSN  553
            S DWLP GWTVE+K R  G  +   Y+   S SG +F S+A+VS++L+++++ +
Sbjct  6    SEDWLPTGWTVEVKFRKNGRRDKYYYE---SSSGHRFSSRAEVSRYLSTSSHED  56



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090