BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS074E01

Length=610
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004248008.1|  PREDICTED: phosphoglucan, water dikinase, ch...    310   2e-94   Solanum lycopersicum
ref|XP_006358813.1|  PREDICTED: phosphoglucan, water dikinase, ch...    306   6e-93   Solanum tuberosum [potatoes]
ref|XP_006358812.1|  PREDICTED: phosphoglucan, water dikinase, ch...    305   7e-93   Solanum tuberosum [potatoes]
ref|NP_001274870.1|  glucan/water dikinase                              305   7e-93   Solanum tuberosum [potatoes]
ref|XP_009777858.1|  PREDICTED: phosphoglucan, water dikinase, ch...    293   3e-88   Nicotiana sylvestris
ref|XP_009599199.1|  PREDICTED: phosphoglucan, water dikinase, ch...    292   4e-88   Nicotiana tomentosiformis
emb|CDP10310.1|  unnamed protein product                                288   1e-86   Coffea canephora [robusta coffee]
ref|XP_010069404.1|  PREDICTED: phosphoglucan, water dikinase, ch...    276   1e-82   Eucalyptus grandis [rose gum]
gb|KDO57834.1|  hypothetical protein CISIN_1g015140mg                   261   7e-82   Citrus sinensis [apfelsine]
ref|XP_006421076.1|  hypothetical protein CICLE_v10004968mg             258   2e-81   
ref|XP_010673296.1|  PREDICTED: phosphoglucan, water dikinase, ch...    272   6e-81   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006421075.1|  hypothetical protein CICLE_v10004968mg             258   2e-80   
gb|KJB71923.1|  hypothetical protein B456_011G147600                    270   3e-80   Gossypium raimondii
gb|KJB71922.1|  hypothetical protein B456_011G147600                    269   4e-80   Gossypium raimondii
gb|KJB71921.1|  hypothetical protein B456_011G147600                    269   4e-80   Gossypium raimondii
ref|XP_002265211.1|  PREDICTED: phosphoglucan, water dikinase, ch...    268   2e-79   Vitis vinifera
emb|CBI39424.3|  unnamed protein product                                267   2e-79   Vitis vinifera
ref|XP_011074900.1|  PREDICTED: phosphoglucan, water dikinase, ch...    267   4e-79   Sesamum indicum [beniseed]
gb|KHF99077.1|  Phosphoglucan, water dikinase, chloroplastic -lik...    265   1e-78   Gossypium arboreum [tree cotton]
gb|KDP32558.1|  hypothetical protein JCGZ_13108                         265   1e-78   Jatropha curcas
ref|XP_006493516.1|  PREDICTED: phosphoglucan, water dikinase, ch...    263   8e-78   Citrus sinensis [apfelsine]
gb|AFO83531.1|  glucan water dikinase 3                                 261   2e-77   Manihot esculenta [manioc]
ref|XP_002301739.2|  hypothetical protein POPTR_0002s23550g             259   1e-76   
ref|XP_002518612.1|  chloroplast alpha-glucan water dikinase, put...    259   2e-76   Ricinus communis
ref|XP_004296959.2|  PREDICTED: phosphoglucan, water dikinase, ch...    258   4e-76   Fragaria vesca subsp. vesca
ref|XP_010244064.1|  PREDICTED: phosphoglucan, water dikinase, ch...    258   7e-76   Nelumbo nucifera [Indian lotus]
ref|XP_010107197.1|  Phosphoglucan, water dikinase                      253   4e-75   
ref|XP_008222722.1|  PREDICTED: phosphoglucan, water dikinase, ch...    254   8e-75   Prunus mume [ume]
gb|EYU23932.1|  hypothetical protein MIMGU_mgv1a000391mg                253   3e-74   Erythranthe guttata [common monkey flower]
ref|XP_007034117.1|  Catalytics,carbohydrate kinases,phosphoglucan      253   4e-74   
ref|XP_011042749.1|  PREDICTED: phosphoglucan, water dikinase, ch...    251   1e-73   Populus euphratica
ref|XP_007225436.1|  hypothetical protein PRUPE_ppa000429mg             251   1e-73   Prunus persica
gb|KJB37918.1|  hypothetical protein B456_006G226300                    249   1e-73   Gossypium raimondii
gb|KJB37917.1|  hypothetical protein B456_006G226300                    250   4e-73   Gossypium raimondii
ref|XP_008393850.1|  PREDICTED: phosphoglucan, water dikinase, ch...    248   6e-73   
ref|XP_008393849.1|  PREDICTED: phosphoglucan, water dikinase, ch...    248   8e-73   
ref|XP_011000022.1|  PREDICTED: LOW QUALITY PROTEIN: phosphogluca...    247   4e-72   Populus euphratica
gb|EPS59827.1|  glucan/water dikinase                                   231   2e-71   Genlisea aurea
gb|KHG00248.1|  Phosphoglucan, water dikinase, chloroplastic -lik...    244   3e-71   Gossypium arboreum [tree cotton]
ref|XP_009371117.1|  PREDICTED: phosphoglucan, water dikinase, ch...    242   7e-71   Pyrus x bretschneideri [bai li]
ref|XP_002320442.2|  hypothetical protein POPTR_0014s14510g             243   8e-71   
ref|XP_009371116.1|  PREDICTED: phosphoglucan, water dikinase, ch...    243   1e-70   Pyrus x bretschneideri [bai li]
ref|XP_007142602.1|  hypothetical protein PHAVU_007G001400g             241   2e-70   Phaseolus vulgaris [French bean]
gb|KFK26410.1|  hypothetical protein AALP_AA8G245000                    239   2e-69   Arabis alpina [alpine rockcress]
ref|XP_010546804.1|  PREDICTED: phosphoglucan, water dikinase, ch...    239   2e-69   Tarenaya hassleriana [spider flower]
ref|XP_010546803.1|  PREDICTED: phosphoglucan, water dikinase, ch...    239   3e-69   Tarenaya hassleriana [spider flower]
ref|XP_006845104.1|  hypothetical protein AMTR_s00005p00168970          238   5e-69   Amborella trichopoda
ref|XP_009416602.1|  PREDICTED: phosphoglucan, water dikinase, ch...    239   6e-69   
ref|XP_010551754.1|  PREDICTED: phosphoglucan, water dikinase, ch...    238   6e-69   Tarenaya hassleriana [spider flower]
ref|XP_010907528.1|  PREDICTED: phosphoglucan, water dikinase, ch...    236   8e-69   
ref|XP_010454991.1|  PREDICTED: phosphoglucan, water dikinase, ch...    234   3e-68   Camelina sativa [gold-of-pleasure]
ref|XP_006394878.1|  hypothetical protein EUTSA_v10003634mg             234   5e-68   
ref|NP_001119280.1|  phosphoglucan, water dikinase                      233   1e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008799788.1|  PREDICTED: phosphoglucan, water dikinase, ch...    231   1e-67   
ref|XP_010493901.1|  PREDICTED: phosphoglucan, water dikinase, ch...    235   1e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010493900.1|  PREDICTED: phosphoglucan, water dikinase, ch...    235   1e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010454990.1|  PREDICTED: phosphoglucan, water dikinase, ch...    234   2e-67   Camelina sativa [gold-of-pleasure]
emb|CDY65142.1|  BnaC02g48400D                                          234   3e-67   Brassica napus [oilseed rape]
ref|NP_198009.3|  phosphoglucan, water dikinase                         234   3e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004152111.1|  PREDICTED: phosphoglucan, water dikinase, ch...    233   5e-67   
ref|XP_002872212.1|  hypothetical protein ARALYDRAFT_489476             233   5e-67   
ref|XP_010424348.1|  PREDICTED: phosphoglucan, water dikinase, ch...    232   8e-67   Camelina sativa [gold-of-pleasure]
ref|XP_004497422.1|  PREDICTED: phosphoglucan, water dikinase, ch...    232   2e-66   Cicer arietinum [garbanzo]
ref|XP_006589801.1|  PREDICTED: LOW QUALITY PROTEIN: phosphogluca...    232   2e-66   
gb|KHN37254.1|  Phosphoglucan, water dikinase, chloroplastic            231   2e-66   Glycine soja [wild soybean]
gb|AAU93516.1|  chloroplast alpha-glucan water dikinase isoform 3       231   2e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004497421.1|  PREDICTED: phosphoglucan, water dikinase, ch...    231   2e-66   
ref|XP_006286926.1|  hypothetical protein CARUB_v10000070mg             231   3e-66   Capsella rubella
ref|XP_009111699.1|  PREDICTED: phosphoglucan, water dikinase, ch...    229   9e-66   Brassica rapa
gb|KEH27294.1|  phosphoglucan, water dikinase                           228   2e-65   Medicago truncatula
emb|CDX87051.1|  BnaC09g03660D                                          228   4e-65   
emb|CDY19771.1|  BnaA09g04240D                                          227   9e-65   Brassica napus [oilseed rape]
ref|XP_008454007.1|  PREDICTED: phosphoglucan, water dikinase, ch...    226   2e-64   Cucumis melo [Oriental melon]
ref|XP_009129923.1|  PREDICTED: phosphoglucan, water dikinase, ch...    225   3e-64   Brassica rapa
ref|XP_008454006.1|  PREDICTED: phosphoglucan, water dikinase, ch...    225   5e-64   Cucumis melo [Oriental melon]
emb|CDY05529.1|  BnaA02g31620D                                          225   5e-64   
ref|XP_008662597.1|  PREDICTED: phosphoglucan, water dikinase, ch...    211   7e-64   
gb|KGN53052.1|  hypothetical protein Csa_4G012480                       224   1e-63   Cucumis sativus [cucumbers]
gb|ABG21981.1|  chloroplast alpha-glucan water dikinase isoform 3...    211   2e-60   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002453659.1|  hypothetical protein SORBIDRAFT_04g010020          214   5e-60   Sorghum bicolor [broomcorn]
ref|NP_001066613.1|  Os12g0297500                                       212   2e-59   
ref|XP_006663965.1|  PREDICTED: phosphoglucan, water dikinase, ch...    210   8e-59   Oryza brachyantha
ref|XP_004952076.1|  PREDICTED: phosphoglucan, water dikinase, ch...    207   1e-57   Setaria italica
ref|XP_010228078.1|  PREDICTED: phosphoglucan, water dikinase, ch...    205   4e-57   Brachypodium distachyon [annual false brome]
ref|XP_006421074.1|  hypothetical protein CICLE_v10004968mg             192   8e-56   
gb|EMS54440.1|  Phosphoglucan, water dikinase, chloroplastic            200   1e-55   Triticum urartu
gb|EMT02873.1|  Phosphoglucan, water dikinase, chloroplastic            199   2e-55   
gb|EEE53074.1|  hypothetical protein OsJ_35828                          200   2e-55   Oryza sativa Japonica Group [Japonica rice]
gb|EEC69133.1|  hypothetical protein OsI_38056                          200   2e-55   Oryza sativa Indica Group [Indian rice]
ref|XP_002973212.1|  hypothetical protein SELMODRAFT_99378              189   1e-51   
gb|AAC26245.1|  contains similarity glycosyl hydrolases                 182   1e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002976638.1|  hypothetical protein SELMODRAFT_105597             185   6e-50   
ref|XP_001752167.1|  predicted protein                                  166   3e-43   
ref|XP_001758857.1|  predicted protein                                  155   2e-39   
ref|XP_005849428.1|  hypothetical protein CHLNCDRAFT_21770              125   5e-29   Chlorella variabilis
emb|CAX51387.1|  phosphoglucan water dikinase                           118   1e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KIZ07735.1|  hypothetical protein MNEG_0234                          122   4e-28   Monoraphidium neglectum
gb|ABR17706.1|  unknown                                                 111   2e-25   Picea sitchensis
gb|KDD72859.1|  hypothetical protein H632_c2807p0                     97.8    1e-20   Helicosporidium sp. ATCC 50920
ref|XP_011396449.1|  Phosphoglucan, water dikinase, chloroplastic       100   2e-20   Auxenochlorella protothecoides
ref|XP_001417570.1|  predicted protein                                90.9    2e-17   Ostreococcus lucimarinus CCE9901
ref|XP_001697099.1|  phosphoglucan water dikinase                     87.8    3e-16   Chlamydomonas reinhardtii
ref|XP_003059536.1|  predicted protein                                87.4    3e-16   Micromonas pusilla CCMP1545
ref|XP_003078935.1|  chloroplast alpha-glucan water dikinase isof...  87.0    4e-16   
emb|CEF97682.1|  Pyruvate phosphate dikinase,PEP/pyruvate-binding     87.0    4e-16   Ostreococcus tauri
ref|XP_002949771.1|  hypothetical protein VOLCADRAFT_90138            87.0    5e-16   Volvox carteri f. nagariensis
ref|XP_007511444.1|  predicted protein                                87.0    6e-16   Bathycoccus prasinos
ref|XP_003080699.1|  phosphoglucan, water dikinase (ISS)              85.1    2e-15   
emb|CEG01409.1|  Carbohydrate binding module family 20                84.7    3e-15   Ostreococcus tauri
ref|XP_005648862.1|  hypothetical protein COCSUDRAFT_47226            82.0    3e-14   Coccomyxa subellipsoidea C-169
gb|ABK26307.1|  unknown                                               75.5    2e-13   Picea sitchensis
gb|KEH27295.1|  phosphoglucan, water dikinase                         76.6    1e-12   Medicago truncatula
ref|XP_002504762.1|  alpha phosphoglucan water dikinase               76.3    2e-12   Micromonas commoda
gb|KEH44553.1|  phosphoglucan, water dikinase, putative               74.3    7e-12   Medicago truncatula
ref|XP_008889223.1|  pyruvate phosphate dikinase, pep/pyruvate bi...  67.0    2e-09   
ref|XP_002368480.1|  phosphoglucan, water dikinase protein, putative  67.0    2e-09   
gb|EPR59823.1|  pyruvate phosphate dikinase, pep/pyruvate binding...  67.0    2e-09   Toxoplasma gondii GT1
gb|ESS33912.1|  pyruvate phosphate dikinase, pep/pyruvate binding...  67.0    2e-09   Toxoplasma gondii VEG
gb|KFG62834.1|  pyruvate phosphate dikinase, pep/pyruvate binding...  67.0    2e-09   Toxoplasma gondii RUB
gb|EPT28056.1|  pyruvate phosphate dikinase, pep/pyruvate binding...  67.0    2e-09   Toxoplasma gondii ME49
gb|KFG31055.1|  pyruvate phosphate dikinase, pep/pyruvate binding...  66.2    2e-09   Toxoplasma gondii p89
gb|KFG42300.1|  pyruvate phosphate dikinase, pep/pyruvate binding...  66.6    2e-09   Toxoplasma gondii GAB2-2007-GAL-DOM2
gb|KFG99968.1|  pyruvate phosphate dikinase, pep/pyruvate binding...  65.9    3e-09   Toxoplasma gondii VAND
gb|KFG41384.1|  pyruvate phosphate dikinase, pep/pyruvate binding...  65.1    5e-09   Toxoplasma gondii FOU
ref|XP_003881249.1|  phosphoenolpyruvate synthase, related            65.5    5e-09   Neospora caninum Liverpool
gb|KFH05191.1|  pyruvate phosphate dikinase, pep/pyruvate binding...  65.1    6e-09   Toxoplasma gondii MAS
emb|CDJ47310.1|  Carbohydrate-binding module family 20 protein, r...  64.3    8e-09   Eimeria brunetti
ref|XP_001419310.1|  predicted protein                                62.4    4e-08   Ostreococcus lucimarinus CCE9901
ref|XP_005827807.1|  hypothetical protein GUITHDRAFT_164559           57.4    2e-06   Guillardia theta CCMP2712
emb|CDI76079.1|  Carbohydrate-binding module family 20 protein, r...  57.0    2e-06   Eimeria acervulina
emb|CDW77583.1|  water chloroplastic-like                             56.6    3e-06   Stylonychia lemnae
ref|XP_005716854.1|  Phosphoglucan water dikinase, PWD                55.1    1e-05   Chondrus crispus [carageen]
gb|EJY83942.1|  hypothetical protein OXYTRI_18322                     52.4    9e-05   Oxytricha trifallax



>ref|XP_004248008.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Solanum 
lycopersicum]
Length=1202

 Score =   310 bits (794),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 171/204 (84%), Gaps = 1/204 (0%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            E+E++ GE +E+KFVIVGKDKN+LWE G NR+LKLP GGSF++VCQWNVTD+P+ LL LD
Sbjct  134  ELEVRSGEILEYKFVIVGKDKNMLWENGSNRILKLPEGGSFELVCQWNVTDEPVNLLSLD  193

Query  182  S-EGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDT  358
              E E   +  +DNG  +T  +  PD+  S FVEQWQG+A SFVRSNDQ   +KNRKWDT
Sbjct  194  PFEVEKLVEETSDNGATITSQAVVPDVVTSPFVEQWQGRAASFVRSNDQLDSDKNRKWDT  253

Query  359  SGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIP  538
            SGL  I LKLVEGDKN++NWWRKLEVVR+L+VEN++S+HRLEALTY+A+YLKWINTGQIP
Sbjct  254  SGLTGISLKLVEGDKNARNWWRKLEVVRELVVENMDSSHRLEALTYAAVYLKWINTGQIP  313

Query  539  CFEDGGHHRPNRHAEISRLIFCEL  610
            C EDGGHHRPNRHAEISRLIF E+
Sbjct  314  CLEDGGHHRPNRHAEISRLIFREV  337



>ref|XP_006358813.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Solanum tuberosum]
Length=1202

 Score =   306 bits (783),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 169/204 (83%), Gaps = 1/204 (0%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            E+E++ GE +E+KFVIVGKDK +LWE G NR+LKLP GG F++VCQWNVTD+P+ LLPLD
Sbjct  134  ELEVRSGETLEYKFVIVGKDKKMLWENGSNRILKLPEGGGFELVCQWNVTDEPVNLLPLD  193

Query  182  S-EGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDT  358
              E E   +  +DNG  +   +  PD+  S FVEQWQG+A SFVRSNDQ   +KNRKWDT
Sbjct  194  PFEVEKVVEETSDNGAKIISQAAVPDVVTSPFVEQWQGRAASFVRSNDQLDSDKNRKWDT  253

Query  359  SGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIP  538
            SGL  I LKLVEGDKN++NWWRKLEVVR+L+VEN++S+HRLEALTY+A+YLKWINTGQIP
Sbjct  254  SGLTGISLKLVEGDKNARNWWRKLEVVRELVVENMDSSHRLEALTYAAVYLKWINTGQIP  313

Query  539  CFEDGGHHRPNRHAEISRLIFCEL  610
            C EDGGHHRPNRHAEISRLIF E+
Sbjct  314  CLEDGGHHRPNRHAEISRLIFREV  337



>ref|XP_006358812.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Solanum tuberosum]
Length=1206

 Score =   305 bits (782),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 169/204 (83%), Gaps = 1/204 (0%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            E+E++ GE +E+KFVIVGKDK +LWE G NR+LKLP GG F++VCQWNVTD+P+ LLPLD
Sbjct  134  ELEVRSGETLEYKFVIVGKDKKMLWENGSNRILKLPEGGGFELVCQWNVTDEPVNLLPLD  193

Query  182  S-EGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDT  358
              E E   +  +DNG  +   +  PD+  S FVEQWQG+A SFVRSNDQ   +KNRKWDT
Sbjct  194  PFEVEKVVEETSDNGAKIISQAAVPDVVTSPFVEQWQGRAASFVRSNDQLDSDKNRKWDT  253

Query  359  SGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIP  538
            SGL  I LKLVEGDKN++NWWRKLEVVR+L+VEN++S+HRLEALTY+A+YLKWINTGQIP
Sbjct  254  SGLTGISLKLVEGDKNARNWWRKLEVVRELVVENMDSSHRLEALTYAAVYLKWINTGQIP  313

Query  539  CFEDGGHHRPNRHAEISRLIFCEL  610
            C EDGGHHRPNRHAEISRLIF E+
Sbjct  314  CLEDGGHHRPNRHAEISRLIFREV  337



>ref|NP_001274870.1| glucan/water dikinase [Solanum tuberosum]
 gb|ACZ66259.1| glucan/water dikinase [Solanum tuberosum]
Length=1202

 Score =   305 bits (782),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 169/204 (83%), Gaps = 1/204 (0%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            E+E++ GE +E+KFVIVGKDK +LWE G NR+LKLP GG F++VCQWNVTD+P+ LLPLD
Sbjct  134  ELEVRSGETLEYKFVIVGKDKKMLWENGSNRILKLPEGGGFELVCQWNVTDEPVNLLPLD  193

Query  182  S-EGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDT  358
              E E   +  +DNG  +   +  PD+  S FVEQWQG+A SFVRSNDQ   +KNRKWDT
Sbjct  194  PFEVEKVVEETSDNGAKIISQAAVPDVVTSPFVEQWQGRAASFVRSNDQLDSDKNRKWDT  253

Query  359  SGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIP  538
            SGL  I LKLVEGDKN++NWWRKLEVVR+L+VEN++S+HRLEALTY+A+YLKWINTGQIP
Sbjct  254  SGLTGISLKLVEGDKNARNWWRKLEVVRELVVENMDSSHRLEALTYAAVYLKWINTGQIP  313

Query  539  CFEDGGHHRPNRHAEISRLIFCEL  610
            C EDGGHHRPNRHAEISRLIF E+
Sbjct  314  CLEDGGHHRPNRHAEISRLIFREV  337



>ref|XP_009777858.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Nicotiana 
sylvestris]
Length=1200

 Score =   293 bits (749),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 163/204 (80%), Gaps = 1/204 (0%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            E+EL  GE +E+KFVIVGKDKN+LWE G NR+L LP GGSF++VCQWNVTD+P+ LL LD
Sbjct  132  ELELPAGESLEYKFVIVGKDKNMLWENGSNRILMLPEGGSFELVCQWNVTDEPVNLLQLD  191

Query  182  SEGEYEAQVLA-DNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDT  358
                 E    A DNG  +T ++   D   S FVEQWQG+A SFVRS D+   + NRKWDT
Sbjct  192  PFVVEEEVEEATDNGATITGETAVLDAVTSPFVEQWQGRAASFVRSKDELDSQTNRKWDT  251

Query  359  SGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIP  538
            SGL  I LKLVEGDKN++NWWRKLEVVR+L+VEN++S+ RLEALTY+A+YLKWINTGQIP
Sbjct  252  SGLTGISLKLVEGDKNARNWWRKLEVVRELVVENMDSSQRLEALTYAAVYLKWINTGQIP  311

Query  539  CFEDGGHHRPNRHAEISRLIFCEL  610
            C EDGGHHRPNRHAEISRLIF E+
Sbjct  312  CLEDGGHHRPNRHAEISRLIFREV  335



>ref|XP_009599199.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Nicotiana 
tomentosiformis]
Length=1202

 Score =   292 bits (747),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 162/204 (79%), Gaps = 1/204 (0%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            E+E   GE +E+KFVIVGKDKN+LWE G NR+LKLP GGSF++ CQWNVTD+P+ LL LD
Sbjct  134  ELEFPAGESLEYKFVIVGKDKNMLWENGSNRILKLPEGGSFELDCQWNVTDEPVNLLQLD  193

Query  182  SEGEYEAQVLA-DNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDT  358
                 E    A DNG  +T +    D   S FVEQWQG+A SFVRS D+   EKNRKWDT
Sbjct  194  PFVVEEEVEEASDNGAAITGEVAVLDAVTSPFVEQWQGRAASFVRSKDELDSEKNRKWDT  253

Query  359  SGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIP  538
            SGL  I LKLVEGDKN++NWWRKLEVVR+L+VEN++S+ RLEALTY+A+YLKWINTGQIP
Sbjct  254  SGLTGISLKLVEGDKNARNWWRKLEVVRELVVENMDSSQRLEALTYAAVYLKWINTGQIP  313

Query  539  CFEDGGHHRPNRHAEISRLIFCEL  610
            C EDGGHHRPNRHAEISRLIF E+
Sbjct  314  CLEDGGHHRPNRHAEISRLIFREV  337



>emb|CDP10310.1| unnamed protein product [Coffea canephora]
Length=1144

 Score =   288 bits (736),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 158/204 (77%), Gaps = 1/204 (0%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            E+ELKGGEPVE KFVIV KDK   WE+GDNRVL LP GGSFK V +W+ T + +E LPLD
Sbjct  82   ELELKGGEPVECKFVIVRKDKRRAWESGDNRVLMLPEGGSFKTVFRWDRTGEAVEFLPLD  141

Query  182  SEGEYEAQVLAD-NGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDT  358
             E E E  V A  NG  V  D  D ++  S  VEQWQGK VSFVRS +Q  +EK RKWD 
Sbjct  142  LEKEEEGGVGATGNGSAVADDVADTEIVASPLVEQWQGKVVSFVRSKEQLNIEKERKWDI  201

Query  359  SGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIP  538
            SGL  I LKLVEGDK S+NWWRKLEVVR+++V N+ES HRLEAL YSAIYLKWINTGQIP
Sbjct  202  SGLEGIALKLVEGDKKSRNWWRKLEVVREIVVGNIESGHRLEALAYSAIYLKWINTGQIP  261

Query  539  CFEDGGHHRPNRHAEISRLIFCEL  610
            CFEDGGHHRPNRHAEISRLIF EL
Sbjct  262  CFEDGGHHRPNRHAEISRLIFREL  285



>ref|XP_010069404.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Eucalyptus 
grandis]
 gb|KCW57742.1| hypothetical protein EUGRSUZ_H00494 [Eucalyptus grandis]
Length=1189

 Score =   276 bits (707),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 158/205 (77%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            E+ELKGGE VE+KFVI  KDK++ WE+GDNRVLKLP GG + MVC WN T + ++L+P+D
Sbjct  138  ELELKGGESVEYKFVIDRKDKSVAWESGDNRVLKLPKGGKYGMVCMWNATKEAVKLMPMD  197

Query  182  SEGEYEAQVLAD--NGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWD  355
            SE   E     D  NG  V   +   + + S FVEQWQGKAVSF+ SN+ R  E   +WD
Sbjct  198  SEETGEELFSNDENNGAAVNDTAALAEAETSPFVEQWQGKAVSFMSSNEHRNRETEMRWD  257

Query  356  TSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQI  535
            TSGL  + LKLVEGD+N++NWWRKLEVVR+LIVEN++  +RLEAL  SAIYLKWINTGQI
Sbjct  258  TSGLEGVALKLVEGDRNARNWWRKLEVVRELIVENLQGENRLEALVNSAIYLKWINTGQI  317

Query  536  PCFEDGGHHRPNRHAEISRLIFCEL  610
            PCFEDGGHHRPNRHAEISRLIF EL
Sbjct  318  PCFEDGGHHRPNRHAEISRLIFREL  342



>gb|KDO57834.1| hypothetical protein CISIN_1g015140mg [Citrus sinensis]
Length=412

 Score =   261 bits (666),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 129/205 (63%), Positives = 157/205 (77%), Gaps = 9/205 (4%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            ++E KGGE +E+KFVIV  DK+  WE GDNR+LKLP GGSF++VC WN T + ++LL L 
Sbjct  55   DLEFKGGESIEYKFVIVRNDKSKAWEAGDNRILKLPKGGSFEIVCHWNKTGEAVDLLHL-  113

Query  182  SEGEYEAQVLADNGPVVTKDSTDPDMQV--SAFVEQWQGKAVSFVRSNDQRGMEKNRKWD  355
                   + + DNG VVT  + D  ++V  S FV QWQGK+ SF+R++D    E  RKWD
Sbjct  114  ------VEDVLDNGSVVTDAAPDALLEVGTSPFVGQWQGKSASFMRADDHWNREMERKWD  167

Query  356  TSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQI  535
            TSGL  + LKLVEGD+ ++NWWRKLEVVR+LIVEN++S  RLEAL YSAIYLKWINTG+I
Sbjct  168  TSGLQGLTLKLVEGDQRARNWWRKLEVVRELIVENLQSDERLEALIYSAIYLKWINTGKI  227

Query  536  PCFEDGGHHRPNRHAEISRLIFCEL  610
            PCFEDGGHHRPNRHAEISRLIF EL
Sbjct  228  PCFEDGGHHRPNRHAEISRLIFREL  252



>ref|XP_006421076.1| hypothetical protein CICLE_v10004968mg [Citrus clementina]
 gb|ESR34316.1| hypothetical protein CICLE_v10004968mg [Citrus clementina]
Length=356

 Score =   258 bits (659),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 156/205 (76%), Gaps = 11/205 (5%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            ++E KGGE +E+KFVIV  DK+  WE G NR+LKLP GGSF++VC WN T + ++LL L+
Sbjct  133  DLEFKGGESIEYKFVIVRNDKSKAWEAGANRILKLPKGGSFEIVCHWNKTGEAVDLLHLE  192

Query  182  SEGEYEAQVLADNGPVVTKDSTDPDMQV--SAFVEQWQGKAVSFVRSNDQRGMEKNRKWD  355
             +         DNG VVT  + D  ++V  S FV QWQGK+ SF+R++D    E  RKWD
Sbjct  193  ED---------DNGSVVTDAAPDALLEVGTSPFVGQWQGKSASFMRADDHWNREMERKWD  243

Query  356  TSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQI  535
            TSGL  + LKLVEGD+ ++NWWRKLEVVR+LIVEN++S  RLEAL YSAIYLKWINTG+I
Sbjct  244  TSGLQGLTLKLVEGDQRARNWWRKLEVVRELIVENLQSDERLEALIYSAIYLKWINTGKI  303

Query  536  PCFEDGGHHRPNRHAEISRLIFCEL  610
            PCFEDGGHHRPNRHAEISRLIF EL
Sbjct  304  PCFEDGGHHRPNRHAEISRLIFREL  328



>ref|XP_010673296.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010673297.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=1189

 Score =   272 bits (695),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 129/205 (63%), Positives = 162/205 (79%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            ++ELKGG+  EFKFVI+GKDK+L WE+GDNR L++P GG F + C WN+T + LE+LP +
Sbjct  128  DLELKGGDSGEFKFVIMGKDKSLTWESGDNRKLQIPGGGKFTLFCHWNMTAEALEILPAE  187

Query  182  SEGEY-EAQVLADNGPVVTKDS-TDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWD  355
            SE +   A+VL DN   V+  + TD + Q S FVEQWQGKA SF+RSN+    E +R+WD
Sbjct  188  SEDDQGSAEVLVDNRSSVSDATVTDSEAQTSPFVEQWQGKAASFMRSNEHHNRESDRRWD  247

Query  356  TSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQI  535
            TSGL  + LKLV+ D+N++NWWRKLEVVR+L+V ++++   LEALT SAIYLKWINTGQI
Sbjct  248  TSGLEGLALKLVQDDQNARNWWRKLEVVRELVVGSLDNNDHLEALTLSAIYLKWINTGQI  307

Query  536  PCFEDGGHHRPNRHAEISRLIFCEL  610
            PCFEDGGHHRPNRHAEISRLIF EL
Sbjct  308  PCFEDGGHHRPNRHAEISRLIFREL  332



>ref|XP_006421075.1| hypothetical protein CICLE_v10004968mg [Citrus clementina]
 gb|ESR34315.1| hypothetical protein CICLE_v10004968mg [Citrus clementina]
Length=445

 Score =   258 bits (660),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 156/205 (76%), Gaps = 11/205 (5%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            ++E KGGE +E+KFVIV  DK+  WE G NR+LKLP GGSF++VC WN T + ++LL L+
Sbjct  133  DLEFKGGESIEYKFVIVRNDKSKAWEAGANRILKLPKGGSFEIVCHWNKTGEAVDLLHLE  192

Query  182  SEGEYEAQVLADNGPVVTKDSTDPDMQV--SAFVEQWQGKAVSFVRSNDQRGMEKNRKWD  355
             +         DNG VVT  + D  ++V  S FV QWQGK+ SF+R++D    E  RKWD
Sbjct  193  ED---------DNGSVVTDAAPDALLEVGTSPFVGQWQGKSASFMRADDHWNREMERKWD  243

Query  356  TSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQI  535
            TSGL  + LKLVEGD+ ++NWWRKLEVVR+LIVEN++S  RLEAL YSAIYLKWINTG+I
Sbjct  244  TSGLQGLTLKLVEGDQRARNWWRKLEVVRELIVENLQSDERLEALIYSAIYLKWINTGKI  303

Query  536  PCFEDGGHHRPNRHAEISRLIFCEL  610
            PCFEDGGHHRPNRHAEISRLIF EL
Sbjct  304  PCFEDGGHHRPNRHAEISRLIFREL  328



>gb|KJB71923.1| hypothetical protein B456_011G147600 [Gossypium raimondii]
Length=1127

 Score =   270 bits (689),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 161/204 (79%), Gaps = 3/204 (1%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            ++ELKGGE VEFKFV+V KDK++ WE G+NRVLKLP GGSF M+C WN T++ LELLPL 
Sbjct  67   DLELKGGESVEFKFVVVSKDKSVAWEGGNNRVLKLPQGGSFGMICHWNSTEETLELLPLS  126

Query  182  SEGEYEAQVLADNGPVVTKDSTDP-DMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDT  358
            SE EY+  V  D G   +  +TD  +++ S FV QWQG+  SF+RSN+    E  R+WDT
Sbjct  127  SE-EYDDSV-DDAGHSESTSTTDALEVEASPFVGQWQGRPASFMRSNEHHNRELERRWDT  184

Query  359  SGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIP  538
            +GL  + LKLVEGDK+++NWWRKLEVVR+L+V +++S  RLEAL  SAIYLKWINTGQIP
Sbjct  185  TGLEGLALKLVEGDKSARNWWRKLEVVRELLVGSLQSEERLEALICSAIYLKWINTGQIP  244

Query  539  CFEDGGHHRPNRHAEISRLIFCEL  610
            CFEDGGHHRPNRHAEISRLIF EL
Sbjct  245  CFEDGGHHRPNRHAEISRLIFREL  268



>gb|KJB71922.1| hypothetical protein B456_011G147600 [Gossypium raimondii]
Length=1186

 Score =   269 bits (688),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 161/204 (79%), Gaps = 3/204 (1%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            ++ELKGGE VEFKFV+V KDK++ WE G+NRVLKLP GGSF M+C WN T++ LELLPL 
Sbjct  126  DLELKGGESVEFKFVVVSKDKSVAWEGGNNRVLKLPQGGSFGMICHWNSTEETLELLPLS  185

Query  182  SEGEYEAQVLADNGPVVTKDSTDP-DMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDT  358
            SE EY+  V  D G   +  +TD  +++ S FV QWQG+  SF+RSN+    E  R+WDT
Sbjct  186  SE-EYDDSV-DDAGHSESTSTTDALEVEASPFVGQWQGRPASFMRSNEHHNRELERRWDT  243

Query  359  SGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIP  538
            +GL  + LKLVEGDK+++NWWRKLEVVR+L+V +++S  RLEAL  SAIYLKWINTGQIP
Sbjct  244  TGLEGLALKLVEGDKSARNWWRKLEVVRELLVGSLQSEERLEALICSAIYLKWINTGQIP  303

Query  539  CFEDGGHHRPNRHAEISRLIFCEL  610
            CFEDGGHHRPNRHAEISRLIF EL
Sbjct  304  CFEDGGHHRPNRHAEISRLIFREL  327



>gb|KJB71921.1| hypothetical protein B456_011G147600 [Gossypium raimondii]
Length=1186

 Score =   269 bits (688),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 161/204 (79%), Gaps = 3/204 (1%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            ++ELKGGE VEFKFV+V KDK++ WE G+NRVLKLP GGSF M+C WN T++ LELLPL 
Sbjct  126  DLELKGGESVEFKFVVVSKDKSVAWEGGNNRVLKLPQGGSFGMICHWNSTEETLELLPLS  185

Query  182  SEGEYEAQVLADNGPVVTKDSTDP-DMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDT  358
            SE EY+  V  D G   +  +TD  +++ S FV QWQG+  SF+RSN+    E  R+WDT
Sbjct  186  SE-EYDDSV-DDAGHSESTSTTDALEVEASPFVGQWQGRPASFMRSNEHHNRELERRWDT  243

Query  359  SGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIP  538
            +GL  + LKLVEGDK+++NWWRKLEVVR+L+V +++S  RLEAL  SAIYLKWINTGQIP
Sbjct  244  TGLEGLALKLVEGDKSARNWWRKLEVVRELLVGSLQSEERLEALICSAIYLKWINTGQIP  303

Query  539  CFEDGGHHRPNRHAEISRLIFCEL  610
            CFEDGGHHRPNRHAEISRLIF EL
Sbjct  304  CFEDGGHHRPNRHAEISRLIFREL  327



>ref|XP_002265211.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Vitis 
vinifera]
Length=1188

 Score =   268 bits (684),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 160/204 (78%), Gaps = 1/204 (0%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            ++EL+G E +E+KFVIV +DK++ WE  +NRVLKLP GGSF +VC WN T + ++LLPLD
Sbjct  121  KLELRGDESIEYKFVIVKRDKSMTWEGANNRVLKLPKGGSFGVVCLWNATGEAVDLLPLD  180

Query  182  SE-GEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDT  358
            SE  E E   + + G  V   ++  ++Q S FVEQWQG++VSF+RSN+ R  E  R+WDT
Sbjct  181  SEKDEVEFDHMDEIGSAVVDSASVLEVQTSPFVEQWQGRSVSFMRSNEHRNQETERRWDT  240

Query  359  SGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIP  538
            SGL  +  KLVEGD+N++NWW+KLEVVR+L+V N+ES  RLEAL +SAIYLKWINTGQIP
Sbjct  241  SGLEGLARKLVEGDRNARNWWQKLEVVRELLVGNLESGDRLEALIFSAIYLKWINTGQIP  300

Query  539  CFEDGGHHRPNRHAEISRLIFCEL  610
            CFE GGHHRPNRHAEISRLIF EL
Sbjct  301  CFEGGGHHRPNRHAEISRLIFREL  324



>emb|CBI39424.3| unnamed protein product [Vitis vinifera]
Length=1149

 Score =   267 bits (683),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 160/204 (78%), Gaps = 1/204 (0%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            ++EL+G E +E+KFVIV +DK++ WE  +NRVLKLP GGSF +VC WN T + ++LLPLD
Sbjct  121  KLELRGDESIEYKFVIVKRDKSMTWEGANNRVLKLPKGGSFGVVCLWNATGEAVDLLPLD  180

Query  182  SE-GEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDT  358
            SE  E E   + + G  V   ++  ++Q S FVEQWQG++VSF+RSN+ R  E  R+WDT
Sbjct  181  SEKDEVEFDHMDEIGSAVVDSASVLEVQTSPFVEQWQGRSVSFMRSNEHRNQETERRWDT  240

Query  359  SGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIP  538
            SGL  +  KLVEGD+N++NWW+KLEVVR+L+V N+ES  RLEAL +SAIYLKWINTGQIP
Sbjct  241  SGLEGLARKLVEGDRNARNWWQKLEVVRELLVGNLESGDRLEALIFSAIYLKWINTGQIP  300

Query  539  CFEDGGHHRPNRHAEISRLIFCEL  610
            CFE GGHHRPNRHAEISRLIF EL
Sbjct  301  CFEGGGHHRPNRHAEISRLIFREL  324



>ref|XP_011074900.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Sesamum 
indicum]
Length=1209

 Score =   267 bits (682),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 134/200 (67%), Positives = 158/200 (79%), Gaps = 7/200 (4%)
 Frame = +2

Query  23   EPVEFKFVIVGKDKN-LLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLP---LDSEG  190
            EPVE+KFVIV KDK  L+WE+GDNR+LK    G+F +VC+WN T++ +E+LP    D+EG
Sbjct  150  EPVEYKFVIVSKDKGKLVWESGDNRILKFSGNGNFNIVCRWNKTNEQVEVLPWDGKDAEG  209

Query  191  EYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLA  370
                Q+   NG VVT  S +  +  SAFVEQWQGK V+FVRS D    EKNR WDTSGL 
Sbjct  210  VEAEQI--KNGNVVTA-SIEEAVTSSAFVEQWQGKDVAFVRSKDHFDAEKNRNWDTSGLE  266

Query  371  EIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFED  550
             I LKLVEGD++++NWWRKLEVVR+L+VEN+E+  RLEALTYSAIYLKWINTGQIPCFED
Sbjct  267  GIALKLVEGDRSARNWWRKLEVVRELVVENIENAKRLEALTYSAIYLKWINTGQIPCFED  326

Query  551  GGHHRPNRHAEISRLIFCEL  610
            GGHHRPNRHAEISRLIF EL
Sbjct  327  GGHHRPNRHAEISRLIFREL  346



>gb|KHF99077.1| Phosphoglucan, water dikinase, chloroplastic -like protein [Gossypium 
arboreum]
Length=1169

 Score =   265 bits (678),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 160/204 (78%), Gaps = 3/204 (1%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            ++ELKGGE VEFKFV+V KDK++ WE G+NRVLKLP GG+F M+C WN T++ LELLPL 
Sbjct  126  DLELKGGESVEFKFVVVSKDKSVAWEGGNNRVLKLPQGGNFGMICHWNSTEETLELLPLS  185

Query  182  SEGEYEAQVLADNGPVVTKDSTDP-DMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDT  358
            SE EY+  V  D G   +  +TD  +++ S FV QWQG+  SF+RSN+    E  R+WDT
Sbjct  186  SE-EYDDSV-DDAGHSESTSTTDALEVEASPFVGQWQGRPASFMRSNEHHNRELERRWDT  243

Query  359  SGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIP  538
            +GL  + LKLVEGDK+++NWWRKLEVVR+L+V +++   RLEAL  SAIYLKWINTGQIP
Sbjct  244  TGLEGLALKLVEGDKSARNWWRKLEVVRELLVGSLQREERLEALICSAIYLKWINTGQIP  303

Query  539  CFEDGGHHRPNRHAEISRLIFCEL  610
            CFEDGGHHRPNRHAEISRLIF EL
Sbjct  304  CFEDGGHHRPNRHAEISRLIFREL  327



>gb|KDP32558.1| hypothetical protein JCGZ_13108 [Jatropha curcas]
Length=1114

 Score =   265 bits (677),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 156/204 (76%), Gaps = 3/204 (1%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            ++ LKGGE +EFKFVI  KDK L+WE GDNR LKLP GG +++VC+WN T + ++LL LD
Sbjct  57   DLVLKGGESIEFKFVIARKDKTLVWEGGDNRTLKLPKGGHYEIVCKWNATAEHIDLLTLD  116

Query  182  SEG-EYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDT  358
             EG + E   +++N  V    +T  D++ S FV QWQGKA SF+RSN+    E  RKWDT
Sbjct  117  LEGNDMEVGDISENRYV--SGTTPLDVETSPFVGQWQGKAASFMRSNEHHNRETERKWDT  174

Query  359  SGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIP  538
            SGL  +   LVEGD+N++NWWRKLE+VR L+VEN++   RLEAL YSAIYLKWINTGQIP
Sbjct  175  SGLEGLAFALVEGDRNARNWWRKLELVRQLLVENLQIADRLEALVYSAIYLKWINTGQIP  234

Query  539  CFEDGGHHRPNRHAEISRLIFCEL  610
            CFEDGGHHRPNRHAEISRLIF EL
Sbjct  235  CFEDGGHHRPNRHAEISRLIFREL  258



>ref|XP_006493516.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Citrus sinensis]
Length=1190

 Score =   263 bits (672),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 129/205 (63%), Positives = 157/205 (77%), Gaps = 9/205 (4%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            ++E KGGE +E+KFVIV  DK+  WE GDNR+LKLP GGSF++VC WN T + ++LL L 
Sbjct  133  DLEFKGGESIEYKFVIVRNDKSKAWEAGDNRILKLPKGGSFEIVCHWNKTGEAVDLLHL-  191

Query  182  SEGEYEAQVLADNGPVVTKDSTDPDMQV--SAFVEQWQGKAVSFVRSNDQRGMEKNRKWD  355
                   + + DNG VVT  + D  ++V  S FV QWQGK+ SF+R++D    E  RKWD
Sbjct  192  ------VEDVLDNGSVVTDAAPDALLEVGTSPFVGQWQGKSASFMRADDHWNREMERKWD  245

Query  356  TSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQI  535
            TSGL  + LKLVEGD+ ++NWWRKLEVVR+LIVEN++S  RLEAL YSAIYLKWINTG+I
Sbjct  246  TSGLQGLTLKLVEGDQRARNWWRKLEVVRELIVENLQSDERLEALIYSAIYLKWINTGKI  305

Query  536  PCFEDGGHHRPNRHAEISRLIFCEL  610
            PCFEDGGHHRPNRHAEISRLIF EL
Sbjct  306  PCFEDGGHHRPNRHAEISRLIFREL  330



>gb|AFO83531.1| glucan water dikinase 3, partial [Manihot esculenta]
Length=1084

 Score =   261 bits (668),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 156/200 (78%), Gaps = 3/200 (2%)
 Frame = +2

Query  5    MELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD-  181
            +EL+GGE +EFKFV+V KD+++LWE G NR LKLP GGS+++VCQWN T +P+ LLPLD 
Sbjct  58   VELRGGESIEFKFVVVKKDESMLWEGGGNRTLKLPKGGSYEIVCQWNATVEPMNLLPLDL  117

Query  182  SEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTS  361
             E E E + +   G V    +T  + + S FV QWQGK++SF+RSN+ R  E  R WDTS
Sbjct  118  KENEVEKENVDKKGSV--SGATLLEGETSPFVGQWQGKSISFMRSNEHRNRETERTWDTS  175

Query  362  GLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPC  541
             L  + L +VEGD+N++NWWRKLEVVR+L+VEN+++  RLEAL  SAIYLKWINTGQIPC
Sbjct  176  DLEGLALTVVEGDRNARNWWRKLEVVRELLVENLDTGDRLEALICSAIYLKWINTGQIPC  235

Query  542  FEDGGHHRPNRHAEISRLIF  601
            FEDGGHHRPNRHAEISRLIF
Sbjct  236  FEDGGHHRPNRHAEISRLIF  255



>ref|XP_002301739.2| hypothetical protein POPTR_0002s23550g [Populus trichocarpa]
 gb|EEE81012.2| hypothetical protein POPTR_0002s23550g [Populus trichocarpa]
Length=1138

 Score =   259 bits (663),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 157/205 (77%), Gaps = 5/205 (2%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            ++E+KGG  VEFKFVIV KD++ +WE+GDNR L+LP GGSF +VC+W+ T + + LLPL+
Sbjct  123  DLEMKGGGIVEFKFVIVSKDRSFVWESGDNRALRLPRGGSFAVVCKWDATGEAVNLLPLE  182

Query  182  SE--GEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWD  355
             E  GE E +   +NG          +++ S FV QWQGKA+SF+RSN+ R  E  R+WD
Sbjct  183  LEHNGE-EVEDAGENGS--ASAGVLLEVETSPFVGQWQGKAISFMRSNEHRNREAERRWD  239

Query  356  TSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQI  535
            TSGL    LKLV+GD N++NWWRKLEVVR+L+V +++S  RLE L YSAIYLKWINTGQI
Sbjct  240  TSGLQGFALKLVQGDLNARNWWRKLEVVRELLVGSLQSEDRLEVLVYSAIYLKWINTGQI  299

Query  536  PCFEDGGHHRPNRHAEISRLIFCEL  610
            PCFEDGGHHRPNRHAEISRLIF EL
Sbjct  300  PCFEDGGHHRPNRHAEISRLIFREL  324



>ref|XP_002518612.1| chloroplast alpha-glucan water dikinase, putative [Ricinus communis]
 gb|EEF43754.1| chloroplast alpha-glucan water dikinase, putative [Ricinus communis]
Length=1174

 Score =   259 bits (661),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/203 (60%), Positives = 160/203 (79%), Gaps = 3/203 (1%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            ++ELKG + + FKFV++  DK+++WE GDNR++KLP GGS+K+VC+W+ T +P++LLP D
Sbjct  120  DLELKGDDSIGFKFVVLRTDKSVVWEGGDNRIIKLPKGGSYKIVCRWHATAEPIDLLPWD  179

Query  182  SEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTS  361
             E E E  V  +NG +    +T  +++ S FV QW+GK +SF+RSN+ R  E  RKWDTS
Sbjct  180  LE-ENEVDVEGENGSI--SGATLLEVETSPFVGQWKGKDISFMRSNEHRDRETERKWDTS  236

Query  362  GLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPC  541
            GL  + L LVEGD++++NWWRKLEVVR L+V ++++  RL+AL YSAIYLKWINTGQIPC
Sbjct  237  GLEGLALALVEGDRDARNWWRKLEVVRQLLVGSLQTADRLDALIYSAIYLKWINTGQIPC  296

Query  542  FEDGGHHRPNRHAEISRLIFCEL  610
            FEDGGHHRPNRHAEISRLIF EL
Sbjct  297  FEDGGHHRPNRHAEISRLIFREL  319



>ref|XP_004296959.2| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=1191

 Score =   258 bits (659),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 121/203 (60%), Positives = 152/203 (75%), Gaps = 5/203 (2%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            ++E KG E +E+KFV V  DK++LWE GDNRVLKLP+ GSF MVC WN   + ++L PLD
Sbjct  135  QLEFKGDEVIEYKFVTVRADKSMLWEGGDNRVLKLPSRGSFGMVCHWNAIGENVDLFPLD  194

Query  182  SEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTS  361
             E   E +     G  V + ++ P++  S FV QW+G A+SF+RSN+ R  E  R WDTS
Sbjct  195  KEDGVELK-----GSSVAETASTPEVGTSPFVGQWKGNAISFMRSNEHRDRESGRNWDTS  249

Query  362  GLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPC  541
            GL  + LKLVEGD+N++NWWRKLEVVRD+++E+ +S  RL AL  S+IYLKWINTGQIPC
Sbjct  250  GLEGLSLKLVEGDRNARNWWRKLEVVRDILLESSQSEERLSALINSSIYLKWINTGQIPC  309

Query  542  FEDGGHHRPNRHAEISRLIFCEL  610
            FEDGGHHRPNRHAEISR+IF EL
Sbjct  310  FEDGGHHRPNRHAEISRVIFREL  332



>ref|XP_010244064.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Nelumbo nucifera]
 ref|XP_010244065.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Nelumbo nucifera]
Length=1197

 Score =   258 bits (658),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 122/203 (60%), Positives = 151/203 (74%), Gaps = 3/203 (1%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            ++E+KGGE VE+KFVI+ KDK+++WE GDNR LKLP GG F+M+C WN T + + LLPL 
Sbjct  131  DLEMKGGEEVEYKFVILRKDKSIIWENGDNRSLKLPEGGRFEMICHWNKTGEAVNLLPL-  189

Query  182  SEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTS  361
              G  E +  +DNG  V    T P+ + S FVEQWQGKA SF+RSN+    E  R W+T 
Sbjct  190  --GATEKEDTSDNGSAVVDAETVPEGEPSPFVEQWQGKAASFMRSNEHTNRETERTWNTE  247

Query  362  GLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPC  541
            GL  + LK VEGD++++NWWRKLEVVR L+VE++++  R EAL YSAIYLKWINTGQIPC
Sbjct  248  GLEGLALKFVEGDRSARNWWRKLEVVRKLLVESLKNGDRFEALIYSAIYLKWINTGQIPC  307

Query  542  FEDGGHHRPNRHAEISRLIFCEL  610
            FEDGGH RPN HAEIS  IF EL
Sbjct  308  FEDGGHRRPNMHAEISMFIFREL  330



>ref|XP_010107197.1| Phosphoglucan, water dikinase [Morus notabilis]
 gb|EXC14221.1| Phosphoglucan, water dikinase [Morus notabilis]
Length=894

 Score =   253 bits (647),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 120/205 (59%), Positives = 153/205 (75%), Gaps = 7/205 (3%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            ++ELKGG  +E+KFVI+GKD++LLWE+G+NRVL LP  G + +VC WN T + ++LL L+
Sbjct  54   QLELKGGNSIEYKFVILGKDESLLWESGENRVLGLPERGIYGIVCHWNKTGEAVDLLALE  113

Query  182  SEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWD--  355
             E +     + +NG +    +    ++ S FV QWQGKA SF+RSN+ R  E  R WD  
Sbjct  114  EEDD-----VGENGSLTADTAAPLGVETSPFVGQWQGKAASFMRSNEHRAHETERTWDRD  168

Query  356  TSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQI  535
            TS L  + LKLVEGD+N++NWWRKLE++R+L+ EN ES  RL+AL YSAIYLKWINTGQI
Sbjct  169  TSDLERLALKLVEGDRNARNWWRKLEIIRELVAENSESEDRLDALIYSAIYLKWINTGQI  228

Query  536  PCFEDGGHHRPNRHAEISRLIFCEL  610
            PC EDGGHHRPNRHAEISRLIF EL
Sbjct  229  PCLEDGGHHRPNRHAEISRLIFREL  253



>ref|XP_008222722.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Prunus 
mume]
Length=1190

 Score =   254 bits (650),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 154/202 (76%), Gaps = 6/202 (3%)
 Frame = +2

Query  5    MELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDS  184
            +E KGGE VE+KF+ V  DK++LWE GDNRVLKLP GG+F +V  WN T + ++LLPL+ 
Sbjct  134  LEFKGGESVEYKFLTVRADKSVLWEGGDNRVLKLPKGGNFGIVSHWNATGEAVDLLPLEK  193

Query  185  EGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSG  364
            E +     + +NG +V   ST P++  S FV QW+G A+SF+RSN+    E  R WDTSG
Sbjct  194  EED-----VGNNGSIVDTVST-PEVGTSPFVGQWKGNAISFMRSNEHGNREAGRIWDTSG  247

Query  365  LAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCF  544
            L  + LKLVEGD+N++NWWRKLEVVRDL+V + +S  RL+AL  SAIYLKWINTGQIPCF
Sbjct  248  LEGLALKLVEGDRNARNWWRKLEVVRDLLVGSSQSEDRLDALINSAIYLKWINTGQIPCF  307

Query  545  EDGGHHRPNRHAEISRLIFCEL  610
            EDGGHHRPNRHAEISR+IF EL
Sbjct  308  EDGGHHRPNRHAEISRVIFREL  329



>gb|EYU23932.1| hypothetical protein MIMGU_mgv1a000391mg [Erythranthe guttata]
Length=1190

 Score =   253 bits (647),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 129/204 (63%), Positives = 157/204 (77%), Gaps = 5/204 (2%)
 Frame = +2

Query  5    MELKGGE-PVEFKFVIVGKDK-NLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPL  178
            MEL   E PVE+KFVIVG DK  L WE GDNR LK P  GSF +VC+W+ T++ +ELLP 
Sbjct  138  MELSNKEEPVEYKFVIVGNDKERLTWENGDNRTLKFPENGSFNVVCKWDKTNEQVELLPW  197

Query  179  DSEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDT  358
            D E E +A+  + NG  V+  + +  ++ SAFV QWQGK  SFVRSND+   EKN  WDT
Sbjct  198  DQE-EVQAEK-SGNGAAVSA-ALEEGVKKSAFVGQWQGKDASFVRSNDRTNEEKNINWDT  254

Query  359  SGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIP  538
            SGL  I LKLVEGD++++NWWRKLEVVR+L+ EN+E+ +RLEALTYSA+YLKWINTGQIP
Sbjct  255  SGLEGISLKLVEGDRSARNWWRKLEVVRELVAENIENGNRLEALTYSAVYLKWINTGQIP  314

Query  539  CFEDGGHHRPNRHAEISRLIFCEL  610
            C EDG HHRPN+HAEISRLIF E+
Sbjct  315  CSEDGAHHRPNKHAEISRLIFREI  338



>ref|XP_007034117.1| Catalytics,carbohydrate kinases,phosphoglucan [Theobroma cacao]
 gb|EOY05043.1| Catalytics,carbohydrate kinases,phosphoglucan [Theobroma cacao]
Length=1180

 Score =   253 bits (645),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 126/203 (62%), Positives = 152/203 (75%), Gaps = 3/203 (1%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            ++ELKG E VE+KFVIV KDK+++WE GDNRVLKLP  G+F MVC WN T + +ELLPL 
Sbjct  122  DLELKGDESVEYKFVIVRKDKSVVWEGGDNRVLKLPQSGNFGMVCHWNSTGETVELLPLS  181

Query  182  SEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTS  361
             E EY  +V  D     T +  +  ++ S FV  WQG+  SF+RSN+    E  RKWDT+
Sbjct  182  LE-EYGDRVEDDGHNESTAEVLE--VETSPFVRNWQGRPASFMRSNEHHNRELERKWDTT  238

Query  362  GLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPC  541
            GL  + LKLVEGDK+S+NWWRKLEVV +L+V +++S   LEAL  SAIYLKWINTGQIPC
Sbjct  239  GLEGLALKLVEGDKSSRNWWRKLEVVHELLVGSLQSGELLEALICSAIYLKWINTGQIPC  298

Query  542  FEDGGHHRPNRHAEISRLIFCEL  610
            FEDGGHHRPNRHAEISR IFCEL
Sbjct  299  FEDGGHHRPNRHAEISRHIFCEL  321



>ref|XP_011042749.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Populus euphratica]
Length=1178

 Score =   251 bits (641),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 156/205 (76%), Gaps = 5/205 (2%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            ++++KGG  VEFKFVIV KD++ +WE+GDNR L+LP GGSF +VC+W+ T + + LLPLD
Sbjct  123  DLKMKGGGIVEFKFVIVRKDRSFVWESGDNRALRLPRGGSFAVVCKWDATGEAVNLLPLD  182

Query  182  SE--GEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWD  355
             E  GE E +   +NG          +++ S FV Q QGKA+SF+RSN+ R  +  R+WD
Sbjct  183  LEHNGE-EVEDAGENGS--ASAGVLLEVETSPFVGQGQGKAISFMRSNEHRNRKAERRWD  239

Query  356  TSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQI  535
            TSGL    LKLV+GD N++NWWRKLEVVR+L+V +++S  RLEAL  SAIYLKWINTGQI
Sbjct  240  TSGLQGFALKLVQGDLNARNWWRKLEVVRELLVGSLQSEDRLEALVCSAIYLKWINTGQI  299

Query  536  PCFEDGGHHRPNRHAEISRLIFCEL  610
            PCFEDGGHHRPNRHAEISRLIF EL
Sbjct  300  PCFEDGGHHRPNRHAEISRLIFREL  324



>ref|XP_007225436.1| hypothetical protein PRUPE_ppa000429mg [Prunus persica]
 gb|EMJ26635.1| hypothetical protein PRUPE_ppa000429mg [Prunus persica]
Length=1191

 Score =   251 bits (641),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 150/202 (74%), Gaps = 5/202 (2%)
 Frame = +2

Query  5    MELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDS  184
            +E KGGE VE+KF+ V  DK +LWE GDNRVLKLP GG+F +V  WN T + ++LLPL+ 
Sbjct  134  LEFKGGESVEYKFLTVRADKTVLWEGGDNRVLKLPKGGNFGIVSHWNATGEAVDLLPLEK  193

Query  185  EGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSG  364
            E +     + +NG  +    + P++  S FV QW+G A+SF+RSN+    E  R  DTSG
Sbjct  194  EED-----VGNNGSTIVDTVSTPEVGTSPFVGQWKGNAISFMRSNEHGNREAGRILDTSG  248

Query  365  LAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCF  544
            L  + LKLVEGD+N++NWWRKLEVVRDL+V + +S  RL+AL  SAIYLKWINTGQIPCF
Sbjct  249  LQGLALKLVEGDRNARNWWRKLEVVRDLLVGSSQSEDRLDALINSAIYLKWINTGQIPCF  308

Query  545  EDGGHHRPNRHAEISRLIFCEL  610
            EDGGHHRPNRHAEISR+IF EL
Sbjct  309  EDGGHHRPNRHAEISRVIFREL  330



>gb|KJB37918.1| hypothetical protein B456_006G226300 [Gossypium raimondii]
Length=872

 Score =   249 bits (636),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 152/203 (75%), Gaps = 4/203 (2%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            + E  GG+  EFKFVIVG DK L+WETG+NR+LKLP GGS+ +VC WN T +P++LLPL 
Sbjct  121  DFEFDGGQSAEFKFVIVGNDKTLVWETGNNRILKLPEGGSYVIVCHWNSTGEPVKLLPLG  180

Query  182  SEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTS  361
             E +Y  +V    G   T D+++  +  S FV QWQG+A SF++SN+    E  RKWDT+
Sbjct  181  LE-DYRDRV-EGVGHKPTVDASE--VGTSPFVGQWQGRAASFIQSNEHHDREVERKWDTT  236

Query  362  GLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPC  541
            GL    LKLVE DKN++NWWRKLEVVR+LI E++E    LEAL  SA+YLKW+NTGQIPC
Sbjct  237  GLKGFALKLVEEDKNARNWWRKLEVVRELIHESLEIGELLEALICSAVYLKWVNTGQIPC  296

Query  542  FEDGGHHRPNRHAEISRLIFCEL  610
            FEDGGHHRPN+HAEISR IFCEL
Sbjct  297  FEDGGHHRPNKHAEISRDIFCEL  319



>gb|KJB37917.1| hypothetical protein B456_006G226300 [Gossypium raimondii]
Length=1161

 Score =   250 bits (638),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 152/203 (75%), Gaps = 4/203 (2%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            + E  GG+  EFKFVIVG DK L+WETG+NR+LKLP GGS+ +VC WN T +P++LLPL 
Sbjct  121  DFEFDGGQSAEFKFVIVGNDKTLVWETGNNRILKLPEGGSYVIVCHWNSTGEPVKLLPLG  180

Query  182  SEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTS  361
             E +Y  +V    G   T D+++  +  S FV QWQG+A SF++SN+    E  RKWDT+
Sbjct  181  LE-DYRDRV-EGVGHKPTVDASE--VGTSPFVGQWQGRAASFIQSNEHHDREVERKWDTT  236

Query  362  GLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPC  541
            GL    LKLVE DKN++NWWRKLEVVR+LI E++E    LEAL  SA+YLKW+NTGQIPC
Sbjct  237  GLKGFALKLVEEDKNARNWWRKLEVVRELIHESLEIGELLEALICSAVYLKWVNTGQIPC  296

Query  542  FEDGGHHRPNRHAEISRLIFCEL  610
            FEDGGHHRPN+HAEISR IFCEL
Sbjct  297  FEDGGHHRPNKHAEISRDIFCEL  319



>ref|XP_008393850.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Malus domestica]
Length=937

 Score =   248 bits (633),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 150/202 (74%), Gaps = 6/202 (3%)
 Frame = +2

Query  5    MELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDS  184
            +E KGGE VE+KF+ V  DK++LWE G NRVLKLP GGSF+MVC WN T + + L P   
Sbjct  129  LEFKGGESVEYKFLTVRADKSMLWEGGHNRVLKLPNGGSFEMVCHWNATTEAVGL-PSSE  187

Query  185  EGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSG  364
            EGE   Q    NG  V       +++ S FV QW+G A+SF+RSN+  G  K  KWDTSG
Sbjct  188  EGEDVGQ----NGSTVADTVGAEEVESSPFVGQWKGNAISFMRSNEH-GNRKGGKWDTSG  242

Query  365  LAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCF  544
            L  + LKLVEGD+N++NWW+KLEVVRDL+V +++S  RL+AL  SAIYLKWINTGQIPCF
Sbjct  243  LEGLALKLVEGDRNARNWWKKLEVVRDLLVGSLQSEDRLDALINSAIYLKWINTGQIPCF  302

Query  545  EDGGHHRPNRHAEISRLIFCEL  610
            EDGGHHRPNRHAEISR+IF EL
Sbjct  303  EDGGHHRPNRHAEISRVIFREL  324



>ref|XP_008393849.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Malus domestica]
Length=965

 Score =   248 bits (633),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 150/202 (74%), Gaps = 6/202 (3%)
 Frame = +2

Query  5    MELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDS  184
            +E KGGE VE+KF+ V  DK++LWE G NRVLKLP GGSF+MVC WN T + + L P   
Sbjct  129  LEFKGGESVEYKFLTVRADKSMLWEGGHNRVLKLPNGGSFEMVCHWNATTEAVGL-PSSE  187

Query  185  EGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSG  364
            EGE   Q    NG  V       +++ S FV QW+G A+SF+RSN+  G  K  KWDTSG
Sbjct  188  EGEDVGQ----NGSTVADTVGAEEVESSPFVGQWKGNAISFMRSNEH-GNRKGGKWDTSG  242

Query  365  LAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCF  544
            L  + LKLVEGD+N++NWW+KLEVVRDL+V +++S  RL+AL  SAIYLKWINTGQIPCF
Sbjct  243  LEGLALKLVEGDRNARNWWKKLEVVRDLLVGSLQSEDRLDALINSAIYLKWINTGQIPCF  302

Query  545  EDGGHHRPNRHAEISRLIFCEL  610
            EDGGHHRPNRHAEISR+IF EL
Sbjct  303  EDGGHHRPNRHAEISRVIFREL  324



>ref|XP_011000022.1| PREDICTED: LOW QUALITY PROTEIN: phosphoglucan, water dikinase, 
chloroplastic-like [Populus euphratica]
Length=1172

 Score =   247 bits (630),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 129/209 (62%), Positives = 151/209 (72%), Gaps = 13/209 (6%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            E+ELKGGE VEFKF IV KD  L+WE G NR LKLP  GSF +VC+W  T + +  LPL+
Sbjct  117  ELELKGGEAVEFKFAIVSKDNGLVWENGHNRALKLPREGSFAIVCRWGATGEAVNFLPLE  176

Query  182  SE--GEYEAQVLADNGPVVTKDSTDPDMQVSA----FVEQWQGKAVSFVRSNDQRGMEKN  343
             E  GE EA+ + +N      DS   D+ + A    FV QWQGKAVSF+RSND       
Sbjct  177  FEQNGE-EAKDVGEN------DSAGADITLEAGTSPFVGQWQGKAVSFMRSNDHGNRGSE  229

Query  344  RKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWIN  523
            R+WDTSGL    LKLVEGD N++NW RKLEVV +L+V +++S  RLEAL YSAIYLKWIN
Sbjct  230  RRWDTSGLQGSVLKLVEGDLNARNWRRKLEVVCELLVGSLQSKDRLEALIYSAIYLKWIN  289

Query  524  TGQIPCFEDGGHHRPNRHAEISRLIFCEL  610
            TGQ+PCFEDGGHHRPNRHAEISRLIF EL
Sbjct  290  TGQVPCFEDGGHHRPNRHAEISRLIFQEL  318



>gb|EPS59827.1| glucan/water dikinase, partial [Genlisea aurea]
Length=315

 Score =   231 bits (588),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 144/199 (72%), Gaps = 17/199 (9%)
 Frame = +2

Query  29   VEFKFVIVGKDK-NLLWETGDNRVLKLPAGG-SFKMVCQWNVTDKPLELLPL---DSEGE  193
            VE+KF IVGKDK NL+WE+G+NR L LP  G SF +VC+W+ TD+ +++LP    D E E
Sbjct  75   VEYKFAIVGKDKQNLIWESGENRTLTLPEKGRSFSVVCKWDKTDEMVQVLPSEVPDEETE  134

Query  194  YEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAE  373
            YE    AD G +V+          SAFVEQWQGK   FV S D    EK   WDT GL  
Sbjct  135  YEN---ADAGELVS---------TSAFVEQWQGKDALFVHSKDHLDSEKKAYWDTDGLDG  182

Query  374  IPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDG  553
            I LKLVEGD+N++NWWRKLEVVR +IVEN+E  +RL+A  YSAIYLKWINTGQIPC EDG
Sbjct  183  IALKLVEGDRNARNWWRKLEVVRGIIVENIEDGNRLDAFIYSAIYLKWINTGQIPCLEDG  242

Query  554  GHHRPNRHAEISRLIFCEL  610
            GHHRPN+HAEIS+LIF EL
Sbjct  243  GHHRPNKHAEISQLIFREL  261



>gb|KHG00248.1| Phosphoglucan, water dikinase, chloroplastic -like protein [Gossypium 
arboreum]
Length=1052

 Score =   244 bits (622),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 152/215 (71%), Gaps = 16/215 (7%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            + E  GG+  EFKFVIVG DK L+WETG+NR+LKLP GGS+ +VC WN T +P +LLPL 
Sbjct  55   DFEFDGGQSAEFKFVIVGNDKTLVWETGNNRILKLPEGGSYVIVCHWNSTGEPAKLLPLG  114

Query  182  SEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTS  361
             E EY  +V  D G   T D+ +  +  S FV QWQG+A SF++SN+    E  RKWDT+
Sbjct  115  LE-EYRDRV-EDVGHKPTADAYE--LGTSPFVGQWQGRAASFMQSNEHHDREVERKWDTT  170

Query  362  GLAEIPLKLVEGDKNSQNWWRK------------LEVVRDLIVENVESTHRLEALTYSAI  505
            GL  + LKLVE DKN++NWWRK            LEVVR++I E++E    LEAL  SA+
Sbjct  171  GLKGLALKLVEEDKNARNWWRKVCPFIILDIAQHLEVVREIIHESLEVGELLEALICSAV  230

Query  506  YLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCEL  610
            YLKW+NTGQIPCFEDGGHHRPN+HAEISR IFCEL
Sbjct  231  YLKWVNTGQIPCFEDGGHHRPNKHAEISRDIFCEL  265



>ref|XP_009371117.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Pyrus x bretschneideri]
Length=965

 Score =   242 bits (618),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 121/202 (60%), Positives = 148/202 (73%), Gaps = 6/202 (3%)
 Frame = +2

Query  5    MELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDS  184
            +E KGGE VE+KF+ V  DK++LWE G NR+LKLP GGSF+MVC WN T + + L P   
Sbjct  129  LEFKGGESVEYKFLTVRADKSMLWEGGQNRILKLPKGGSFEMVCHWNATTEAVGL-PSSE  187

Query  185  EGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSG  364
            EGE   Q    NG  V       +++ S FV QW+G A+SF+RSN+  G  +  KWDTSG
Sbjct  188  EGEDVDQ----NGSTVADTVGAEEVESSPFVGQWKGNAISFMRSNEH-GNREGGKWDTSG  242

Query  365  LAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCF  544
            L  + LKLVEGD+N++NWWRKLEVVRDL+V +++S  RL+AL  S IYLKWINTGQIPCF
Sbjct  243  LEGLALKLVEGDRNARNWWRKLEVVRDLLVGSLQSEDRLDALINSTIYLKWINTGQIPCF  302

Query  545  EDGGHHRPNRHAEISRLIFCEL  610
            E GGHHRPNRHAEISR+IF EL
Sbjct  303  EGGGHHRPNRHAEISRVIFREL  324



>ref|XP_002320442.2| hypothetical protein POPTR_0014s14510g [Populus trichocarpa]
 gb|EEE98757.2| hypothetical protein POPTR_0014s14510g [Populus trichocarpa]
Length=1159

 Score =   243 bits (621),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 149/205 (73%), Gaps = 5/205 (2%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            ++ELKGGE VEFKF I  KD +L+WE+GDNR LKLP  GSF +VC+W  T + +   PL+
Sbjct  117  KLELKGGEVVEFKFAIASKDNSLVWESGDNRALKLPREGSFAIVCRWGATGEAINFSPLE  176

Query  182  SE--GEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWD  355
             E  GE EA+ + +NG      + +     S FV QWQGKA SF+RSND       R+WD
Sbjct  177  LEQNGE-EAEDVGENGSAGADITLEAG--TSPFVGQWQGKAASFMRSNDHGNRGSERRWD  233

Query  356  TSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQI  535
            TSGL    LKLVEGD N++NW RKLEVV +L+V +++S  RLEAL YSAIYLKWINTGQ+
Sbjct  234  TSGLQGSVLKLVEGDLNARNWRRKLEVVCELLVGSLQSKDRLEALIYSAIYLKWINTGQV  293

Query  536  PCFEDGGHHRPNRHAEISRLIFCEL  610
            PCFEDGGHHRPNRHAEISRLIF EL
Sbjct  294  PCFEDGGHHRPNRHAEISRLIFQEL  318



>ref|XP_009371116.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Pyrus x bretschneideri]
Length=1185

 Score =   243 bits (620),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 121/202 (60%), Positives = 148/202 (73%), Gaps = 6/202 (3%)
 Frame = +2

Query  5    MELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDS  184
            +E KGGE VE+KF+ V  DK++LWE G NR+LKLP GGSF+MVC WN T + + L P   
Sbjct  129  LEFKGGESVEYKFLTVRADKSMLWEGGQNRILKLPKGGSFEMVCHWNATTEAVGL-PSSE  187

Query  185  EGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSG  364
            EGE   Q    NG  V       +++ S FV QW+G A+SF+RSN+  G  +  KWDTSG
Sbjct  188  EGEDVDQ----NGSTVADTVGAEEVESSPFVGQWKGNAISFMRSNEH-GNREGGKWDTSG  242

Query  365  LAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCF  544
            L  + LKLVEGD+N++NWWRKLEVVRDL+V +++S  RL+AL  S IYLKWINTGQIPCF
Sbjct  243  LEGLALKLVEGDRNARNWWRKLEVVRDLLVGSLQSEDRLDALINSTIYLKWINTGQIPCF  302

Query  545  EDGGHHRPNRHAEISRLIFCEL  610
            E GGHHRPNRHAEISR+IF EL
Sbjct  303  EGGGHHRPNRHAEISRVIFREL  324



>ref|XP_007142602.1| hypothetical protein PHAVU_007G001400g [Phaseolus vulgaris]
 gb|ESW14596.1| hypothetical protein PHAVU_007G001400g [Phaseolus vulgaris]
Length=952

 Score =   241 bits (616),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/204 (57%), Positives = 139/204 (68%), Gaps = 4/204 (2%)
 Frame = +2

Query  5    MELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDS  184
            +E KG + +EFKF+ V KD  ++WE G NRVLKLP  G F  V  W+ T   LEL PLD 
Sbjct  130  LEFKGTDHIEFKFITVKKDSTMVWEAGQNRVLKLPVAGHFTTVATWDATQTNLELHPLDE  189

Query  185  EGEYEAQVLADNGPVV--TKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDT  358
            +   + QV  + G        S     + S FV QWQGK VSF+RSND R  E   KWDT
Sbjct  190  Q--LQLQVQGEEGKPYDGATSSVSETAEASPFVGQWQGKPVSFMRSNDHRTHETQMKWDT  247

Query  359  SGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIP  538
            SGL  +PLK V+ D+N++NWWRKL++VRD+I   ++   RLEAL YSAIYLKWINTGQI 
Sbjct  248  SGLHGLPLKFVQADQNARNWWRKLDIVRDIIAGGLQGEDRLEALLYSAIYLKWINTGQIT  307

Query  539  CFEDGGHHRPNRHAEISRLIFCEL  610
            CFEDGGHHRPNRHAEISRLIF EL
Sbjct  308  CFEDGGHHRPNRHAEISRLIFREL  331



>gb|KFK26410.1| hypothetical protein AALP_AA8G245000 [Arabis alpina]
Length=1180

 Score =   239 bits (611),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/207 (57%), Positives = 145/207 (70%), Gaps = 5/207 (2%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            ++EL GG+ +E+KFVIV  D +L WE+GDNRVL+LP  GSF +VC WN T + L++ P +
Sbjct  116  DLELSGGQVLEYKFVIVQNDGSLSWESGDNRVLRLPNSGSFSVVCHWNATGETLDV-PQE  174

Query  182  SEGEYEAQVLADNGPV----VTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRK  349
               +      +DN  V    V        ++ S    QWQGK  SF+RSND    E  R 
Sbjct  175  VANDASVHDHSDNTDVGDDRVVGSENGAQLKKSTLAGQWQGKDASFMRSNDHSNREVGRN  234

Query  350  WDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTG  529
            WDT+GL    LK+VEGD+NS+NWWRKLE+VR+LIV ++E   RL+AL YSAIYLKWINTG
Sbjct  235  WDTTGLKGTALKIVEGDQNSKNWWRKLEMVRELIVGSLEREERLQALIYSAIYLKWINTG  294

Query  530  QIPCFEDGGHHRPNRHAEISRLIFCEL  610
            QIPCFEDGGHHRPNRHAEISRLIF +L
Sbjct  295  QIPCFEDGGHHRPNRHAEISRLIFRQL  321



>ref|XP_010546804.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Tarenaya hassleriana]
Length=1174

 Score =   239 bits (611),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/205 (58%), Positives = 151/205 (74%), Gaps = 5/205 (2%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            E+EL GG+ +E+KFVIV KD +L WE+G+NRVL+LP  GSF +VC+W+ T +PL+L P +
Sbjct  118  ELELSGGQVLEYKFVIVRKDGSLAWESGENRVLQLPNSGSFSVVCRWDATREPLDL-PQE  176

Query  182  S--EGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWD  355
            +  + ++E  V   +  +V  D     +  S    QWQGK  SF+RSN+ R  E +R W+
Sbjct  177  AGIDDDHEDDVGEQDDHIVNNDGVQ--IGKSTLAGQWQGKDASFMRSNEHRNREVDRIWN  234

Query  356  TSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQI  535
            T+GL    LKLVEGD+N++NWWRKLEVVR+LIV ++E   RLEAL YSAIYLKWINTGQI
Sbjct  235  TTGLEGSALKLVEGDRNARNWWRKLEVVRELIVGSIEREERLEALLYSAIYLKWINTGQI  294

Query  536  PCFEDGGHHRPNRHAEISRLIFCEL  610
            PC EDGGHHRPNRHAEISR IF EL
Sbjct  295  PCLEDGGHHRPNRHAEISRFIFREL  319



>ref|XP_010546803.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Tarenaya hassleriana]
Length=1176

 Score =   239 bits (610),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 119/205 (58%), Positives = 151/205 (74%), Gaps = 5/205 (2%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            E+EL GG+ +E+KFVIV KD +L WE+G+NRVL+LP  GSF +VC+W+ T +PL+L P +
Sbjct  118  ELELSGGQVLEYKFVIVRKDGSLAWESGENRVLQLPNSGSFSVVCRWDATREPLDL-PQE  176

Query  182  S--EGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWD  355
            +  + ++E  V   +  +V  D     +  S    QWQGK  SF+RSN+ R  E +R W+
Sbjct  177  AGIDDDHEDDVGEQDDHIVNNDGVQ--IGKSTLAGQWQGKDASFMRSNEHRNREVDRIWN  234

Query  356  TSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQI  535
            T+GL    LKLVEGD+N++NWWRKLEVVR+LIV ++E   RLEAL YSAIYLKWINTGQI
Sbjct  235  TTGLEGSALKLVEGDRNARNWWRKLEVVRELIVGSIEREERLEALLYSAIYLKWINTGQI  294

Query  536  PCFEDGGHHRPNRHAEISRLIFCEL  610
            PC EDGGHHRPNRHAEISR IF EL
Sbjct  295  PCLEDGGHHRPNRHAEISRFIFREL  319



>ref|XP_006845104.1| hypothetical protein AMTR_s00005p00168970 [Amborella trichopoda]
 gb|ERN06779.1| hypothetical protein AMTR_s00005p00168970 [Amborella trichopoda]
Length=1176

 Score =   238 bits (608),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 118/208 (57%), Positives = 148/208 (71%), Gaps = 9/208 (4%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            +++LKGGE VE+KFVI+ K+K  +WE GDNR LKLP  G F+MVC WN T + + L   +
Sbjct  125  DLKLKGGENVEYKFVILAKEKTTIWEEGDNRALKLPKEGKFEMVCHWNQTREAVNLPAFE  184

Query  182  SEGEYEAQVLADNGPVVTKDSTDPDMQV-----SAFVEQWQGKAVSFVRSNDQRGMEKNR  346
             E E  ++ +A    VV  +S    + V     SAFV+ WQGK VSF++SN     E  R
Sbjct  185  DEVEVGSEEVA----VVDDNSNSSPLLVEVQEPSAFVQGWQGKVVSFMKSNKHGETESAR  240

Query  347  KWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINT  526
            +W+T  L    LKLV+GD+N++NWWRKLEVVR+L+ +N E   RLE+L YSAIYLK INT
Sbjct  241  RWNTESLEGPALKLVKGDQNARNWWRKLEVVRELLTQNTEEESRLESLIYSAIYLKLINT  300

Query  527  GQIPCFEDGGHHRPNRHAEISRLIFCEL  610
            GQIPCFEDGGHHRPNRHAEISRLIFC+L
Sbjct  301  GQIPCFEDGGHHRPNRHAEISRLIFCDL  328



>ref|XP_009416602.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Musa 
acuminata subsp. malaccensis]
Length=1264

 Score =   239 bits (609),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 122/206 (59%), Positives = 149/206 (72%), Gaps = 4/206 (2%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGK-DKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELL--  172
            ++EL+GGE VEFKFV++ +  K+++WE G NRVL LP  G+F MVC WN TD+ LELL  
Sbjct  202  DIELRGGESVEFKFVVLLRGKKDVVWEGGGNRVLTLPEKGAFDMVCHWNRTDEALELLGT  261

Query  173  PLDSEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKW  352
             L  E E       ++  +V   S + +   S FVEQWQG+A SF+RSND    E  RKW
Sbjct  262  SLGEEDEELQSADVEDVSLVEDRSFESEAGASPFVEQWQGRAASFMRSNDHASRETERKW  321

Query  353  DTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQ  532
            +T GL    LKLVEGD++++NWWRKLEVVR+L+  N+   + LEAL YSAIYLKWINTGQ
Sbjct  322  NTDGLDGAALKLVEGDRSARNWWRKLEVVRELLTGNI-GGNCLEALIYSAIYLKWINTGQ  380

Query  533  IPCFEDGGHHRPNRHAEISRLIFCEL  610
            IPCFEDGGHHRPNRHAEISRLIF EL
Sbjct  381  IPCFEDGGHHRPNRHAEISRLIFREL  406



>ref|XP_010551754.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Tarenaya hassleriana]
Length=1183

 Score =   238 bits (608),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 120/214 (56%), Positives = 149/214 (70%), Gaps = 18/214 (8%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLEL----  169
            E+EL GG+ +E+KFVIV KD +L WE+GDNRVL+LP  GSF + C+W+ T +PL+L    
Sbjct  119  ELELSGGQVLEYKFVIVRKDGSLAWESGDNRVLQLPNSGSFSVSCRWDATREPLDLPQEA  178

Query  170  -------LPLDSEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQR  328
                      + +G  E     +N  V         ++ S+   QWQGK VSF+RSN+ R
Sbjct  179  AADDDDDDDNEQDGHDEVDYTVNNDGV-------QQLEKSSLAGQWQGKDVSFMRSNEHR  231

Query  329  GMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIY  508
              E +R WDT+GL    LKLVEGD+N++NWWRKLEVVR+LIV ++E   RLEAL YSAIY
Sbjct  232  NREVDRIWDTTGLEGSALKLVEGDRNARNWWRKLEVVRELIVGSIERKERLEALIYSAIY  291

Query  509  LKWINTGQIPCFEDGGHHRPNRHAEISRLIFCEL  610
            LKWINTGQIPCFEDG H+RPNRHAEISRLIF EL
Sbjct  292  LKWINTGQIPCFEDGSHYRPNRHAEISRLIFREL  325



>ref|XP_010907528.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Elaeis 
guineensis]
Length=926

 Score =   236 bits (603),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 121/213 (57%), Positives = 150/213 (70%), Gaps = 17/213 (8%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDK-NLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPL  178
            E+EL GGE +E+KFVI+ K K  ++WE GDNRVLKLP  G F MVC+WN T + ++LL  
Sbjct  118  ELELCGGEVLEYKFVILRKGKMGMIWEDGDNRVLKLPEEGMFDMVCRWNKTGEAVDLLGA  177

Query  179  DSEGEYEAQV---------LADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRG  331
            D + E   ++          +D+G  V+K    P      FVE WQG+A SF+RSN+ + 
Sbjct  178  DIDDEKVEELESEDGGDATASDDGGFVSKRKPSP------FVEHWQGRAASFMRSNEHKS  231

Query  332  MEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYL  511
             E  R WDT GL  + LKLVEGD+ ++NWWRKLEVVR+L++EN++    LEAL Y AIYL
Sbjct  232  RETERTWDTDGLDGVVLKLVEGDRVARNWWRKLEVVRELLMENIKGDC-LEALIYFAIYL  290

Query  512  KWINTGQIPCFEDGGHHRPNRHAEISRLIFCEL  610
            KWIN GQIPCFEDGGHHRPNRHAEISRLIFCEL
Sbjct  291  KWINMGQIPCFEDGGHHRPNRHAEISRLIFCEL  323



>ref|XP_010454991.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=895

 Score =   234 bits (598),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 143/203 (70%), Gaps = 2/203 (1%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            E+EL GG+ +E+KFVIV  D +L WE+GDNRVLKLP  G+F +VC W+ T + L+L    
Sbjct  120  ELELDGGQVLEYKFVIVKNDGSLSWESGDNRVLKLPNSGNFSVVCHWDATRETLDLPQEV  179

Query  182  SEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTS  361
               +       D   V +++     +Q S    QWQGK  SF+RSND    E  R WDT+
Sbjct  180  CNDDGGGGDERDTQDVGSENGAQ--LQKSTLGGQWQGKDASFMRSNDHGNREVGRNWDTT  237

Query  362  GLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPC  541
            GL    LK+VEGD+NS+NWWRKLE+VR++IV +VE   RL+AL YSAIYLKWINTGQIPC
Sbjct  238  GLEGTALKMVEGDRNSRNWWRKLEMVREVIVGSVEREERLKALIYSAIYLKWINTGQIPC  297

Query  542  FEDGGHHRPNRHAEISRLIFCEL  610
            FEDGGHHRPNRHAEISRLIF EL
Sbjct  298  FEDGGHHRPNRHAEISRLIFREL  320



>ref|XP_006394878.1| hypothetical protein EUTSA_v10003634mg [Eutrema salsugineum]
 gb|ESQ32164.1| hypothetical protein EUTSA_v10003634mg [Eutrema salsugineum]
Length=880

 Score =   234 bits (597),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 114/206 (55%), Positives = 146/206 (71%), Gaps = 5/206 (2%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLEL---L  172
            E+EL GG+ +E+KFVIV  D +L WE+GDNRVLKLP  GSF +VC W+ T + L+    +
Sbjct  114  ELELSGGQVLEYKFVIVHNDGSLSWESGDNRVLKLPNSGSFSVVCHWDATGETLDFPQEV  173

Query  173  PLDSEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKW  352
              D   + +   + D+  V +++     +  S    QWQGK  SF+RSN+    E  R W
Sbjct  174  ASDGHDDSDKHDVVDDRVVGSENGAQ--LHKSTLAGQWQGKDASFMRSNEHGNREVGRNW  231

Query  353  DTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQ  532
            DT+GL    LK+VEGD+NS+NWWRKLE+VR++IV ++E   RL+AL YSA+YLKWINTGQ
Sbjct  232  DTTGLEGSALKMVEGDRNSRNWWRKLEMVREVIVGSLEREERLKALIYSAVYLKWINTGQ  291

Query  533  IPCFEDGGHHRPNRHAEISRLIFCEL  610
            IPCFEDGGHHRPNRHAEISRLIF EL
Sbjct  292  IPCFEDGGHHRPNRHAEISRLIFREL  317



>ref|NP_001119280.1| phosphoglucan, water dikinase [Arabidopsis thaliana]
 gb|AED93556.1| phosphoglucan, water dikinase [Arabidopsis thaliana]
Length=865

 Score =   233 bits (594),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 145/210 (69%), Gaps = 8/210 (4%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            E+EL GG+ +E+KFVIV  D +L WE+GDNRVLK+P  G+F +VC W+ T + L+L P +
Sbjct  118  ELELDGGQVLEYKFVIVKNDGSLSWESGDNRVLKVPNSGNFSVVCHWDATRETLDL-PQE  176

Query  182  SEGEYEAQVLA---DNGPV----VTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEK  340
               + +        DN  V    V        +Q S    QWQGK  SF+RSND    E 
Sbjct  177  VGNDDDVGDGGHERDNHDVGDDRVVGSENGAQLQKSTLGGQWQGKDASFMRSNDHGNREV  236

Query  341  NRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWI  520
             R WDTSGL    LK+VEGD+NS+NWWRKLE+VR++IV +VE   RL+AL YSAIYLKWI
Sbjct  237  GRNWDTSGLEGTALKMVEGDRNSKNWWRKLEMVREVIVGSVEREERLKALIYSAIYLKWI  296

Query  521  NTGQIPCFEDGGHHRPNRHAEISRLIFCEL  610
            NTGQIPCFEDGGHHRPNRHAEISRLIF EL
Sbjct  297  NTGQIPCFEDGGHHRPNRHAEISRLIFREL  326



>ref|XP_008799788.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Phoenix dactylifera]
Length=758

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 119/207 (57%), Positives = 152/207 (73%), Gaps = 6/207 (3%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKD-KNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPL  178
            E+EL GGE +E+KFVI+ K  K ++WE GDNRVLKLP  G F MVC+WN T + ++L   
Sbjct  119  ELELCGGEVLEYKFVILMKGRKGMIWEDGDNRVLKLPEEGMFDMVCRWNKTGEAVDLSGA  178

Query  179  DSEGEYEAQVLADNG---PVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRK  349
             ++G  E ++ ++NG   P         +++ S F EQWQG+A SF+RSN+ +  E  R+
Sbjct  179  ATDGVVE-ELDSENGGGAPASEDGGVVSELEPSPFAEQWQGRAASFMRSNEHKSWEAERR  237

Query  350  WDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTG  529
            WDT GL  + LKLVEGD+ ++NWWRKLEVVR+L++EN++    LEAL YSAIYLKWINTG
Sbjct  238  WDTDGLDGVVLKLVEGDRVARNWWRKLEVVRELLMENIKGDC-LEALIYSAIYLKWINTG  296

Query  530  QIPCFEDGGHHRPNRHAEISRLIFCEL  610
            QIPCFEDGGH RPNRHAEISRLIF EL
Sbjct  297  QIPCFEDGGHRRPNRHAEISRLIFREL  323



>ref|XP_010493901.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Camelina sativa]
Length=1194

 Score =   235 bits (599),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 141/207 (68%), Gaps = 4/207 (2%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            ++EL GG+ +E+KFVIV  D +L WE+GDNRVLKLP  G+F +VC W+ T + L+L    
Sbjct  118  QLELDGGQVLEYKFVIVKNDGSLSWESGDNRVLKLPNSGNFSVVCHWDATRETLDLPQEV  177

Query  182  SEGEYEAQVLADNGPV----VTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRK  349
                       DN  V    V        +Q S    QWQGK  SF+RSND    E  R 
Sbjct  178  GNDGGGGGDERDNHEVSDERVVGSENGAQLQKSTLGGQWQGKDASFMRSNDHGNREVGRN  237

Query  350  WDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTG  529
            WDT+GL    LK+VEGD+NS+NWWRKLE+VR++IV +VE   RL+AL YSAIYLKWINTG
Sbjct  238  WDTTGLEGTALKMVEGDRNSRNWWRKLEMVREVIVGSVEREERLKALIYSAIYLKWINTG  297

Query  530  QIPCFEDGGHHRPNRHAEISRLIFCEL  610
            QIPCFEDGGHHRPNRHAEISRLIF EL
Sbjct  298  QIPCFEDGGHHRPNRHAEISRLIFREL  324



>ref|XP_010493900.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Camelina sativa]
Length=1194

 Score =   235 bits (599),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 141/207 (68%), Gaps = 4/207 (2%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            ++EL GG+ +E+KFVIV  D +L WE+GDNRVLKLP  G+F +VC W+ T + L+L    
Sbjct  118  QLELDGGQVLEYKFVIVKNDGSLSWESGDNRVLKLPNSGNFSVVCHWDATRETLDLPQEV  177

Query  182  SEGEYEAQVLADNGPV----VTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRK  349
                       DN  V    V        +Q S    QWQGK  SF+RSND    E  R 
Sbjct  178  GNDGGGGGDERDNHEVSDERVVGSENGAQLQKSTLGGQWQGKDASFMRSNDHGNREVGRN  237

Query  350  WDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTG  529
            WDT+GL    LK+VEGD+NS+NWWRKLE+VR++IV +VE   RL+AL YSAIYLKWINTG
Sbjct  238  WDTTGLEGTALKMVEGDRNSRNWWRKLEMVREVIVGSVEREERLKALIYSAIYLKWINTG  297

Query  530  QIPCFEDGGHHRPNRHAEISRLIFCEL  610
            QIPCFEDGGHHRPNRHAEISRLIF EL
Sbjct  298  QIPCFEDGGHHRPNRHAEISRLIFREL  324



>ref|XP_010454990.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=1182

 Score =   234 bits (598),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 143/203 (70%), Gaps = 2/203 (1%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            E+EL GG+ +E+KFVIV  D +L WE+GDNRVLKLP  G+F +VC W+ T + L+L    
Sbjct  120  ELELDGGQVLEYKFVIVKNDGSLSWESGDNRVLKLPNSGNFSVVCHWDATRETLDLPQEV  179

Query  182  SEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTS  361
               +       D   V +++     +Q S    QWQGK  SF+RSND    E  R WDT+
Sbjct  180  CNDDGGGGDERDTQDVGSENGAQ--LQKSTLGGQWQGKDASFMRSNDHGNREVGRNWDTT  237

Query  362  GLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPC  541
            GL    LK+VEGD+NS+NWWRKLE+VR++IV +VE   RL+AL YSAIYLKWINTGQIPC
Sbjct  238  GLEGTALKMVEGDRNSRNWWRKLEMVREVIVGSVEREERLKALIYSAIYLKWINTGQIPC  297

Query  542  FEDGGHHRPNRHAEISRLIFCEL  610
            FEDGGHHRPNRHAEISRLIF EL
Sbjct  298  FEDGGHHRPNRHAEISRLIFREL  320



>emb|CDY65142.1| BnaC02g48400D [Brassica napus]
Length=1315

 Score =   234 bits (598),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 142/203 (70%), Gaps = 8/203 (4%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            E+ L GG+P+EFKFVI+  D +L WE+GDNRVL LP  G+F +VC W+ T + L+++  +
Sbjct  114  ELHLNGGQPLEFKFVIMKTDGSLSWESGDNRVLNLPKSGAFSVVCHWDATREALDVVSQE  173

Query  182  SEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTS  361
              GE E         VV        ++ S    +W+GK  SF+ SN+    E  R WDTS
Sbjct  174  EVGEGER--------VVGSSENGAQLRKSTLAGEWKGKEASFMSSNEHGSREVGRSWDTS  225

Query  362  GLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPC  541
            GL    LK+VEGD+NS+NWWRKLE+VR++IV +VE   RL+AL YSA+YLKWINTGQIPC
Sbjct  226  GLEGPCLKMVEGDRNSRNWWRKLEMVREVIVGSVEREERLKALIYSAVYLKWINTGQIPC  285

Query  542  FEDGGHHRPNRHAEISRLIFCEL  610
            FEDGGHHRPNRHAEISRLIF EL
Sbjct  286  FEDGGHHRPNRHAEISRLIFREL  308



>ref|NP_198009.3| phosphoglucan, water dikinase [Arabidopsis thaliana]
 sp|Q6ZY51.1|PWD_ARATH RecName: Full=Phosphoglucan, water dikinase, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAG25776.1| phosphoglucan, water dikinase [Arabidopsis thaliana]
 gb|AED93555.1| phosphoglucan, water dikinase [Arabidopsis thaliana]
Length=1196

 Score =   234 bits (596),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 145/210 (69%), Gaps = 8/210 (4%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            E+EL GG+ +E+KFVIV  D +L WE+GDNRVLK+P  G+F +VC W+ T + L+L P +
Sbjct  118  ELELDGGQVLEYKFVIVKNDGSLSWESGDNRVLKVPNSGNFSVVCHWDATRETLDL-PQE  176

Query  182  SEGEYEAQVLA---DNGPV----VTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEK  340
               + +        DN  V    V        +Q S    QWQGK  SF+RSND    E 
Sbjct  177  VGNDDDVGDGGHERDNHDVGDDRVVGSENGAQLQKSTLGGQWQGKDASFMRSNDHGNREV  236

Query  341  NRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWI  520
             R WDTSGL    LK+VEGD+NS+NWWRKLE+VR++IV +VE   RL+AL YSAIYLKWI
Sbjct  237  GRNWDTSGLEGTALKMVEGDRNSKNWWRKLEMVREVIVGSVEREERLKALIYSAIYLKWI  296

Query  521  NTGQIPCFEDGGHHRPNRHAEISRLIFCEL  610
            NTGQIPCFEDGGHHRPNRHAEISRLIF EL
Sbjct  297  NTGQIPCFEDGGHHRPNRHAEISRLIFREL  326



>ref|XP_004152111.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004156941.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Cucumis sativus]
Length=1217

 Score =   233 bits (595),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 120/217 (55%), Positives = 154/217 (71%), Gaps = 14/217 (6%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLEL---L  172
            ++E +G E VEFKFVI+GKD ++ WE+GDNRVL+LP  G F +  QWN T + +E+   L
Sbjct  132  DLEHRGDERVEFKFVILGKDGSVSWESGDNRVLQLPKVGKFSLAYQWNKTGEVVEINETL  191

Query  173  PLDSEG--EYEAQVLADNGPVVTKDSTDPDMQ---------VSAFVEQWQGKAVSFVRSN  319
            PLD+EG  +    +L D   +   D  D D++          S FV QW+GK +SF+RSN
Sbjct  192  PLDAEGVDKGVGALLFDVNEINEGDEKDKDVEDGNGSLVDEASPFVGQWKGKEISFMRSN  251

Query  320  DQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYS  499
            +    E  R W+TS L  + L+LVEGDKN++NW RKL+VVR+L+VENV + + LE+L YS
Sbjct  252  EHHSRESERVWNTSDLKGLALQLVEGDKNARNWRRKLDVVRELLVENVHAENCLESLIYS  311

Query  500  AIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCEL  610
            AIYLKWINTGQIPCFEDGGHHRPNRHAEISR+IF EL
Sbjct  312  AIYLKWINTGQIPCFEDGGHHRPNRHAEISRIIFREL  348



>ref|XP_002872212.1| hypothetical protein ARALYDRAFT_489476 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48471.1| hypothetical protein ARALYDRAFT_489476 [Arabidopsis lyrata subsp. 
lyrata]
Length=1193

 Score =   233 bits (594),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 117/207 (57%), Positives = 142/207 (69%), Gaps = 4/207 (2%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            E+EL GG+ +E+KFVIV  D +L WE+GDNRVLK+P  G+F +VC W+ T + L+L    
Sbjct  117  ELELDGGQVLEYKFVIVKDDGSLSWESGDNRVLKVPNSGNFSVVCHWDATRETLDLPQEV  176

Query  182  SEGEYEAQVLADNGPV----VTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRK  349
               +       DN  V    V        +Q S    QWQGK  SF+RSND    E  R 
Sbjct  177  GIDDGGGGDERDNHDVGDERVMGSENGAQLQKSTLGGQWQGKDASFMRSNDHGNREVGRN  236

Query  350  WDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTG  529
            WDT+GL    LK+VEGD+NS+NWWRKLE+VR++IV +VE   RL+AL YS+IYLKWINTG
Sbjct  237  WDTTGLEGTALKMVEGDRNSKNWWRKLEMVREVIVGSVEKEERLKALIYSSIYLKWINTG  296

Query  530  QIPCFEDGGHHRPNRHAEISRLIFCEL  610
            QIPCFEDGGHHRPNRHAEISRLIF EL
Sbjct  297  QIPCFEDGGHHRPNRHAEISRLIFREL  323



>ref|XP_010424348.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Camelina sativa]
Length=1126

 Score =   232 bits (592),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 118/208 (57%), Positives = 144/208 (69%), Gaps = 5/208 (2%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLEL-LPL  178
            E+EL GG+ +E+KFVIV  D +L WE+GDNRVLKLP  G+F +VC W+ T + L+L   +
Sbjct  107  EIELDGGQVLEYKFVIVKNDGSLSWESGDNRVLKLPNSGNFSVVCHWDATRETLDLPQEV  166

Query  179  DSEGEYEAQVLADNGPV----VTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNR  346
             ++         DN  V    V        +Q S    QWQGK  SF+RSND    E  R
Sbjct  167  GNDDGGGGGDERDNHEVSDERVVGSENGGQLQKSTLGGQWQGKDASFMRSNDHGNREVGR  226

Query  347  KWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINT  526
             WDT+GL    L++VEGD+NS+NWWRKLE+VR++IV +VE   RL+AL YSAIYLKWINT
Sbjct  227  NWDTTGLEGTALRMVEGDRNSRNWWRKLEMVREVIVGSVEREERLKALIYSAIYLKWINT  286

Query  527  GQIPCFEDGGHHRPNRHAEISRLIFCEL  610
            GQIPCFEDGGHHRPNRHAEISRLIF EL
Sbjct  287  GQIPCFEDGGHHRPNRHAEISRLIFREL  314



>ref|XP_004497422.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=1180

 Score =   232 bits (591),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/207 (55%), Positives = 148/207 (71%), Gaps = 8/207 (4%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            +++ KGG+ +EFKF+IV  D  ++WE G NR+L LPA G F+ V  WN T++ +ELLPL+
Sbjct  119  DLDFKGGDHIEFKFLIVTNDGTVVWEAGQNRLLNLPAAGHFQTVATWNTTNQIMELLPLN  178

Query  182  SEGEYEAQVLADNGPVVTKD----STDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRK  349
               E + Q   D+     +D    S+  +   S FV +WQGK++SF+R+N+ +  E  R 
Sbjct  179  ---EQQQQQQQDDNLEHIEDTAASSSHSEAGPSPFVGEWQGKSISFMRTNEHQSNEAGRT  235

Query  350  WDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTG  529
            WDTS L  +PLKLV+GD+  +NWWRKL++VRD IV NVE   RLEAL Y +IYLKWINTG
Sbjct  236  WDTSDLQGLPLKLVQGDQTGRNWWRKLDIVRD-IVGNVEGEDRLEALIYCSIYLKWINTG  294

Query  530  QIPCFEDGGHHRPNRHAEISRLIFCEL  610
            QIPCFEDGGHHRPNRHAEISRLIF +L
Sbjct  295  QIPCFEDGGHHRPNRHAEISRLIFRDL  321



>ref|XP_006589801.1| PREDICTED: LOW QUALITY PROTEIN: phosphoglucan, water dikinase, 
chloroplastic-like [Glycine max]
Length=1186

 Score =   232 bits (591),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 140/199 (70%), Gaps = 9/199 (5%)
 Frame = +2

Query  14   KGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDSEGE  193
            +G   +EFKFV V KD  L+WE G+NRVLK+P  G+F  V  W+ T + LEL  LD + +
Sbjct  138  QGTLHIEFKFVTVNKDDTLVWEAGENRVLKVPGAGNFATVATWDATQETLELHSLDDDEQ  197

Query  194  YEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAE  373
             +    AD    V++    P      FV QWQGK +SF+RSN+ R  E  RKWDTSGL  
Sbjct  198  VQD---ADINESVSESEASP------FVGQWQGKPISFMRSNEHRSHETERKWDTSGLQG  248

Query  374  IPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDG  553
            +PLK V+ D++++NWWRKL++VRD+I  +++   RLEAL YSAIYLKWINTGQI CFEDG
Sbjct  249  LPLKFVQADQSARNWWRKLDIVRDIIAGSLQGEDRLEALLYSAIYLKWINTGQISCFEDG  308

Query  554  GHHRPNRHAEISRLIFCEL  610
            GHHRPNRHAEISRLIF EL
Sbjct  309  GHHRPNRHAEISRLIFREL  327



>gb|KHN37254.1| Phosphoglucan, water dikinase, chloroplastic [Glycine soja]
Length=1179

 Score =   231 bits (590),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 140/199 (70%), Gaps = 9/199 (5%)
 Frame = +2

Query  14   KGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDSEGE  193
            +G   +EFKFV V KD  L+WE G+NRVLK+P  G+F  V  W+ T + LEL  LD + +
Sbjct  136  QGTLHIEFKFVTVNKDDTLVWEAGENRVLKVPGAGNFATVATWDATQETLELHSLDDDEQ  195

Query  194  YEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAE  373
             +    AD    V++    P      FV QWQGK +SF+RSN+ R  E  RKWDTSGL  
Sbjct  196  VQD---ADINESVSESEASP------FVGQWQGKPISFMRSNEHRSHETERKWDTSGLQG  246

Query  374  IPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDG  553
            +PLK V+ D++++NWWRKL++VRD+I  +++   RLEAL YSAIYLKWINTGQI CFEDG
Sbjct  247  LPLKFVQADQSARNWWRKLDIVRDIIAGSLQGEDRLEALLYSAIYLKWINTGQISCFEDG  306

Query  554  GHHRPNRHAEISRLIFCEL  610
            GHHRPNRHAEISRLIF EL
Sbjct  307  GHHRPNRHAEISRLIFREL  325



>gb|AAU93516.1| chloroplast alpha-glucan water dikinase isoform 3 [Arabidopsis 
thaliana]
Length=1196

 Score =   231 bits (590),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 144/210 (69%), Gaps = 8/210 (4%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            E+EL GG+ +E KFVIV  D +L WE+GDNRVLK+P  G+F +VC W+ T + L+L P +
Sbjct  118  ELELDGGQVLECKFVIVKNDGSLSWESGDNRVLKVPNSGNFSVVCHWDATRETLDL-PQE  176

Query  182  SEGEYEAQVLA---DNGPV----VTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEK  340
               + +        DN  V    V        +Q S    QWQGK  SF+RSND    E 
Sbjct  177  VGNDDDVGDGGHERDNHDVGDDRVVGSENGAQLQKSTLGGQWQGKDASFMRSNDHGNREV  236

Query  341  NRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWI  520
             R WDTSGL    LK+VEGD+NS+NWWRKLE+VR++IV +VE   RL+AL YSAIYLKWI
Sbjct  237  GRNWDTSGLEGTALKMVEGDRNSKNWWRKLEMVREVIVGSVEREERLKALIYSAIYLKWI  296

Query  521  NTGQIPCFEDGGHHRPNRHAEISRLIFCEL  610
            NTGQIPCFEDGGHHRPNRHAEISRLIF EL
Sbjct  297  NTGQIPCFEDGGHHRPNRHAEISRLIFREL  326



>ref|XP_004497421.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=1212

 Score =   231 bits (590),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/207 (55%), Positives = 148/207 (71%), Gaps = 8/207 (4%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            +++ KGG+ +EFKF+IV  D  ++WE G NR+L LPA G F+ V  WN T++ +ELLPL+
Sbjct  119  DLDFKGGDHIEFKFLIVTNDGTVVWEAGQNRLLNLPAAGHFQTVATWNTTNQIMELLPLN  178

Query  182  SEGEYEAQVLADNGPVVTKD----STDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRK  349
               E + Q   D+     +D    S+  +   S FV +WQGK++SF+R+N+ +  E  R 
Sbjct  179  ---EQQQQQQQDDNLEHIEDTAASSSHSEAGPSPFVGEWQGKSISFMRTNEHQSNEAGRT  235

Query  350  WDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTG  529
            WDTS L  +PLKLV+GD+  +NWWRKL++VRD IV NVE   RLEAL Y +IYLKWINTG
Sbjct  236  WDTSDLQGLPLKLVQGDQTGRNWWRKLDIVRD-IVGNVEGEDRLEALIYCSIYLKWINTG  294

Query  530  QIPCFEDGGHHRPNRHAEISRLIFCEL  610
            QIPCFEDGGHHRPNRHAEISRLIF +L
Sbjct  295  QIPCFEDGGHHRPNRHAEISRLIFRDL  321



>ref|XP_006286926.1| hypothetical protein CARUB_v10000070mg [Capsella rubella]
 gb|EOA19824.1| hypothetical protein CARUB_v10000070mg [Capsella rubella]
Length=1195

 Score =   231 bits (589),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 143/207 (69%), Gaps = 5/207 (2%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVT----DKPLEL  169
            E+ L GG+ +E+KFVIV  D +L WE+GDNRVLKLP  G+F +VC W+ T    D P E+
Sbjct  120  ELNLDGGQVLEYKFVIVKDDGSLSWESGDNRVLKLPNSGNFSVVCHWDATRETLDLPHEV  179

Query  170  LPLDSEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRK  349
               D  GE        +  VV  ++    +Q S    QWQGK  SF+RSND    E  R 
Sbjct  180  GGNDGGGEERGNHDVGDERVVGSEN-GAQLQKSTLGGQWQGKDASFMRSNDHGNREVGRN  238

Query  350  WDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTG  529
            W+T+GL    LK+VEGD+NS+NWWRKLE+VR++IV  VE   +L+AL YSAIYLKWINTG
Sbjct  239  WNTTGLEGTALKMVEGDRNSKNWWRKLEMVREVIVGTVEREEKLKALIYSAIYLKWINTG  298

Query  530  QIPCFEDGGHHRPNRHAEISRLIFCEL  610
            QIPCFEDGGHHRPNRHAEISRLIF EL
Sbjct  299  QIPCFEDGGHHRPNRHAEISRLIFREL  325



>ref|XP_009111699.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Brassica 
rapa]
Length=1184

 Score =   229 bits (585),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 144/203 (71%), Gaps = 3/203 (1%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            E+EL GGE +EFKFV+V KD +L WE+GDNRVLKLP  GSF +VC W+ T + L+L  +D
Sbjct  119  ELELSGGEALEFKFVVVKKDGSLSWESGDNRVLKLPKSGSFSVVCHWDATGETLDLPLVD  178

Query  182  SEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTS  361
             +G  E     D+  V   D+    ++ S    QWQGK  SF+RSN+    E  R WD S
Sbjct  179  DDGGGEES--GDSHDVGGGDN-GAQLRKSTLGGQWQGKDASFMRSNEHGNREVGRNWDAS  235

Query  362  GLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPC  541
            GL    LK+VEGD++S+NW +KLE+V ++IV +VE   RL+AL YSA+YLKWINTGQIPC
Sbjct  236  GLKGSALKMVEGDRSSRNWRKKLELVSEVIVGSVEREERLKALIYSAVYLKWINTGQIPC  295

Query  542  FEDGGHHRPNRHAEISRLIFCEL  610
            FEDGGHHRPN HAEISRLIF EL
Sbjct  296  FEDGGHHRPNHHAEISRLIFREL  318



>gb|KEH27294.1| phosphoglucan, water dikinase [Medicago truncatula]
Length=1202

 Score =   228 bits (582),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/213 (53%), Positives = 145/213 (68%), Gaps = 11/213 (5%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            +     G+ +EFKF+IV +D  L WE+GDNRVL LP  G F+ + +WN T + +ELLPL+
Sbjct  132  DFHFNAGDHLEFKFIIVHQDGTLHWESGDNRVLNLPNAGHFQTIAKWNKTHQTMELLPLN  191

Query  182  SEGEYEAQVLADNGPVVTKDSTDPDMQVSA----------FVEQWQGKAVSFVRSNDQRG  331
               + + Q    +      D  + +   SA          FV +WQGK+VSF+RSND + 
Sbjct  192  FNEQQQHQSHDHDQNNNNNDDDEKEAAASAPLSDAAGPSPFVGEWQGKSVSFMRSNDHQT  251

Query  332  MEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYL  511
             E  R WDTSG+  +PLK V+GD++++NWWRKL++VRD IV +V    +LEAL YS+IYL
Sbjct  252  HETQRTWDTSGIQGLPLKFVQGDQSARNWWRKLDLVRD-IVGSVHGEDQLEALIYSSIYL  310

Query  512  KWINTGQIPCFEDGGHHRPNRHAEISRLIFCEL  610
            KWINTGQIPCFEDGGHHRPNRHAEISRLIF EL
Sbjct  311  KWINTGQIPCFEDGGHHRPNRHAEISRLIFREL  343



>emb|CDX87051.1| BnaC09g03660D [Brassica napus]
Length=1182

 Score =   228 bits (581),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 120/209 (57%), Positives = 144/209 (69%), Gaps = 16/209 (8%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPL-  178
            E+EL GGE +EFKFV+V KD +L WE+GDNRVLKLP  GSF +VC W+ T + L+L PL 
Sbjct  123  ELELSGGEALEFKFVVVKKDGSLSWESGDNRVLKLPDSGSFSVVCHWDATGEALDL-PLV  181

Query  179  --DSEGEYEAQ---VLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKN  343
              D+ GE       V  DNG  + K         S    QWQGK  SF+RSN+    E  
Sbjct  182  DDDAGGEESGDSYDVGGDNGVQLRK---------STLGGQWQGKDASFMRSNEHGSREVG  232

Query  344  RKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWIN  523
            R WD SGL    LK+VEGD++S+NW +KLE+V ++IV +VE   RL+AL YSA+YLKWIN
Sbjct  233  RNWDASGLEGSALKMVEGDRSSRNWRKKLELVSEVIVGSVEREERLKALIYSAVYLKWIN  292

Query  524  TGQIPCFEDGGHHRPNRHAEISRLIFCEL  610
            TGQIPCFEDGGHHRPN HAEISRLIF EL
Sbjct  293  TGQIPCFEDGGHHRPNHHAEISRLIFREL  321



>emb|CDY19771.1| BnaA09g04240D [Brassica napus]
Length=1179

 Score =   227 bits (578),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 144/203 (71%), Gaps = 3/203 (1%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            E+EL GGE +EFKFV+V KD +L WE+GDNRVLKLP  GSF +VC W+ T + L+L  + 
Sbjct  119  ELELNGGEALEFKFVVVKKDGSLSWESGDNRVLKLPKSGSFSVVCHWDATGETLDLPLVG  178

Query  182  SEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTS  361
             +G  E    +D+  V   D+    ++ S    QWQGK  SF+RSN+    E  R WD S
Sbjct  179  DDGGGEES--SDSHDVGGGDN-GAQLRKSTLGGQWQGKDASFMRSNEHGNREVGRNWDAS  235

Query  362  GLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPC  541
            GL    LK+VEGD++S+NW +KLE+V ++IV +VE   RL+AL YSA+YLKWINTGQIPC
Sbjct  236  GLEGSALKMVEGDRSSRNWRKKLELVSEVIVGSVEREERLKALIYSAVYLKWINTGQIPC  295

Query  542  FEDGGHHRPNRHAEISRLIFCEL  610
            FEDGGHHRPN HAEISRLIF EL
Sbjct  296  FEDGGHHRPNHHAEISRLIFREL  318



>ref|XP_008454007.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Cucumis melo]
Length=1161

 Score =   226 bits (575),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 125/241 (52%), Positives = 157/241 (65%), Gaps = 38/241 (16%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDK--------  157
            ++E +G E VEFKFVI+GKD ++LWE+GDNRVL+LP  G F +V +WN T +        
Sbjct  56   DLEHRGDERVEFKFVILGKDGSVLWESGDNRVLQLPKVGKFSLVYKWNKTGEAVDMLPLK  115

Query  158  ----------PL---------ELLPLDSEG---EYEAQVLADN----GPVVTKDSTDPDM  259
                      PL         E LPLD+EG   E  A +  +N    G    KD  D + 
Sbjct  116  VEEINGDGTLPLDAKAIGERNETLPLDAEGVNKEVGASLFDENEINEGDEKNKDVEDGNG  175

Query  260  ----QVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRK  427
                + S FV QW+GK +SF+RSN+    E  R W+TS L  + L+LVEGDKN++NW RK
Sbjct  176  SLVDEASPFVGQWKGKEISFMRSNEHHNRESERIWNTSDLKGLALQLVEGDKNARNWRRK  235

Query  428  LEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCE  607
            L+VVR+L+VENV + + LE+L YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISR+IF E
Sbjct  236  LDVVRELLVENVHAENCLESLIYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRIIFRE  295

Query  608  L  610
            L
Sbjct  296  L  296



>ref|XP_009129923.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Brassica rapa]
Length=1156

 Score =   225 bits (574),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 142/203 (70%), Gaps = 12/203 (6%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            E+ L G + +EFKFVIV  D +L WE+GDNRVL LP  G+F +VC W+ T + L+++   
Sbjct  115  ELHLNGDQALEFKFVIVKTDGSLSWESGDNRVLNLPKSGAFSVVCHWDATREALDVV---  171

Query  182  SEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTS  361
            S+ E      ++NG  + K         SA   +W+GK  SF+ SN+    E  R WDTS
Sbjct  172  SQEEVGEGESSENGAQLRK---------SALAGEWKGKEASFMSSNEHGDREVGRSWDTS  222

Query  362  GLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPC  541
            GL    LK+VEGD+NS+NWWRKLE+VR++IV +VE   RL+AL YSA+YLKWINTGQIPC
Sbjct  223  GLEGPGLKMVEGDRNSRNWWRKLEMVREVIVGSVEREERLKALIYSAVYLKWINTGQIPC  282

Query  542  FEDGGHHRPNRHAEISRLIFCEL  610
            FEDGGHHRPNRHAEISRLIF EL
Sbjct  283  FEDGGHHRPNRHAEISRLIFREL  305



>ref|XP_008454006.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Cucumis melo]
Length=1237

 Score =   225 bits (573),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 125/241 (52%), Positives = 157/241 (65%), Gaps = 38/241 (16%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDK--------  157
            ++E +G E VEFKFVI+GKD ++LWE+GDNRVL+LP  G F +V +WN T +        
Sbjct  132  DLEHRGDERVEFKFVILGKDGSVLWESGDNRVLQLPKVGKFSLVYKWNKTGEAVDMLPLK  191

Query  158  ----------PL---------ELLPLDSEG---EYEAQVLADN----GPVVTKDSTDPDM  259
                      PL         E LPLD+EG   E  A +  +N    G    KD  D + 
Sbjct  192  VEEINGDGTLPLDAKAIGERNETLPLDAEGVNKEVGASLFDENEINEGDEKNKDVEDGNG  251

Query  260  ----QVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRK  427
                + S FV QW+GK +SF+RSN+    E  R W+TS L  + L+LVEGDKN++NW RK
Sbjct  252  SLVDEASPFVGQWKGKEISFMRSNEHHNRESERIWNTSDLKGLALQLVEGDKNARNWRRK  311

Query  428  LEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCE  607
            L+VVR+L+VENV + + LE+L YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISR+IF E
Sbjct  312  LDVVRELLVENVHAENCLESLIYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRIIFRE  371

Query  608  L  610
            L
Sbjct  372  L  372



>emb|CDY05529.1| BnaA02g31620D [Brassica napus]
Length=1312

 Score =   225 bits (574),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 142/203 (70%), Gaps = 12/203 (6%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            E+ L G + +EFKFVIV  D +L WE+GDNRVL LP  G+F +VC W+ T + L+++   
Sbjct  115  ELHLNGDQALEFKFVIVKTDGSLSWESGDNRVLNLPKSGAFSVVCHWDATREALDVV---  171

Query  182  SEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTS  361
            S+ E      ++NG  + K         SA   +W+GK  SF+ SN+    E  R WDTS
Sbjct  172  SQEEVGEGESSENGAQLRK---------SALAGEWKGKEASFMSSNEHGDREVGRSWDTS  222

Query  362  GLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPC  541
            GL    LK+VEGD+NS+NWWRKLE+VR++IV +VE   RL+AL YSA+YLKWINTGQIPC
Sbjct  223  GLEGPGLKMVEGDRNSRNWWRKLEMVREVIVGSVEREERLKALIYSAVYLKWINTGQIPC  282

Query  542  FEDGGHHRPNRHAEISRLIFCEL  610
            FEDGGHHRPNRHAEISRLIF EL
Sbjct  283  FEDGGHHRPNRHAEISRLIFREL  305



>ref|XP_008662597.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Zea mays]
Length=287

 Score =   211 bits (536),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 140/219 (64%), Gaps = 16/219 (7%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIV-GKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELL--  172
            ++++ G   +EFKFVI+  K K+ +WE GDNRV+ LP  GSF M C WN T +PL+LL  
Sbjct  34   QLDVPGEALLEFKFVIILNKGKDKIWEDGDNRVVNLPKNGSFDMPCHWNKTKEPLDLLGS  93

Query  173  -----PLDSEGEYEAQVLADN------GPVVTKDSTD--PDMQVSAFVEQWQGKAVSFVR  313
                   D+E   E   L++N      G +      D  P  + S    QWQG    F+R
Sbjct  94   SEIKLSGDTEVIGEDAKLSENIALEEMGSICNAGVGDLTPKHESSTLGGQWQGSDTVFMR  153

Query  314  SNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALT  493
            SN+    E  RKWD +GL  + LKLVEGDK S+NWWRKLE+VR L+ E V+    LEALT
Sbjct  154  SNEHHNTENCRKWDMTGLDAVSLKLVEGDKASRNWWRKLELVRVLLSEYVQDQSHLEALT  213

Query  494  YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCEL  610
            YSAIYLKWI TGQIPCFEDGGHHRPN+HAEISR IF E+
Sbjct  214  YSAIYLKWIYTGQIPCFEDGGHHRPNKHAEISRQIFGEI  252



>gb|KGN53052.1| hypothetical protein Csa_4G012480 [Cucumis sativus]
Length=1241

 Score =   224 bits (571),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 122/241 (51%), Positives = 155/241 (64%), Gaps = 38/241 (16%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDK-----PLE  166
            ++E +G E VEFKFVI+GKD ++ WE+GDNRVL+LP  G F +  QWN T +     PL+
Sbjct  132  DLEHRGDERVEFKFVILGKDGSVSWESGDNRVLQLPKVGKFSLAYQWNKTGEVVEMLPLK  191

Query  167  L----------------------LPLDSEG--EYEAQVLADNGPVVTKDSTDPDMQ----  262
            L                      LPLD+EG  +    +L D   +   D  D D++    
Sbjct  192  LEEINGDGTLPLDAKAIEERNETLPLDAEGVDKGVGALLFDVNEINEGDEKDKDVEDGNG  251

Query  263  -----VSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRK  427
                  S FV QW+GK +SF+RSN+    E  R W+TS L  + L+LVEGDKN++NW RK
Sbjct  252  SLVDEASPFVGQWKGKEISFMRSNEHHSRESERVWNTSDLKGLALQLVEGDKNARNWRRK  311

Query  428  LEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCE  607
            L+VVR+L+VENV + + LE+L YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISR+IF E
Sbjct  312  LDVVRELLVENVHAENCLESLIYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRIIFRE  371

Query  608  L  610
            L
Sbjct  372  L  372



>gb|ABG21981.1| chloroplast alpha-glucan water dikinase isoform 3, putative, 
expressed [Oryza sativa Japonica Group]
Length=728

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 116/222 (52%), Positives = 139/222 (63%), Gaps = 21/222 (9%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIV---GKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELL  172
            +++L G   VEFKFVI    GKDK  +WE G+NRV++LP  G F +VC WN T++PLELL
Sbjct  119  QLKLPGETLVEFKFVIFLVGGKDK--IWEDGNNRVVELPKDGKFDIVCHWNRTEEPLELL  176

Query  173  ---PLDSEGEYEAQVLADNGPVVT-------------KDSTDPDMQVSAFVEQWQGKAVS  304
                 +  GE E     D    VT                  P+ + S F  QWQG    
Sbjct  177  GTPKFELVGEAEKNTGEDASASVTFAPEKVQDISVVENGDPAPEAESSKFGGQWQGSKTV  236

Query  305  FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  484
            F+RSN+    E +R WDT+GL  I LKLVEGDK S+NWWRKLEVVR ++ E+ +   RL 
Sbjct  237  FMRSNEHLNKEADRMWDTTGLDGIALKLVEGDKASRNWWRKLEVVRGILSESFDDQSRLG  296

Query  485  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCEL  610
            AL YSAIYLKWI TGQI CFEDGGHHRPN+HAEISR IF EL
Sbjct  297  ALVYSAIYLKWIYTGQISCFEDGGHHRPNKHAEISRQIFREL  338



>ref|XP_002453659.1| hypothetical protein SORBIDRAFT_04g010020 [Sorghum bicolor]
 gb|EES06635.1| hypothetical protein SORBIDRAFT_04g010020 [Sorghum bicolor]
Length=1212

 Score =   214 bits (544),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 115/222 (52%), Positives = 139/222 (63%), Gaps = 21/222 (9%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIV---GKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELL  172
            +++L G   +EFKFV+    GKDK  +WE GDNRV+ LP  GSF M C WN T +PL LL
Sbjct  127  QLDLPGETLLEFKFVVFLNRGKDK--IWEDGDNRVVNLPKNGSFDMACHWNKTKEPLNLL  184

Query  173  PL-------DSEGEYEAQV-------LADNGPVVTKDSTD--PDMQVSAFVEQWQGKAVS  304
                     D+E E +          L + G +      D  P ++ S     WQG    
Sbjct  185  GTSEIKLSGDTEKEKDEDAKLSRNIALEEMGNISNAGDGDLTPKLESSTLGGLWQGSDTV  244

Query  305  FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  484
            F+RSN+ R  E +RKWD +GL  + LKLVEGDK S+NWWRKLE+VR L+ E V     LE
Sbjct  245  FMRSNEHRNNESDRKWDMTGLDAVSLKLVEGDKASRNWWRKLELVRGLVSEYVHDQSHLE  304

Query  485  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCEL  610
            ALTYSAIYLKWI TGQIPCFEDGGHHRPN+HAEISR IF E+
Sbjct  305  ALTYSAIYLKWIYTGQIPCFEDGGHHRPNKHAEISRQIFREI  346



>ref|NP_001066613.1| Os12g0297500 [Oryza sativa Japonica Group]
 sp|Q2QTC2.2|PWD_ORYSJ RecName: Full=Phosphoglucan, water dikinase, chloroplastic; Flags: 
Precursor [Oryza sativa Japonica Group]
 gb|ABA97816.2| chloroplast alpha-glucan water dikinase isoform 3, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF29632.1| Os12g0297500 [Oryza sativa Japonica Group]
Length=1206

 Score =   212 bits (540),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 116/222 (52%), Positives = 139/222 (63%), Gaps = 21/222 (9%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIV---GKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELL  172
            +++L G   VEFKFVI    GKDK  +WE G+NRV++LP  G F +VC WN T++PLELL
Sbjct  119  QLKLPGETLVEFKFVIFLVGGKDK--IWEDGNNRVVELPKDGKFDIVCHWNRTEEPLELL  176

Query  173  ---PLDSEGEYEAQVLADNGPVVT-------------KDSTDPDMQVSAFVEQWQGKAVS  304
                 +  GE E     D    VT                  P+ + S F  QWQG    
Sbjct  177  GTPKFELVGEAEKNTGEDASASVTFAPEKVQDISVVENGDPAPEAESSKFGGQWQGSKTV  236

Query  305  FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLE  484
            F+RSN+    E +R WDT+GL  I LKLVEGDK S+NWWRKLEVVR ++ E+ +   RL 
Sbjct  237  FMRSNEHLNKEADRMWDTTGLDGIALKLVEGDKASRNWWRKLEVVRGILSESFDDQSRLG  296

Query  485  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCEL  610
            AL YSAIYLKWI TGQI CFEDGGHHRPN+HAEISR IF EL
Sbjct  297  ALVYSAIYLKWIYTGQISCFEDGGHHRPNKHAEISRQIFREL  338



>ref|XP_006663965.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Oryza brachyantha]
Length=1206

 Score =   210 bits (535),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 144/224 (64%), Gaps = 26/224 (12%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKD-KNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPL  178
            +++L G   VEFKFVI  K  K+  WE G+NRV++LP  G + +VC WN T +PLELL  
Sbjct  120  QLKLPGETLVEFKFVIFLKGIKDKTWEDGNNRVVELPKDGKYDIVCHWNRTKEPLELL--  177

Query  179  DSEGEYEAQVLADNGPVVTKDST-----------------DPDMQ---VSAFVEQWQGKA  298
               G  + +++ + G    +D+T                 D D+Q    S F  QWQG  
Sbjct  178  ---GTPKLELVGEAGKNSREDATASVNIVPEDAENISVDGDVDLQEADSSTFSGQWQGSE  234

Query  299  VSFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHR  478
              F+RS++ R  E +R WDT+GL EI LKLVEGDK S+NWWRKLEVVR ++ E+ +   R
Sbjct  235  TVFMRSSEHRNKETDRMWDTTGLKEIALKLVEGDKASRNWWRKLEVVRGILSESYDDQSR  294

Query  479  LEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCEL  610
            LEAL Y+AIYLKWI TGQ+ CFEDGGHHRPN+HAEISR IF +L
Sbjct  295  LEALIYAAIYLKWIYTGQVACFEDGGHHRPNKHAEISRQIFRQL  338



>ref|XP_004952076.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Setaria italica]
Length=1206

 Score =   207 bits (526),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 107/217 (49%), Positives = 144/217 (66%), Gaps = 14/217 (6%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKD-KNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELL--  172
            +++L G   +EFKFVI  K+ K  +WE GDNRV+ LP  G+F ++C WN T + L+LL  
Sbjct  120  QLDLPGETLMEFKFVIFLKEGKEKVWEDGDNRVVNLPKDGAFDILCHWNRTKESLDLLLG  179

Query  173  ----PLDSEGEYE-AQVLADNGPVVTKDSTDPDMQVSAFVEQ------WQGKAVSFVRSN  319
                 L  E + E  +    +G +  +++   D  ++  +E       WQG    F+RSN
Sbjct  180  TPEVKLSGEADEEIGEGATVSGNIAVEEAVAGDGYLTLELESSKLGGLWQGSDAVFMRSN  239

Query  320  DQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYS  499
            +    +  RKWDT+GL  +PL+LVEGDK S+NWWRKLE++R L+ ++V+   RLEALTYS
Sbjct  240  EHGNKDSERKWDTTGLGAVPLQLVEGDKVSRNWWRKLELIRGLLSKSVDDQSRLEALTYS  299

Query  500  AIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCEL  610
            AIYLKWI TGQIPCFEDGGHHRPN+HAEISR IF E+
Sbjct  300  AIYLKWIYTGQIPCFEDGGHHRPNKHAEISREIFREI  336



>ref|XP_010228078.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Brachypodium 
distachyon]
Length=1182

 Score =   205 bits (522),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 109/216 (50%), Positives = 140/216 (65%), Gaps = 22/216 (10%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIV---GKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELL  172
            ++EL     VEFKFVI+   GK K   WE G+NRV++LP GG+F +VC WN+T++PL+L 
Sbjct  118  QLELPAETLVEFKFVIILEGGKGKT--WEDGNNRVIELPKGGTFDIVCHWNMTEEPLDL-  174

Query  173  PLDSEGEYEAQVLADNGPVVTKDSTD----------PDMQVSAFVEQWQGKAVSFVRSND  322
                     ++V  ++  +  K+  D          P+   S F  QWQG    F+RSN+
Sbjct  175  ------SGTSKVHKESRNITPKEVRDVSVTGNGDLAPETDSSNFGGQWQGSDAVFMRSNE  228

Query  323  QRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSA  502
                  +R WDTSGL  + LKLVEGDK S+NWW+KLE+VR+L+ E V+   RLEAL  SA
Sbjct  229  HHNKSSDRMWDTSGLGGMTLKLVEGDKVSRNWWKKLELVRELLSEPVDDQSRLEALICSA  288

Query  503  IYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCEL  610
            IYLKWI TGQI CFEDGGH+RPN+HAEISR IF EL
Sbjct  289  IYLKWIYTGQISCFEDGGHYRPNKHAEISRQIFREL  324



>ref|XP_006421074.1| hypothetical protein CICLE_v10004968mg [Citrus clementina]
 gb|ESR34314.1| hypothetical protein CICLE_v10004968mg [Citrus clementina]
Length=353

 Score =   192 bits (487),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 125/173 (72%), Gaps = 11/173 (6%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            ++E KGGE +E+KFVIV  DK+  WE G NR+LKLP GGSF++VC WN T + ++LL L+
Sbjct  133  DLEFKGGESIEYKFVIVRNDKSKAWEAGANRILKLPKGGSFEIVCHWNKTGEAVDLLHLE  192

Query  182  SEGEYEAQVLADNGPVVTKDSTDPDMQV--SAFVEQWQGKAVSFVRSNDQRGMEKNRKWD  355
             +         DNG VVT  + D  ++V  S FV QWQGK+ SF+R++D    E  RKWD
Sbjct  193  ED---------DNGSVVTDAAPDALLEVGTSPFVGQWQGKSASFMRADDHWNREMERKWD  243

Query  356  TSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLK  514
            TSGL  + LKLVEGD+ ++NWWRKLEVVR+LIVEN++S  RLEAL YSAIYLK
Sbjct  244  TSGLQGLTLKLVEGDQRARNWWRKLEVVRELIVENLQSDERLEALIYSAIYLK  296



>gb|EMS54440.1| Phosphoglucan, water dikinase, chloroplastic [Triticum urartu]
Length=1059

 Score =   200 bits (509),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 137/208 (66%), Gaps = 9/208 (4%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKN-LLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLE---L  169
            ++EL G   VEFKFVIV K  N   WE GDNR ++LP GG+  +VC W+ T++PL     
Sbjct  70   QLELPGEAAVEFKFVIVSKGGNDKTWEGGDNRAIQLPKGGTLDIVCNWDKTEEPLGPSGT  129

Query  170  LPLDSEGEYEA-QVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNR  346
              +D   ++ A Q + D    V+  +  P+   S+F  QWQG    F+RSN+      +R
Sbjct  130  PKVDRAPKHAAPQTVGD----VSAANLAPETDSSSFGGQWQGSEAVFMRSNEHGNKSSDR  185

Query  347  KWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINT  526
             WDT+GL  + LKLVEGDK+S+NWW+KL++VR L+ E V+   RLEAL  SAIYLKWI T
Sbjct  186  MWDTAGLGGMALKLVEGDKSSKNWWQKLDLVRRLVSEPVDDQSRLEALICSAIYLKWIYT  245

Query  527  GQIPCFEDGGHHRPNRHAEISRLIFCEL  610
            GQI C EDGGH+RPN+HAEISR IF EL
Sbjct  246  GQISCSEDGGHYRPNKHAEISRQIFREL  273



>gb|EMT02873.1| Phosphoglucan, water dikinase, chloroplastic [Aegilops tauschii]
Length=998

 Score =   199 bits (507),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 129/204 (63%), Gaps = 1/204 (0%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKN-LLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPL  178
            ++EL     VEFKFVIV K  N   WE GDNR ++LP GG+  + C W+ T++PL     
Sbjct  68   QLELPSEALVEFKFVIVSKGGNDKTWEGGDNRAIQLPKGGTLDIACNWDKTEEPLGPSGT  127

Query  179  DSEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDT  358
                     V+      V+  S+ P    S+F  QWQG    F+RSN+      +R WDT
Sbjct  128  PKVDRAPKHVVPQTAGDVSAASSAPGTDSSSFGGQWQGSEAVFMRSNEHGNKSSDRMWDT  187

Query  359  SGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIP  538
            +GL  + LKLVEGDK+S+NWW+KL++VR L+ E V+   RLEAL  SAIYLKWI TGQI 
Sbjct  188  AGLGGMALKLVEGDKSSKNWWQKLDLVRRLVSEPVDDQSRLEALICSAIYLKWIYTGQIS  247

Query  539  CFEDGGHHRPNRHAEISRLIFCEL  610
            C EDGGH+RPN+HAEISR IF EL
Sbjct  248  CSEDGGHYRPNKHAEISRQIFREL  271



>gb|EEE53074.1| hypothetical protein OsJ_35828 [Oryza sativa Japonica Group]
Length=1188

 Score =   200 bits (509),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 116/242 (48%), Positives = 139/242 (57%), Gaps = 41/242 (17%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIV---GKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELL  172
            +++L G   VEFKFVI    GKDK  +WE G+NRV++LP  G F +VC WN T++PLELL
Sbjct  81   QLKLPGETLVEFKFVIFLVGGKDK--IWEDGNNRVVELPKDGKFDIVCHWNRTEEPLELL  138

Query  173  ---PLDSEGEYEAQVLADNGPVVT-------------KDSTDPDMQVSAFVEQWQGKAVS  304
                 +  GE E     D    VT                  P+ + S F  QWQG    
Sbjct  139  GTPKFELVGEAEKNTGEDASASVTFAPEKVQDISVVENGDPAPEAESSKFGGQWQGSKTV  198

Query  305  FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRK-------------------  427
            F+RSN+    E +R WDT+GL  I LKLVEGDK S+NWWRK                   
Sbjct  199  FMRSNEHLNKEADRMWDTTGLDGIALKLVEGDKASRNWWRKECTLCSDPASKALSYNASV  258

Query  428  -LEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFC  604
             LEVVR ++ E+ +   RL AL YSAIYLKWI TGQI CFEDGGHHRPN+HAEISR IF 
Sbjct  259  LLEVVRGILSESFDDQSRLGALVYSAIYLKWIYTGQISCFEDGGHHRPNKHAEISRQIFR  318

Query  605  EL  610
            EL
Sbjct  319  EL  320



>gb|EEC69133.1| hypothetical protein OsI_38056 [Oryza sativa Indica Group]
Length=1191

 Score =   200 bits (509),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 116/242 (48%), Positives = 139/242 (57%), Gaps = 41/242 (17%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIV---GKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELL  172
            +++L G   VEFKFVI    GKDK  +WE G+NRV++LP  G F +VC WN T++PLELL
Sbjct  84   QLKLPGETLVEFKFVIFLVGGKDK--IWEDGNNRVVELPKDGKFDIVCHWNRTEEPLELL  141

Query  173  ---PLDSEGEYEAQVLADNGPVVT-------------KDSTDPDMQVSAFVEQWQGKAVS  304
                 +  GE E     D    VT                   + + S FV QWQG    
Sbjct  142  GTPKFELVGEAEKNTGEDASASVTFAPEKVQDISVVENGDLASEAESSKFVGQWQGSKTV  201

Query  305  FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRK-------------------  427
            F+RSN+    E +R WDT+GL  I LKLVEGDK S+NWWRK                   
Sbjct  202  FMRSNEHLNKEADRMWDTTGLDGIALKLVEGDKASRNWWRKECTLCSDPASKALSYNASV  261

Query  428  -LEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFC  604
             LEVVR ++ E+ +   RL AL YSAIYLKWI TGQI CFEDGGHHRPN+HAEISR IF 
Sbjct  262  LLEVVRGILSESFDDQSRLGALVYSAIYLKWIYTGQISCFEDGGHHRPNKHAEISRQIFR  321

Query  605  EL  610
            EL
Sbjct  322  EL  323



>ref|XP_002973212.1| hypothetical protein SELMODRAFT_99378 [Selaginella moellendorffii]
 gb|EFJ25586.1| hypothetical protein SELMODRAFT_99378 [Selaginella moellendorffii]
Length=1104

 Score =   189 bits (481),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 100/208 (48%), Positives = 134/208 (64%), Gaps = 10/208 (5%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            ++E   G+  EFK+VIV  D  L WE G NRVL +P+GGS ++V QW   D  +      
Sbjct  54   DIEASPGDRAEFKYVIVAGDGRLTWEEGPNRVLDVPSGGS-EIVSQWENPDLVVTTNGAA  112

Query  182  SEGEYEAQV-----LADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNR  346
            +E   EA V       +        S+D DM   +F + WQGK V+F+++N+    +   
Sbjct  113  AEAHVEAPVHEKKDKKEKAKETVTASSDGDM---SFSQGWQGKNVAFMKANEHTSRQGG-  168

Query  347  KWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINT  526
            KW+T+GL    L++VEGDK S NWWRKLEVVRDL+ +++    RL+AL YS+ YLKWI+T
Sbjct  169  KWETAGLEGAALRIVEGDKKSGNWWRKLEVVRDLLTDDLGKADRLDALVYSSTYLKWIST  228

Query  527  GQIPCFEDGGHHRPNRHAEISRLIFCEL  610
            GQI CFEDGGH+RPN+HAEISR+IF EL
Sbjct  229  GQIQCFEDGGHYRPNKHAEISRMIFREL  256



>gb|AAC26245.1| contains similarity glycosyl hydrolases [Arabidopsis thaliana]
Length=491

 Score =   182 bits (461),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 121/210 (58%), Gaps = 37/210 (18%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            E+EL GG+ +E+KFVIV  D +L WE+GDNRVLK+P  G+F +VC W+ T + L+L P +
Sbjct  118  ELELDGGQVLEYKFVIVKNDGSLSWESGDNRVLKVPNSGNFSVVCHWDATRETLDL-PQE  176

Query  182  SEGEYEAQVLA---DNGPV----VTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEK  340
               + +        DN  V    V        +Q S    QWQGK  SF+RSND    E 
Sbjct  177  VGNDDDVGDGGHERDNHDVGDDRVVGSENGAQLQKSTLGGQWQGKDASFMRSNDHGNREV  236

Query  341  NRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWI  520
             R WDTSGL    LK+VEGD+NS+NWWR                             KWI
Sbjct  237  GRNWDTSGLEGTALKMVEGDRNSKNWWR-----------------------------KWI  267

Query  521  NTGQIPCFEDGGHHRPNRHAEISRLIFCEL  610
            NTGQIPCFEDGGHHRPNRHAEISRLIF EL
Sbjct  268  NTGQIPCFEDGGHHRPNRHAEISRLIFREL  297



>ref|XP_002976638.1| hypothetical protein SELMODRAFT_105597 [Selaginella moellendorffii]
 gb|EFJ22307.1| hypothetical protein SELMODRAFT_105597 [Selaginella moellendorffii]
Length=1101

 Score =   185 bits (469),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 133/208 (64%), Gaps = 10/208 (5%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            ++E   G+  EFK+VIV  D  L WE G NRVL +P+GGS ++V QW   D  +      
Sbjct  54   DIEASPGDRAEFKYVIVAGDGRLTWEEGPNRVLDVPSGGS-EIVSQWENPDLVVTTNGAS  112

Query  182  SEGEYEAQV-----LADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNR  346
            +E   EA V       +        S+D DM   +F + WQGK V+F+++N+    +   
Sbjct  113  AEAHVEAPVHEKKDKKEKAKETVTASSDGDM---SFSQGWQGKNVAFMKANEHTSRQGG-  168

Query  347  KWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINT  526
            KW+T+GL    L++VEGDK S NWWRKLEVVR+L+ +++    RL+AL YS+ YLKWI+T
Sbjct  169  KWETAGLDGAVLRIVEGDKKSGNWWRKLEVVRELLTDDLGKADRLDALVYSSTYLKWIST  228

Query  527  GQIPCFEDGGHHRPNRHAEISRLIFCEL  610
            GQI CFEDGGH+RP +HAEISR+IF EL
Sbjct  229  GQIQCFEDGGHYRPKKHAEISRMIFREL  256



>ref|XP_001752167.1| predicted protein [Physcomitrella patens]
 gb|EDQ82900.1| predicted protein [Physcomitrella patens]
Length=1094

 Score =   166 bits (419),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 91/205 (44%), Positives = 123/205 (60%), Gaps = 13/205 (6%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            ++E   GE VE+K +IV  D  ++WE G NR + LP  G F++V  W  T +     P  
Sbjct  57   DLEGDSGETVEYKHIIVTHDGGVIWEEGPNRTISLPDEGDFELVTHWGCTQED----PQF  112

Query  182  SEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQ--WQGKAVSFVRSNDQRGMEKNRKWD  355
              G       +DNG     +        S+ VE+  WQG +V      D++  E++ KWD
Sbjct  113  QGGRSPKSHGSDNGHAGKAEEQTEGKAESSKVEEAEWQGASV-----KDRK--ERSGKWD  165

Query  356  TSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQI  535
            T+GL    L++VEGDK++ NWWRKL+VVRDL+        RL+AL  +A+YLKWINTGQI
Sbjct  166  TTGLGGPTLQIVEGDKSASNWWRKLDVVRDLLSGEAGKKDRLKALINAAVYLKWINTGQI  225

Query  536  PCFEDGGHHRPNRHAEISRLIFCEL  610
             C+EDG H+RPN+HAEISR IF EL
Sbjct  226  VCYEDGQHYRPNKHAEISRRIFVEL  250



>ref|XP_001758857.1| predicted protein [Physcomitrella patens]
 gb|EDQ76363.1| predicted protein [Physcomitrella patens]
Length=1126

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 95/224 (42%), Positives = 125/224 (56%), Gaps = 38/224 (17%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            E+E   GE  E+K +IV    +++WE G NRVL +P  G F++V  W  T + L+L    
Sbjct  52   ELEANPGETFEYKHIIVTHGGDVIWEGGPNRVLSVPDEGEFEVVTHWGCTHEELQL----  107

Query  182  SEGEYEAQVLADNGPV-VTKDSTDPDMQVS--------------------AFVEQWQGKA  298
             +GE   QV+  +GPV V K S +   Q S                    +FV QW G A
Sbjct  108  -QGE---QVI--DGPVDVGKGSKEEPGQASETSSGQQRERSVCELGEISTSFVHQWLGGA  161

Query  299  VSFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHR  478
                    + G E+  KWDT+GL    L LVEGDKN++NWW+KLEVVR L+     +T R
Sbjct  162  A-------KDGQERACKWDTTGLDGPALHLVEGDKNAKNWWQKLEVVRSLVSGEFGNTER  214

Query  479  LEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCEL  610
            L+ L Y ++YLKWI TGQI C ED  H+  ++HAEISR IF EL
Sbjct  215  LKTLVYISVYLKWIRTGQIACCEDAKHYSLDQHAEISRKIFAEL  258



>ref|XP_005849428.1| hypothetical protein CHLNCDRAFT_21770 [Chlorella variabilis]
 gb|EFN57326.1| hypothetical protein CHLNCDRAFT_21770 [Chlorella variabilis]
Length=1182

 Score =   125 bits (313),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 88/231 (38%), Positives = 122/231 (53%), Gaps = 33/231 (14%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIV-GKDK-NLLWETGDNRVLKLPAGG--SFKMVCQW------NVT  151
            E+ L  G  +EFK V V G+D  +  WE GDNR L +PAGG  S  ++ +W         
Sbjct  79   EVALPPGTALEFKCVRVKGEDGGDGRWEDGDNRSLVVPAGGASSLSVLLEWGGEMHVQAA  138

Query  152  DKPLELLPLDS------EGEYEAQVLADN-------GPVVTKDSTDPDMQVSAFVEQWQG  292
                EL  L+       E E+E               P  +  S        A + QWQG
Sbjct  139  GAGEELPGLEGAHQQQREREWERSRSGSGSDSDDSWAPPSSGGSGSSFDDSMALLPQWQG  198

Query  293  KAVSFVRSN----DQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVEN  460
            K + F++SN    D+RG+     WDT+GL    L LV GD+++ NW  KLEVV+ L+V+N
Sbjct  199  KELRFMQSNEHSRDRRGV-----WDTAGLEGPALHLVAGDRDAANWLGKLEVVKKLLVDN  253

Query  461  V-ESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCEL  610
              E    L+AL ++ IY++W+ TG + C E GGHHRPNRHAE++R +F  L
Sbjct  254  APELRPSLDALAHAYIYMQWLATGAVECVEGGGHHRPNRHAELARSMFRSL  304



>emb|CAX51387.1| phosphoglucan water dikinase [Hordeum vulgare subsp. vulgare]
Length=261

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 70/86 (81%), Gaps = 1/86 (1%)
 Frame = +2

Query  356  TSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVE-STHRLEALTYSAIYLKWINTGQ  532
            T+GL  + LKLVEGDK+S+NWW+KL++VR L+ E V+  + RLEAL  SAIYLKWI TGQ
Sbjct  1    TAGLGGMALKLVEGDKSSKNWWQKLDLVRRLVSEPVDDQSSRLEALICSAIYLKWIYTGQ  60

Query  533  IPCFEDGGHHRPNRHAEISRLIFCEL  610
            I C EDGGH+RPN+HAEISR IF E+
Sbjct  61   ISCSEDGGHYRPNKHAEISRQIFREI  86



>gb|KIZ07735.1| hypothetical protein MNEG_0234 [Monoraphidium neglectum]
Length=832

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 85/228 (37%), Positives = 114/228 (50%), Gaps = 27/228 (12%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK-LPAGGSFKMVCQWNVTDKPLELLPL  178
            E+EL  G  VEFK V VGKD +  WE G+NR +K L AG S  + C+W  T +       
Sbjct  52   EVELDAGSHVEFKLVCVGKDSDA-WEDGNNRGIKVLGAGYSQDVHCEWGRTKENDVRARE  110

Query  179  DSEGEYEAQVL------------------ADNGPVVTKDSTDPDMQVSAFVEQ----WQG  292
              EG+   + L                  +++ P    D        S   EQ    WQG
Sbjct  111  LQEGQPRFEDLAAAVGARAAADAQQRRLGSESYPTTDTDEGGFSSTASGDDEQLTPAWQG  170

Query  293  KAVSFVRSNDQRGMEKNRKWDTSGLAEIP-LKLVEGDKNSQNWWRKLEVVRDLIVENVES  469
            + V F+RSND    E+  +WDTSGLA  P L+LV GD+ + NW  KL V R L+V+    
Sbjct  171  REVRFMRSNDH-SRERAGRWDTSGLAAGPVLELVRGDEGAPNWLGKLGVARGLLVDAAPR  229

Query  470  TH-RLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCEL  610
                  +L  + +YL W+N+G I C E GGH+RPN HA  ++ IF  L
Sbjct  230  MRPETPSLAAALVYLSWVNSGAIACAEGGGHYRPNHHARTAQQIFRSL  277



>gb|ABR17706.1| unknown [Picea sitchensis]
Length=328

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 90/153 (59%), Gaps = 9/153 (6%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            ++E +GGE VE+KFVIV  D  ++WE G NRVL LP  G F++VC W+ T + L+L  +D
Sbjct  136  DLETRGGEKVEYKFVIVSGDGKIIWEGGHNRVLALPKEGRFEIVCHWDKTQEALDLQRMD  195

Query  182  ------SEGEYEAQVLADNG-PVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEK  340
                     + + +  + NG P V  ++ +   + S FV+ WQ K ++F+R N     E+
Sbjct  196  RALAALQTLDMKKEATSSNGKPQV--ETYENVAEASPFVQGWQVKNITFMRYNGHSTRER  253

Query  341  NRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVV  439
             R W+T+ L     KLVE D+N +NWWRK+  +
Sbjct  254  KRSWNTTCLEGSAGKLVEVDQNKRNWWRKVRFI  286



>gb|KDD72859.1| hypothetical protein H632_c2807p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=386

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 65/205 (32%), Positives = 94/205 (46%), Gaps = 27/205 (13%)
 Frame = +2

Query  29   VEFKFVIV-GKDKNLLWETGDNRVLKLPAGGSFKMVCQWN---------VTDKPLELLPL  178
             EFK V V G    + WE G NR +      +  +  +W               LE    
Sbjct  20   AEFKIVQVDGSGSPVEWEPGSNRRVTTEELQALSLSLEWGRQGFVGNRAAPAHGLEAASS  79

Query  179  DSEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDT  358
             S+G+ EA                P  + +    QW G   SF+RSN+    E+  +WD+
Sbjct  80   ASDGDGEA---------------PPAHEPTDATRQWVGSFPSFMRSNEH-SRERRGRWDS  123

Query  359  SGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTH-RLEALTYSAIYLKWINTGQI  535
            S +      LVE D  S +W  KL+ +++L+V+  E     L+A+  + +Y +WI TG +
Sbjct  124  SSVQGAARFLVEQDAESPSWLHKLQTLKELLVDRPERARPELDAVAAAFVYAQWIATGAV  183

Query  536  PCFEDGGHHRPNRHAEISRLIFCEL  610
            PC E GGHHRP  HA +SR IF  L
Sbjct  184  PCVEGGGHHRPCHHATLSRDIFQSL  208



>ref|XP_011396449.1| Phosphoglucan, water dikinase, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM23575.1| Phosphoglucan, water dikinase, chloroplastic [Auxenochlorella 
protothecoides]
Length=1068

 Score =   100 bits (249),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 55/183 (30%), Positives = 94/183 (51%), Gaps = 11/183 (6%)
 Frame = +2

Query  65   NLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDSEGEYEAQVLADNGPVVTKDS  244
            N+ WE+G N V+  P   +  +   W   +  ++      + E  +   +  GP     +
Sbjct  51   NVEWESGSNHVVPAPEADA-AVSLNWGAAEAVVK------KAEAGSPFASSPGP--DPGT  101

Query  245  TDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWR  424
              P    S    +W GK   F++ N+    E+  +W+T GL    L++V GD+++ +W +
Sbjct  102  QGPASDDSPVRARWSGKEPVFMQGNEH-SRERQGRWETEGLEGATLEIVNGDRDAGSWLQ  160

Query  425  KLEVVRDLIVENVESTH-RLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF  601
            KL V   L+V++      RL+A+  + +YL+W+  G + C E GGHHRPN HAE++R +F
Sbjct  161  KLAVAEKLLVQSAPRLRPRLDAVAAAYVYLQWVGNGTLACAESGGHHRPNHHAELARSMF  220

Query  602  CEL  610
              L
Sbjct  221  RSL  223



>ref|XP_001417570.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO95863.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=997

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 41/104 (39%), Positives = 69/104 (66%), Gaps = 4/104 (4%)
 Frame = +2

Query  269  AFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDL  448
            A + QW+G+ V  ++++   G E+N +W+T  LA+   ++VEGD++S +W +KL++V  L
Sbjct  33   AALNQWRGQEVK-LQTHKGGGGERNLQWNTDNLADAARRIVEGDRDSSSWRQKLQMVEKL  91

Query  449  IVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHA  580
            I ++      +++L Y+ +YL WI+ G I C EDG H+RPN HA
Sbjct  92   ICDDGAD---VDSLAYATVYLFWISVGAIACVEDGTHYRPNHHA  132



>ref|XP_001697099.1| phosphoglucan water dikinase [Chlamydomonas reinhardtii]
 gb|EDP00354.1| phosphoglucan water dikinase [Chlamydomonas reinhardtii]
Length=978

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 62/201 (31%), Positives = 97/201 (48%), Gaps = 15/201 (7%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            E  +  G  VEFK V +  D  ++WE GDNR  K  +  S     + + T          
Sbjct  75   EARVPVGTEVEFKVVKMKPDGEVIWEDGDNRTFKSSSKSSRSR--EASATSSVDGGDSSS  132

Query  182  SEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTS  361
            S     A        V++K S + +   S     W G    FVRS  ++       W T 
Sbjct  133  SSRGSTA--------VLSKSSFEEE---SGSRGAWVGAGPEFVRSR-KKDERPAGTWRTE  180

Query  362  GLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTH-RLEALTYSAIYLKWINTGQIP  538
            GL+ + L LV+GD+ + +W +KL + + L+V++  +   RL+ L+Y  +Y  W+NTG + 
Sbjct  181  GLSGVALALVKGDEQAASWLKKLGLQKQLLVDSPPACRPRLDDLSYLYVYATWVNTGALA  240

Query  539  CFEDGGHHRPNRHAEISRLIF  601
            C E G H+RPN HA ++  +F
Sbjct  241  CAESGSHYRPNHHANLALAMF  261



>ref|XP_003059536.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56668.1| predicted protein [Micromonas pusilla CCMP1545]
Length=975

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 36/111 (32%), Positives = 68/111 (61%), Gaps = 1/111 (1%)
 Frame = +2

Query  269  AFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDL  448
            A +  W+G AV  ++ + +   +++ +W+   L +   ++VEGD++S +W +KL+ +  +
Sbjct  2    ALLSNWRGSAVE-LKGHREHNKDRHNQWNVDNLPDAARRIVEGDRDSPSWRQKLQALEGV  60

Query  449  IVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF  601
            +  +      ++AL Y AIYL W+  G I C EDGGH+RPN HA+ ++ ++
Sbjct  61   LCFDDPGAMDMDALGYGAIYLFWVGVGAIACVEDGGHYRPNHHAKAAQHMY  111



>ref|XP_003078935.1| chloroplast alpha-glucan water dikinase isoform 3 (ISS), partial 
[Ostreococcus tauri]
Length=969

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 68/109 (62%), Gaps = 5/109 (5%)
 Frame = +2

Query  254  DMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLE  433
            D+Q +A   QW+G+ V   R     G ++N +W+T  LA+   ++VEGD++S +W +KL+
Sbjct  69   DVQFAAL-NQWRGQEVKLQRHKGGYG-DRNLRWNTDNLADAARRIVEGDRDSSSWRQKLQ  126

Query  434  VVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHA  580
            +V  ++ +N      +++L Y  +YL WI+ G I C EDG H+RPN HA
Sbjct  127  MVEKVLCDNGAD---VDSLAYVTVYLFWISVGAIMCVEDGTHYRPNHHA  172



>emb|CEF97682.1| Pyruvate phosphate dikinase,PEP/pyruvate-binding, partial [Ostreococcus 
tauri]
Length=1107

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 68/109 (62%), Gaps = 5/109 (5%)
 Frame = +2

Query  254  DMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLE  433
            D+Q +A   QW+G+ V   R     G ++N +W+T  LA+   ++VEGD++S +W +KL+
Sbjct  143  DVQFAAL-NQWRGQEVKLQRHKGGYG-DRNLRWNTDNLADAARRIVEGDRDSSSWRQKLQ  200

Query  434  VVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHA  580
            +V  ++ +N      +++L Y  +YL WI+ G I C EDG H+RPN HA
Sbjct  201  MVEKVLCDNGAD---VDSLAYVTVYLFWISVGAIMCVEDGTHYRPNHHA  246



>ref|XP_002949771.1| hypothetical protein VOLCADRAFT_90138 [Volvox carteri f. nagariensis]
 gb|EFJ49323.1| hypothetical protein VOLCADRAFT_90138 [Volvox carteri f. nagariensis]
Length=1125

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 72/254 (28%), Positives = 113/254 (44%), Gaps = 62/254 (24%)
 Frame = +2

Query  20   GEPVEFKFVIVGKDKNLL-WETGDNRVLKL--PAGGSFKMVCQWN-VTDKPLELLPLDSE  187
            G  V+FK V    D  ++ WE GDNR  K+  P  G  ++ C W    D  ++   L S+
Sbjct  18   GADVDFKVVKAKHDSGVITWEAGDNRSFKILGPDFG-LRLTCHWGRPQDMQIDAYKLQSQ  76

Query  188  GEYE-------AQVLADNGP----------------------------------------  226
               E       A+V ++NG                                         
Sbjct  77   QRQEGKGAAMAAEVGSNNGATNGVTSVSGNGVAAASRGVSKASRNGSSAAAASMSPAGSL  136

Query  227  VVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRK--WDTSGLAEIPLKLVEGD  400
            V+++ S + +   SA    W G    FVRS  ++  E+ R   W T GL+ + L+LV GD
Sbjct  137  VMSRSSLEEE---SAARTAWVGAEPEFVRSR-RKDEEQLRGGVWRTEGLSGVALELVRGD  192

Query  401  KNSQN---WWRKLEVVRDLIVENVESTHR-LEALTYSAIYLKWINTGQIPCFEDGGHHRP  568
            + + +   W +KL + + L+V+   +    LEA++Y  +Y  W+NTG +PC E G H+RP
Sbjct  193  EAASSECSWLKKLGLQKRLLVDEAPACRPGLEAMSYLYVYATWVNTGALPCAESGSHYRP  252

Query  569  NRHAEISRLIFCEL  610
            N HA ++  +F  L
Sbjct  253  NHHANLALAMFRSL  266



>ref|XP_007511444.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17565.1| predicted protein [Bathycoccus prasinos]
Length=1340

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 60/114 (53%), Gaps = 1/114 (1%)
 Frame = +2

Query  260  QVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVV  439
            +V A V  W G  V    +   R      +WDTS L      LV  D+++ +W +KL+ V
Sbjct  379  RVFAAVSNWVGDDVELSNNRKDRSSRDRNRWDTSNLPSFAAALVSNDQSASSWRQKLQSV  438

Query  440  RDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF  601
              L+ EN +     +AL YS IYL WI+ G I C EDG H+RPN HA  +  +F
Sbjct  439  EKLLCEN-DGNDMEDALAYSTIYLFWISVGAISCVEDGTHYRPNHHAGSAERMF  491



>ref|XP_003080699.1| phosphoglucan, water dikinase (ISS), partial [Ostreococcus tauri]
Length=760

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 65/201 (32%), Positives = 98/201 (49%), Gaps = 11/201 (5%)
 Frame = +2

Query  23   EPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDSEGEYEA  202
            + V FK         + WE GDNRV+++   G+F++   +   +   E+   +     EA
Sbjct  100  QSVAFKCATRRASGGVEWEGGDNRVIEIERVGAFEVKGAFG--NGAFEVTSANGT-SVEA  156

Query  203  QVLADNGPV--VTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNR-KWDTSGLAE  373
            +V A +G V      +T   M+ +A  ++W G  V  + +N+      ++ +WD SGL E
Sbjct  157  EVRAVDGDVDGAEAAATGTWMEANAR-DKWVGGNVRMMTANEHSDERPSKMQWDVSGLEE  215

Query  374  I--PLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFE  547
                  +V  D+N  +W+ KL  V + I    E T   E L   A YL+WI+TG I C E
Sbjct  216  TGAARAIVFADENGGSWFEKLAAVANQIGIGREITR--EKLAVCATYLRWISTGTILCVE  273

Query  548  DGGHHRPNRHAEISRLIFCEL  610
             GGH RPN  A + R IF  L
Sbjct  274  SGGHRRPNGPAMVGRGIFISL  294



>emb|CEG01409.1| Carbohydrate binding module family 20 [Ostreococcus tauri]
Length=1117

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 65/201 (32%), Positives = 98/201 (49%), Gaps = 11/201 (5%)
 Frame = +2

Query  23   EPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDSEGEYEA  202
            + V FK         + WE GDNRV+++   G+F++   +   +   E+   +     EA
Sbjct  100  QSVAFKCATRRASGGVEWEGGDNRVIEIERVGAFEVKGAFG--NGAFEVTSANGT-SVEA  156

Query  203  QVLADNGPV--VTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNR-KWDTSGLAE  373
            +V A +G V      +T   M+ +A  ++W G  V  + +N+      ++ +WD SGL E
Sbjct  157  EVRAVDGDVDGAEAAATGTWMEANAR-DKWVGGNVRMMTANEHSDERPSKMQWDVSGLEE  215

Query  374  I--PLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFE  547
                  +V  D+N  +W+ KL  V + I    E T   E L   A YL+WI+TG I C E
Sbjct  216  TGAARAIVFADENGGSWFEKLAAVANQIGIGREITR--EKLAVCATYLRWISTGTILCVE  273

Query  548  DGGHHRPNRHAEISRLIFCEL  610
             GGH RPN  A + R IF  L
Sbjct  274  SGGHRRPNGPAMVGRGIFISL  294



>ref|XP_005648862.1| hypothetical protein COCSUDRAFT_47226 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE24318.1| hypothetical protein COCSUDRAFT_47226 [Coccomyxa subellipsoidea 
C-169]
Length=1158

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 62/216 (29%), Positives = 100/216 (46%), Gaps = 43/216 (20%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            ++ +  G  +EFK V VG +  + WE G NR  ++  GG  K+  +W         L +D
Sbjct  94   DVSVPAGSSLEFKCVKVG-NGQMEWEGGGNRNFQVE-GGEVKVGFEWGNEGS----LHVD  147

Query  182  SE--GEYEAQVLADN-GPVVTKDSTDPDMQVSAFV----------EQWQGKAVSFVRSND  322
            +   G    +  AD+  P    + + P                  ++WQGK+  F+RSN+
Sbjct  148  AHANGASPPESRADSPAPAQEPEQSSPPEGTPGNGASPGDDRLPHQRWQGKSTRFMRSNE  207

Query  323  QRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSA  502
              G +++  W+  GL    L +V GD+ S +W +K++V +                    
Sbjct  208  H-GGDRSGVWNREGLEGAALSIVAGDEKSGSWLQKMQVAKS-------------------  247

Query  503  IYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCEL  610
                +I+TG I C E GGH+RPN+HAE++R IF  L
Sbjct  248  ----FISTGAIECVEGGGHYRPNKHAELARDIFRAL  279



>gb|ABK26307.1| unknown [Picea sitchensis]
Length=237

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 62/113 (55%), Gaps = 17/113 (15%)
 Frame = +2

Query  2    EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  181
            ++E  GGE VE+KF+IV +D  ++WE G NRVL+LP  G+F++VC W+ T + L L   D
Sbjct  128  DLETGGGEKVEYKFLIVSRDGKIIWEGGCNRVLELPKEGNFEIVCHWDKTQEALNLQGTD  187

Query  182  SEGEYEAQVLADNGPVVTKDSTDPD-----------MQVSAFVEQWQGKAVSF  307
                    + A     + KD+T  +            + S FV+ WQGK ++F
Sbjct  188  RA------LAASQTLNIKKDATSSNGKPQVESYGNVAEASPFVQGWQGKDINF  234



>gb|KEH27295.1| phosphoglucan, water dikinase [Medicago truncatula]
Length=893

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +2

Query  509  LKWINTGQIPCFEDGGHHRPNRHAEISRLIFCEL  610
            ++WINTGQIPCFEDGGHHRPNRHAEISRLIF EL
Sbjct  1    MQWINTGQIPCFEDGGHHRPNRHAEISRLIFREL  34



>ref|XP_002504762.1| alpha phosphoglucan water dikinase [Micromonas sp. RCC299]
 gb|ACO66020.1| alpha phosphoglucan water dikinase [Micromonas sp. RCC299]
Length=1001

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 58/94 (62%), Gaps = 7/94 (7%)
 Frame = +2

Query  338  KNRKWDTSGLAEIPLKLVE-GDKNSQNWWRKLEVVRDLIVENVESTHR--LEALTYSAIY  508
            +NR      L E P K +  GDK + +W +KLE+++ ++ +     HR  L  L  +++Y
Sbjct  5    RNRSDGGVNLPEGPAKYIAAGDKEAPSWLQKLELIQSILGQG----HRITLARLGAASVY  60

Query  509  LKWINTGQIPCFEDGGHHRPNRHAEISRLIFCEL  610
            L+WI+TG + C EDG HHRPNR AEI+R IF  L
Sbjct  61   LRWISTGALFCAEDGNHHRPNRPAEIARDIFVSL  94



>gb|KEH44553.1| phosphoglucan, water dikinase, putative [Medicago truncatula]
Length=1226

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  509  LKWINTGQIPCFEDGGHHRPNRHAEISRLIFCEL  610
             +WINTGQIPCFEDGGHHRPNRHAEISRLIF +L
Sbjct  377  FRWINTGQIPCFEDGGHHRPNRHAEISRLIFRKL  410



>ref|XP_008889223.1| pyruvate phosphate dikinase, pep/pyruvate binding domain-containing 
protein [Hammondia hammondi]
 gb|KEP60361.1| pyruvate phosphate dikinase, pep/pyruvate binding domain-containing 
protein [Hammondia hammondi]
Length=1239

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 50/80 (63%), Gaps = 10/80 (13%)
 Frame = +2

Query  383  KLVEGDKNSQNWWRKLEVVRDLIVENV----------ESTHRLEALTYSAIYLKWINTGQ  532
            +LVEG++ +++W  KLEVV++++   +          E+   +++L Y +IYL +++ G 
Sbjct  214  RLVEGEQTARSWREKLEVVKNVLAAALKEGKSRSSPQETVTLIDSLAYCSIYLHFVSQGN  273

Query  533  IPCFEDGGHHRPNRHAEISR  592
            I C EDG H RPN HA +SR
Sbjct  274  IVCTEDGRHFRPNHHANLSR  293



>ref|XP_002368480.1| phosphoglucan, water dikinase protein, putative [Toxoplasma gondii 
ME49]
Length=1222

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 50/80 (63%), Gaps = 10/80 (13%)
 Frame = +2

Query  383  KLVEGDKNSQNWWRKLEVVRDLIVENV----------ESTHRLEALTYSAIYLKWINTGQ  532
            +LVEG++ +++W  KLEVV++++   +          E+   +++L Y +IYL +++ G 
Sbjct  197  RLVEGEQTARSWREKLEVVKNVLAAALKEGKSRCNPQETVTLIDSLAYCSIYLHFVSQGD  256

Query  533  IPCFEDGGHHRPNRHAEISR  592
            I C EDG H RPN HA +SR
Sbjct  257  IVCTEDGRHFRPNHHASLSR  276



>gb|EPR59823.1| pyruvate phosphate dikinase, pep/pyruvate binding domain-containing 
protein [Toxoplasma gondii GT1]
Length=1239

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 50/80 (63%), Gaps = 10/80 (13%)
 Frame = +2

Query  383  KLVEGDKNSQNWWRKLEVVRDLIVENV----------ESTHRLEALTYSAIYLKWINTGQ  532
            +LVEG++ +++W  KLEVV++++   +          E+   +++L Y +IYL +++ G 
Sbjct  214  RLVEGEQTARSWREKLEVVKNVLAAALKEGKSRCNPQETVTLIDSLAYCSIYLHFVSQGD  273

Query  533  IPCFEDGGHHRPNRHAEISR  592
            I C EDG H RPN HA +SR
Sbjct  274  IVCTEDGRHFRPNHHASLSR  293



>gb|ESS33912.1| pyruvate phosphate dikinase, pep/pyruvate binding domain-containing 
protein [Toxoplasma gondii VEG]
Length=1239

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 50/80 (63%), Gaps = 10/80 (13%)
 Frame = +2

Query  383  KLVEGDKNSQNWWRKLEVVRDLIVENV----------ESTHRLEALTYSAIYLKWINTGQ  532
            +LVEG++ +++W  KLEVV++++   +          E+   +++L Y +IYL +++ G 
Sbjct  214  RLVEGEQTARSWREKLEVVKNVLAAALKEGKSRCNPQETVTLIDSLAYCSIYLHFVSQGD  273

Query  533  IPCFEDGGHHRPNRHAEISR  592
            I C EDG H RPN HA +SR
Sbjct  274  IVCTEDGRHFRPNHHASLSR  293



>gb|KFG62834.1| pyruvate phosphate dikinase, pep/pyruvate binding domain-containing 
protein [Toxoplasma gondii RUB]
Length=1239

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 50/80 (63%), Gaps = 10/80 (13%)
 Frame = +2

Query  383  KLVEGDKNSQNWWRKLEVVRDLIVENV----------ESTHRLEALTYSAIYLKWINTGQ  532
            +LVEG++ +++W  KLEVV++++   +          E+   +++L Y +IYL +++ G 
Sbjct  214  RLVEGEQTARSWREKLEVVKNVLAAALKEGKSRCNPQETVTLIDSLAYCSIYLHFVSQGD  273

Query  533  IPCFEDGGHHRPNRHAEISR  592
            I C EDG H RPN HA +SR
Sbjct  274  IVCTEDGRHFRPNHHASLSR  293



>gb|EPT28056.1| pyruvate phosphate dikinase, pep/pyruvate binding domain-containing 
protein [Toxoplasma gondii ME49]
Length=1239

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 50/80 (63%), Gaps = 10/80 (13%)
 Frame = +2

Query  383  KLVEGDKNSQNWWRKLEVVRDLIVENV----------ESTHRLEALTYSAIYLKWINTGQ  532
            +LVEG++ +++W  KLEVV++++   +          E+   +++L Y +IYL +++ G 
Sbjct  214  RLVEGEQTARSWREKLEVVKNVLAAALKEGKSRCNPQETVTLIDSLAYCSIYLHFVSQGD  273

Query  533  IPCFEDGGHHRPNRHAEISR  592
            I C EDG H RPN HA +SR
Sbjct  274  IVCTEDGRHFRPNHHASLSR  293



>gb|KFG31055.1| pyruvate phosphate dikinase, pep/pyruvate binding domain-containing 
protein, partial [Toxoplasma gondii p89]
Length=441

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 50/80 (63%), Gaps = 10/80 (13%)
 Frame = +2

Query  383  KLVEGDKNSQNWWRKLEVVRDLIVENV----------ESTHRLEALTYSAIYLKWINTGQ  532
            +LVEG++ +++W  KLEVV++++   +          E+   +++L Y +IYL +++ G 
Sbjct  126  RLVEGEQTARSWREKLEVVKNVLAAALKEGKSRCNPQETVTLIDSLAYCSIYLHFVSQGD  185

Query  533  IPCFEDGGHHRPNRHAEISR  592
            I C EDG H RPN HA +SR
Sbjct  186  IVCTEDGRHFRPNHHASLSR  205



>gb|KFG42300.1| pyruvate phosphate dikinase, pep/pyruvate binding domain-containing 
protein, partial [Toxoplasma gondii GAB2-2007-GAL-DOM2]
Length=965

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 50/80 (63%), Gaps = 10/80 (13%)
 Frame = +2

Query  383  KLVEGDKNSQNWWRKLEVVRDLIVENV----------ESTHRLEALTYSAIYLKWINTGQ  532
            +LVEG++ +++W  KLEVV++++   +          E+   +++L Y +IYL +++ G 
Sbjct  214  RLVEGEQTARSWREKLEVVKNVLAAALKEGKSRCNPQETVTLIDSLAYCSIYLHFVSQGD  273

Query  533  IPCFEDGGHHRPNRHAEISR  592
            I C EDG H RPN HA +SR
Sbjct  274  IVCTEDGRHFRPNHHASLSR  293



>gb|KFG99968.1| pyruvate phosphate dikinase, pep/pyruvate binding domain-containing 
protein, partial [Toxoplasma gondii VAND]
Length=529

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 56/91 (62%), Gaps = 11/91 (12%)
 Frame = +2

Query  353  DTSGLAEIPL-KLVEGDKNSQNWWRKLEVVRDLIVENV----------ESTHRLEALTYS  499
            +++ LA   L +LVEG++ +++W  KLEVV++++   +          E+   +++L Y 
Sbjct  203  ESATLASSALQRLVEGEQTARSWREKLEVVKNVLAAALKEGKSRCNPQETVTLIDSLAYC  262

Query  500  AIYLKWINTGQIPCFEDGGHHRPNRHAEISR  592
            +IYL +++ G I C EDG H RPN HA +SR
Sbjct  263  SIYLHFVSQGDIVCTEDGRHFRPNHHASLSR  293



>gb|KFG41384.1| pyruvate phosphate dikinase, pep/pyruvate binding domain-containing 
protein [Toxoplasma gondii FOU]
Length=535

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 50/80 (63%), Gaps = 10/80 (13%)
 Frame = +2

Query  383  KLVEGDKNSQNWWRKLEVVRDLIVENV----------ESTHRLEALTYSAIYLKWINTGQ  532
            +LVEG++ +++W  KLEVV++++   +          E+   +++L Y +IYL +++ G 
Sbjct  214  RLVEGEQTARSWREKLEVVKNVLAAALKEGKSRCNPQETVTLIDSLAYCSIYLHFVSQGD  273

Query  533  IPCFEDGGHHRPNRHAEISR  592
            I C EDG H RPN HA +SR
Sbjct  274  IVCTEDGRHFRPNHHASLSR  293



>ref|XP_003881249.1| phosphoenolpyruvate synthase, related [Neospora caninum Liverpool]
 emb|CBZ51216.1| phosphoenolpyruvate synthase, related [Neospora caninum Liverpool]
Length=1180

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 53/83 (64%), Gaps = 11/83 (13%)
 Frame = +2

Query  377  PLKLV-EGDKNSQNWWRKLEVVRDLIVENV----------ESTHRLEALTYSAIYLKWIN  523
            PL+LV +G++ +++W  KLEVV+ ++   +          ++ + +++L Y +IYL++I+
Sbjct  195  PLRLVVDGERGAKSWREKLEVVKAVLTAALKDGKFRYNPQDTVNLIDSLAYCSIYLRFIS  254

Query  524  TGQIPCFEDGGHHRPNRHAEISR  592
             G I C EDG H RPN HA +SR
Sbjct  255  QGDIVCTEDGRHFRPNHHANLSR  277



>gb|KFH05191.1| pyruvate phosphate dikinase, pep/pyruvate binding domain-containing 
protein, partial [Toxoplasma gondii MAS]
Length=765

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 30/80 (38%), Positives = 50/80 (63%), Gaps = 10/80 (13%)
 Frame = +2

Query  383  KLVEGDKNSQNWWRKLEVVRDLIVENV----------ESTHRLEALTYSAIYLKWINTGQ  532
            +LVEG++ +++W  KLEVV++++   +          E+   +++L Y +IYL +++ G 
Sbjct  126  RLVEGEQTARSWREKLEVVKNVLAAALKEGKSRCNPQETVTLIDSLAYCSIYLHFVSQGD  185

Query  533  IPCFEDGGHHRPNRHAEISR  592
            I C EDG H RPN HA +SR
Sbjct  186  IVCTEDGRHFRPNHHASLSR  205



>emb|CDJ47310.1| Carbohydrate-binding module family 20 protein, related [Eimeria 
brunetti]
Length=540

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 15/82 (18%)
 Frame = +2

Query  386  LVEGDKNSQNWWRKLEVVRDLI-------------VENVESTHRLEALTYSAIYLKWINT  526
            +VEG+  + +W  KLE+V+ +I              E V +   ++AL YS +YL++I  
Sbjct  255  IVEGNAAAASWGAKLEIVKKIIQKIGDGSSFSKAPAEKVVAA--IDALCYSGVYLQFIKQ  312

Query  527  GQIPCFEDGGHHRPNRHAEISR  592
            G I C EDG HHRPN HA ISR
Sbjct  313  GLICCSEDGEHHRPNVHANISR  334



>ref|XP_001419310.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97603.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=918

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 47/90 (52%), Gaps = 4/90 (4%)
 Frame = +2

Query  347  KWDTSGL--AEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWI  520
            +WD   L  A     +V  D++  +W+ KL  V + I    E T   + L  SA YL+WI
Sbjct  15   RWDVGNLEEASAARAVVLADESGGSWFEKLAAVANQIGIGKEITR--DKLAVSATYLRWI  72

Query  521  NTGQIPCFEDGGHHRPNRHAEISRLIFCEL  610
            +TG I C E GGH RPN  A + R IF  +
Sbjct  73   STGTIKCVESGGHRRPNGPAMVGRGIFISM  102



>ref|XP_005827807.1| hypothetical protein GUITHDRAFT_164559 [Guillardia theta CCMP2712]
 gb|EKX40827.1| hypothetical protein GUITHDRAFT_164559 [Guillardia theta CCMP2712]
Length=1011

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 47/88 (53%), Gaps = 17/88 (19%)
 Frame = +2

Query  386  LVEGDKNSQNWWRKLEVVRDLIVENVES-----------------THRLEALTYSAIYLK  514
            +V+ ++ + +W +KLE V+ L  +  +S                       L   AIYL 
Sbjct  121  IVKANQENGSWRQKLEFVKTLFYDKSDSDPCTPGDLATASGFNQQEPETSHLAMIAIYLH  180

Query  515  WINTGQIPCFEDGGHHRPNRHAEISRLI  598
            +++TGQ+PC++ GGH+RPNRHA ++  I
Sbjct  181  FLSTGQVPCYDVGGHNRPNRHAMLASAI  208



>emb|CDI76079.1| Carbohydrate-binding module family 20 protein, related [Eimeria 
acervulina]
Length=531

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 47/87 (54%), Gaps = 13/87 (15%)
 Frame = +2

Query  386  LVEGDKNSQNWWRKLEVVRDLIVENVESTHRL------------EALTYSAIYLKWINTG  529
            +VEG+ ++ +W  KLE+V+  +V+N      L            +AL Y+ +Y   ++ G
Sbjct  246  IVEGNASAPSWGAKLELVKS-VVKNAGDGSSLAKASAEQLVVAIDALCYAGVYADLVSQG  304

Query  530  QIPCFEDGGHHRPNRHAEISRLIFCEL  610
             + C EDG H RPNRHA ISR +   L
Sbjct  305  ALRCSEDGRHLRPNRHANISREVSVHL  331



>emb|CDW77583.1| water chloroplastic-like [Stylonychia lemnae]
Length=991

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 53/205 (26%), Positives = 87/205 (42%), Gaps = 45/205 (22%)
 Frame = +2

Query  26   PVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVC----QWNVTDKPLELLPLDSEGE  193
            P E+K++I  ++ N+ WE G+NRVL L +    K V      ++    P  L  +D E E
Sbjct  64   PFEYKYII-NQNDNIKWEQGNNRVLNLSSHLGEKEVLIIDHGYDQKAAPKILDTIDEEEE  122

Query  194  YEAQVLADNGPVVTKDSTDPDMQ-----VSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDT  358
             ++ +  D+       S   ++Q     V   +E+ +G        N ++G         
Sbjct  123  KQSDISQDHILPAKPKSLQQNLQPLSTLVRDIIEELKG-------LNAEKG---------  166

Query  359  SGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVE-NVESTHRLEALTYSAIYLKWINTGQI  535
                               W +KLE+V  L+ +    S    E L   + YL ++N+ QI
Sbjct  167  ------------------TWKQKLEIVAQLVDKFKGYSNFPTEGLAILSAYLYFVNSHQI  208

Query  536  PCFEDGGHHRPNRHAEISRLIFCEL  610
             C E+G H RPN HA I+  ++  L
Sbjct  209  KCSENGTHFRPNNHANIAYQLYQTL  233



>ref|XP_005716854.1| Phosphoglucan water dikinase, PWD [Chondrus crispus]
 emb|CDF37035.1| Phosphoglucan water dikinase, PWD [Chondrus crispus]
Length=1033

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 47/89 (53%), Gaps = 6/89 (7%)
 Frame = +2

Query  362  GLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVEST------HRLEALTYSAIYLKWIN  523
             L ++   +V      ++W ++L  VR L  E+  ++        ++ L   +++L ++ 
Sbjct  137  ALDDLERAIVHLTNEKRSWRQRLSFVRSLFTEDSAASKNSFNPQNIDHLATVSVFLTFLA  196

Query  524  TGQIPCFEDGGHHRPNRHAEISRLIFCEL  610
            +GQ+ C EDGGHHRPN HA  +R +   L
Sbjct  197  SGQVRCEEDGGHHRPNHHANEARQLEAAL  225



>gb|EJY83942.1| hypothetical protein OXYTRI_18322 [Oxytricha trifallax]
Length=1101

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 51/209 (24%), Positives = 91/209 (44%), Gaps = 27/209 (13%)
 Frame = +2

Query  29   VEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDSEGEYEAQ-  205
            +E+K++I  +++ + WE G NRV+ L     + +  +  ++D+   +     + E  +Q 
Sbjct  65   IEYKYII-KQNETVRWEDGKNRVVNLQ---QYHLGQEIIISDQAFNMDGASPQIEIASQT  120

Query  206  ----VLADNGPVVTK------------DSTDPDMQVSAFVEQWQGKAVSFVRSN----DQ  325
                ++  N  V TK            D+ D  +    F E     +   +++      Q
Sbjct  121  SQGLIIPTNQTVNTKATCGQFYQNLGGDNLD-TISEHPFEESKSNSSQEIIQTQTPQISQ  179

Query  326  RGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVE-STHRLEALTYSA  502
                 N+K   +   +I  +L   +     W +KLE+V  L+ +  E      E L   A
Sbjct  180  NPRPANQKQSDTLAQDIISQLQSLNAEKGTWKQKLEIVAQLVEKYKEFKNFPTEGLAILA  239

Query  503  IYLKWINTGQIPCFEDGGHHRPNRHAEIS  589
             YL ++N+ QI C E+G H RPN HA I+
Sbjct  240  AYLYFVNSHQIKCAENGTHFRPNNHANIA  268



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 829366762230