BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS073F08

Length=625
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP07384.1|  unnamed protein product                                323   2e-101   Coffea canephora [robusta coffee]
ref|XP_011083591.1|  PREDICTED: endoplasmin homolog                     315   2e-98    
gb|EYU38796.1|  hypothetical protein MIMGU_mgv1a001101mg                314   1e-97    Erythranthe guttata [common monkey flower]
ref|XP_009596271.1|  PREDICTED: endoplasmin homolog                     307   4e-97    Nicotiana tomentosiformis
gb|EYU36792.1|  hypothetical protein MIMGU_mgv1a001447mg                311   5e-97    Erythranthe guttata [common monkey flower]
ref|XP_009606988.1|  PREDICTED: endoplasmin homolog                     309   3e-96    Nicotiana tomentosiformis
ref|XP_009791520.1|  PREDICTED: endoplasmin homolog                     309   4e-96    Nicotiana sylvestris
sp|P35016.1|ENPL_CATRO  RecName: Full=Endoplasmin homolog; AltNam...    309   4e-96    Catharanthus roseus [chatas]
dbj|BAL42333.1|  Heat shock protein 90                                  308   7e-96    Nicotiana tabacum [American tobacco]
ref|XP_002273785.1|  PREDICTED: endoplasmin homolog                     307   2e-95    Vitis vinifera
ref|XP_004238368.1|  PREDICTED: endoplasmin homolog                     306   4e-95    Solanum lycopersicum
ref|XP_006342064.1|  PREDICTED: endoplasmin homolog                     305   6e-95    Solanum tuberosum [potatoes]
ref|XP_009791518.1|  PREDICTED: endoplasmin homolog                     305   1e-94    Nicotiana sylvestris
dbj|BAL42332.1|  Heat shock protein 90                                  305   1e-94    Nicotiana tabacum [American tobacco]
gb|KDO84888.1|  hypothetical protein CISIN_1g003458mg                   294   1e-93    Citrus sinensis [apfelsine]
emb|CAN79404.1|  hypothetical protein VITISV_028074                     305   4e-93    Vitis vinifera
ref|XP_011074690.1|  PREDICTED: endoplasmin homolog                     300   5e-93    Sesamum indicum [beniseed]
ref|XP_004499283.1|  PREDICTED: endoplasmin homolog isoform X3          300   8e-93    Cicer arietinum [garbanzo]
gb|KDO84887.1|  hypothetical protein CISIN_1g003458mg                   294   8e-93    Citrus sinensis [apfelsine]
ref|XP_004499281.1|  PREDICTED: endoplasmin homolog isoform X1          300   8e-93    Cicer arietinum [garbanzo]
gb|KDP36908.1|  hypothetical protein JCGZ_08199                         299   2e-92    Jatropha curcas
ref|XP_010539097.1|  PREDICTED: endoplasmin homolog                     298   5e-92    Tarenaya hassleriana [spider flower]
ref|XP_010109992.1|  Endoplasmin-like protein                           301   6e-92    
ref|XP_003589505.1|  Endoplasmin-like protein                           298   7e-92    Medicago truncatula
ref|XP_002307732.1|  hypothetical protein POPTR_0005s26260g             297   1e-91    Populus trichocarpa [western balsam poplar]
ref|XP_011045067.1|  PREDICTED: endoplasmin homolog                     296   2e-91    Populus euphratica
gb|KDO84886.1|  hypothetical protein CISIN_1g003458mg                   295   3e-91    Citrus sinensis [apfelsine]
ref|XP_009409971.1|  PREDICTED: endoplasmin homolog                     295   4e-91    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006473673.1|  PREDICTED: endoplasmin homolog                     295   5e-91    Citrus sinensis [apfelsine]
ref|XP_008377135.1|  PREDICTED: endoplasmin homolog                     295   5e-91    
ref|XP_006435195.1|  hypothetical protein CICLE_v10000296mg             295   6e-91    Citrus clementina [clementine]
gb|KDO84884.1|  hypothetical protein CISIN_1g003458mg                   295   6e-91    Citrus sinensis [apfelsine]
ref|XP_008387928.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmin ...    295   9e-91    
dbj|BAD94659.1|  HSP90-like protein                                     281   9e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009334927.1|  PREDICTED: endoplasmin homolog                     294   2e-90    Pyrus x bretschneideri [bai li]
ref|XP_003550428.1|  PREDICTED: endoplasmin homolog isoform X1          293   3e-90    
ref|XP_006601356.1|  PREDICTED: endoplasmin homolog isoform X2          293   3e-90    Glycine max [soybeans]
ref|XP_006596543.1|  PREDICTED: endoplasmin homolog isoform X2          293   5e-90    Glycine max [soybeans]
ref|XP_003545030.1|  PREDICTED: endoplasmin homolog isoform X1          293   6e-90    Glycine max [soybeans]
ref|XP_004291352.1|  PREDICTED: endoplasmin homolog                     292   6e-90    Fragaria vesca subsp. vesca
ref|XP_002510550.1|  endoplasmin, putative                              291   3e-89    Ricinus communis
ref|XP_009393849.1|  PREDICTED: endoplasmin homolog                     290   3e-89    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010691883.1|  PREDICTED: endoplasmin homolog                     290   5e-89    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010246858.1|  PREDICTED: endoplasmin homolog                     290   6e-89    Nelumbo nucifera [Indian lotus]
ref|XP_007225662.1|  hypothetical protein PRUPE_ppa001487mg             289   1e-88    Prunus persica
ref|XP_010069812.1|  PREDICTED: endoplasmin homolog                     289   2e-88    Eucalyptus grandis [rose gum]
ref|XP_008221245.1|  PREDICTED: endoplasmin homolog                     288   3e-88    Prunus mume [ume]
gb|AAX19870.1|  unknown                                                 273   4e-88    Doryanthes excelsa
ref|XP_007160650.1|  hypothetical protein PHAVU_001G005200g             287   5e-88    Phaseolus vulgaris [French bean]
ref|XP_010266798.1|  PREDICTED: endoplasmin homolog                     287   5e-88    Nelumbo nucifera [Indian lotus]
ref|XP_008444821.1|  PREDICTED: endoplasmin homolog                     287   6e-88    Cucumis melo [Oriental melon]
gb|KJB63270.1|  hypothetical protein B456_010G0030002                   270   2e-87    Gossypium raimondii
gb|AIZ68158.1|  heat shock protein 90                                   286   2e-87    Ornithogalum longebracteatum [sea-onion]
gb|KJB63271.1|  hypothetical protein B456_010G0030002                   270   2e-87    Gossypium raimondii
gb|KJB63272.1|  hypothetical protein B456_010G0030002                   270   8e-87    Gossypium raimondii
ref|XP_010935079.1|  PREDICTED: endoplasmin homolog                     283   2e-86    Elaeis guineensis
ref|XP_010941296.1|  PREDICTED: endoplasmin homolog                     283   2e-86    Elaeis guineensis
gb|EPS69355.1|  hypothetical protein M569_05408                         282   4e-86    Genlisea aurea
ref|XP_006657350.1|  PREDICTED: endoplasmin homolog                     281   6e-86    Oryza brachyantha
ref|NP_194150.1|  HSP90-like protein GRP94                              281   8e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008808636.1|  PREDICTED: endoplasmin homolog                     281   9e-86    Phoenix dactylifera
ref|XP_002867677.1|  hypothetical protein ARALYDRAFT_492441             281   9e-86    Arabidopsis lyrata subsp. lyrata
dbj|BAB86368.1|  SHEPHERD                                               281   9e-86    Arabidopsis thaliana [mouse-ear cress]
gb|AFW75766.1|  hypothetical protein ZEAMMB73_790349                    279   1e-85    
ref|XP_004966467.1|  PREDICTED: endoplasmin homolog                     281   1e-85    Setaria italica
ref|XP_002439030.1|  hypothetical protein SORBIDRAFT_10g030240          281   1e-85    
ref|XP_010433803.1|  PREDICTED: endoplasmin homolog                     281   1e-85    Camelina sativa [gold-of-pleasure]
ref|XP_010439073.1|  PREDICTED: endoplasmin homolog                     281   1e-85    Camelina sativa [gold-of-pleasure]
ref|XP_006283118.1|  hypothetical protein CARUB_v10004140mg             281   1e-85    Capsella rubella
ref|NP_001151475.1|  endoplasmin precursor                              281   1e-85    Zea mays [maize]
gb|AFW75767.1|  endoplasmin                                             280   3e-85    
gb|AAN34791.1|  Grp94                                                   280   4e-85    Xerophyta viscosa
ref|NP_974606.1|  HSP90-like protein GRP94                              279   8e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008643502.1|  PREDICTED: shepherd-like1 isoform X1               278   9e-85    
ref|XP_006413464.1|  hypothetical protein EUTSA_v10024414mg             278   2e-84    Eutrema salsugineum [saltwater cress]
ref|NP_001058590.1|  Os06g0716700                                       278   2e-84    
gb|KFK29085.1|  hypothetical protein AALP_AA7G086900                    278   3e-84    Arabis alpina [alpine rockcress]
gb|KJB14398.1|  hypothetical protein B456_002G122800                    276   3e-84    Gossypium raimondii
gb|AAL79732.1|AC091774_23  heat shock protein 90                        277   3e-84    Oryza sativa Japonica Group [Japonica rice]
emb|CDY10992.1|  BnaA03g46510D                                          278   4e-84    Brassica napus [oilseed rape]
ref|XP_010448597.1|  PREDICTED: endoplasmin homolog                     276   7e-84    Camelina sativa [gold-of-pleasure]
ref|XP_009137776.1|  PREDICTED: endoplasmin homolog                     276   8e-84    Brassica rapa
emb|CDY24830.1|  BnaA08g14800D                                          276   8e-84    Brassica napus [oilseed rape]
emb|CDY34264.1|  BnaA01g13670D                                          276   8e-84    Brassica napus [oilseed rape]
gb|KJB14397.1|  hypothetical protein B456_002G122800                    276   1e-83    Gossypium raimondii
dbj|BAA90487.1|  heat shock protein 90                                  276   1e-83    Oryza sativa [red rice]
ref|XP_008788614.1|  PREDICTED: endoplasmin homolog                     275   2e-83    Phoenix dactylifera
emb|CDY03477.1|  BnaC01g16050D                                          275   4e-83    
sp|P36183.1|ENPL_HORVU  RecName: Full=Endoplasmin homolog; AltNam...    274   4e-83    Hordeum vulgare [barley]
emb|CDX92620.1|  BnaC07g38780D                                          273   8e-83    
gb|KJB63501.1|  hypothetical protein B456_010G0030001                   273   8e-83    Gossypium raimondii
gb|KHG17445.1|  Endoplasmin                                             273   1e-82    Gossypium arboreum [tree cotton]
ref|XP_006851911.1|  hypothetical protein AMTR_s00041p00161550          272   4e-82    Amborella trichopoda
gb|EAZ02369.1|  hypothetical protein OsI_24473                          272   4e-82    Oryza sativa Indica Group [Indian rice]
gb|EAZ38293.1|  hypothetical protein OsJ_22671                          272   4e-82    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004152644.1|  PREDICTED: endoplasmin homolog                     271   6e-82    Cucumis sativus [cucumbers]
ref|XP_003563275.1|  PREDICTED: endoplasmin homolog                     270   2e-81    Brachypodium distachyon [annual false brome]
gb|ABV82432.1|  Hsp90-like protein                                      269   4e-81    Dactylis glomerata [cocksfoot]
gb|AFW69515.1|  hypothetical protein ZEAMMB73_665489                    269   4e-80    
ref|XP_007017829.1|  Chaperone protein htpG family protein isoform 2    265   9e-80    
ref|XP_007017828.1|  Chaperone protein htpG family protein isoform 1    265   1e-79    
gb|EMT19498.1|  Endoplasmin-like protein                                266   6e-79    
gb|EMS56078.1|  Endoplasmin-like protein                                260   2e-77    Triticum urartu
gb|ABV21762.1|  GRP94                                                   258   7e-77    Pinus taeda
ref|XP_007017830.1|  Chaperone protein htpG family protein isoform 3    255   1e-76    
gb|KJB63502.1|  hypothetical protein B456_010G0030001                   256   2e-76    Gossypium raimondii
ref|XP_002981308.1|  hypothetical protein SELMODRAFT_444847             233   1e-67    Selaginella moellendorffii
ref|XP_002969701.1|  hypothetical protein SELMODRAFT_451343             233   1e-67    Selaginella moellendorffii
gb|KHN44921.1|  Endoplasmin like                                        218   7e-67    Glycine soja [wild soybean]
tpg|DAA46734.1|  TPA: hypothetical protein ZEAMMB73_851694              221   1e-66    
ref|XP_001770511.1|  predicted protein                                  229   2e-66    
tpg|DAA46735.1|  TPA: hypothetical protein ZEAMMB73_851694              220   5e-66    
gb|AFW81541.1|  hypothetical protein ZEAMMB73_624427                    216   1e-64    
emb|CDY08910.1|  BnaC08g11400D                                          222   5e-64    Brassica napus [oilseed rape]
ref|XP_008660989.1|  PREDICTED: endoplasmin homolog                     198   5e-60    
ref|XP_002949693.1|  hypothetical protein VOLCADRAFT_80696              204   1e-57    Volvox carteri f. nagariensis
ref|XP_001701885.1|  heat shock protein 90B                             204   2e-57    Chlamydomonas reinhardtii
ref|XP_008646956.1|  PREDICTED: endoplasmin homolog                     187   2e-55    
gb|KJB63273.1|  hypothetical protein B456_010G0030002                   176   1e-51    Gossypium raimondii
gb|AFK46854.1|  unknown                                                 168   2e-49    Medicago truncatula
ref|XP_001753222.1|  predicted protein                                  177   4e-48    
gb|KHG15193.1|  Endoplasmin                                             177   4e-48    Gossypium arboreum [tree cotton]
ref|XP_001421809.1|  Heat Shock Protein 90, endoplasmic reticulum       177   9e-48    Ostreococcus lucimarinus CCE9901
ref|XP_002508627.1|  predicted protein                                  176   1e-47    Micromonas commoda
ref|XP_006657349.1|  PREDICTED: endoplasmin homolog                     177   2e-47    
ref|NP_001146348.1|  shepherd-like1                                     174   5e-47    
ref|XP_003083767.1|  heat shock protein 90 (ISS)                        174   6e-47    
ref|XP_003063917.1|  predicted protein                                  174   9e-47    Micromonas pusilla CCMP1545
ref|XP_005823214.1|  hypothetical protein GUITHDRAFT_160160             173   3e-46    Guillardia theta CCMP2712
ref|XP_007512535.1|  predicted protein                                  172   2e-45    Bathycoccus prasinos
ref|XP_002157524.1|  PREDICTED: endoplasmin-like                        170   4e-45    Hydra vulgaris
ref|XP_005651682.1|  heat shock protein Hsp90                           169   6e-45    Coccomyxa subellipsoidea C-169
dbj|GAM27457.1|  hypothetical protein SAMD00019534_106330               166   9e-44    Acytostelium subglobosum LB1
ref|XP_006588134.1|  PREDICTED: endoplasmin homolog                     154   1e-43    Glycine max [soybeans]
emb|CEG00480.1|  Histidine kinase-like ATPase, ATP-binding domain       165   1e-43    Ostreococcus tauri
gb|EFA78289.1|  heat shock protein Hsp90 family protein                 164   5e-43    Heterostelium album PN500
gb|ACR38010.1|  unknown                                                 151   7e-43    Zea mays [maize]
gb|AGX25162.1|  heat shock protein                                      155   2e-42    Leptinotarsa decemlineata
gb|AFW81490.1|  hypothetical protein ZEAMMB73_031063                    149   3e-42    
tpg|DAA34121.1|  TPA: endoplasmic reticulum glucose-regulated pro...    152   3e-42    Amblyomma variegatum
gb|AIC62039.1|  HSP90B1                                                 154   1e-41    synthetic construct
gb|AAH09195.1|  HSP90B1 protein                                         154   1e-41    Homo sapiens [man]
ref|XP_011402246.1|  Endoplasmin-like protein                           161   1e-41    Auxenochlorella protothecoides
ref|XP_002117847.1|  hypothetical protein TRIADDRAFT_64388              158   2e-41    Trichoplax adhaerens
gb|EAW97723.1|  heat shock protein 90kDa beta (Grp94), member 1, ...    154   4e-41    Homo sapiens [man]
emb|CBN74418.1|  Heat shock protein 90                                  156   2e-40    Ectocarpus siliculosus
ref|XP_011311739.1|  PREDICTED: endoplasmin                             156   3e-40    Fopius arisanus
ref|XP_007893493.1|  PREDICTED: endoplasmin                             156   3e-40    Callorhinchus milii [Australian ghost shark]
ref|XP_003907109.1|  PREDICTED: endoplasmin                             155   7e-40    
ref|XP_004373828.1|  PREDICTED: endoplasmin                             155   8e-40    Trichechus manatus latirostris
gb|AAH81917.1|  Tra1 protein                                            153   9e-40    Rattus norvegicus [brown rat]
ref|XP_010219153.1|  PREDICTED: endoplasmin-like                        149   9e-40    Tinamus guttatus
ref|XP_009065664.1|  hypothetical protein LOTGIDRAFT_197084             155   9e-40    Lottia gigantea
dbj|BAD92771.1|  tumor rejection antigen (gp96) 1 variant               153   9e-40    Homo sapiens [man]
dbj|BAP28370.1|  heat shock protein 90 kDa beta member 1                153   9e-40    Canis lupus familiaris [dogs]
ref|XP_005358282.1|  PREDICTED: endoplasmin                             155   1e-39    Microtus ochrogaster [prairie voles]
ref|XP_006740281.1|  PREDICTED: endoplasmin isoform X2                  154   1e-39    Leptonychotes weddellii
ref|XP_007109922.1|  PREDICTED: endoplasmin                             154   1e-39    Physeter catodon
ref|XP_004326676.1|  PREDICTED: endoplasmin                             154   1e-39    Tursiops truncatus [Atlantic bottle-nosed dolphin]
gb|KFM57735.1|  Endoplasmin                                             154   1e-39    Stegodyphus mimosarum
ref|XP_002428463.1|  Hsp90 protein, putative                            154   1e-39    Pediculus humanus corporis [human body lice]
ref|XP_009019107.1|  hypothetical protein HELRODRAFT_157169             154   2e-39    Helobdella robusta
ref|XP_004269495.1|  PREDICTED: endoplasmin                             154   2e-39    
ref|XP_007165840.1|  PREDICTED: endoplasmin                             154   2e-39    Balaenoptera acutorostrata scammoni
ref|XP_007096540.1|  PREDICTED: endoplasmin                             154   2e-39    Panthera tigris altaica
ref|XP_004414318.1|  PREDICTED: endoplasmin                             154   2e-39    Odobenus rosmarus divergens
gb|EFB13451.1|  hypothetical protein PANDA_003512                       154   2e-39    Ailuropoda melanoleuca
ref|XP_007619353.1|  PREDICTED: endoplasmin                             154   2e-39    
ref|XP_005068020.1|  PREDICTED: endoplasmin                             154   2e-39    Mesocricetus auratus [Syrian golden hamster]
ref|XP_003202424.1|  PREDICTED: endoplasmin                             154   2e-39    Meleagris gallopavo [common turkey]
ref|XP_003505898.1|  PREDICTED: endoplasmin                             154   2e-39    Cricetulus griseus [Chinese hamsters]
ref|NP_777125.1|  endoplasmin precursor                                 154   2e-39    Bos taurus [bovine]
ref|XP_004006728.1|  PREDICTED: endoplasmin                             154   2e-39    
ref|XP_004743081.1|  PREDICTED: endoplasmin                             154   2e-39    
ref|XP_005322404.1|  PREDICTED: endoplasmin                             154   2e-39    Ictidomys tridecemlineatus
gb|ELR54024.1|  Endoplasmin                                             154   2e-39    Bos mutus
ref|XP_006979926.1|  PREDICTED: endoplasmin                             154   2e-39    Peromyscus maniculatus bairdii
ref|NP_001012197.2|  endoplasmin precursor                              154   2e-39    Rattus norvegicus [brown rat]
gb|EPY74066.1|  endoplasmin precursor                                   153   2e-39    Camelus ferus
ref|XP_003745792.1|  PREDICTED: endoplasmin-like                        154   2e-39    Galendromus occidentalis
gb|AAH10445.1|  Heat shock protein 90, beta (Grp94), member 1           154   2e-39    Mus musculus [mouse]
ref|XP_006934044.1|  PREDICTED: endoplasmin                             154   2e-39    
ref|XP_008703910.1|  PREDICTED: endoplasmin                             154   2e-39    Ursus maritimus [white bear]
ref|XP_006141474.1|  PREDICTED: endoplasmin                             154   2e-39    Tupaia chinensis
ref|XP_971540.1|  PREDICTED: endoplasmin                                153   2e-39    Tribolium castaneum [rust-red flour beetle]
dbj|BAE29874.1|  unnamed protein product                                154   3e-39    Mus musculus [mouse]
ref|NP_001003327.1|  endoplasmin precursor                              154   3e-39    Canis lupus familiaris [dogs]
ref|XP_006888611.1|  PREDICTED: endoplasmin                             154   3e-39    Elephantulus edwardii [Cape long-eared elephant shrew]
emb|CAI64497.1|  tumor rejection antigen (gp96) 1                       154   3e-39    Homo sapiens [man]
gb|EHH21126.1|  hypothetical protein EGK_04124                          154   3e-39    Macaca mulatta [rhesus macaque]
gb|AAQ02595.1|  tumor rejection antigen 1gp96                           154   3e-39    synthetic construct
ref|NP_003290.1|  endoplasmin precursor                                 154   3e-39    Homo sapiens [man]
ref|XP_011385167.1|  PREDICTED: endoplasmin                             154   3e-39    
ref|XP_006769416.1|  PREDICTED: endoplasmin                             154   3e-39    Myotis davidii
ref|XP_003269991.2|  PREDICTED: endoplasmin                             154   3e-39    Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_001365625.1|  PREDICTED: endoplasmin                             154   3e-39    Monodelphis domestica
ref|NP_001182453.1|  heat shock protein 90kDa beta (Grp94), membe...    154   3e-39    Macaca mulatta [rhesus macaque]
ref|NP_001233416.1|  endoplasmin precursor                              154   3e-39    Pan troglodytes
ref|XP_011218345.1|  PREDICTED: endoplasmin isoform X2                  153   3e-39    
ref|XP_006084129.1|  PREDICTED: endoplasmin                             154   3e-39    Myotis lucifugus
ref|XP_008142964.1|  PREDICTED: endoplasmin                             154   3e-39    Eptesicus fuscus
ref|XP_003929672.1|  PREDICTED: endoplasmin                             154   3e-39    Saimiri boliviensis boliviensis
ref|NP_035761.1|  endoplasmin precursor                                 153   3e-39    Mus musculus [mouse]
ref|XP_008002644.1|  PREDICTED: endoplasmin                             153   3e-39    Chlorocebus sabaeus
ref|XP_006740280.1|  PREDICTED: endoplasmin isoform X1                  153   3e-39    Leptonychotes weddellii
ref|XP_004879102.1|  PREDICTED: endoplasmin                             153   3e-39    
ref|XP_005865309.1|  PREDICTED: endoplasmin                             153   3e-39    Myotis brandtii
ref|NP_001157345.1|  glucose-regulated protein precursor                153   3e-39    Equus caballus [domestic horse]
ref|XP_002915502.1|  PREDICTED: endoplasmin isoform X1                  153   3e-39    Ailuropoda melanoleuca
ref|XP_008568503.1|  PREDICTED: endoplasmin                             153   3e-39    Galeopterus variegatus [Malayan flying lemur]
ref|XP_004053833.1|  PREDICTED: endoplasmin                             153   3e-39    
gb|EHA99498.1|  Endoplasmin                                             153   3e-39    Heterocephalus glaber [naked mole rat]
ref|XP_003783342.1|  PREDICTED: endoplasmin-like                        153   3e-39    Otolemur garnettii
gb|EHH66650.1|  hypothetical protein EGM_03684                          153   3e-39    Macaca fascicularis [crab eating macaque]
ref|XP_004418096.1|  PREDICTED: endoplasmin                             153   3e-39    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_004844893.1|  PREDICTED: endoplasmin isoform X1                  154   3e-39    
ref|XP_011494775.1|  PREDICTED: endoplasmin                             153   3e-39    Ceratosolen solmsi marchali
ref|XP_006193753.1|  PREDICTED: endoplasmin                             153   3e-39    Camelus ferus
ref|XP_006205953.1|  PREDICTED: endoplasmin                             153   4e-39    Vicugna pacos
ref|XP_010629639.1|  PREDICTED: endoplasmin                             153   4e-39    Fukomys damarensis [Damara mole rat]
ref|XP_001637407.1|  predicted protein                                  153   4e-39    Nematostella vectensis
gb|EPQ07146.1|  Endoplasmin                                             153   4e-39    Myotis brandtii
gb|ADR79285.1|  Hsp90 beta                                              153   4e-39    Brachionus ibericus
emb|CAA62352.1|  protein kinase                                         153   4e-39    Sus scrofa [pigs]
sp|Q29092.3|ENPL_PIG  RecName: Full=Endoplasmin; AltName: Full=94...    153   4e-39    Sus scrofa [pigs]
ref|XP_004349108.2|  glucose-regulated protein 94                       153   4e-39    Capsaspora owczarzaki ATCC 30864
ref|XP_007454336.1|  PREDICTED: endoplasmin                             153   4e-39    Lipotes vexillifer [baiji]
ref|XP_004623907.1|  PREDICTED: endoplasmin                             153   5e-39    Octodon degus
ref|XP_003405348.1|  PREDICTED: endoplasmin                             153   5e-39    Loxodonta africana [African bush elephant]
gb|AAA48827.1|  108K heat shock protein                                 153   5e-39    Gallus gallus [bantam]
ref|XP_004602837.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmin        152   5e-39    Sorex araneus [Eurasian shrew]
ref|XP_004589651.1|  PREDICTED: endoplasmin                             153   5e-39    Ochotona princeps [southern American pika]
ref|XP_009861771.1|  PREDICTED: endoplasmin-like                        153   5e-39    Ciona intestinalis [sea vase]
ref|NP_001039228.1|  heat shock protein 90kDa beta (Grp94), membe...    153   5e-39    Xenopus tropicalis [western clawed frog]
emb|CAA28629.1|  hsp 108                                                152   5e-39    Gallus gallus [bantam]
ref|XP_005680600.1|  PREDICTED: endoplasmin                             153   5e-39    
ref|XP_006619420.1|  PREDICTED: endoplasmin-like                        153   5e-39    Apis dorsata [rock honeybee]
ref|XP_003401925.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmin-...    153   5e-39    Bombus terrestris [large earth bumblebee]
ref|XP_005374635.1|  PREDICTED: endoplasmin                             153   5e-39    Chinchilla lanigera
dbj|BAI23208.1|  heat shock protein 90kDa beta (Grp94), member 1        152   5e-39    Coturnix japonica
ref|NP_989620.1|  endoplasmin precursor                                 152   5e-39    Gallus gallus [bantam]
gb|ACF35012.1|  heat shock protein 108                                  152   6e-39    Gallus gallus [bantam]
gb|KDD75133.1|  heat shock protein 90 Hsp90                             152   6e-39    Helicosporidium sp. ATCC 50920
gb|KFP71026.1|  Endoplasmin                                             151   6e-39    Acanthisitta chloris
ref|NP_999268.1|  endoplasmin precursor                                 152   6e-39    Sus scrofa [pigs]
ref|NP_001083114.1|  uncharacterized protein LOC398753 precursor        152   6e-39    Xenopus laevis [clawed frog]
ref|XP_006782653.1|  PREDICTED: endoplasmin-like                        152   6e-39    Neolamprologus brichardi [lyretail cichlid]
gb|AEE63339.1|  unknown                                                 152   7e-39    Dendroctonus ponderosae
gb|ERL91651.1|  hypothetical protein D910_08979                         152   7e-39    Dendroctonus ponderosae
ref|XP_007950582.1|  PREDICTED: endoplasmin                             152   7e-39    Orycteropus afer afer
ref|XP_006039346.1|  PREDICTED: endoplasmin-like                        148   7e-39    
ref|XP_011474862.1|  PREDICTED: endoplasmin                             152   7e-39    
ref|XP_003694125.1|  PREDICTED: endoplasmin-like                        152   7e-39    Apis florea [dwarf honeybee]
emb|CAG08708.1|  unnamed protein product                                152   7e-39    Tetraodon nigroviridis
ref|XP_008062311.1|  PREDICTED: endoplasmin isoform X1                  152   8e-39    
ref|XP_003461118.1|  PREDICTED: endoplasmin isoform X1                  152   8e-39    Cavia porcellus [guinea pig]
gb|AAK74072.1|  heat shock protein gp96 precursor                       152   8e-39    Homo sapiens [man]
ref|XP_004675798.1|  PREDICTED: endoplasmin                             152   8e-39    
ref|XP_003493872.1|  PREDICTED: endoplasmin-like                        152   8e-39    Bombus impatiens
gb|KFB42185.1|  AGAP001424-PA-like protein                              152   8e-39    Anopheles sinensis
ref|XP_008841379.1|  PREDICTED: endoplasmin                             152   1e-38    Nannospalax galili
gb|ENN73291.1|  hypothetical protein YQE_10055                          152   1e-38    Dendroctonus ponderosae
ref|XP_005984835.1|  PREDICTED: endoplasmin                             151   1e-38    Pantholops hodgsonii [Tibetan antelope]
ref|NP_937853.1|  endoplasmin precursor                                 151   1e-38    Danio rerio [leopard danio]
ref|XP_008255217.1|  PREDICTED: endoplasmin                             151   1e-38    Oryctolagus cuniculus [domestic rabbit]
ref|XP_006871146.1|  PREDICTED: endoplasmin                             151   1e-38    Chrysochloris asiatica
gb|KDR24512.1|  Endoplasmin                                             151   1e-38    Zootermopsis nevadensis
gb|ACS75351.1|  endoplasmin                                             151   2e-38    Locusta migratoria
sp|Q9NKX1.2|ENPL_DICDI  RecName: Full=Endoplasmin homolog; AltNam...    151   2e-38    Dictyostelium discoideum
ref|XP_641313.1|  heat shock protein Hsp90 family protein               151   2e-38    Dictyostelium discoideum AX4
dbj|BAA94290.2|  glucose-regulated protein 94                           151   2e-38    Dictyostelium discoideum
ref|XP_009700867.1|  PREDICTED: endoplasmin                             151   2e-38    Cariama cristata
ref|XP_004999393.1|  PREDICTED: endoplasmin isoform X2                  151   2e-38    
gb|ELK25961.1|  Endoplasmin                                             152   2e-38    Myotis davidii
ref|XP_004994487.1|  heat shock protein gp96                            151   2e-38    Salpingoeca rosetta
ref|XP_004446859.1|  PREDICTED: endoplasmin isoform 1                   151   2e-38    
ref|XP_004446860.1|  PREDICTED: endoplasmin isoform 2                   151   2e-38    
gb|EFX71215.1|  hypothetical protein DAPPUDRAFT_309186                  151   2e-38    Daphnia pulex
ref|XP_002155110.2|  PREDICTED: heat shock protein HSP 90-alpha         141   2e-38    
gb|KFP55508.1|  Endoplasmin                                             151   2e-38    
ref|XP_002752963.1|  PREDICTED: endoplasmin                             151   2e-38    
gb|KFQ43502.1|  Endoplasmin                                             150   2e-38    
ref|XP_395614.3|  PREDICTED: endoplasmin-like isoform 1                 151   2e-38    
ref|XP_007527982.1|  PREDICTED: endoplasmin                             151   2e-38    
ref|XP_006633152.1|  PREDICTED: endoplasmin-like                        151   2e-38    
emb|CBK24402.2|  unnamed protein product                                151   3e-38    
ref|NP_001084280.1|  heat shock protein 90kDa beta (Grp94), membe...    150   3e-38    
ref|XP_001599282.1|  PREDICTED: endoplasmin                             150   3e-38    
ref|XP_004650619.1|  PREDICTED: endoplasmin                             150   3e-38    
gb|KFP37272.1|  Endoplasmin                                             150   3e-38    
emb|CBK20696.2|  unnamed protein product                                150   3e-38    
gb|KFP21894.1|  Endoplasmin                                             150   3e-38    
ref|XP_008281449.1|  PREDICTED: endoplasmin                             150   3e-38    
gb|ELU00023.1|  hypothetical protein CAPTEDRAFT_159587                  150   3e-38    
gb|KFU95780.1|  Endoplasmin                                             150   3e-38    
ref|XP_009844916.1|  hypothetical protein H257_17728                    148   3e-38    
ref|NP_001127573.1|  endoplasmin precursor                              150   3e-38    
ref|XP_001746031.1|  hypothetical protein                               150   3e-38    
ref|XP_003443932.1|  PREDICTED: endoplasmin-like                        150   4e-38    
gb|ABA06415.1|  83 kDa heat shock protein                               142   4e-38    
ref|XP_011330408.1|  PREDICTED: endoplasmin                             150   4e-38    
ref|XP_004700402.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmin        150   4e-38    
ref|XP_005929149.1|  PREDICTED: endoplasmin-like                        150   5e-38    
ref|XP_005728136.1|  PREDICTED: endoplasmin-like                        150   6e-38    
ref|XP_004567801.1|  PREDICTED: endoplasmin-like                        150   6e-38    
ref|XP_008620345.1|  heat shock protein 90kDa beta                      150   6e-38    
pdb|3H80|A  Chain A, Crystal Structure Of The Amino-Terminal Doma...    142   6e-38    
ref|XP_004358722.1|  heat shock protein Hsp90 family protein            149   6e-38    
ref|XP_001662951.1|  AAEL012827-PA                                      150   6e-38    
gb|KFP29919.1|  Endoplasmin                                             149   6e-38    
gb|EMC80264.1|  Endoplasmin                                             149   6e-38    
gb|KDO21013.1|  hypothetical protein SPRG_13941                         150   6e-38    
gb|KFQ97565.1|  Endoplasmin                                             149   7e-38    
ref|XP_003772640.1|  PREDICTED: endoplasmin-like                        150   7e-38    
gb|KFQ54644.1|  Endoplasmin                                             149   7e-38    
ref|XP_002199813.1|  PREDICTED: endoplasmin                             149   7e-38    
gb|KFV74906.1|  Endoplasmin                                             149   7e-38    
ref|XP_005527932.1|  PREDICTED: endoplasmin                             149   7e-38    
gb|KFV91223.1|  Endoplasmin                                             149   7e-38    
gb|KFQ04275.1|  Endoplasmin                                             149   8e-38    
ref|XP_009906642.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmin        149   8e-38    
ref|XP_009464118.1|  PREDICTED: endoplasmin                             149   8e-38    
gb|KFV06212.1|  Endoplasmin                                             149   8e-38    
gb|KFP75492.1|  Endoplasmin                                             149   8e-38    
gb|KFO95435.1|  Endoplasmin                                             149   8e-38    
ref|XP_009560285.1|  PREDICTED: endoplasmin                             149   8e-38    
gb|KFQ80494.1|  Endoplasmin                                             149   8e-38    
gb|KFM13671.1|  Endoplasmin                                             149   8e-38    
gb|KFV41897.1|  Endoplasmin                                             149   8e-38    
gb|KFQ78325.1|  Endoplasmin                                             149   8e-38    
gb|KFW84338.1|  Endoplasmin                                             149   8e-38    
gb|KFQ37930.1|  Endoplasmin                                             149   8e-38    
gb|AAI29529.1|  Unknown (protein for MGC:160189)                        149   8e-38    
gb|KFW73460.1|  Endoplasmin                                             149   8e-38    
gb|KFO61201.1|  Endoplasmin                                             149   8e-38    
gb|KFO76957.1|  Endoplasmin                                             149   8e-38    
ref|XP_010564611.1|  PREDICTED: endoplasmin                             149   8e-38    
ref|XP_005150492.1|  PREDICTED: endoplasmin                             149   9e-38    
ref|XP_009917591.1|  PREDICTED: endoplasmin                             149   9e-38    
gb|KFU98338.1|  Endoplasmin                                             149   9e-38    
ref|XP_003288550.1|  hypothetical protein DICPUDRAFT_98061              149   9e-38    
gb|KFZ45999.1|  Endoplasmin                                             149   9e-38    
ref|XP_005100278.1|  PREDICTED: mesocentin-like                         151   9e-38    
gb|KFP99533.1|  Endoplasmin                                             149   1e-37    
ref|XP_008310403.1|  PREDICTED: endoplasmin                             149   1e-37    
ref|XP_005494809.1|  PREDICTED: endoplasmin                             149   1e-37    
ref|XP_010195758.1|  PREDICTED: endoplasmin                             149   1e-37    
ref|XP_005040044.1|  PREDICTED: endoplasmin isoform X2                  149   1e-37    
ref|XP_010409181.1|  PREDICTED: endoplasmin                             149   1e-37    
gb|ABG56395.1|  glucose-regulated protein 94                            149   1e-37    
gb|KFO89906.1|  Endoplasmin                                             149   1e-37    
dbj|BAJ98551.1|  predicted protein                                      149   1e-37    
ref|XP_007438500.1|  PREDICTED: endoplasmin                             149   1e-37    
gb|KFV83935.1|  Endoplasmin                                             149   1e-37    
ref|XP_010901527.1|  PREDICTED: endoplasmin-like                        149   1e-37    
ref|XP_003220951.1|  PREDICTED: endoplasmin                             149   1e-37    
ref|XP_005022616.1|  PREDICTED: endoplasmin                             148   1e-37    
gb|AAK69350.1|AF387865_1  heat shock protein 108                        149   1e-37    
ref|XP_010073947.1|  PREDICTED: endoplasmin                             149   1e-37    
ref|XP_321706.5|  AGAP001424-PA                                         149   2e-37    
ref|XP_009286695.1|  PREDICTED: endoplasmin                             149   2e-37    
ref|XP_003967565.1|  PREDICTED: endoplasmin-like                        149   2e-37    
gb|KGL95273.1|  Endoplasmin                                             148   2e-37    
ref|XP_005500402.1|  PREDICTED: endoplasmin                             149   2e-37    
ref|XP_011061023.1|  PREDICTED: endoplasmin                             149   2e-37    
ref|XP_005040043.1|  PREDICTED: endoplasmin isoform X1                  149   2e-37    
ref|XP_003701264.1|  PREDICTED: endoplasmin-like                        149   2e-37    
ref|XP_001844128.1|  endoplasmin                                        148   2e-37    
gb|EPY43731.1|  hypothetical protein AGDE_00190                         143   2e-37    
gb|KFO04912.1|  Endoplasmin                                             148   2e-37    
ref|XP_002141043.1|  Hsp90 protein                                      148   2e-37    
ref|XP_009942600.1|  PREDICTED: endoplasmin                             148   2e-37    
ref|NP_001181938.1|  94 kD glucose-regulated protein precursor          148   2e-37    
gb|ETN62729.1|  endoplasmin                                             148   2e-37    
gb|KFR02424.1|  Endoplasmin                                             148   2e-37    
emb|CDG41617.1|  GRP94a protein                                         148   2e-37    
ref|XP_007541888.1|  PREDICTED: endoplasmin                             148   2e-37    
emb|CBK22622.2|  unnamed protein product                                148   2e-37    
ref|XP_002413149.1|  tumor rejection antigen (gp96), putative           148   3e-37    
gb|KFQ16767.1|  Endoplasmin                                             148   3e-37    
emb|CDQ84254.1|  unnamed protein product                                148   3e-37    
ref|XP_008880478.1|  hypothetical protein H310_14401                    148   3e-37    
gb|ETE69540.1|  Endoplasmin                                             148   3e-37    
ref|XP_001507634.2|  PREDICTED: endoplasmin                             148   3e-37    
ref|XP_008559868.1|  PREDICTED: endoplasmin                             147   4e-37    
ref|XP_008934413.1|  PREDICTED: endoplasmin                             147   4e-37    
ref|XP_005796337.1|  PREDICTED: endoplasmin-like                        147   4e-37    
gb|ADA70351.1|  heat shock protein                                      147   4e-37    
gb|KFZ55452.1|  Endoplasmin                                             147   4e-37    
ref|XP_005310776.1|  PREDICTED: endoplasmin                             147   4e-37    
ref|XP_001899398.1|  Endoplasmin precursor                              147   4e-37    
ref|XP_009843856.1|  hypothetical protein H257_16935                    147   5e-37    
ref|NP_001274194.1|  heat shock protein 90kDa beta (Grp94), membe...    147   5e-37    
ref|XP_011260972.1|  PREDICTED: endoplasmin                             147   5e-37    
ref|XP_010885352.1|  PREDICTED: endoplasmin                             147   6e-37    
ref|NP_999808.1|  heat shock protein gp96 precursor                     147   6e-37    
gb|KHN71590.1|  Endoplasmin                                             147   6e-37    
gb|EPY39497.1|  molecular chaperone HtpG                                142   6e-37    
gb|AEE01388.1|  heat shock protein 90                                   139   6e-37    
ref|XP_007252443.1|  PREDICTED: endoplasmin-like isoform X1             147   7e-37    
emb|CAJ28988.1|  heat shock protein 83                                  137   7e-37    
ref|XP_007252444.1|  PREDICTED: endoplasmin-like isoform X2             147   7e-37    
gb|AAC07922.1|  82 kDa heat shock protein                               140   8e-37    
gb|EKF98902.1|  Heat shock protein 83, putative                         138   8e-37    
gb|KGL81577.1|  Endoplasmin                                             139   8e-37    
ref|XP_011155603.1|  PREDICTED: endoplasmin                             147   8e-37    
ref|XP_009706990.1|  PREDICTED: putative heat shock protein HSP 9...    137   8e-37    
ref|XP_006138079.1|  PREDICTED: endoplasmin                             146   8e-37    
gb|AAC07939.1|  82 kDa heat shock protein                               140   8e-37    
gb|KFP60419.1|  Heat shock protein HSP 90-alpha                         137   8e-37    
ref|XP_010790631.1|  PREDICTED: endoplasmin                             146   1e-36    
gb|KIY96790.1|  molecular chaperone HtpG                                136   1e-36    
gb|EKF26442.1|  Heat shock protein 83, putative                         139   1e-36    
gb|AAC07920.1|  82 kDa heat shock protein                               139   1e-36    
gb|AAC07927.1|  82 kDa heat shock protein                               139   1e-36    
gb|AAC07921.1|  82 kDa heat shock protein                               139   2e-36    
gb|AAC07930.1|  82 kDa heat shock protein                               139   2e-36    
gb|AAC07919.1|  82 kDa heat shock protein                               139   2e-36    
ref|XP_011212529.1|  PREDICTED: endoplasmin                             145   2e-36    
gb|AAC07937.1|  82 kDa heat shock protein                               139   2e-36    
gb|AAC07946.1|  82 kDa heat shock protein                               139   2e-36    
gb|AAC07936.1|  82 kDa heat shock protein                               139   2e-36    
sp|O16087.1|HSP83_DROMI  RecName: Full=Heat shock protein 83; Alt...    139   2e-36    
gb|AAC07942.1|  82 kDa heat shock protein                               139   2e-36    
gb|AAC07917.1|  82 kDa heat shock protein                               139   2e-36    
gb|AAC07924.1|  82 kDa heat shock protein                               139   2e-36    
dbj|BAG61917.1|  unnamed protein product                                137   2e-36    
gb|AAC07947.1|  82 kDa heat shock protein                               139   2e-36    
ref|XP_011152996.1|  PREDICTED: endoplasmin                             145   2e-36    
sp|O16076.1|HSP83_DROPE  RecName: Full=Heat shock protein 83; Alt...    139   2e-36    
gb|AAC07928.1|  82 kDa heat shock protein                               139   2e-36    
emb|CDQ78594.1|  unnamed protein product                                145   2e-36    
ref|XP_011216700.1|  PREDICTED: putative heat shock protein HSP 9...    136   2e-36    
pdb|3O6O|A  Chain A, Crystal Structure Of The N-Terminal Domain O...    137   2e-36    
ref|XP_002262292.1|  endoplasmin homolog                                145   2e-36    
gb|EPY42272.1|  molecular chaperone HtpG                                142   2e-36    
ref|XP_009519039.1|  hypothetical protein PHYSODRAFT_255139             145   3e-36    
ref|XP_628530.1|  heat shock protein 90 (Hsp90), signal peptide p...    145   3e-36    
gb|EKF99923.1|  Heat shock protein 83, putative                         139   3e-36    
gb|ADQ64484.1|  hypothetical protein                                    138   3e-36    
ref|XP_668238.1|  heat shock protein 90                                 145   4e-36    
pdb|1U2O|A  Chain A, Crystal Structure Of The N-Domain Of Grp94 L...    137   4e-36    
pdb|3PEH|A  Chain A, Crystal Structure Of The N-Terminal Domain O...    139   4e-36    
ref|XP_006079133.1|  PREDICTED: heat shock protein HSP 90-alpha i...    144   4e-36    
pdb|3OPD|A  Chain A, Crystal Structure Of The N-Terminal Domain O...    137   4e-36    
ref|XP_002012968.1|  GL23644                                            144   4e-36    
ref|XP_001358252.1|  GA18946                                            144   5e-36    
emb|CAG32523.1|  hypothetical protein RCJMB04_28d6                      137   5e-36    
pdb|4NH9|A  Chain A, Correlation Between Chemotype-dependent Bind...    138   5e-36    
pdb|2FWY|A  Chain A, Structure Of Human Hsp90-Alpha Bound To The ...    138   5e-36    
pdb|1QY5|A  Chain A, Crystal Structure Of The N-Domain Of The Er ...    138   5e-36    
pdb|1U0Y|A  Chain A, N-Domain Of Grp94, With The Charged Domain, ...    138   5e-36    
gb|AAC07935.1|  82 kDa heat shock protein                               138   6e-36    
ref|XP_008814600.1|  heat shock protein 90kDa beta                      144   6e-36    
ref|XP_001617311.1|  endoplasmin precursor                              144   6e-36    
gb|ABB55890.1|  heat shock protein 90                                   142   6e-36    
gb|AAC07948.1|  82 kDa heat shock protein                               138   7e-36    
ref|XP_003878279.1|  heat shock protein 83-1                            143   7e-36    
gb|EKF99676.1|  Heat shock protein 83, putative                         139   7e-36    
ref|XP_004224999.1|  endoplasmin precursor                              144   7e-36    
ref|XP_811792.1|  heat shock protein 83                                 138   8e-36    
ref|XP_002021280.1|  Hsp83                                              139   8e-36    
ref|XP_001441660.1|  hypothetical protein                               142   8e-36    
ref|XP_006004183.1|  PREDICTED: endoplasmin isoform X1                  144   8e-36    
gb|AJG42174.1|  heat shock protein 90                                   135   9e-36    
gb|AAL83217.1|AF473560_1  heat shock protein 90 alpha                   136   9e-36    
gb|AAC07938.1|  82 kDa heat shock protein                               137   9e-36    
pdb|3HHU|A  Chain A, Human Heat-Shock Protein 90 (Hsp90) In Compl...    136   1e-35    
emb|CAD66568.1|  unnamed protein product                                137   1e-35    
gb|EPY30260.1|  molecular chaperone HtpG                                143   1e-35    
ref|XP_003140246.1|  endoplasmin                                        143   1e-35    
ref|XP_006004184.1|  PREDICTED: endoplasmin isoform X2                  144   1e-35    
gb|AHN92447.1|  heat shock protein 90                                   134   1e-35    
ref|XP_006748995.1|  PREDICTED: heat shock protein HSP 90-alpha-like    137   1e-35    
ref|XP_006985046.1|  PREDICTED: heat shock protein HSP 90-beta-like     135   1e-35    
pdb|2XJJ|A  Chain A, Structure Of Hsp90 With Small Molecule Inhib...    137   1e-35    
gb|AER60491.1|  heat shock protein gp96                                 144   1e-35    
pir||S57415  Hsp83 protein - Leishmania donovani infantum               142   1e-35 
pdb|2QFO|A  Chain A, Hsp90 Complexed With A143571 And A516383           135   1e-35    
gb|AAC07940.1|  82 kDa heat shock protein                               137   1e-35    
pdb|3FT5|A  Chain A, Structure Of Hsp90 Bound With A Novel Fragment     137   1e-35    
dbj|BAF63637.1|  glucose-regulated protein 94                           143   1e-35    
ref|XP_004523400.1|  PREDICTED: endoplasmin-like                        143   1e-35    
ref|XP_003863861.1|  heat shock protein 83-1                            142   1e-35    
pdb|3TUH|A  Chain A, Crystal Structure Of The N-Terminal Domain O...    135   1e-35    
pdb|4LWE|A  Chain A, Crystal Structure Of The Human Hsp90-alpha N...    135   1e-35    
sp|Q25293.2|HSP83_LEIIN  RecName: Full=Heat shock protein 83-1; S...    142   1e-35    
ref|XP_002072044.1|  GK22636                                            143   1e-35    
gb|AEX08891.1|  heat-shock protein 90                                   135   1e-35    
ref|XP_003392730.1|  heat shock protein 83-1                            142   1e-35    
ref|XP_010755578.1|  PREDICTED: endoplasmin isoform X1                  143   1e-35    
pdb|3QDD|A  Chain A, Hsp90a N-Terminal Domain In Complex With Bii...    136   1e-35    
pdb|2YJW|A  Chain A, Tricyclic Series Of Hsp90 Inhibitors               135   1e-35    
pdb|1UYI|A  Chain A, Human Hsp90-Alpha With 8-(2,5-Dimethoxy-Benz...    136   1e-35    
pdb|1OSF|A  Chain A, Human Hsp90 In Complex With 17-desmethoxy-17...    135   1e-35    
pdb|2BSM|A  Chain A, Novel, Potent Small Molecule Inhibitors Of T...    136   1e-35    
ref|XP_001685762.1|  heat shock protein 83-1                            142   1e-35    
ref|XP_001685759.1|  heat shock protein 83-1                            142   1e-35    
pdb|2YI0|A  Chain A, Structural Characterization Of 5-Aryl-4-(5-S...    136   1e-35    
pdb|3D0B|A  Chain A, Crystal Structure Of Benzamide Tetrahydro-4h...    136   1e-35    



>emb|CDP07384.1| unnamed protein product [Coffea canephora]
Length=815

 Score =   323 bits (827),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 190/201 (95%), Positives = 196/201 (98%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW VPAVLFLLCLLFLLPDQGRKIHANAEVD+DAPVDPPKVEEKIG VP+GLSTD DV
Sbjct  1    MRKWTVPAVLFLLCLLFLLPDQGRKIHANAEVDADAPVDPPKVEEKIGAVPNGLSTDSDV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
             KREAESMS+RTLRA AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKREAESMSRRTLRATAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDK+ILGEGDTAKLEIQIKLDK+KKILSIRDRGIGMTKEDLVKNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEILGEGDTAKLEIQIKLDKEKKILSIRDRGIGMTKEDLVKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  181  VEKMQTSGDLNLIGQFGVGFY  201



>ref|XP_011083591.1| PREDICTED: endoplasmin homolog [Sesamum indicum]
Length=808

 Score =   315 bits (806),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 183/201 (91%), Positives = 194/201 (97%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW +P+VLFLLCLLFLLPDQGRKI ANAEVDSDAP+DPPKVEEKIGGVP+GLSTD DV
Sbjct  1    MRKWTIPSVLFLLCLLFLLPDQGRKIQANAEVDSDAPLDPPKVEEKIGGVPNGLSTDSDV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
             KREAESMS+RTLRA AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKREAESMSRRTLRANAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FL+LTDK++LGEGD  KLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLALTDKEVLGEGDNTKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  181  VEKMQTSGDLNLIGQFGVGFY  201



>gb|EYU38796.1| hypothetical protein MIMGU_mgv1a001101mg [Erythranthe guttata]
Length=889

 Score =   314 bits (805),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 184/202 (91%), Positives = 192/202 (95%), Gaps = 0/202 (0%)
 Frame = +1

Query  19   TMRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPD  198
            TMRKW +P+VLFLLCLLFLLPDQGRKI ANAEVDSDA VDPPKVEEK+G VPHGLSTD D
Sbjct  70   TMRKWTIPSVLFLLCLLFLLPDQGRKIQANAEVDSDAAVDPPKVEEKLGAVPHGLSTDSD  129

Query  199  VAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI  378
            V KREAESMS+R LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI
Sbjct  130  VVKREAESMSRRNLRTNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI  189

Query  379  RFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSA  558
            RFLSLTDK+ILGEGD AKLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSA
Sbjct  190  RFLSLTDKEILGEGDDAKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSA  249

Query  559  FVEKMQSSGDLNLIGQFGVGFY  624
            FVEKMQ+SGDLNLIGQFGVGFY
Sbjct  250  FVEKMQTSGDLNLIGQFGVGFY  271



>ref|XP_009596271.1| PREDICTED: endoplasmin homolog, partial [Nicotiana tomentosiformis]
Length=644

 Score =   307 bits (787),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 178/201 (89%), Positives = 191/201 (95%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW +P+VLFLLCLLFLLPDQGR+I ANAE +SD PVDPPKVEEK G +PHGLSTD DV
Sbjct  1    MRKWTIPSVLFLLCLLFLLPDQGRRIQANAEAESDVPVDPPKVEEKFGAIPHGLSTDSDV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
             KRE+ESMS++TLRA AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESMSRKTLRADAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDK++LGEGD AKLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGDNAKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  181  VEKMQTSGDLNLIGQFGVGFY  201



>gb|EYU36792.1| hypothetical protein MIMGU_mgv1a001447mg [Erythranthe guttata]
Length=818

 Score =   311 bits (797),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 177/201 (88%), Positives = 191/201 (95%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW +P+VLFLLCLLFLLPDQGRKIHANAE DSD P+DPPKVEEKIG VPHGLSTD +V
Sbjct  1    MRKWTIPSVLFLLCLLFLLPDQGRKIHANAEADSDVPLDPPKVEEKIGAVPHGLSTDSEV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
             KREAESMS++TLRA A+KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKREAESMSRKTLRASAQKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDK++LGEGD  KLEIQIKLDK+ KILSIRDRG+GMTKEDL+KNLGTIA+SGTSAF
Sbjct  121  FLSLTDKEVLGEGDNTKLEIQIKLDKENKILSIRDRGVGMTKEDLIKNLGTIARSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  181  VEKMQTSGDLNLIGQFGVGFY  201



>ref|XP_009606988.1| PREDICTED: endoplasmin homolog [Nicotiana tomentosiformis]
Length=812

 Score =   309 bits (792),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 178/201 (89%), Positives = 192/201 (96%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW +P+VLFLLCLLFLLPDQGR+I ANAE +SDAPVDPPKVEEK+G VPHGLSTD DV
Sbjct  1    MRKWTIPSVLFLLCLLFLLPDQGRRIQANAEAESDAPVDPPKVEEKLGAVPHGLSTDSDV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
             KRE+ESMS++TLRA AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESMSRKTLRADAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDK++LGEGD  +LEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGDNTELEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  181  VEKMQTSGDLNLIGQFGVGFY  201



>ref|XP_009791520.1| PREDICTED: endoplasmin homolog [Nicotiana sylvestris]
Length=811

 Score =   309 bits (791),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 179/201 (89%), Positives = 191/201 (95%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW +P+VLFLLCLLFLLPDQGR+I ANAE +SDAPVDPPKVEEK G VPHGLSTD DV
Sbjct  1    MRKWTIPSVLFLLCLLFLLPDQGRRIQANAEAESDAPVDPPKVEEKFGAVPHGLSTDSDV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
             KRE+ESMS++TLRA AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESMSRKTLRADAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDK++LGEGD  KLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGDNTKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  181  VEKMQTSGDLNLIGQFGVGFY  201



>sp|P35016.1|ENPL_CATRO RecName: Full=Endoplasmin homolog; AltName: Full=Glucose-regulated 
protein 94 homolog; Short=GRP-94 homolog; Flags: Precursor 
[Catharanthus roseus]
 gb|AAA16785.1| heat shock protein 90 [Catharanthus roseus]
Length=817

 Score =   309 bits (791),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 178/201 (89%), Positives = 187/201 (93%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW VP+VLFLLC       QGRKIHANAE DSDAPVDPPKVE+KIG VP+GLSTD DV
Sbjct  1    MRKWTVPSVLFLLCPSLSSSCQGRKIHANAEADSDAPVDPPKVEDKIGAVPNGLSTDSDV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
            AKREAESMS R LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESMSMRNLRSDAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FL+LTDK+ILGEGDTAKLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLALTDKEILGEGDTAKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  181  VEKMQTSGDLNLIGQFGVGFY  201



>dbj|BAL42333.1| Heat shock protein 90 [Nicotiana tabacum]
Length=812

 Score =   308 bits (789),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 178/201 (89%), Positives = 191/201 (95%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW +P+VLFLLCLLFLLPDQGR+I ANAE +SD PVDPPKVEEK G +PHGLSTD DV
Sbjct  1    MRKWTIPSVLFLLCLLFLLPDQGRRIQANAEAESDVPVDPPKVEEKFGAIPHGLSTDSDV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
             KRE+ESMS++TLRA AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESMSRKTLRADAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDK++LGEGD AKLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGDNAKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  181  VEKMQTSGDLNLIGQFGVGFY  201



>ref|XP_002273785.1| PREDICTED: endoplasmin homolog [Vitis vinifera]
 emb|CBI19885.3| unnamed protein product [Vitis vinifera]
Length=818

 Score =   307 bits (786),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 178/201 (89%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW +P+ L LLCLL LLPDQGRKIHANAE DS+  V+PPKVEEKIG VP+GLSTD DV
Sbjct  1    MRKWTIPSALLLLCLLCLLPDQGRKIHANAEADSEELVNPPKVEEKIGAVPNGLSTDSDV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
            AKREAES+SKR LRA AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRNLRANAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDK+ILGEGDTAKL+IQIKLDK+KKILSIRDRGIGMTK+DL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEILGEGDTAKLDIQIKLDKEKKILSIRDRGIGMTKDDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  181  VEKMQTSGDLNLIGQFGVGFY  201



>ref|XP_004238368.1| PREDICTED: endoplasmin homolog [Solanum lycopersicum]
Length=812

 Score =   306 bits (783),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 176/201 (88%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW +P VLFLLCL++L+PDQGRKI ANAE DSDAPVDPPKVEEK G VP+GLSTD DV
Sbjct  1    MRKWKIPFVLFLLCLIYLVPDQGRKIQANAEADSDAPVDPPKVEEKFGAVPNGLSTDSDV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
            AKREAESMS++TLRA AEKFEFQAEVSRLMDI+INSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESMSRKTLRASAEKFEFQAEVSRLMDILINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FL+LTDK++LGEGD  KLEIQIKLDK+KKILSIRDRG+GMTKEDL KNLGTIAKSGTSAF
Sbjct  121  FLALTDKEVLGEGDNTKLEIQIKLDKEKKILSIRDRGVGMTKEDLRKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  181  VEKMQTSGDLNLIGQFGVGFY  201



>ref|XP_006342064.1| PREDICTED: endoplasmin homolog [Solanum tuberosum]
Length=806

 Score =   305 bits (782),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 176/201 (88%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW +P VLFLLCL+FL+PDQGRKI ANAE DSDAPVDPPKVEEK G VP+GLSTD DV
Sbjct  1    MRKWTIPFVLFLLCLIFLVPDQGRKIQANAEADSDAPVDPPKVEEKFGAVPNGLSTDSDV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
            AKREAESMS++TLRA AEKFEFQAEVSRLMDI+INSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESMSRKTLRASAEKFEFQAEVSRLMDILINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FL+LTDK++LGEGD  KLEIQIKLDK+KKIL IRDRG+GMTKEDL KNLGTIAKSGTSAF
Sbjct  121  FLALTDKEVLGEGDNTKLEIQIKLDKEKKILFIRDRGVGMTKEDLRKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  181  VEKMQTSGDLNLIGQFGVGFY  201



>ref|XP_009791518.1| PREDICTED: endoplasmin homolog [Nicotiana sylvestris]
Length=811

 Score =   305 bits (781),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 176/201 (88%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW +P+VLFLLCLLFLLPDQGR+I ANAE +SD PVDPPKVEEK G +PHGLSTD DV
Sbjct  1    MRKWTIPSVLFLLCLLFLLPDQGRRIQANAEAESDVPVDPPKVEEKFGAIPHGLSTDSDV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
             KRE+ESMS++TLRA AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESMSRKTLRADAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDK++LGEG+  KLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGENTKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  181  VEKMQTSGDLNLIGQFGVGFY  201



>dbj|BAL42332.1| Heat shock protein 90 [Nicotiana tabacum]
Length=811

 Score =   305 bits (781),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 176/201 (88%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW +P+VLFLLCLLFLLPDQGR+I ANAE +SD PVDPPKVEEK G +PHGLSTD DV
Sbjct  1    MRKWTIPSVLFLLCLLFLLPDQGRRIQANAEAESDVPVDPPKVEEKFGAIPHGLSTDSDV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
             KRE+ESMS++TLRA AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESMSRKTLRADAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDK++LGEG+  KLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGENTKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  181  VEKMQTSGDLNLIGQFGVGFY  201



>gb|KDO84888.1| hypothetical protein CISIN_1g003458mg [Citrus sinensis]
Length=507

 Score =   294 bits (753),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 170/201 (85%), Positives = 185/201 (92%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW +P++L LL L+ L+PDQGR I A AE +SD  VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTIPSILLLLFLVALIPDQGRNIQAKAEDESDKLVDPPKVEEKLGAVPNGLSTDSDV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
            AKREAES+SKR+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDK++LGEGD  KLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGDNTKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  181  VEKMQTSGDLNLIGQFGVGFY  201



>emb|CAN79404.1| hypothetical protein VITISV_028074 [Vitis vinifera]
Length=1084

 Score =   305 bits (782),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 178/201 (89%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW +P+ L LLCLL LLPDQGRKIHANAE DS+  V+PPKVEEKIG VP+GLSTD DV
Sbjct  266  MRKWTIPSALLLLCLLCLLPDQGRKIHANAEADSEELVNPPKVEEKIGAVPNGLSTDSDV  325

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
            AKREAES+SKR LRA AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  326  AKREAESISKRNLRANAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  385

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDK+ILGEGDTAKL+IQIKLDK+KKILSIRDRGIGMTK+DL+KNLGTIAKSGTSAF
Sbjct  386  FLSLTDKEILGEGDTAKLDIQIKLDKEKKILSIRDRGIGMTKDDLIKNLGTIAKSGTSAF  445

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  446  VEKMQTSGDLNLIGQFGVGFY  466



>ref|XP_011074690.1| PREDICTED: endoplasmin homolog [Sesamum indicum]
Length=811

 Score =   300 bits (769),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 178/201 (89%), Positives = 191/201 (95%), Gaps = 1/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW + +VLFLLCLLFL PDQGRKIH NA+ DSDA VDPPKVEEKIG VP+GLSTD +V
Sbjct  1    MRKWTI-SVLFLLCLLFLFPDQGRKIHVNAKGDSDASVDPPKVEEKIGAVPNGLSTDSNV  59

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
            AKREAESMS+RTLRA AE+FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  60   AKREAESMSRRTLRANAERFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  119

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDK++LGEGD AKLE+QIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  120  FLSLTDKEVLGEGDDAKLEMQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  179

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  180  VEKMQTSGDLNLIGQFGVGFY  200



>ref|XP_004499283.1| PREDICTED: endoplasmin homolog isoform X3 [Cicer arietinum]
Length=816

 Score =   300 bits (768),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW +P+ L LL LL L  DQG+K+ ANAE +SD  VDPPKVE+KIG VPHGLSTD DV
Sbjct  1    MRKWTIPSALLLLSLLLLFADQGQKLKANAEDNSDELVDPPKVEDKIGAVPHGLSTDSDV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
            AKREAES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDKDILGEGD AKL+IQIKLDK+KKILSIRDRGIGMTKEDLVKNLGTIAKSGTSAF
Sbjct  121  FLSLTDKDILGEGDNAKLDIQIKLDKEKKILSIRDRGIGMTKEDLVKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  181  VEKMQTSGDLNLIGQFGVGFY  201



>gb|KDO84887.1| hypothetical protein CISIN_1g003458mg [Citrus sinensis]
Length=584

 Score =   294 bits (753),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 170/201 (85%), Positives = 185/201 (92%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW +P++L LL L+ L+PDQGR I A AE +SD  VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTIPSILLLLFLVALIPDQGRNIQAKAEDESDKLVDPPKVEEKLGAVPNGLSTDSDV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
            AKREAES+SKR+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDK++LGEGD  KLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGDNTKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  181  VEKMQTSGDLNLIGQFGVGFY  201



>ref|XP_004499281.1| PREDICTED: endoplasmin homolog isoform X1 [Cicer arietinum]
 ref|XP_004499282.1| PREDICTED: endoplasmin homolog isoform X2 [Cicer arietinum]
Length=817

 Score =   300 bits (768),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW +P+ L LL LL L  DQG+K+ ANAE +SD  VDPPKVE+KIG VPHGLSTD DV
Sbjct  1    MRKWTIPSALLLLSLLLLFADQGQKLKANAEDNSDELVDPPKVEDKIGAVPHGLSTDSDV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
            AKREAES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDKDILGEGD AKL+IQIKLDK+KKILSIRDRGIGMTKEDLVKNLGTIAKSGTSAF
Sbjct  121  FLSLTDKDILGEGDNAKLDIQIKLDKEKKILSIRDRGIGMTKEDLVKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  181  VEKMQTSGDLNLIGQFGVGFY  201



>gb|KDP36908.1| hypothetical protein JCGZ_08199 [Jatropha curcas]
Length=821

 Score =   299 bits (766),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 170/201 (85%), Positives = 187/201 (93%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW +P+ L LLCLL ++ DQGR +HANAE DS  PVDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTIPSALLLLCLLSVISDQGRNLHANAEADSQNPVDPPKVEEKLGAVPNGLSTDSDV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
            AKREAES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FL+LTDK++LGEGD  KL+IQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLALTDKEVLGEGDNTKLDIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  181  VEKMQTSGDLNLIGQFGVGFY  201



>ref|XP_010539097.1| PREDICTED: endoplasmin homolog [Tarenaya hassleriana]
Length=830

 Score =   298 bits (763),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 187/201 (93%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW +P+VLF +CL+FLLPDQGRK+HANA+  SD  VDPPKVEEK+GG+  GLSTD DV
Sbjct  1    MRKWTIPSVLFFVCLIFLLPDQGRKLHANADGSSDEVVDPPKVEEKVGGIHGGLSTDSDV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
              RE+ESMSKRTLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VHRESESMSKRTLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDKD+LGEGD AKLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKDVLGEGDNAKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ SGDLNLIGQFGVGFY
Sbjct  181  VEKMQKSGDLNLIGQFGVGFY  201



>ref|XP_010109992.1| Endoplasmin-like protein [Morus notabilis]
 gb|EXC25010.1| Endoplasmin-like protein [Morus notabilis]
Length=1004

 Score =   301 bits (770),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 178/201 (89%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW +P+ LFLLCLLFLLPDQGRK+ ANAE  SD  VDPPKVEEKIG VP+GLSTD DV
Sbjct  1    MRKWTIPSALFLLCLLFLLPDQGRKLQANAEGSSDDLVDPPKVEEKIGAVPNGLSTDSDV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
             KREAES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDA+DKIR
Sbjct  61   VKREAESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDAIDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDK+ILGEGDTAKLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEILGEGDTAKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  181  VEKMQTSGDLNLIGQFGVGFY  201



>ref|XP_003589505.1| Endoplasmin-like protein [Medicago truncatula]
 gb|AES59756.1| heat shock protein 81-2 [Medicago truncatula]
Length=818

 Score =   298 bits (762),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 185/201 (92%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW +P+ L LL LL LL DQG+K  ANAE +SD  VDPPKVEEK+G VPHGLSTD DV
Sbjct  1    MRKWTIPSTLLLLSLLLLLADQGQKFQANAEGNSDEIVDPPKVEEKLGAVPHGLSTDSDV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
             KRE+ES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDKDILGEGD AKLEIQIKLDK+KKILSIRDRGIGMTKEDLVKNLGTIAKSGTSAF
Sbjct  121  FLSLTDKDILGEGDNAKLEIQIKLDKEKKILSIRDRGIGMTKEDLVKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  181  VEKMQTSGDLNLIGQFGVGFY  201



>ref|XP_002307732.1| hypothetical protein POPTR_0005s26260g [Populus trichocarpa]
 gb|EEE94728.1| hypothetical protein POPTR_0005s26260g [Populus trichocarpa]
Length=823

 Score =   297 bits (760),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 173/201 (86%), Positives = 188/201 (94%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW VP+VL LLCLL L+ DQG+K+HA AE DSD+ VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTVPSVLLLLCLLSLISDQGQKLHAKAEDDSDSLVDPPKVEEKLGAVPNGLSTDSDV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
             KRE+ES+SKRTLR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESISKRTLRNTAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDK++LGEGD AKL+IQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGDNAKLDIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  181  VEKMQTSGDLNLIGQFGVGFY  201



>ref|XP_011045067.1| PREDICTED: endoplasmin homolog [Populus euphratica]
Length=823

 Score =   296 bits (759),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 173/201 (86%), Positives = 188/201 (94%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW VP+VL LLCLL L+ DQG+K+HA AE DSD+ VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTVPSVLLLLCLLSLISDQGQKLHAKAEDDSDSLVDPPKVEEKLGAVPNGLSTDSDV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
             KRE+ES+SKRTLR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESISKRTLRNTAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDK++LGEGD AKL+IQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGDNAKLDIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  181  VEKMQTSGDLNLIGQFGVGFY  201



>gb|KDO84886.1| hypothetical protein CISIN_1g003458mg [Citrus sinensis]
Length=762

 Score =   295 bits (755),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 170/201 (85%), Positives = 185/201 (92%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW +P++L LL L+ L+PDQGR I A AE +SD  VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTIPSILLLLFLVALIPDQGRNIQAKAEDESDKLVDPPKVEEKLGAVPNGLSTDSDV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
            AKREAES+SKR+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDK++LGEGD  KLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGDNTKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  181  VEKMQTSGDLNLIGQFGVGFY  201



>ref|XP_009409971.1| PREDICTED: endoplasmin homolog [Musa acuminata subsp. malaccensis]
Length=814

 Score =   295 bits (756),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 186/203 (92%), Gaps = 2/203 (1%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEV--DSDAPVDPPKVEEKIGGVPHGLSTDP  195
            MRKWA+P+ L LL LL  +PD+GRK+HANAE   DSD  VDPPKVE+K+G VPHGLSTD 
Sbjct  1    MRKWALPSALLLLLLLSTIPDRGRKLHANAEDSGDSDELVDPPKVEDKLGAVPHGLSTDS  60

Query  196  DVAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK  375
            +VAKREAES+S+RTLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK
Sbjct  61   EVAKREAESISRRTLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK  120

Query  376  IRFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTS  555
            IRFLSLTDK++LGEGD  KL+I IKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTS
Sbjct  121  IRFLSLTDKEVLGEGDNTKLDILIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTS  180

Query  556  AFVEKMQSSGDLNLIGQFGVGFY  624
            AFVEKMQ+ GDLNLIGQFGVGFY
Sbjct  181  AFVEKMQTGGDLNLIGQFGVGFY  203



>ref|XP_006473673.1| PREDICTED: endoplasmin homolog [Citrus sinensis]
Length=822

 Score =   295 bits (756),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 185/201 (92%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW +P++L LL LL L+PDQGR I A AE +SD  VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTIPSILLLLFLLALIPDQGRNIQAKAEDESDKLVDPPKVEEKLGAVPNGLSTDSDV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
            AKREAES+SKR+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDK++LGEGD  KLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGDNTKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  181  VEKMQTSGDLNLIGQFGVGFY  201



>ref|XP_008377135.1| PREDICTED: endoplasmin homolog [Malus domestica]
Length=818

 Score =   295 bits (756),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 170/201 (85%), Positives = 185/201 (92%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW +P+VL LLCLL LLPDQGRK+ ANAE DSD  VDPPKVEEKIG VP GLSTD DV
Sbjct  1    MRKWTIPSVLLLLCLLSLLPDQGRKLQANAEADSDELVDPPKVEEKIGAVPSGLSTDSDV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
            AKREAES+SKR+ R+ A+ FEFQAEVSRLMDIII+SLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRSQRSNAQHFEFQAEVSRLMDIIIHSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FL+LTDKD+LGEGD   LEIQIKLDK+K+I+SIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLALTDKDVLGEGDDTNLEIQIKLDKEKRIISIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  181  VEKMQTSGDLNLIGQFGVGFY  201



>ref|XP_006435195.1| hypothetical protein CICLE_v10000296mg [Citrus clementina]
 gb|ESR48435.1| hypothetical protein CICLE_v10000296mg [Citrus clementina]
Length=820

 Score =   295 bits (756),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 170/201 (85%), Positives = 185/201 (92%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW +P++L LL L+ L+PDQGR I A AE +SD  VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTIPSILLLLFLVALIPDQGRNIQAKAEDESDKLVDPPKVEEKLGAVPNGLSTDSDV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
            AKREAES+SKR+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDK++LGEGD  KLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGDNTKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  181  VEKMQTSGDLNLIGQFGVGFY  201



>gb|KDO84884.1| hypothetical protein CISIN_1g003458mg [Citrus sinensis]
Length=818

 Score =   295 bits (755),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 170/201 (85%), Positives = 185/201 (92%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW +P++L LL L+ L+PDQGR I A AE +SD  VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTIPSILLLLFLVALIPDQGRNIQAKAEDESDKLVDPPKVEEKLGAVPNGLSTDSDV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
            AKREAES+SKR+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDK++LGEGD  KLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGDNTKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  181  VEKMQTSGDLNLIGQFGVGFY  201



>ref|XP_008387928.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmin homolog [Malus domestica]
Length=818

 Score =   295 bits (754),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 170/201 (85%), Positives = 187/201 (93%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW +P+VL LLCLL LLPDQGRK+ ANAE +SD  VDPPKVEEKIG VP+GL+TD DV
Sbjct  1    MRKWTIPSVLLLLCLLSLLPDQGRKLQANAEANSDELVDPPKVEEKIGAVPNGLTTDSDV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
            AKREAES+SKR+ R+ A+ FEFQAEVSRLMDIII+SLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRSQRSNAQHFEFQAEVSRLMDIIIHSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FL+LTDKD+LGEGD  KLEIQIKLDK+K+ILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLALTDKDVLGEGDNTKLEIQIKLDKEKRILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  181  VEKMQTSGDLNLIGQFGVGFY  201



>dbj|BAD94659.1| HSP90-like protein [Arabidopsis thaliana]
Length=328

 Score =   281 bits (719),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 169/182 (93%), Gaps = 1/182 (1%)
 Frame = +1

Query  79   PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEK  258
            PDQGRK+HANAE  SD   DPPKVEEKIGG   GLSTD DV  RE+ESMSK+TLR+ AEK
Sbjct  20   PDQGRKLHANAEESSDDVTDPPKVEEKIGG-HGGLSTDSDVVHRESESMSKKTLRSNAEK  78

Query  259  FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkle  438
            FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKLE
Sbjct  79   FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKLE  138

Query  439  iqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGVG  618
            IQIKLDK KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGVG
Sbjct  139  IQIKLDKAKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGVG  198

Query  619  FY  624
            FY
Sbjct  199  FY  200



>ref|XP_009334927.1| PREDICTED: endoplasmin homolog [Pyrus x bretschneideri]
Length=818

 Score =   294 bits (753),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 170/201 (85%), Positives = 187/201 (93%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW +P+VL LLCLL LLPDQGRK+ ANAE +SD  VDPPKVEEKIG VP+GL+TD DV
Sbjct  1    MRKWTIPSVLLLLCLLSLLPDQGRKLQANAEANSDELVDPPKVEEKIGAVPNGLTTDSDV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
            AKREAES+SKR+ R+ A+ FEFQAEVSRLMDIII+SLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRSQRSNAQHFEFQAEVSRLMDIIIHSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FL+LTDKD+LGEGD  KLEIQIKLDK+K+ILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLALTDKDVLGEGDNTKLEIQIKLDKEKRILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  181  VEKMQTSGDLNLIGQFGVGFY  201



>ref|XP_003550428.1| PREDICTED: endoplasmin homolog isoform X1 [Glycine max]
 gb|KHN12637.1| Endoplasmin like [Glycine soja]
Length=814

 Score =   293 bits (750),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW V + L LL LLFL  DQGRK  ANAE DSD  VDPPKVE+KIG VPHGLSTD DV
Sbjct  1    MRKWTVASALLLLSLLFLFADQGRKFQANAEGDSDELVDPPKVEDKIGAVPHGLSTDSDV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
             KRE+ES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDKD+LGEGD  KL+IQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKDVLGEGDNTKLDIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  181  VEKMQTSGDLNLIGQFGVGFY  201



>ref|XP_006601356.1| PREDICTED: endoplasmin homolog isoform X2 [Glycine max]
Length=813

 Score =   293 bits (750),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW V + L LL LLFL  DQGRK  ANAE DSD  VDPPKVE+KIG VPHGLSTD DV
Sbjct  1    MRKWTVASALLLLSLLFLFADQGRKFQANAEGDSDELVDPPKVEDKIGAVPHGLSTDSDV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
             KRE+ES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDKD+LGEGD  KL+IQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKDVLGEGDNTKLDIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  181  VEKMQTSGDLNLIGQFGVGFY  201



>ref|XP_006596543.1| PREDICTED: endoplasmin homolog isoform X2 [Glycine max]
Length=815

 Score =   293 bits (749),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW V + L LL LLFL  DQGRK  ANAE DSD  VDPPKVE+KIG VPHGLSTD DV
Sbjct  1    MRKWTVASALLLLSLLFLFADQGRKFQANAEGDSDELVDPPKVEDKIGAVPHGLSTDSDV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
             KREAES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKREAESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDK++LGEGD  KL+IQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGDNTKLDIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  181  VEKMQTSGDLNLIGQFGVGFY  201



>ref|XP_003545030.1| PREDICTED: endoplasmin homolog isoform X1 [Glycine max]
 gb|KHN39421.1| Endoplasmin like [Glycine soja]
Length=816

 Score =   293 bits (749),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW V + L LL LLFL  DQGRK  ANAE DSD  VDPPKVE+KIG VPHGLSTD DV
Sbjct  1    MRKWTVASALLLLSLLFLFADQGRKFQANAEGDSDELVDPPKVEDKIGAVPHGLSTDSDV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
             KREAES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKREAESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDK++LGEGD  KL+IQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGDNTKLDIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  181  VEKMQTSGDLNLIGQFGVGFY  201



>ref|XP_004291352.1| PREDICTED: endoplasmin homolog [Fragaria vesca subsp. vesca]
Length=815

 Score =   292 bits (748),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 173/201 (86%), Positives = 186/201 (93%), Gaps = 2/201 (1%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW +P+VL LLCLL LLPDQGRK+ ANAE +SD  VDPPKVEEKIG VP+GLSTD DV
Sbjct  1    MRKWTIPSVLLLLCLLSLLPDQGRKLQANAEANSDELVDPPKVEEKIGAVPNGLSTDSDV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
            AKREAESMSKR  R  A++FEFQAEVSRLMDIII+SLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESMSKR--RGNAQQFEFQAEVSRLMDIIIHSLYSNKDIFLRELISNASDALDKIR  118

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDK+ILGEGD  KLEIQIKLDK+K+ILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  119  FLSLTDKEILGEGDNTKLEIQIKLDKEKRILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  178

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  179  VEKMQTSGDLNLIGQFGVGFY  199



>ref|XP_002510550.1| endoplasmin, putative [Ricinus communis]
 gb|EEF52737.1| endoplasmin, putative [Ricinus communis]
Length=816

 Score =   291 bits (744),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW +P+ L LLCLL L+ DQGR +HANAE DS  PVDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTIPSALLLLCLLSLISDQGRNLHANAEADSQNPVDPPKVEEKLGAVPNGLSTDSDV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
             KRE+ES+SKR+LR+ AEKF+FQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESISKRSLRSDAEKFQFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FL+LTDK++LGEG+  KL+IQIKLDK+KKILSIRD+GIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLALTDKEVLGEGENTKLDIQIKLDKEKKILSIRDKGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  181  VEKMQTSGDLNLIGQFGVGFY  201



>ref|XP_009393849.1| PREDICTED: endoplasmin homolog [Musa acuminata subsp. malaccensis]
Length=815

 Score =   290 bits (743),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 185/203 (91%), Gaps = 2/203 (1%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEV--DSDAPVDPPKVEEKIGGVPHGLSTDP  195
            MRKWA+P+ L LL LL  +PD+GR +HANAE   DSD  VDPPKVEEK+G VP+GLSTD 
Sbjct  1    MRKWALPSALLLLLLLSTVPDRGRNLHANAEDSGDSDELVDPPKVEEKLGAVPNGLSTDA  60

Query  196  DVAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK  375
            +VAKREAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK
Sbjct  61   EVAKREAESISRKTLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK  120

Query  376  IRFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTS  555
            IRFL+LTDKD+LGEGD  KL+I IKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTS
Sbjct  121  IRFLALTDKDVLGEGDDTKLDILIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTS  180

Query  556  AFVEKMQSSGDLNLIGQFGVGFY  624
            AFVEKMQ+ GDLNLIGQFGVGFY
Sbjct  181  AFVEKMQTGGDLNLIGQFGVGFY  203



>ref|XP_010691883.1| PREDICTED: endoplasmin homolog [Beta vulgaris subsp. vulgaris]
Length=810

 Score =   290 bits (742),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            M+KW + + +FLLC+LFL PDQGR+IHANAE DSD   +PPKVEEK+G VP+GLSTD DV
Sbjct  1    MKKWTLTSAIFLLCILFLFPDQGRRIHANAEGDSDEIANPPKVEEKLGAVPNGLSTDSDV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
             KRE+ESMSK+TLR  A+KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESMSKKTLRNSAQKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FL+LTDK++LGEGD AKLEI IKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLALTDKEVLGEGDNAKLEILIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  181  VEKMQTSGDLNLIGQFGVGFY  201



>ref|XP_010246858.1| PREDICTED: endoplasmin homolog [Nelumbo nucifera]
Length=821

 Score =   290 bits (742),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 186/201 (93%), Gaps = 1/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW +P+ L LL LL LLPDQG K+HA+AE +S+  VDPPKVEEKIG VP+GLSTD DV
Sbjct  1    MRKWTIPSALLLLLLLSLLPDQGHKLHASAE-ESEELVDPPKVEEKIGAVPNGLSTDSDV  59

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
            AKREAES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  60   AKREAESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  119

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDK+ILGEGD  KLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  120  FLSLTDKEILGEGDNTKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  179

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            +EKMQ+ GDLNLIGQFGVGFY
Sbjct  180  MEKMQTGGDLNLIGQFGVGFY  200



>ref|XP_007225662.1| hypothetical protein PRUPE_ppa001487mg [Prunus persica]
 gb|EMJ26861.1| hypothetical protein PRUPE_ppa001487mg [Prunus persica]
Length=815

 Score =   289 bits (740),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW +P+ L LLCLL LLPDQGRK+ ANAE  S+  VDPPKVE+KIG VP+GLSTD DV
Sbjct  1    MRKWTIPSALLLLCLLSLLPDQGRKLQANAEDSSEELVDPPKVEDKIGAVPNGLSTDSDV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
            AKREAES+SKR+LR+ AE+F+FQAEVSRLMDIII+SLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRSLRSNAEQFQFQAEVSRLMDIIIHSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FL+LTDK++LGEGD   LEIQIKLDK+K+ILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLALTDKEVLGEGDDTNLEIQIKLDKEKRILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  181  VEKMQTSGDLNLIGQFGVGFY  201



>ref|XP_010069812.1| PREDICTED: endoplasmin homolog [Eucalyptus grandis]
 gb|KCW58281.1| hypothetical protein EUGRSUZ_H00972 [Eucalyptus grandis]
Length=822

 Score =   289 bits (739),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 163/201 (81%), Positives = 185/201 (92%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            M KW +P+VL +LCLL  LPDQGRK+ ANAE DS+  VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MGKWTIPSVLLVLCLLCALPDQGRKLRANAEGDSEELVDPPKVEEKLGAVPNGLSTDSDV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
             KRE+ES+SKR+LR  AEKFEFQAEVSRLMDI++NSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESISKRSLRNSAEKFEFQAEVSRLMDILVNSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FL+LTDKDILGEGD  KLEIQ+K+DK+K+I+++RDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLALTDKDILGEGDDTKLEIQMKVDKEKRIVTLRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  181  VEKMQTSGDLNLIGQFGVGFY  201



>ref|XP_008221245.1| PREDICTED: endoplasmin homolog [Prunus mume]
Length=815

 Score =   288 bits (737),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW +P+ L LLCLL LLPDQGRK+ ANAE  S+  VDPPKVE+KIG VP+GLSTD DV
Sbjct  1    MRKWTIPSALLLLCLLSLLPDQGRKLQANAEGGSEELVDPPKVEDKIGAVPNGLSTDSDV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
            AKREAES+SKR+LR+ AE+F+FQAEVSRLMDIII+SLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRSLRSNAEQFQFQAEVSRLMDIIIHSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FL+LTDK++LGEGD   L+IQIKLDK+K+ILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLALTDKEVLGEGDDTNLQIQIKLDKEKRILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  181  VEKMQTSGDLNLIGQFGVGFY  201



>gb|AAX19870.1| unknown, partial [Doryanthes excelsa]
Length=289

 Score =   273 bits (698),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 155/181 (86%), Positives = 169/181 (93%), Gaps = 1/181 (1%)
 Frame = +1

Query  82   DQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKF  261
            DQGRK+ ANAE +S+  VDPPKVEEK+G VP GLSTD DVAKREAES+S++TLR+ AEKF
Sbjct  23   DQGRKLQANAE-ESEELVDPPKVEEKLGAVPGGLSTDSDVAKREAESISRKTLRSSAEKF  81

Query  262  EFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAklei  441
            EFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDK+ILGEGD  KLEI
Sbjct  82   EFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKEILGEGDNTKLEI  141

Query  442  qikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGVGF  621
             IKLDK+KKIL+IRDRGIGMTKEDL+KNLGTIAKSGTSAFVEKMQ+ GDLNLIGQFGVGF
Sbjct  142  LIKLDKEKKILTIRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQTGGDLNLIGQFGVGF  201

Query  622  Y  624
            Y
Sbjct  202  Y  202



>ref|XP_007160650.1| hypothetical protein PHAVU_001G005200g [Phaseolus vulgaris]
 gb|ESW32644.1| hypothetical protein PHAVU_001G005200g [Phaseolus vulgaris]
Length=817

 Score =   287 bits (735),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW V +VL LL LLFL  DQGRK  ANA  DSD  VDPPKVE+KIG VPHGLSTD DV
Sbjct  1    MRKWTVASVLLLLSLLFLFADQGRKFQANAAGDSDELVDPPKVEDKIGAVPHGLSTDSDV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
             KREAES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKREAESISKRSLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDK++LGEGD  KL+I+IKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGDNTKLDIRIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  181  VEKMQTSGDLNLIGQFGVGFY  201



>ref|XP_010266798.1| PREDICTED: endoplasmin homolog [Nelumbo nucifera]
Length=822

 Score =   287 bits (735),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 183/201 (91%), Gaps = 1/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW +P+ L LL LL LLPDQG KIHANAE +S+  VDPPKVEEKIG VP GLSTD DV
Sbjct  1    MRKWMIPSALLLLLLLSLLPDQGHKIHANAE-ESEDLVDPPKVEEKIGAVPKGLSTDSDV  59

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
            A+REAES+SKR+LR+ AEKFEFQAEVSRLMDI++NSLYSNKDIFLRELISNASDALDKIR
Sbjct  60   ARREAESISKRSLRSNAEKFEFQAEVSRLMDILVNSLYSNKDIFLRELISNASDALDKIR  119

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLT+K+ILGEGD  KLEIQI LDK+KK+LSIRDRGIGMT+EDL+KNLGTIAKSGTSAF
Sbjct  120  FLSLTNKEILGEGDNTKLEIQINLDKEKKVLSIRDRGIGMTREDLIKNLGTIAKSGTSAF  179

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKM S GDLNLIGQFGVGFY
Sbjct  180  VEKMHSGGDLNLIGQFGVGFY  200



>ref|XP_008444821.1| PREDICTED: endoplasmin homolog [Cucumis melo]
Length=817

 Score =   287 bits (735),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW + + L LLC+L L+PD+G + HA A+ D+D  VDPPKVEEKIG VPHGLSTD DV
Sbjct  1    MRKWTIASALLLLCILSLVPDEGPRFHAKADGDADEVVDPPKVEEKIGAVPHGLSTDSDV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
             KRE+ES+SKR+LR+  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESISKRSLRSSGEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDK+ILGEGD +KLEIQIKLDK  KILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEILGEGDNSKLEIQIKLDKANKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  181  VEKMQTSGDLNLIGQFGVGFY  201



>gb|KJB63270.1| hypothetical protein B456_010G0030002, partial [Gossypium raimondii]
Length=260

 Score =   270 bits (691),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 183/201 (91%), Gaps = 3/201 (1%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKWA+P+ L LLCLL LL D GRK+  NAE   +  VDPPKVEEKIG VPHGL TD DV
Sbjct  1    MRKWAIPSALVLLCLLSLLSDHGRKVQVNAE---EGAVDPPKVEEKIGAVPHGLQTDSDV  57

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
            AKRE+ES+S R+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  58   AKRESESISSRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  117

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDK++LGEGDT+KL+IQIKLDK+KKILS+RDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  118  FLSLTDKEVLGEGDTSKLDIQIKLDKEKKILSLRDRGIGMTKEDLIKNLGTIAKSGTSAF  177

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQSSGDLNLIGQFGVGFY
Sbjct  178  VEKMQSSGDLNLIGQFGVGFY  198



>gb|AIZ68158.1| heat shock protein 90 [Ornithogalum saundersiae]
Length=814

 Score =   286 bits (731),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 172/202 (85%), Positives = 183/202 (91%), Gaps = 1/202 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAE-VDSDAPVDPPKVEEKIGGVPHGLSTDPD  198
            MRKWA+P+VL LL LL  LPDQGRKIHANAE  D D  VDPPKVEEKIG VP GLSTD D
Sbjct  1    MRKWALPSVLLLLVLLSTLPDQGRKIHANAEESDGDELVDPPKVEEKIGAVPSGLSTDSD  60

Query  199  VAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI  378
            VAKREAES+S+++LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI
Sbjct  61   VAKREAESISRKSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI  120

Query  379  RFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSA  558
            RFLSLTDK+ILGEGD  KLEI IKLDK+ K+LSIRDRGIGMTKEDL+KNLGTIAKSGTSA
Sbjct  121  RFLSLTDKEILGEGDNTKLEIMIKLDKENKVLSIRDRGIGMTKEDLIKNLGTIAKSGTSA  180

Query  559  FVEKMQSSGDLNLIGQFGVGFY  624
            FVEKMQ+ GDLNLIGQFGVGFY
Sbjct  181  FVEKMQTGGDLNLIGQFGVGFY  202



>gb|KJB63271.1| hypothetical protein B456_010G0030002, partial [Gossypium raimondii]
Length=264

 Score =   270 bits (691),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 183/201 (91%), Gaps = 3/201 (1%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKWA+P+ L LLCLL LL D GRK+  NAE   +  VDPPKVEEKIG VPHGL TD DV
Sbjct  1    MRKWAIPSALVLLCLLSLLSDHGRKVQVNAE---EGAVDPPKVEEKIGAVPHGLQTDSDV  57

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
            AKRE+ES+S R+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  58   AKRESESISSRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  117

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDK++LGEGDT+KL+IQIKLDK+KKILS+RDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  118  FLSLTDKEVLGEGDTSKLDIQIKLDKEKKILSLRDRGIGMTKEDLIKNLGTIAKSGTSAF  177

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQSSGDLNLIGQFGVGFY
Sbjct  178  VEKMQSSGDLNLIGQFGVGFY  198



>gb|KJB63272.1| hypothetical protein B456_010G0030002, partial [Gossypium raimondii]
Length=303

 Score =   270 bits (691),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 183/201 (91%), Gaps = 3/201 (1%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKWA+P+ L LLCLL LL D GRK+  NAE   +  VDPPKVEEKIG VPHGL TD DV
Sbjct  1    MRKWAIPSALVLLCLLSLLSDHGRKVQVNAE---EGAVDPPKVEEKIGAVPHGLQTDSDV  57

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
            AKRE+ES+S R+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  58   AKRESESISSRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  117

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDK++LGEGDT+KL+IQIKLDK+KKILS+RDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  118  FLSLTDKEVLGEGDTSKLDIQIKLDKEKKILSLRDRGIGMTKEDLIKNLGTIAKSGTSAF  177

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQSSGDLNLIGQFGVGFY
Sbjct  178  VEKMQSSGDLNLIGQFGVGFY  198



>ref|XP_010935079.1| PREDICTED: endoplasmin homolog [Elaeis guineensis]
Length=822

 Score =   283 bits (724),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 186/203 (92%), Gaps = 2/203 (1%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEV--DSDAPVDPPKVEEKIGGVPHGLSTDP  195
            MRKWA+P+ L LL LL  LPDQGRK+HANAE   DSD  VDPPKVEEK+G VP GLSTDP
Sbjct  1    MRKWALPSALLLLLLLSFLPDQGRKLHANAEDSGDSDELVDPPKVEEKLGAVPGGLSTDP  60

Query  196  DVAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK  375
            DVAKREAES+S++TLR+ AEKFEFQAEVSRL+DIIINSLYSNKDIFLRELISNASDALDK
Sbjct  61   DVAKREAESISRKTLRSNAEKFEFQAEVSRLLDIIINSLYSNKDIFLRELISNASDALDK  120

Query  376  IRFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTS  555
            IRFLSLT+KDILGEGD  KLEI +KLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTS
Sbjct  121  IRFLSLTNKDILGEGDNTKLEILMKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTS  180

Query  556  AFVEKMQSSGDLNLIGQFGVGFY  624
            AF+EKMQ+ GDL+LIGQFGVGFY
Sbjct  181  AFMEKMQTGGDLSLIGQFGVGFY  203



>ref|XP_010941296.1| PREDICTED: endoplasmin homolog [Elaeis guineensis]
Length=838

 Score =   283 bits (725),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 170/205 (83%), Positives = 184/205 (90%), Gaps = 2/205 (1%)
 Frame = +1

Query  16   VTMRKWAVPAVlfllcllfllPDQGRKIHANAEV--DSDAPVDPPKVEEKIGGVPHGLST  189
            + MRKWA+P+ L LL LL   PDQGRK+HANAE   DSD  VDPPKVEEK+G VP GLST
Sbjct  20   IAMRKWALPSALLLLLLLSSFPDQGRKLHANAEDSGDSDELVDPPKVEEKLGAVPGGLST  79

Query  190  DPDVAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDAL  369
            D DVAKREAES+S++TL + AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDAL
Sbjct  80   DSDVAKREAESISRKTLGSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDAL  139

Query  370  DKIRFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSG  549
            DKIRFLSLT+K+ILGEGD  KLEI IKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSG
Sbjct  140  DKIRFLSLTNKEILGEGDNTKLEILIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSG  199

Query  550  TSAFVEKMQSSGDLNLIGQFGVGFY  624
            TSAFVEKMQ+ GDLNLIGQFGVGFY
Sbjct  200  TSAFVEKMQTGGDLNLIGQFGVGFY  224



>gb|EPS69355.1| hypothetical protein M569_05408 [Genlisea aurea]
Length=815

 Score =   282 bits (722),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW V ++L LLC+L +LPDQGRK   NAE + DA   PPKVEEKIGG+P GLSTD +V
Sbjct  1    MRKWTVTSILLLLCILLVLPDQGRKARVNAESEKDAATGPPKVEEKIGGIPSGLSTDSEV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
             KREAES+S R LRA AEKF+FQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKREAESISGRNLRAEAEKFQFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDK++LGEG+ AKL+IQIKLDKDKKILS+RDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGENAKLDIQIKLDKDKKILSLRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  181  VEKMQTSGDLNLIGQFGVGFY  201



>ref|XP_006657350.1| PREDICTED: endoplasmin homolog [Oryza brachyantha]
Length=810

 Score =   281 bits (720),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 184/201 (92%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKWA+ + L LL LL  LPD  +K+  NA+  +D  VDPPKVEE+IG VPHGLSTD +V
Sbjct  1    MRKWALASALLLLFLLTTLPDPAKKLQVNADDSADELVDPPKVEERIGAVPHGLSTDSEV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
            A+REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AQREAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FL+LTDK++LGEGDTAKLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLALTDKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  181  VEKMQTSGDLNLIGQFGVGFY  201



>ref|NP_194150.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
 sp|Q9STX5.1|ENPL_ARATH RecName: Full=Endoplasmin homolog; AltName: Full=Glucose-regulated 
protein 94 homolog; Short=GRP-94 homolog; AltName: Full=HSP90-like 
protein 7; AltName: Full=Protein SHEPHERD; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB45054.1| HSP90-like protein [Arabidopsis thaliana]
 emb|CAB79329.1| HSP90-like protein [Arabidopsis thaliana]
 gb|AAK63999.1| AT4g24190/T22A6_20 [Arabidopsis thaliana]
 dbj|BAB86369.1| SHEPHERD [Arabidopsis thaliana]
 gb|AAO42773.1| At4g24190/T22A6_20 [Arabidopsis thaliana]
 gb|AEE84861.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
Length=823

 Score =   281 bits (720),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 170/183 (93%), Gaps = 3/183 (2%)
 Frame = +1

Query  79   PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHG-LSTDPDVAKREAESMSKRTLRAGAE  255
            PDQGRK+HANAE  SD   DPPKVEEKIGG  HG LSTD DV  RE+ESMSK+TLR+ AE
Sbjct  20   PDQGRKLHANAEESSDDVTDPPKVEEKIGG--HGGLSTDSDVVHRESESMSKKTLRSNAE  77

Query  256  KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkl  435
            KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKL
Sbjct  78   KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKL  137

Query  436  eiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGV  615
            EIQIKLDK KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGV
Sbjct  138  EIQIKLDKAKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGV  197

Query  616  GFY  624
            GFY
Sbjct  198  GFY  200



>ref|XP_008808636.1| PREDICTED: endoplasmin homolog [Phoenix dactylifera]
Length=817

 Score =   281 bits (720),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 183/203 (90%), Gaps = 2/203 (1%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEV--DSDAPVDPPKVEEKIGGVPHGLSTDP  195
            MRKWA+P+ L LL LL   PDQGRK+HANAE   D+D   DPPKVEEK+G VP GLSTD 
Sbjct  1    MRKWALPSALLLLLLLSSFPDQGRKLHANAEDSGDADELADPPKVEEKLGAVPGGLSTDS  60

Query  196  DVAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK  375
            DVAKREAES+S++TLR+ AEKF+FQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK
Sbjct  61   DVAKREAESISRKTLRSNAEKFDFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK  120

Query  376  IRFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTS  555
            IRFLSLT+K+ILGEGD  KLEI IKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTS
Sbjct  121  IRFLSLTNKEILGEGDNTKLEILIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTS  180

Query  556  AFVEKMQSSGDLNLIGQFGVGFY  624
            AFVEKMQ+ GDLNLIGQFGVGFY
Sbjct  181  AFVEKMQTGGDLNLIGQFGVGFY  203



>ref|XP_002867677.1| hypothetical protein ARALYDRAFT_492441 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43936.1| hypothetical protein ARALYDRAFT_492441 [Arabidopsis lyrata subsp. 
lyrata]
Length=823

 Score =   281 bits (720),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 170/183 (93%), Gaps = 3/183 (2%)
 Frame = +1

Query  79   PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHG-LSTDPDVAKREAESMSKRTLRAGAE  255
            PDQGRK+HANAE  SD   DPPKVEEKIGG  HG LSTD DV  RE+ESMSK+TLR+ AE
Sbjct  20   PDQGRKLHANAEDSSDEVTDPPKVEEKIGG--HGGLSTDSDVVHRESESMSKKTLRSNAE  77

Query  256  KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkl  435
            KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKL
Sbjct  78   KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKL  137

Query  436  eiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGV  615
            EIQIKLDK KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGV
Sbjct  138  EIQIKLDKAKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGV  197

Query  616  GFY  624
            GFY
Sbjct  198  GFY  200



>dbj|BAB86368.1| SHEPHERD [Arabidopsis thaliana]
Length=823

 Score =   281 bits (720),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 170/183 (93%), Gaps = 3/183 (2%)
 Frame = +1

Query  79   PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHG-LSTDPDVAKREAESMSKRTLRAGAE  255
            PDQGRK+HANAE  SD   DPPKVEEKIGG  HG LSTD DV  RE+ESMSK+TLR+ AE
Sbjct  20   PDQGRKLHANAEESSDDVTDPPKVEEKIGG--HGGLSTDSDVVHRESESMSKKTLRSNAE  77

Query  256  KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkl  435
            KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKL
Sbjct  78   KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKL  137

Query  436  eiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGV  615
            EIQIKLDK KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGV
Sbjct  138  EIQIKLDKAKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGV  197

Query  616  GFY  624
            GFY
Sbjct  198  GFY  200



>gb|AFW75766.1| hypothetical protein ZEAMMB73_790349 [Zea mays]
Length=710

 Score =   279 bits (714),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 180/201 (90%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKWA+ + L LL LL  LPD  +K+  NAE  S    +PPKVEEK G VPHGLSTD +V
Sbjct  1    MRKWALSSTLLLLFLLTTLPDPAKKLQVNAEESSHDLANPPKVEEKFGAVPHGLSTDSEV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
            A+REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AQREAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDK++LGEGDTAKLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQS GDLNLIGQFGVGFY
Sbjct  181  VEKMQSGGDLNLIGQFGVGFY  201



>ref|XP_004966467.1| PREDICTED: endoplasmin homolog [Setaria italica]
Length=807

 Score =   281 bits (719),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKWA+ + L LL LL  LPD  +K+  NAE  SD   +PPKVEEK+G VPHGLSTD +V
Sbjct  1    MRKWALSSALLLLFLLTTLPDPAKKLQVNAEESSDDLANPPKVEEKLGAVPHGLSTDAEV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
            A+REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AQREAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDK++LGEGDTAKLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQS GDLNLIGQFGVGFY
Sbjct  181  VEKMQSGGDLNLIGQFGVGFY  201



>ref|XP_002439030.1| hypothetical protein SORBIDRAFT_10g030240 [Sorghum bicolor]
 gb|EER90397.1| hypothetical protein SORBIDRAFT_10g030240 [Sorghum bicolor]
Length=807

 Score =   281 bits (719),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKWA+ + L LL LL  LPD  +K+  NAE  SD   +PPKVEEK+G VPHGLSTD DV
Sbjct  1    MRKWALSSALLLLFLLTTLPDPAKKLQVNAEESSDDLANPPKVEEKLGAVPHGLSTDSDV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
            A+REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDI+LRELISNASDALDKIR
Sbjct  61   AQREAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIYLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDK++LGEGDTAKLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQS GDLNLIGQFGVGFY
Sbjct  181  VEKMQSGGDLNLIGQFGVGFY  201



>ref|XP_010433803.1| PREDICTED: endoplasmin homolog [Camelina sativa]
Length=823

 Score =   281 bits (719),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 170/183 (93%), Gaps = 3/183 (2%)
 Frame = +1

Query  79   PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHG-LSTDPDVAKREAESMSKRTLRAGAE  255
            PDQGRK+HANAE  SD   DPPKVEEKIGG  HG LSTD DV  RE+ESMSK+TLR+ AE
Sbjct  20   PDQGRKLHANAEDSSDEVTDPPKVEEKIGG--HGGLSTDSDVVHRESESMSKKTLRSSAE  77

Query  256  KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkl  435
            KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKL
Sbjct  78   KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKL  137

Query  436  eiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGV  615
            EIQIKLDK KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGV
Sbjct  138  EIQIKLDKAKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGV  197

Query  616  GFY  624
            GFY
Sbjct  198  GFY  200



>ref|XP_010439073.1| PREDICTED: endoplasmin homolog [Camelina sativa]
Length=823

 Score =   281 bits (719),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 170/183 (93%), Gaps = 3/183 (2%)
 Frame = +1

Query  79   PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHG-LSTDPDVAKREAESMSKRTLRAGAE  255
            PDQGRK+HANAE  SD   DPPKVEEKIGG  HG LSTD DV  RE+ESMSK+TLR+ AE
Sbjct  20   PDQGRKLHANAEDSSDEVTDPPKVEEKIGG--HGGLSTDSDVVHRESESMSKKTLRSSAE  77

Query  256  KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkl  435
            KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKL
Sbjct  78   KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKL  137

Query  436  eiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGV  615
            EIQIKLDK KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGV
Sbjct  138  EIQIKLDKAKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGV  197

Query  616  GFY  624
            GFY
Sbjct  198  GFY  200



>ref|XP_006283118.1| hypothetical protein CARUB_v10004140mg [Capsella rubella]
 gb|EOA16016.1| hypothetical protein CARUB_v10004140mg [Capsella rubella]
Length=823

 Score =   281 bits (719),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 170/183 (93%), Gaps = 3/183 (2%)
 Frame = +1

Query  79   PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHG-LSTDPDVAKREAESMSKRTLRAGAE  255
            PDQGRK+HANAE  SD   DPPKVEEKIGG  HG LSTD DV  RE+ESMSK+TLR+ AE
Sbjct  20   PDQGRKLHANAEDSSDEVTDPPKVEEKIGG--HGGLSTDSDVVHRESESMSKKTLRSSAE  77

Query  256  KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkl  435
            KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKL
Sbjct  78   KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKL  137

Query  436  eiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGV  615
            EIQIKLDK KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGV
Sbjct  138  EIQIKLDKAKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGV  197

Query  616  GFY  624
            GFY
Sbjct  198  GFY  200



>ref|NP_001151475.1| endoplasmin precursor [Zea mays]
 gb|ACG42989.1| endoplasmin precursor [Zea mays]
Length=807

 Score =   281 bits (718),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKWA+ + L LL LL  LPD  +K+  NAE  SD   +PPKVEEK+G VPHGLSTD +V
Sbjct  1    MRKWALSSALLLLFLLTTLPDPAKKLQVNAEESSDDLANPPKVEEKLGAVPHGLSTDSEV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
            A+REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AQREAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDK++LGEGDTAKLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQS GDLNLIGQFGVGFY
Sbjct  181  VEKMQSGGDLNLIGQFGVGFY  201



>gb|AFW75767.1| endoplasmin [Zea mays]
Length=804

 Score =   280 bits (715),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 180/201 (90%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKWA+ + L LL LL  LPD  +K+  NAE  S    +PPKVEEK G VPHGLSTD +V
Sbjct  1    MRKWALSSTLLLLFLLTTLPDPAKKLQVNAEESSHDLANPPKVEEKFGAVPHGLSTDSEV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
            A+REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AQREAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDK++LGEGDTAKLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQS GDLNLIGQFGVGFY
Sbjct  181  VEKMQSGGDLNLIGQFGVGFY  201



>gb|AAN34791.1| Grp94 [Xerophyta viscosa]
Length=812

 Score =   280 bits (715),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 167/205 (81%), Positives = 180/205 (88%), Gaps = 4/205 (2%)
 Frame = +1

Query  22   MRKWAVP--AVlfllcllfllPDQGRKIHANAE--VDSDAPVDPPKVEEKIGGVPHGLST  189
            MR W++P   VL LL  L  +PD GRK+HANAE   D+D  VDPPKVEEKI GV  GLST
Sbjct  1    MRNWSIPPALVLLLLISLSAIPDGGRKLHANAEESRDADELVDPPKVEEKIAGVHGGLST  60

Query  190  DPDVAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDAL  369
            D DVAKREAESMS++ LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDAL
Sbjct  61   DADVAKREAESMSRKNLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDAL  120

Query  370  DKIRFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSG  549
            DKIRFLSLTDK++LGEGD  KLEI IKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSG
Sbjct  121  DKIRFLSLTDKEVLGEGDNTKLEIMIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSG  180

Query  550  TSAFVEKMQSSGDLNLIGQFGVGFY  624
            TSAFVEKMQ+ GDLNLIGQFGVGFY
Sbjct  181  TSAFVEKMQTGGDLNLIGQFGVGFY  205



>ref|NP_974606.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
 gb|AEE84862.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
Length=823

 Score =   279 bits (713),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 169/183 (92%), Gaps = 3/183 (2%)
 Frame = +1

Query  79   PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHG-LSTDPDVAKREAESMSKRTLRAGAE  255
            PDQG K+HANAE  SD   DPPKVEEKIGG  HG LSTD DV  RE+ESMSK+TLR+ AE
Sbjct  20   PDQGTKLHANAEESSDDVTDPPKVEEKIGG--HGGLSTDSDVVHRESESMSKKTLRSNAE  77

Query  256  KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkl  435
            KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKL
Sbjct  78   KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKL  137

Query  436  eiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGV  615
            EIQIKLDK KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGV
Sbjct  138  EIQIKLDKAKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGV  197

Query  616  GFY  624
            GFY
Sbjct  198  GFY  200



>ref|XP_008643502.1| PREDICTED: shepherd-like1 isoform X1 [Zea mays]
 gb|AFW69514.1| hypothetical protein ZEAMMB73_665489 [Zea mays]
Length=808

 Score =   278 bits (712),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 181/201 (90%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKWA+ + L LL LL  LPD  +K+  NAE  SD   +PPKVEEK+G VPHGLSTD +V
Sbjct  1    MRKWALSSALLLLFLLTTLPDPAKKLQVNAEESSDDLANPPKVEEKLGAVPHGLSTDSEV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
            A+REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AQREAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDK++LGEGDTAKLEIQIKLDK+KKILSIRDRGIGMTKEDL+ NLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIGMTKEDLINNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQS GDLNLIGQFGVGFY
Sbjct  181  VEKMQSGGDLNLIGQFGVGFY  201



>ref|XP_006413464.1| hypothetical protein EUTSA_v10024414mg [Eutrema salsugineum]
 gb|ESQ54917.1| hypothetical protein EUTSA_v10024414mg [Eutrema salsugineum]
Length=822

 Score =   278 bits (711),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 172/202 (85%), Positives = 184/202 (91%), Gaps = 3/202 (1%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHG-LSTDPD  198
            MRK  + +VLFL  LLFLLPDQGRK+HANAE  SD   DPPKVEEK+GG  HG LSTD D
Sbjct  1    MRKRTIVSVLFLFSLLFLLPDQGRKLHANAEDSSDEVTDPPKVEEKLGG--HGGLSTDSD  58

Query  199  VAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI  378
            V  RE+ES+SK++LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI
Sbjct  59   VVHRESESISKKSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI  118

Query  379  RFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSA  558
            RFL+LTDKD+LGEGDTAKLEIQIKLDK KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSA
Sbjct  119  RFLALTDKDVLGEGDTAKLEIQIKLDKAKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSA  178

Query  559  FVEKMQSSGDLNLIGQFGVGFY  624
            FVEKMQSSGDLNLIGQFGVGFY
Sbjct  179  FVEKMQSSGDLNLIGQFGVGFY  200



>ref|NP_001058590.1| Os06g0716700 [Oryza sativa Japonica Group]
 dbj|BAF20504.1| Os06g0716700 [Oryza sativa Japonica Group]
Length=810

 Score =   278 bits (710),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 182/201 (91%), Gaps = 1/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKWA+ +   LL LL  LPD  +K+  NA+  +D  VDPPKVEEKIGGVPHGLSTD +V
Sbjct  1    MRKWAL-SSALLLLLLTTLPDPAKKLQVNADDSTDELVDPPKVEEKIGGVPHGLSTDSEV  59

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
             +REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  60   VQREAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  119

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FL+LTDK++LGEGDTAKLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  120  FLALTDKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  179

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+ GDLNLIGQFGVGFY
Sbjct  180  VEKMQTGGDLNLIGQFGVGFY  200



>gb|KFK29085.1| hypothetical protein AALP_AA7G086900 [Arabis alpina]
Length=823

 Score =   278 bits (710),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 172/202 (85%), Positives = 185/202 (92%), Gaps = 3/202 (1%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHG-LSTDPD  198
            MRK  + +VLFL+CL+FLLPDQGRK+HANAE  ++   DPPKVEEK+GG  HG LSTD D
Sbjct  1    MRKKTIVSVLFLVCLVFLLPDQGRKLHANAEGSTEEYSDPPKVEEKLGG--HGGLSTDSD  58

Query  199  VAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI  378
            V  RE+ESMSKR+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI
Sbjct  59   VVHRESESMSKRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI  118

Query  379  RFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSA  558
            RFL+LTDKD+LGEGDTAKLEIQIKLDK KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSA
Sbjct  119  RFLALTDKDVLGEGDTAKLEIQIKLDKAKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSA  178

Query  559  FVEKMQSSGDLNLIGQFGVGFY  624
            FVEKMQSSGDLNLIGQFGVGFY
Sbjct  179  FVEKMQSSGDLNLIGQFGVGFY  200



>gb|KJB14398.1| hypothetical protein B456_002G122800 [Gossypium raimondii]
Length=739

 Score =   276 bits (705),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 163/201 (81%), Positives = 181/201 (90%), Gaps = 3/201 (1%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            M KW +P+ L LLCLL LL DQGRK+ ANA+   +  VDPPKVE+ IG VPHGL TD DV
Sbjct  1    MGKWTIPSALILLCLLSLLSDQGRKLQANAK---EGAVDPPKVEDNIGAVPHGLQTDSDV  57

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
             KRE++S+S R+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  58   VKRESDSISSRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  117

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDK++LGEGDT+KLEIQIKLDK+KK+LS+RDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  118  FLSLTDKEVLGEGDTSKLEIQIKLDKEKKMLSLRDRGIGMTKEDLIKNLGTIAKSGTSAF  177

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQS+GDLNLIGQFGVGFY
Sbjct  178  VEKMQSTGDLNLIGQFGVGFY  198



>gb|AAL79732.1|AC091774_23 heat shock protein 90 [Oryza sativa Japonica Group]
 dbj|BAD53585.1| heat shock protein 90 [Oryza sativa Japonica Group]
 dbj|BAD61715.1| heat shock protein 90 [Oryza sativa Japonica Group]
 gb|ADR66979.1| 90 kDa heat shock protein [Oryza sativa Japonica Group]
Length=812

 Score =   277 bits (709),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 164/202 (81%), Positives = 182/202 (90%), Gaps = 1/202 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfll-PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPD  198
            MRKWA+ + L LL LL    PD  +K+  NA+  +D  VDPPKVEEKIGGVPHGLSTD +
Sbjct  1    MRKWALSSALLLLLLLLTTLPDPAKKLQVNADDSTDELVDPPKVEEKIGGVPHGLSTDSE  60

Query  199  VAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI  378
            V +REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI
Sbjct  61   VVQREAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI  120

Query  379  RFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSA  558
            RFL+LTDK++LGEGDTAKLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSA
Sbjct  121  RFLALTDKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSA  180

Query  559  FVEKMQSSGDLNLIGQFGVGFY  624
            FVEKMQ+ GDLNLIGQFGVGFY
Sbjct  181  FVEKMQTGGDLNLIGQFGVGFY  202



>emb|CDY10992.1| BnaA03g46510D [Brassica napus]
Length=871

 Score =   278 bits (711),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 169/182 (93%), Gaps = 1/182 (1%)
 Frame = +1

Query  79   PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEK  258
            PDQGRK+HANAE  SD   DPPKVEEK+GG   GLSTD DV  RE+ES+SK++LR+ AEK
Sbjct  20   PDQGRKLHANAEDSSDEVTDPPKVEEKLGG-HSGLSTDSDVVHRESESISKKSLRSNAEK  78

Query  259  FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkle  438
            FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKLE
Sbjct  79   FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKLE  138

Query  439  iqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGVG  618
            IQIKLDK KKI+SIRDRGIGMTKEDL+KNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGVG
Sbjct  139  IQIKLDKAKKIISIRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGVG  198

Query  619  FY  624
            FY
Sbjct  199  FY  200



>ref|XP_010448597.1| PREDICTED: endoplasmin homolog [Camelina sativa]
Length=823

 Score =   276 bits (707),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 169/183 (92%), Gaps = 3/183 (2%)
 Frame = +1

Query  79   PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHG-LSTDPDVAKREAESMSKRTLRAGAE  255
            PDQGRK+HANAE  SD   DPPKVEE IGG  HG LSTD DV  RE+ES+SK+TLR+ AE
Sbjct  20   PDQGRKLHANAEDSSDEVTDPPKVEEPIGG--HGGLSTDSDVVHRESESISKKTLRSSAE  77

Query  256  KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkl  435
            KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKL
Sbjct  78   KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKL  137

Query  436  eiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGV  615
            EIQIKLDK KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGV
Sbjct  138  EIQIKLDKAKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGV  197

Query  616  GFY  624
            GFY
Sbjct  198  GFY  200



>ref|XP_009137776.1| PREDICTED: endoplasmin homolog [Brassica rapa]
Length=822

 Score =   276 bits (707),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 160/183 (87%), Positives = 170/183 (93%), Gaps = 3/183 (2%)
 Frame = +1

Query  79   PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHG-LSTDPDVAKREAESMSKRTLRAGAE  255
            PDQGRK+HANAE  SD   DPPKVEEK+GG  HG LSTD DV  RE+ES+SK++LR+ AE
Sbjct  20   PDQGRKLHANAEDSSDEVSDPPKVEEKLGG--HGGLSTDSDVVHRESESISKKSLRSNAE  77

Query  256  KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkl  435
            KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKL
Sbjct  78   KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKL  137

Query  436  eiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGV  615
            EIQIKLDK KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGV
Sbjct  138  EIQIKLDKAKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGV  197

Query  616  GFY  624
            GFY
Sbjct  198  GFY  200



>emb|CDY24830.1| BnaA08g14800D [Brassica napus]
Length=819

 Score =   276 bits (706),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 169/202 (84%), Positives = 183/202 (91%), Gaps = 3/202 (1%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHG-LSTDPD  198
            MRK  + +V+FL  LLFLLP+QGRK+HANAE  SD   DPPKVEEK+GG  HG LSTD D
Sbjct  1    MRKKTIVSVMFLFSLLFLLPEQGRKLHANAEESSDDVTDPPKVEEKLGG--HGGLSTDSD  58

Query  199  VAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI  378
            V  R +ES+SK++LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI
Sbjct  59   VVHRSSESISKKSLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI  118

Query  379  RFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSA  558
            RFL+LTDKD+LGEGDTAKLEIQIKLDK KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSA
Sbjct  119  RFLALTDKDVLGEGDTAKLEIQIKLDKAKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSA  178

Query  559  FVEKMQSSGDLNLIGQFGVGFY  624
            FVEKMQSSGDLNLIGQFGVGFY
Sbjct  179  FVEKMQSSGDLNLIGQFGVGFY  200



>emb|CDY34264.1| BnaA01g13670D [Brassica napus]
Length=822

 Score =   276 bits (706),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 160/183 (87%), Positives = 170/183 (93%), Gaps = 3/183 (2%)
 Frame = +1

Query  79   PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHG-LSTDPDVAKREAESMSKRTLRAGAE  255
            PDQGRK+HANAE  SD   DPPKVEEK+GG  HG LSTD DV  RE+ES+SK++LR+ AE
Sbjct  20   PDQGRKLHANAEDSSDEVSDPPKVEEKLGG--HGGLSTDSDVVHRESESISKKSLRSNAE  77

Query  256  KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkl  435
            KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKL
Sbjct  78   KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKL  137

Query  436  eiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGV  615
            EIQIKLDK KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGV
Sbjct  138  EIQIKLDKAKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGV  197

Query  616  GFY  624
            GFY
Sbjct  198  GFY  200



>gb|KJB14397.1| hypothetical protein B456_002G122800 [Gossypium raimondii]
Length=809

 Score =   276 bits (705),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 163/201 (81%), Positives = 181/201 (90%), Gaps = 3/201 (1%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            M KW +P+ L LLCLL LL DQGRK+ ANA+   +  VDPPKVE+ IG VPHGL TD DV
Sbjct  1    MGKWTIPSALILLCLLSLLSDQGRKLQANAK---EGAVDPPKVEDNIGAVPHGLQTDSDV  57

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
             KRE++S+S R+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  58   VKRESDSISSRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  117

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDK++LGEGDT+KLEIQIKLDK+KK+LS+RDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  118  FLSLTDKEVLGEGDTSKLEIQIKLDKEKKMLSLRDRGIGMTKEDLIKNLGTIAKSGTSAF  177

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQS+GDLNLIGQFGVGFY
Sbjct  178  VEKMQSTGDLNLIGQFGVGFY  198



>dbj|BAA90487.1| heat shock protein 90 [Oryza sativa]
Length=810

 Score =   276 bits (705),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 163/201 (81%), Positives = 182/201 (91%), Gaps = 1/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKWA+ +   LL LL  LPD  +K+  NA+  +D  VDPPKVEEKIGGVPHGLSTD +V
Sbjct  1    MRKWAL-SSALLLLLLTTLPDPAKKLQVNADDSTDELVDPPKVEEKIGGVPHGLSTDSEV  59

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
             +REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  60   VQREAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  119

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FL+LTDK++LGEGDTAKLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  120  FLALTDKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  179

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEK+Q+ GDLNLIGQFGVGFY
Sbjct  180  VEKVQTGGDLNLIGQFGVGFY  200



>ref|XP_008788614.1| PREDICTED: endoplasmin homolog [Phoenix dactylifera]
Length=822

 Score =   275 bits (704),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 184/203 (91%), Gaps = 2/203 (1%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEV--DSDAPVDPPKVEEKIGGVPHGLSTDP  195
            MRKWA+P+ L LL LL  LPDQGRK+HANAE   DSD  VDPPKVEEK+G VP GLSTD 
Sbjct  1    MRKWALPSALLLLLLLSSLPDQGRKLHANAEDSGDSDELVDPPKVEEKLGAVPGGLSTDS  60

Query  196  DVAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK  375
            DVAKREAES+S++++R+  EKFEFQAEVSRL+DIIINSLYSNKDIFLRELISNASDALDK
Sbjct  61   DVAKREAESISRKSMRSDGEKFEFQAEVSRLLDIIINSLYSNKDIFLRELISNASDALDK  120

Query  376  IRFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTS  555
            IRFLSLT+K+ILGEGD  KLEI IKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTS
Sbjct  121  IRFLSLTNKEILGEGDNTKLEILIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTS  180

Query  556  AFVEKMQSSGDLNLIGQFGVGFY  624
            AF+EKMQ+ GDLNLIGQFGVGFY
Sbjct  181  AFMEKMQTGGDLNLIGQFGVGFY  203



>emb|CDY03477.1| BnaC01g16050D [Brassica napus]
Length=822

 Score =   275 bits (702),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 159/183 (87%), Positives = 169/183 (92%), Gaps = 3/183 (2%)
 Frame = +1

Query  79   PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHG-LSTDPDVAKREAESMSKRTLRAGAE  255
            PDQGRK+HANAE  SD   DPPKVEEK+GG  HG LSTD DV  RE+ES+SK++LR+ AE
Sbjct  20   PDQGRKLHANAEDSSDEVSDPPKVEEKLGG--HGGLSTDSDVVHRESESISKKSLRSNAE  77

Query  256  KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkl  435
            KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGD AKL
Sbjct  78   KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDNAKL  137

Query  436  eiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGV  615
            EIQIKLDK KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGV
Sbjct  138  EIQIKLDKAKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGV  197

Query  616  GFY  624
            GFY
Sbjct  198  GFY  200



>sp|P36183.1|ENPL_HORVU RecName: Full=Endoplasmin homolog; AltName: Full=Glucose-regulated 
protein 94 homolog; Short=GRP-94 homolog; Flags: Precursor 
[Hordeum vulgare]
 emb|CAA48143.1| GRP94 homologue [Hordeum vulgare]
 dbj|BAJ91793.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=809

 Score =   274 bits (701),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 177/201 (88%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKWA+   L L+ LL  LPD  +K+  NAE  SD   D PKVEEK+G VPHGLSTD +V
Sbjct  1    MRKWALSCALLLVLLLTTLPDPAKKLQVNAEESSDEVGDFPKVEEKLGAVPHGLSTDSEV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
             +RE+ES+S++TLR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VQRESESISRKTLRNSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FL+LTDK+++GEGDTAKLEIQIKLDK+ KILSIRDRG+GMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLALTDKEVMGEGDTAKLEIQIKLDKENKILSIRDRGVGMTKEDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+ GDLNLIGQFGVGFY
Sbjct  181  VEKMQTGGDLNLIGQFGVGFY  201



>emb|CDX92620.1| BnaC07g38780D [Brassica napus]
Length=792

 Score =   273 bits (698),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 157/183 (86%), Positives = 169/183 (92%), Gaps = 3/183 (2%)
 Frame = +1

Query  79   PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHG-LSTDPDVAKREAESMSKRTLRAGAE  255
            PDQGRK+HA+AE  +D   DPPKVEEK+GG  HG LSTD DV  RE+ES+SK++LR+ AE
Sbjct  20   PDQGRKLHASAEDSTDEVTDPPKVEEKLGG--HGGLSTDSDVVHRESESISKKSLRSNAE  77

Query  256  KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkl  435
            KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKL
Sbjct  78   KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKL  137

Query  436  eiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGV  615
            EIQIKLDK KKIL IRDRGIGMTKEDL+KNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGV
Sbjct  138  EIQIKLDKAKKILCIRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGV  197

Query  616  GFY  624
            GFY
Sbjct  198  GFY  200



>gb|KJB63501.1| hypothetical protein B456_010G0030001, partial [Gossypium raimondii]
Length=823

 Score =   273 bits (699),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 170/202 (84%), Positives = 184/202 (91%), Gaps = 3/202 (1%)
 Frame = +1

Query  19   TMRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPD  198
            TMRKWA+P+ L LLCLL LL D GRK+ ANAE   +  VDPPKVEEKIG VPHGL TD D
Sbjct  19   TMRKWAIPSALVLLCLLSLLSDHGRKVQANAE---EGAVDPPKVEEKIGAVPHGLQTDSD  75

Query  199  VAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI  378
            V KRE+ES+S R+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI
Sbjct  76   VVKRESESISSRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI  135

Query  379  RFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSA  558
            RFLSLTDK++LGEGDT+KL+IQIKLDK+KKILS+RDRGIGMTKEDL+KNLGTIAKSGTSA
Sbjct  136  RFLSLTDKEVLGEGDTSKLDIQIKLDKEKKILSLRDRGIGMTKEDLIKNLGTIAKSGTSA  195

Query  559  FVEKMQSSGDLNLIGQFGVGFY  624
            FVEKMQSSGDLNLIGQFGVGFY
Sbjct  196  FVEKMQSSGDLNLIGQFGVGFY  217



>gb|KHG17445.1| Endoplasmin [Gossypium arboreum]
Length=812

 Score =   273 bits (697),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 161/201 (80%), Positives = 180/201 (90%), Gaps = 3/201 (1%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            M  W +P+ L LLCLL LL DQGRK+ ANA+   +  VDPPKVE+ IG VPHGL TD DV
Sbjct  1    MGNWTIPSALILLCLLSLLSDQGRKLQANAK---EGAVDPPKVEDNIGAVPHGLQTDSDV  57

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
             KRE++S+S R+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  58   VKRESDSISSRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  117

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDK++LGEGDT+KLEIQIKLDK+KK+LS+RDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  118  FLSLTDKEVLGEGDTSKLEIQIKLDKEKKMLSLRDRGIGMTKEDLIKNLGTIAKSGTSAF  177

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VE+MQS+GDLNLIGQFGVGFY
Sbjct  178  VERMQSTGDLNLIGQFGVGFY  198



>ref|XP_006851911.1| hypothetical protein AMTR_s00041p00161550 [Amborella trichopoda]
 gb|ERN13378.1| hypothetical protein AMTR_s00041p00161550 [Amborella trichopoda]
Length=818

 Score =   272 bits (695),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 180/203 (89%), Gaps = 2/203 (1%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAP--VDPPKVEEKIGGVPHGLSTDP  195
            MRK A+ + +FL+ LL LLP QGR + ANAE ++ A   VDPPKVEEKIG +P  LSTD 
Sbjct  1    MRKGAMTSAIFLVFLLALLPYQGRHLQANAEENNGAEGLVDPPKVEEKIGAIPDALSTDS  60

Query  196  DVAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK  375
            DVAKREAESMS+++LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK
Sbjct  61   DVAKREAESMSRKSLRGNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK  120

Query  376  IRFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTS  555
            IRFLSLTDK+ILGEGD  KLEI IKLDK+KK+LSIRDRGIGMTKEDL+KNLGTIAKSGTS
Sbjct  121  IRFLSLTDKEILGEGDNTKLEILIKLDKEKKVLSIRDRGIGMTKEDLIKNLGTIAKSGTS  180

Query  556  AFVEKMQSSGDLNLIGQFGVGFY  624
            AFVEKMQ+ GDLNLIGQFGVGFY
Sbjct  181  AFVEKMQTGGDLNLIGQFGVGFY  203



>gb|EAZ02369.1| hypothetical protein OsI_24473 [Oryza sativa Indica Group]
Length=837

 Score =   272 bits (695),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  88   GRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEF  267
             +K+  NA+  +D  VDPPKVEEKIGGVPHGLSTD +V +REAES+S++TLR+ AEKFEF
Sbjct  49   AKKLQVNADDSTDELVDPPKVEEKIGGVPHGLSTDSEVVQREAESISRKTLRSSAEKFEF  108

Query  268  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqi  447
            QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDK++LGEGDTAKLEIQI
Sbjct  109  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKEVLGEGDTAKLEIQI  168

Query  448  kldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGVGFY  624
            KLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAFVEKMQ+ GDLNLIGQFGVGFY
Sbjct  169  KLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQTGGDLNLIGQFGVGFY  227



>gb|EAZ38293.1| hypothetical protein OsJ_22671 [Oryza sativa Japonica Group]
Length=838

 Score =   272 bits (695),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  88   GRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEF  267
             +K+  NA+  +D  VDPPKVEEKIGGVPHGLSTD +V +REAES+S++TLR+ AEKFEF
Sbjct  50   AKKLQVNADDSTDELVDPPKVEEKIGGVPHGLSTDSEVVQREAESISRKTLRSSAEKFEF  109

Query  268  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqi  447
            QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDK++LGEGDTAKLEIQI
Sbjct  110  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKEVLGEGDTAKLEIQI  169

Query  448  kldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGVGFY  624
            KLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAFVEKMQ+ GDLNLIGQFGVGFY
Sbjct  170  KLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQTGGDLNLIGQFGVGFY  228



>ref|XP_004152644.1| PREDICTED: endoplasmin homolog [Cucumis sativus]
 ref|XP_004162237.1| PREDICTED: endoplasmin homolog [Cucumis sativus]
 gb|KGN62687.1| hypothetical protein Csa_2G368880 [Cucumis sativus]
Length=817

 Score =   271 bits (693),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKW + + L LLC+L L+PD+G + HA A+VD+D  VDPPKVEEKIG VPHGLSTD DV
Sbjct  1    MRKWTIASALLLLCILSLVPDEGPRFHAKADVDADEVVDPPKVEEKIGAVPHGLSTDSDV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
             KRE+ES+S+R+LR+  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESISRRSLRSSGEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDK+ILGEGD +KLEIQIKLDK  KILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEILGEGDNSKLEIQIKLDKANKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+SGDLNLIGQFGVGFY
Sbjct  181  VEKMQTSGDLNLIGQFGVGFY  201



>ref|XP_003563275.1| PREDICTED: endoplasmin homolog [Brachypodium distachyon]
Length=807

 Score =   270 bits (690),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 176/202 (87%), Gaps = 1/202 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfl-lPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPD  198
            MRKWA+ + L L+ LL    PD  +++  NAE  SD   D PKVEEK+G VPHGLSTD +
Sbjct  1    MRKWALSSALLLVFLLATLSPDPAKRLQVNAEESSDELADLPKVEEKLGAVPHGLSTDSE  60

Query  199  VAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI  378
            V KRE+ES+S++TLR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI
Sbjct  61   VVKRESESISRKTLRNSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI  120

Query  379  RFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSA  558
            RFL LTDK++LGEGDTAKLEIQIKLDK+ KILSIRDRG+GMTKEDL+KNLGTIAKSGTSA
Sbjct  121  RFLGLTDKEVLGEGDTAKLEIQIKLDKENKILSIRDRGVGMTKEDLIKNLGTIAKSGTSA  180

Query  559  FVEKMQSSGDLNLIGQFGVGFY  624
            FVEKMQ+ GDLNLIGQFGVGFY
Sbjct  181  FVEKMQTGGDLNLIGQFGVGFY  202



>gb|ABV82432.1| Hsp90-like protein [Dactylis glomerata]
Length=808

 Score =   269 bits (687),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 156/201 (78%), Positives = 178/201 (89%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MR+WA+ + L L+ LL  LPD  +++  NAE  SD   D PKVEEK+G VPHGLSTD +V
Sbjct  1    MRRWALSSALLLVLLLTTLPDPAKRLQVNAEESSDELTDLPKVEEKLGAVPHGLSTDSEV  60

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
             +RE+ES+S++TLR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VQRESESISRKTLRNSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FL+LT+K++LGEGDTAKLEIQIKLDK+ KILSIRDRG+GMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLALTEKEVLGEGDTAKLEIQIKLDKENKILSIRDRGVGMTKEDLIKNLGTIAKSGTSAF  180

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQ+ GDLNLIGQFGVGFY
Sbjct  181  VEKMQTGGDLNLIGQFGVGFY  201



>gb|AFW69515.1| hypothetical protein ZEAMMB73_665489 [Zea mays]
Length=1001

 Score =   269 bits (687),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  88   GRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEF  267
             +K+  NAE  SD   +PPKVEEK+G VPHGLSTD +VA+REAES+S++TLR+ AEKFEF
Sbjct  216  AKKLQVNAEESSDDLANPPKVEEKLGAVPHGLSTDSEVAQREAESISRKTLRSSAEKFEF  275

Query  268  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqi  447
            QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGDTAKLEIQI
Sbjct  276  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTAKLEIQI  335

Query  448  kldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGVGFY  624
            KLDK+KKILSIRDRGIGMTKEDL+ NLGTIAKSGTSAFVEKMQS GDLNLIGQFGVGFY
Sbjct  336  KLDKEKKILSIRDRGIGMTKEDLINNLGTIAKSGTSAFVEKMQSGGDLNLIGQFGVGFY  394



>ref|XP_007017829.1| Chaperone protein htpG family protein isoform 2 [Theobroma cacao]
 gb|EOY15054.1| Chaperone protein htpG family protein isoform 2 [Theobroma cacao]
Length=824

 Score =   265 bits (678),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 186/201 (93%), Gaps = 3/201 (1%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKWA+P+ L LLCLL LL DQGRK+HANA+   +  VDPPKVEEKIG VP+GL TD DV
Sbjct  1    MRKWAIPSALILLCLLSLLSDQGRKVHANAD---EGAVDPPKVEEKIGAVPNGLQTDSDV  57

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
             KRE+ES+S R+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  58   VKRESESISSRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  117

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDK++LGEGDTAKLEIQIKLDK+KKIL++RDRGIGMTKEDL+K+LGTIAKSGTSAF
Sbjct  118  FLSLTDKEVLGEGDTAKLEIQIKLDKEKKILTLRDRGIGMTKEDLIKHLGTIAKSGTSAF  177

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQSSGDLNLIGQFGVGFY
Sbjct  178  VEKMQSSGDLNLIGQFGVGFY  198



>ref|XP_007017828.1| Chaperone protein htpG family protein isoform 1 [Theobroma cacao]
 gb|EOY15053.1| Chaperone protein htpG family protein isoform 1 [Theobroma cacao]
Length=840

 Score =   265 bits (678),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 186/201 (93%), Gaps = 3/201 (1%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  201
            MRKWA+P+ L LLCLL LL DQGRK+HANA+   +  VDPPKVEEKIG VP+GL TD DV
Sbjct  1    MRKWAIPSALILLCLLSLLSDQGRKVHANAD---EGAVDPPKVEEKIGAVPNGLQTDSDV  57

Query  202  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  381
             KRE+ES+S R+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  58   VKRESESISSRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  117

Query  382  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  561
            FLSLTDK++LGEGDTAKLEIQIKLDK+KKIL++RDRGIGMTKEDL+K+LGTIAKSGTSAF
Sbjct  118  FLSLTDKEVLGEGDTAKLEIQIKLDKEKKILTLRDRGIGMTKEDLIKHLGTIAKSGTSAF  177

Query  562  VEKMQSSGDLNLIGQFGVGFY  624
            VEKMQSSGDLNLIGQFGVGFY
Sbjct  178  VEKMQSSGDLNLIGQFGVGFY  198



>gb|EMT19498.1| Endoplasmin-like protein [Aegilops tauschii]
Length=1222

 Score =   266 bits (681),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 160/211 (76%), Positives = 177/211 (84%), Gaps = 10/211 (5%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGR----------KIHANAEVDSDAPVDPPKVEEKIGGV  171
            MRKWA+   L L+ LL  LPD G+          K+  NAE  SD   D PKVEEK+G V
Sbjct  1    MRKWALSCALLLVLLLTTLPDPGKPPQSLPLNTKKLQVNAEESSDEVGDFPKVEEKLGAV  60

Query  172  PHGLSTDPDVAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELIS  351
            PHGLSTD +V +RE+ES+S++TLR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELIS
Sbjct  61   PHGLSTDSEVVQRESESISRKTLRNSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELIS  120

Query  352  NASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLG  531
            NASDALDKIRFL+LTDK+ LGEGDTAKLEIQIKLDK+ KILSIRDRG+GMTKEDL+KNLG
Sbjct  121  NASDALDKIRFLTLTDKEALGEGDTAKLEIQIKLDKENKILSIRDRGVGMTKEDLIKNLG  180

Query  532  TIAKSGTSAFVEKMQSSGDLNLIGQFGVGFY  624
            TIAKSGTSAFVEKMQ+ GDLNLIGQFGVGFY
Sbjct  181  TIAKSGTSAFVEKMQTGGDLNLIGQFGVGFY  211



>gb|EMS56078.1| Endoplasmin-like protein [Triticum urartu]
Length=875

 Score =   260 bits (665),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = +1

Query  88   GRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEF  267
             +K+  NAE  SD   D PKVEEK+G VPHGLSTD +V +RE+ES+S++TLR  AEKFEF
Sbjct  92   AKKLQVNAEESSDEVGDFPKVEEKLGAVPHGLSTDSEVVQRESESISRKTLRNSAEKFEF  151

Query  268  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqi  447
            QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDK+++GEGDTAKLEIQI
Sbjct  152  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKEVMGEGDTAKLEIQI  211

Query  448  kldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGVGFY  624
            KLDK+ KILSIRDRG+GMTKEDL+KNLGTIAKSGTSAFVEKMQ+ GDLNLIGQFGVGFY
Sbjct  212  KLDKENKILSIRDRGVGMTKEDLIKNLGTIAKSGTSAFVEKMQTGGDLNLIGQFGVGFY  270



>gb|ABV21762.1| GRP94 [Pinus taeda]
Length=834

 Score =   258 bits (659),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 151/203 (74%), Positives = 174/203 (86%), Gaps = 2/203 (1%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVD-SDAPVDPPKVEEKIGG-VPHGLSTDP  195
            MRKWAVP  LFLL +L  +P Q   + ANAE   +D    PPKVEE IGG +P  LSTD 
Sbjct  1    MRKWAVPTALFLLIILTFVPHQSPHLRANAEASPADENASPPKVEEGIGGAIPDALSTDA  60

Query  196  DVAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK  375
            DVA+RE+ES+S++TLRA A+KFEFQAEVSRLMDI+INSLYSNKDIFLRELISNASDALDK
Sbjct  61   DVAQRESESISRKTLRANAQKFEFQAEVSRLMDILINSLYSNKDIFLRELISNASDALDK  120

Query  376  IRFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTS  555
            IRF++LTDK++LGEGD  +L+I+IKLDK+ KILSIRDRGIGMTKEDL+KNLGTIAKSGTS
Sbjct  121  IRFMALTDKNVLGEGDNTRLDIKIKLDKENKILSIRDRGIGMTKEDLIKNLGTIAKSGTS  180

Query  556  AFVEKMQSSGDLNLIGQFGVGFY  624
            AF+E+MQ  GDLNLIGQ GVGFY
Sbjct  181  AFLEQMQKGGDLNLIGQLGVGFY  203



>ref|XP_007017830.1| Chaperone protein htpG family protein isoform 3, partial [Theobroma 
cacao]
 gb|EOY15055.1| Chaperone protein htpG family protein isoform 3, partial [Theobroma 
cacao]
Length=712

 Score =   255 bits (652),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 155/181 (86%), Positives = 170/181 (94%), Gaps = 3/181 (2%)
 Frame = +1

Query  82   DQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKF  261
            DQGRK+HANA+   +  VDPPKVEEKIG VP+GL TD DV KRE+ES+S R+LR+ AEKF
Sbjct  13   DQGRKVHANAD---EGAVDPPKVEEKIGAVPNGLQTDSDVVKRESESISSRSLRSNAEKF  69

Query  262  EFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAklei  441
            EFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGDTAKLEI
Sbjct  70   EFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTAKLEI  129

Query  442  qikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGVGF  621
            QIKLDK+KKIL++RDRGIGMTKEDL+K+LGTIAKSGTSAFVEKMQSSGDLNLIGQFGVGF
Sbjct  130  QIKLDKEKKILTLRDRGIGMTKEDLIKHLGTIAKSGTSAFVEKMQSSGDLNLIGQFGVGF  189

Query  622  Y  624
            Y
Sbjct  190  Y  190



>gb|KJB63502.1| hypothetical protein B456_010G0030001, partial [Gossypium raimondii]
Length=781

 Score =   256 bits (653),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 165/178 (93%), Gaps = 3/178 (2%)
 Frame = +1

Query  91   RKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEFQ  270
            RK+ ANAE   +  VDPPKVEEKIG VPHGL TD DV KRE+ES+S R+LR  AEKFEFQ
Sbjct  1    RKVQANAE---EGAVDPPKVEEKIGAVPHGLQTDSDVVKRESESISSRSLRNNAEKFEFQ  57

Query  271  AEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqik  450
            AEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGDT+KL+IQIK
Sbjct  58   AEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTSKLDIQIK  117

Query  451  ldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGVGFY  624
            LDK+KKILS+RDRGIGMTKEDL+KNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGVGFY
Sbjct  118  LDKEKKILSLRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGVGFY  175



>ref|XP_002981308.1| hypothetical protein SELMODRAFT_444847 [Selaginella moellendorffii]
 gb|EFJ17496.1| hypothetical protein SELMODRAFT_444847 [Selaginella moellendorffii]
Length=867

 Score =   233 bits (594),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 158/186 (85%), Gaps = 4/186 (2%)
 Frame = +1

Query  79   PDQG---RKIHANAEVDSDAPVDPPKVEEKIGG-VPHGLSTDPDVAKREAESMSKRTLRA  246
            PDQG    K+HA     ++    PPK+EE IGG +P  LSTD  V +RE+ES+ ++TLRA
Sbjct  20   PDQGPIRSKVHAEDTGVTEENASPPKIEEPIGGAIPDALSTDSQVVERESESVGQKTLRA  79

Query  247  GAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDT  426
             A++F FQAEVSRLMDII+NSLYSNKDIFLRELISNASDALDKIRFLSLTDK  LGEGD 
Sbjct  80   HAQRFTFQAEVSRLMDIIVNSLYSNKDIFLRELISNASDALDKIRFLSLTDKSQLGEGDE  139

Query  427  AkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQ  606
            +KLEI+IKLDK+KK+LSIRDRGIGMTK++L+KNLGTIAKSGTSAF EKMQS GDLNLIGQ
Sbjct  140  SKLEIRIKLDKEKKLLSIRDRGIGMTKDELIKNLGTIAKSGTSAFFEKMQSGGDLNLIGQ  199

Query  607  FGVGFY  624
            FGVGFY
Sbjct  200  FGVGFY  205



>ref|XP_002969701.1| hypothetical protein SELMODRAFT_451343 [Selaginella moellendorffii]
 gb|EFJ28825.1| hypothetical protein SELMODRAFT_451343 [Selaginella moellendorffii]
Length=867

 Score =   233 bits (594),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 158/186 (85%), Gaps = 4/186 (2%)
 Frame = +1

Query  79   PDQG---RKIHANAEVDSDAPVDPPKVEEKIGG-VPHGLSTDPDVAKREAESMSKRTLRA  246
            PDQG    K+HA     ++    PPK+EE IGG +P  LSTD  V +RE+ES+ ++TLRA
Sbjct  20   PDQGPIRSKVHAEDTGVTEENASPPKIEEPIGGAIPDALSTDSQVVERESESVGQKTLRA  79

Query  247  GAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDT  426
             A++F FQAEVSRLMDII+NSLYSNKDIFLRELISNASDALDKIRFLSLTDK  LGEGD 
Sbjct  80   HAQRFTFQAEVSRLMDIIVNSLYSNKDIFLRELISNASDALDKIRFLSLTDKSQLGEGDE  139

Query  427  AkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQ  606
            +KLEI+IKLDK+KK+LSIRDRGIGMTK++L+KNLGTIAKSGTSAF EKMQS GDLNLIGQ
Sbjct  140  SKLEIRIKLDKEKKLLSIRDRGIGMTKDELIKNLGTIAKSGTSAFFEKMQSGGDLNLIGQ  199

Query  607  FGVGFY  624
            FGVGFY
Sbjct  200  FGVGFY  205



>gb|KHN44921.1| Endoplasmin like [Glycine soja]
Length=283

 Score =   218 bits (556),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 148/184 (80%), Gaps = 17/184 (9%)
 Frame = +1

Query  88   GRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEF  267
            GRK  ANAE DSD  VDPPKV++KI  VPHGL TD +V            +++  EKFEF
Sbjct  92   GRKFQANAEGDSDELVDPPKVKDKISDVPHGLLTDSNV------------IKSNVEKFEF  139

Query  268  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqi  447
            QAEVS LMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK+++GEGD  KL+IQI
Sbjct  140  QAEVSWLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVVGEGDNTKLDIQI  199

Query  448  kldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF-----VEKMQSSGDLNLIGQFG  612
            KLDK+KK LSIR+RGIGMTKEDL+KNLGTIAK GTS       + +MQ+SGDLNLIGQFG
Sbjct  200  KLDKEKKSLSIRERGIGMTKEDLIKNLGTIAKFGTSGMYVADIIAEMQTSGDLNLIGQFG  259

Query  613  VGFY  624
            VGFY
Sbjct  260  VGFY  263



>tpg|DAA46734.1| TPA: hypothetical protein ZEAMMB73_851694 [Zea mays]
Length=377

 Score =   221 bits (562),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +1

Query  91   RKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEFQ  270
            +K+  NAE  SD   +PPKVEEK+G +PHGLSTD  VA+ EAES+S++TLR+ AEKFEFQ
Sbjct  138  KKLQVNAEESSDDLANPPKVEEKLGAIPHGLSTDSKVAQSEAESISRKTLRSSAEKFEFQ  197

Query  271  AEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqik  450
            AEVSRLMDIIINSLY+NKDIFLRELISNASDALDKIRFLSLTDK++LGEGDTAKLEIQIK
Sbjct  198  AEVSRLMDIIINSLYNNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTAKLEIQIK  257

Query  451  ldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTS  555
            LDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTS
Sbjct  258  LDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTS  292



>ref|XP_001770511.1| predicted protein [Physcomitrella patens]
 gb|EDQ64680.1| predicted protein [Physcomitrella patens]
Length=849

 Score =   229 bits (585),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +1

Query  142  PKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSN  321
            PK+EE +G VP G +TD +V KRE+ESM+ + LR+ AEKFEFQAEVSRLMDIII+SLYSN
Sbjct  51   PKLEENLGAVPAGSTTDSEVVKRESESMTSKNLRSNAEKFEFQAEVSRLMDIIIHSLYSN  110

Query  322  KDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGM  501
            KDIFLRELISNASDALDKIRFLSLTD  +LGEGD AKL+I IKLDK+KK+L+IRDRGIGM
Sbjct  111  KDIFLRELISNASDALDKIRFLSLTDSSVLGEGDDAKLDIHIKLDKEKKVLTIRDRGIGM  170

Query  502  TKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGVGFY  624
            TK DL+KNLGTIAKSGTSAF+E+MQ  GDLNLIGQFGVGFY
Sbjct  171  TKNDLIKNLGTIAKSGTSAFLEQMQKGGDLNLIGQFGVGFY  211



>tpg|DAA46735.1| TPA: hypothetical protein ZEAMMB73_851694 [Zea mays]
Length=411

 Score =   220 bits (561),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +1

Query  91   RKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEFQ  270
            +K+  NAE  SD   +PPKVEEK+G +PHGLSTD  VA+ EAES+S++TLR+ AEKFEFQ
Sbjct  138  KKLQVNAEESSDDLANPPKVEEKLGAIPHGLSTDSKVAQSEAESISRKTLRSSAEKFEFQ  197

Query  271  AEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqik  450
            AEVSRLMDIIINSLY+NKDIFLRELISNASDALDKIRFLSLTDK++LGEGDTAKLEIQIK
Sbjct  198  AEVSRLMDIIINSLYNNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTAKLEIQIK  257

Query  451  ldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTS  555
            LDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTS
Sbjct  258  LDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTS  292



>gb|AFW81541.1| hypothetical protein ZEAMMB73_624427 [Zea mays]
 gb|AFW81542.1| hypothetical protein ZEAMMB73_624427 [Zea mays]
Length=411

 Score =   216 bits (551),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  85   QGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFE  264
            Q  K+  NAE  SD   +PPKVEEK+G VPHGLSTD +VA+ EAES+S++TLR+ AEKFE
Sbjct  244  QANKLQVNAEESSDDLANPPKVEEKLGAVPHGLSTDSEVAQSEAESISRKTLRSSAEKFE  303

Query  265  FQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiq  444
            FQAEVSRLMDIIINSLY+NKDIF RELISNASDALDKIRFLSLTDK++LGE DTAKLEIQ
Sbjct  304  FQAEVSRLMDIIINSLYNNKDIFPRELISNASDALDKIRFLSLTDKEVLGERDTAKLEIQ  363

Query  445  ikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTS  555
            IKLDK+KKILSI DRGIGMTKEDL+KNLGTIAKSGTS
Sbjct  364  IKLDKEKKILSIWDRGIGMTKEDLIKNLGTIAKSGTS  400



>emb|CDY08910.1| BnaC08g11400D [Brassica napus]
Length=783

 Score =   222 bits (566),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 162/181 (90%), Gaps = 4/181 (2%)
 Frame = +1

Query  22   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHG-LSTDPD  198
            MRK A+ +VLFL  LLFLLPDQGRK+HANAE  SD   DPPKVE+K+GG  HG LSTD D
Sbjct  1    MRKRAIVSVLFLFSLLFLLPDQGRKLHANAEDSSDEVTDPPKVEKKLGG--HGGLSTDSD  58

Query  199  VAKR-EAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK  375
            V +R E+ES+SK++LR+  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK
Sbjct  59   VVRRLESESISKKSLRSSGEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK  118

Query  376  IRFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTS  555
            IRFL+LTDKD+LGEGDTAKLEIQIKLDK KKILSIRDRGIGMTKEDL+KNLGTIA+SGTS
Sbjct  119  IRFLALTDKDVLGEGDTAKLEIQIKLDKAKKILSIRDRGIGMTKEDLIKNLGTIAQSGTS  178

Query  556  A  558
             
Sbjct  179  V  179



>ref|XP_008660989.1| PREDICTED: endoplasmin homolog [Zea mays]
Length=209

 Score =   198 bits (504),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +1

Query  163  GGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRE  342
              VPHGLSTD +VA+REAES+S++TLR+  EKFEFQAEVSRLMDIIINSLYSNKDIFLRE
Sbjct  13   NAVPHGLSTDSEVAQREAESISRKTLRSSIEKFEFQAEVSRLMDIIINSLYSNKDIFLRE  72

Query  343  LISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVK  522
            LISNASDALDKIRFLSLTDK++LGEGDTAKLEIQIKLDK+KKILSIRDRGIGMTKEDL+K
Sbjct  73   LISNASDALDKIRFLSLTDKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIGMTKEDLIK  132

Query  523  NLGTIAKSGTS  555
            NLGTIAKSGTS
Sbjct  133  NLGTIAKSGTS  143



>ref|XP_002949693.1| hypothetical protein VOLCADRAFT_80696 [Volvox carteri f. nagariensis]
 gb|EFJ49245.1| hypothetical protein VOLCADRAFT_80696 [Volvox carteri f. nagariensis]
Length=808

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 138/176 (78%), Gaps = 6/176 (3%)
 Frame = +1

Query  103  ANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRT--LRAGAEKFEFQAE  276
            A+  +D+ A    PKV+  +    H  +TD     RE ESMS     LR+GAE+F FQAE
Sbjct  24   ADTSIDATAA---PKVDNGVSS-GHATTTDATSIHREKESMSNTANRLRSGAEQFAFQAE  79

Query  277  VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikld  456
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK  LGEG+ A L+I+I LD
Sbjct  80   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKAQLGEGEAANLDIKIWLD  139

Query  457  kdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGVGFY  624
               + L+IRDRGIGMTK+DLVKNLGTIAKSGTSAF+E+MQ  GD+NLIGQFGVGFY
Sbjct  140  AASRTLNIRDRGIGMTKDDLVKNLGTIAKSGTSAFLEQMQKGGDMNLIGQFGVGFY  195



>ref|XP_001701885.1| heat shock protein 90B [Chlamydomonas reinhardtii]
 gb|EDP06860.1| heat shock protein 90B, partial [Chlamydomonas reinhardtii]
Length=768

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 138/170 (81%), Gaps = 4/170 (2%)
 Frame = +1

Query  124  DAPVDP---PKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEFQAEVSRLMD  294
            D+ VD    PKV+  +    H  +TD     RE E+MSK+ +R   E+F FQAEV+RLMD
Sbjct  1    DSAVDATAAPKVDNGVSS-GHATATDATSIHREKEAMSKQRVRDSGEQFAFQAEVTRLMD  59

Query  295  IIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkkil  474
            III+SLYSNKDIFLRELISNASDALDKIRFLSLTDK ILG+GDT+ LEI+I LD + K+L
Sbjct  60   IIIHSLYSNKDIFLRELISNASDALDKIRFLSLTDKSILGDGDTSNLEIKIWLDPESKVL  119

Query  475  sirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGVGFY  624
             IRDRGIGMTK+DL+KNLGTIAKSGTSAF+E+MQ  GD+NLIGQFGVGFY
Sbjct  120  YIRDRGIGMTKDDLIKNLGTIAKSGTSAFLEQMQKGGDMNLIGQFGVGFY  169



>ref|XP_008646956.1| PREDICTED: endoplasmin homolog [Zea mays]
Length=215

 Score =   187 bits (474),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = +1

Query  142  PKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSN  321
            P+V  +   VP GLSTD +VA+REAES+S++TLR+  EKFEFQAEVSRLMDIIINSLY+ 
Sbjct  69   PRVTTQRSVVPRGLSTDSEVAQREAESISRKTLRSSTEKFEFQAEVSRLMDIIINSLYNK  128

Query  322  KDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGM  501
            KDIFLRE ISNASDALDKIRFLSLTDK++LGEGDTAKLEIQIKLDK+KKILSIRDRGIGM
Sbjct  129  KDIFLREPISNASDALDKIRFLSLTDKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIGM  188

Query  502  TKEDLVKNLGTIAKSGTS  555
            TKEDL+KNLGTIAKSGTS
Sbjct  189  TKEDLIKNLGTIAKSGTS  206



>gb|KJB63273.1| hypothetical protein B456_010G0030002, partial [Gossypium raimondii]
Length=178

 Score =   176 bits (446),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 105/112 (94%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +1

Query  289  MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkk  468
            MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGDT+KL+IQIKLDK+KK
Sbjct  1    MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTSKLDIQIKLDKEKK  60

Query  469  ilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGVGFY  624
            ILS+RDRGIGMTKEDL+KNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGVGFY
Sbjct  61   ILSLRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGVGFY  112



>gb|AFK46854.1| unknown [Medicago truncatula]
Length=121

 Score =   168 bits (426),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 106/111 (95%), Positives = 108/111 (97%), Gaps = 0/111 (0%)
 Frame = +1

Query  289  MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkk  468
            MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGD AKLEIQIKLDK+KK
Sbjct  1    MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDNAKLEIQIKLDKEKK  60

Query  469  ilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGVGF  621
            ILSIRDRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQ+SGDLNLIGQFG  F
Sbjct  61   ILSIRDRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQTSGDLNLIGQFGSWF  111



>ref|XP_001753222.1| predicted protein [Physcomitrella patens]
 gb|EDQ81851.1| predicted protein [Physcomitrella patens]
Length=759

 Score =   177 bits (450),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 122/139 (88%), Gaps = 1/139 (1%)
 Frame = +1

Query  208  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  387
            RE ++++ +  R G E FEFQAEVSRLMDIIINSLYSNKDIFLREL+SNASDALDKIRFL
Sbjct  4    RERDTLAPKERRNG-ESFEFQAEVSRLMDIIINSLYSNKDIFLRELVSNASDALDKIRFL  62

Query  388  SLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVE  567
            SL DK +L +G  A+L+I IK+DK + +LSIRD G+GMTKEDL+KNLGT+AKSGTS+F++
Sbjct  63   SLMDKTLLSDGKDAELDIHIKVDKKENVLSIRDNGVGMTKEDLIKNLGTVAKSGTSSFLD  122

Query  568  KMQSSGDLNLIGQFGVGFY  624
            ++QS GDLNLIGQFGVGFY
Sbjct  123  QIQSGGDLNLIGQFGVGFY  141



>gb|KHG15193.1| Endoplasmin [Gossypium arboreum]
Length=718

 Score =   177 bits (449),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 105/112 (94%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +1

Query  289  MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkk  468
            MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGDT+KL+IQIKLDK+KK
Sbjct  1    MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTSKLDIQIKLDKEKK  60

Query  469  ilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGVGFY  624
            ILS+RDRGIGMTKEDL+KNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGVGFY
Sbjct  61   ILSLRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGVGFY  112



>ref|XP_001421809.1| Heat Shock Protein 90, endoplasmic reticulum [Ostreococcus lucimarinus 
CCE9901]
 gb|ABP00103.1| Heat Shock Protein 90, endoplasmic reticulum [Ostreococcus lucimarinus 
CCE9901]
Length=794

 Score =   177 bits (448),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  GAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDT  426
            GAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISN SD+LDKIRF+SLTDK+ LG G+ 
Sbjct  53   GAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNGSDSLDKIRFMSLTDKEQLGGGEN  112

Query  427  AkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQ  606
            A L+I+IK DK++K+L+IRDRGIGMTK+DL+ NLGTIAKSGTSAF+++M S GD++LIGQ
Sbjct  113  ADLDIRIKADKERKVLTIRDRGIGMTKDDLMNNLGTIAKSGTSAFLDQMASGGDMSLIGQ  172

Query  607  FGVGFY  624
            FGVGFY
Sbjct  173  FGVGFY  178



>ref|XP_002508627.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69885.1| predicted protein [Micromonas sp. RCC299]
Length=777

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  232  RTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  411
            +T ++GAE  EFQAEVSRLMDIIINSLYSNKDIFLRELISN SD+LDKIRFLSLTD+ +L
Sbjct  33   KTFKSGAEVSEFQAEVSRLMDIIINSLYSNKDIFLRELISNGSDSLDKIRFLSLTDESVL  92

Query  412  GEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDL  591
            G GD A L+I+IK+DK+  +LSIRDRG+GMTK +L +NLGTIAKSGTSAF+E+MQ  GD+
Sbjct  93   GAGDDANLDIRIKVDKENGVLSIRDRGVGMTKAELKENLGTIAKSGTSAFLEQMQKGGDM  152

Query  592  NLIGQFGVGFY  624
            NLIGQFGVGFY
Sbjct  153  NLIGQFGVGFY  163



>ref|XP_006657349.1| PREDICTED: endoplasmin homolog [Oryza brachyantha]
Length=951

 Score =   177 bits (449),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 123/138 (89%), Gaps = 2/138 (1%)
 Frame = +1

Query  217  ESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLT  396
            E ++ + LR   E FEFQA ++ L+DIIINS Y N DIFLRELISNASDALDKIRFL+LT
Sbjct  398  EPIATKALRRSGEMFEFQAILTNLIDIIINSPYRNSDIFLRELISNASDALDKIRFLALT  457

Query  397  DKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQ  576
            DK++LGEGDTAKLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAFVEKMQ
Sbjct  458  DKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQ  517

Query  577  SSGDLNLIGQFGVG--FY  624
            + GDLNLIG+FGVG  FY
Sbjct  518  TGGDLNLIGKFGVGVRFY  535



>ref|NP_001146348.1| shepherd-like1 [Zea mays]
 gb|ACL53742.1| unknown [Zea mays]
Length=719

 Score =   174 bits (442),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 106/112 (95%), Positives = 110/112 (98%), Gaps = 0/112 (0%)
 Frame = +1

Query  289  MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkk  468
            MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGDTAKLEIQIKLDK+KK
Sbjct  1    MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTAKLEIQIKLDKEKK  60

Query  469  ilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGVGFY  624
            ILSIRDRGIGMTKEDL+ NLGTIAKSGTSAFVEKMQS GDLNLIGQFGVGFY
Sbjct  61   ILSIRDRGIGMTKEDLINNLGTIAKSGTSAFVEKMQSGGDLNLIGQFGVGFY  112



>ref|XP_003083767.1| heat shock protein 90 (ISS) [Ostreococcus tauri]
Length=788

 Score =   174 bits (442),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  GAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDT  426
            G+EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISN SDALDKIRF+SLTDK+ LG G+ 
Sbjct  51   GSEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNGSDALDKIRFMSLTDKEQLGSGEN  110

Query  427  AkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQ  606
            A L+I+IK DK++K+L+IRDRG+GMTK DL+ NLGTIAKSGTSAF+++M   GD++LIGQ
Sbjct  111  ANLDIRIKADKERKVLTIRDRGVGMTKADLMNNLGTIAKSGTSAFLDQMAKGGDMSLIGQ  170

Query  607  FGVGFY  624
            FGVGFY
Sbjct  171  FGVGFY  176



>ref|XP_003063917.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH51539.1| predicted protein [Micromonas pusilla CCMP1545]
Length=820

 Score =   174 bits (442),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  232  RTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  411
            +  + GAE+ EFQAEVSRLMDIIINSLYSNKDIFLRELISN SD+LDKIRFL+LTD+ +L
Sbjct  41   KAFKEGAEQHEFQAEVSRLMDIIINSLYSNKDIFLRELISNGSDSLDKIRFLALTDESLL  100

Query  412  GEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDL  591
            G GD A LEI+IK+D DKKIL+IRDRG+GMTK+DL +NLGTIAKSGTSAF+E+MQ  GD+
Sbjct  101  GVGDDANLEIRIKVDHDKKILTIRDRGVGMTKKDLKENLGTIAKSGTSAFLEQMQKGGDM  160

Query  592  NLIGQFGVGFY  624
            +LIGQFGVGFY
Sbjct  161  SLIGQFGVGFY  171



>ref|XP_005823214.1| hypothetical protein GUITHDRAFT_160160 [Guillardia theta CCMP2712]
 gb|EKX36234.1| hypothetical protein GUITHDRAFT_160160 [Guillardia theta CCMP2712]
Length=839

 Score =   173 bits (439),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = +1

Query  229  KRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDI  408
            K+ L  G +K EFQAEV RLMDIIINSLYS K+IFLRELISNASDALDKIRFLSLTD  +
Sbjct  63   KKALEQGGQKQEFQAEVGRLMDIIINSLYSKKEIFLRELISNASDALDKIRFLSLTDPKV  122

Query  409  LGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGD  588
            LGEGD +KLEI+I+ DK+   +SI D GIGMT+EDL+ NLGTIAKSGTS+F+EKM   GD
Sbjct  123  LGEGDQSKLEIRIEADKEAGTISISDTGIGMTREDLMNNLGTIAKSGTSSFLEKMAKEGD  182

Query  589  LNLIGQFGVGFY  624
            +NLIGQFGVGFY
Sbjct  183  MNLIGQFGVGFY  194



>ref|XP_007512535.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17135.1| predicted protein [Bathycoccus prasinos]
Length=1223

 Score =   172 bits (437),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  TLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  414
            T +AGAE  EFQAEVSRLMDIIINSLYSNKDIFLRELISN SDALDKIRFLSLTD   LG
Sbjct  461  TFKAGAEVNEFQAEVSRLMDIIINSLYSNKDIFLRELISNGSDALDKIRFLSLTDASQLG  520

Query  415  EGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLN  594
            +GD A+L+I+IK+DKD+K++SIRD+G+GMTK+++  NLGTIAKSGTSAF+E+MQ  GD++
Sbjct  521  DGDAAQLDIRIKIDKDQKLISIRDKGVGMTKQEIKDNLGTIAKSGTSAFLEQMQKGGDMS  580

Query  595  LIGQFGVGFY  624
            LIGQFGVGFY
Sbjct  581  LIGQFGVGFY  590



>ref|XP_002157524.1| PREDICTED: endoplasmin-like [Hydra vulgaris]
Length=825

 Score =   170 bits (430),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 122/180 (68%), Gaps = 14/180 (8%)
 Frame = +1

Query  121  SDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMS--------KRTLRAGAEKFEFQAE  276
            S+  VD PKV + IG    G  TD +V KRE E+++         + LR  AEK  FQAE
Sbjct  28   SEDEVDTPKVTDDIGKSRDGSKTDDEVVKREEEAINIDGLSVAEVKQLRESAEKHAFQAE  87

Query  277  VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikld  456
            VSR+M +IINSLY NK+IFLRELISNASDALDKIRFLSLTDK +L   D   ++I+   D
Sbjct  88   VSRMMKLIINSLYKNKEIFLRELISNASDALDKIRFLSLTDKSVLSATDEFSVKIKADKD  147

Query  457  kdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLN----LIGQFGVGFY  624
             +   ++    GIGMTK+DL+K LGTIAKSGTS F +KMQ +G  N    LIGQFGVGFY
Sbjct  148  NNILHITDT--GIGMTKDDLIKQLGTIAKSGTSEFFQKMQEAGTANQASDLIGQFGVGFY  205



>ref|XP_005651682.1| heat shock protein Hsp90 [Coccomyxa subellipsoidea C-169]
 gb|EIE27138.1| heat shock protein Hsp90 [Coccomyxa subellipsoidea C-169]
Length=768

 Score =   169 bits (427),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 116/128 (91%), Gaps = 2/128 (2%)
 Frame = +1

Query  241  RAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEG  420
            + GAEKF FQAEV+RLMDI+I+SLYSNK+IFLRELISNA+DALDKIRFLSLTDK  LGE 
Sbjct  49   KEGAEKFTFQAEVNRLMDILIHSLYSNKEIFLRELISNAADALDKIRFLSLTDKGQLGE-  107

Query  421  DTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLI  600
             T+ LEI++K+D D KIL+I+D G+GMT++DLVKNLGTIAKSGTSAF+E+MQ S D+NLI
Sbjct  108  -TSDLEIRVKVDHDNKILTIQDTGVGMTRDDLVKNLGTIAKSGTSAFLEQMQKSNDINLI  166

Query  601  GQFGVGFY  624
            GQFGVGFY
Sbjct  167  GQFGVGFY  174



>dbj|GAM27457.1| hypothetical protein SAMD00019534_106330 [Acytostelium subglobosum 
LB1]
Length=821

 Score =   166 bits (420),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 129/174 (74%), Gaps = 12/174 (7%)
 Frame = +1

Query  139  PPKVEEKIGGVPHGLSTDPDVAKREAESM--------SKRTLRAGAEKFEFQAEVSRLMD  294
            P +++  + G    L+TD +V +RE E++         ++ ++  AEKF FQAEV++LM+
Sbjct  35   PIELDLDLKGAKTPLTTDSEVVQRENEAIKSEGYSVAEQKLIQENAEKFTFQAEVNKLMN  94

Query  295  IIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkkil  474
            IIINSLYS K+IFLRELISNASDALDKIRFL+LT+  +LG+GD +KL+I+I +D   K+L
Sbjct  95   IIINSLYSKKEIFLRELISNASDALDKIRFLALTNPALLGDGDQSKLDIRIMIDNANKVL  154

Query  475  sirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDL----NLIGQFGVGFY  624
             I DRGIGMTK+DL+KNLGTIA+SGT  F+ K+  S D     NLIGQFGVGFY
Sbjct  155  HIIDRGIGMTKDDLIKNLGTIAQSGTKDFINKLAQSNDTKDNSNLIGQFGVGFY  208



>ref|XP_006588134.1| PREDICTED: endoplasmin homolog [Glycine max]
Length=137

 Score =   154 bits (388),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 105/117 (90%), Gaps = 5/117 (4%)
 Frame = +1

Query  289  MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkk  468
            MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK+++GEGD  KL+IQIKLDK+KK
Sbjct  1    MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVVGEGDNTKLDIQIKLDKEKK  60

Query  469  ilsirdRGIGMTKEDLVKNLGTIAKSGTSAF-----VEKMQSSGDLNLIGQFGVGFY  624
             LSIR+RGIGMTKEDL+KNLGTIAK GTS       + +MQ+SGDLNLIGQFGVGFY
Sbjct  61   SLSIRERGIGMTKEDLIKNLGTIAKFGTSGMYVADIIAEMQTSGDLNLIGQFGVGFY  117



>emb|CEG00480.1| Histidine kinase-like ATPase, ATP-binding domain [Ostreococcus 
tauri]
Length=789

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 113/126 (90%), Gaps = 2/126 (2%)
 Frame = +1

Query  247  GAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDT  426
            G+EKFEFQAEVSRL  IIINSLYSNKDIFLRELISN SDALDKIRF+SLTDK+ LG G+ 
Sbjct  54   GSEKFEFQAEVSRL--IIINSLYSNKDIFLRELISNGSDALDKIRFMSLTDKEQLGSGEN  111

Query  427  AkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQ  606
            A L+I+IK DK++K+L+IRDRG+GMTK DL+ NLGTIAKSGTSAF+++M   GD++LIGQ
Sbjct  112  ANLDIRIKADKERKVLTIRDRGVGMTKADLMNNLGTIAKSGTSAFLDQMAKGGDMSLIGQ  171

Query  607  FGVGFY  624
            FGVGFY
Sbjct  172  FGVGFY  177



>gb|EFA78289.1| heat shock protein Hsp90 family protein [Polysphondylium pallidum 
PN500]
Length=822

 Score =   164 bits (415),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 130/179 (73%), Gaps = 12/179 (7%)
 Frame = +1

Query  124  DAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMS--------KRTLRAGAEKFEFQAEV  279
            DA  +  KV+  + G    L TD +V +RE E++         ++ +   +EKF+FQAEV
Sbjct  30   DAARETLKVDLDMKGPKVPLQTDSEVVQRENEAIKSEGFSVAEQQFIEEQSEKFKFQAEV  89

Query  280  SRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldk  459
            ++LM+IIINSLYS K+IFLRELISNASDALDKIRFL+LT+  +LGEGD A L+I+I +DK
Sbjct  90   NKLMNIIINSLYSKKEIFLRELISNASDALDKIRFLALTNPSLLGEGDQANLDIRIMIDK  149

Query  460  dkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGD----LNLIGQFGVGFY  624
              K + I DRG+GMTK++LVKNLGTIA+SGT  F++K+  S D     NLIGQFGVGFY
Sbjct  150  VNKYIHIIDRGVGMTKDELVKNLGTIAQSGTKEFIKKVTESNDPKNSSNLIGQFGVGFY  208



>gb|ACR38010.1| unknown [Zea mays]
Length=104

 Score =   151 bits (381),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +1

Query  91   RKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEFQ  270
            +K+  NAE  SD   +PPKVEEK+G VPHGLSTD +VA+REAES+S++TLR+ AEKFEFQ
Sbjct  12   KKLQVNAEESSDDLANPPKVEEKLGAVPHGLSTDSEVAQREAESISRKTLRSSAEKFEFQ  71

Query  271  AEVSRLMDIIINSLYSNKDIFLRELISNASDA  366
            AEVSRLMDIIINSLYSNKDIFLRELISNASDA
Sbjct  72   AEVSRLMDIIINSLYSNKDIFLRELISNASDA  103



>gb|AGX25162.1| heat shock protein, partial [Leptinotarsa decemlineata]
Length=291

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 122/172 (71%), Gaps = 14/172 (8%)
 Frame = +1

Query  145  KVEEKIGGVPHGLSTDPDVAKREAESM--------SKRTLRAGAEKFEFQAEVSRLMDII  300
            +VE  +G    G  TD +V KRE E++          R LR  +EKF FQ EV+R+M +I
Sbjct  32   EVELDLGASREGSRTDDEVVKREEEAIKLDGLNVAQLRELREKSEKFAFQTEVNRMMKLI  91

Query  301  INSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkkilsi  480
            INSLY NK+IFLRELISNASDALDKIR LSLTDK++L      ++ I+IK DK+  +L I
Sbjct  92   INSLYRNKEIFLRELISNASDALDKIRMLSLTDKEVL--NSQPEMNIRIKADKESGMLHI  149

Query  481  rdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQ---SSGDLN-LIGQFGVGFY  624
             D GIGMTKEDL+ NLGTIAKSGT+ F+ KMQ   +S D+N +IGQFGVGFY
Sbjct  150  TDTGIGMTKEDLINNLGTIAKSGTAEFLAKMQTSETSQDMNDMIGQFGVGFY  201



>gb|AFW81490.1| hypothetical protein ZEAMMB73_031063, partial [Zea mays]
Length=102

 Score =   149 bits (377),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +1

Query  91   RKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEFQ  270
            +K+  NAE  SD   +PPKVEEK+G VPHGLSTD +VA+REAES+S++TLR+ AEKFEFQ
Sbjct  12   KKLQVNAEESSDDLANPPKVEEKLGAVPHGLSTDSEVAQREAESISRKTLRSSAEKFEFQ  71

Query  271  AEVSRLMDIIINSLYSNKDIFLRELISNASD  363
            AEVSRLMDIIINSLYSNKDIFLRELISNASD
Sbjct  72   AEVSRLMDIIINSLYSNKDIFLRELISNASD  102



>tpg|DAA34121.1| TPA_exp: endoplasmic reticulum glucose-regulated protein [Amblyomma 
variegatum]
Length=207

 Score =   152 bits (385),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 121/180 (67%), Gaps = 15/180 (8%)
 Frame = +1

Query  124  DAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESM--------SKRTLRAGAEKFEFQAEV  279
            DA    PKVE+ +G    G  TD  V +RE E++          + +R  AEK  FQAEV
Sbjct  23   DAESSTPKVEDDLGATREGSRTDDQVVEREEEAIKLDGLNVAQMKEMREKAEKHAFQAEV  82

Query  280  SRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldk  459
            +R+M +IINSLY NK+IFLRELISNASDALDKIR LSLT+ D+L      +L I++K DK
Sbjct  83   TRMMKLIINSLYRNKEIFLRELISNASDALDKIRLLSLTNPDVLNSN--PELTIRVKSDK  140

Query  460  dkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGD----LN-LIGQFGVGFY  624
            +  +L I D GIGMTK DLV NLGTIAKSGT+ F++K+  + D    LN LIGQ GVGFY
Sbjct  141  ENGLLHITDTGIGMTKSDLVNNLGTIAKSGTAEFLQKVAETADAPKELNDLIGQLGVGFY  200



>gb|AIC62039.1| HSP90B1, partial [synthetic construct]
Length=315

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>gb|AAH09195.1| HSP90B1 protein [Homo sapiens]
Length=315

 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_011402246.1| Endoplasmin-like protein [Auxenochlorella protothecoides]
 gb|KFM29193.1| Endoplasmin-like protein [Auxenochlorella protothecoides]
Length=1046

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 113/130 (87%), Gaps = 1/130 (1%)
 Frame = +1

Query  238  LRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGE  417
             R GAE  +FQAEV+RLMDI+INSLYSNKDIFLRELISNA+DALDKIRFL+LTDK  LG+
Sbjct  30   FRKGAETMQFQAEVNRLMDILINSLYSNKDIFLRELISNAADALDKIRFLALTDKSQLGD  89

Query  418  GDTAkle-iqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLN  594
             + ++   I+I +D+++++LSIRD G+GMT++DLV NLGT+A+SGTSAF+E+ Q  GDL+
Sbjct  90   TEESQALGIRIWVDEERRVLSIRDSGVGMTRQDLVNNLGTVARSGTSAFLEQAQRGGDLS  149

Query  595  LIGQFGVGFY  624
            LIGQFGVGFY
Sbjct  150  LIGQFGVGFY  159



>ref|XP_002117847.1| hypothetical protein TRIADDRAFT_64388 [Trichoplax adhaerens]
 gb|EDV19690.1| hypothetical protein TRIADDRAFT_64388 [Trichoplax adhaerens]
Length=669

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 125/172 (73%), Gaps = 15/172 (9%)
 Frame = +1

Query  148  VEEKIGGVPHGLSTDPDVAKREAESM--------SKRTLRAGAEKFEFQAEVSRLMDIII  303
            VEE IG       TD +   RE E++          + LR   EK EFQAEVSR+M +II
Sbjct  15   VEEDIGKSRDASKTDDEAVAREEEAIKIDGLNVAQMKELREKGEKSEFQAEVSRMMKLII  74

Query  304  NSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkkilsir  483
            NSLY NK+IFLRELISN+SDALDKIRF+SLTDK++L  G+  +LEI+IK+DK+ ++L I 
Sbjct  75   NSLYRNKEIFLRELISNSSDALDKIRFMSLTDKEVL--GNNPELEIKIKVDKENRVLHIT  132

Query  484  dRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGD-----LNLIGQFGVGFY  624
            D GIGMTK+DL+KNLGTIAKSGT+ F +KMQ SG+      +LIGQFGVGFY
Sbjct  133  DTGIGMTKQDLIKNLGTIAKSGTNEFFKKMQESGEESKQASDLIGQFGVGFY  184



>gb|EAW97723.1| heat shock protein 90kDa beta (Grp94), member 1, isoform CRA_a, 
partial [Homo sapiens]
Length=367

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  47   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  101

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  102  EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  161

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  162  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  218

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  219  -LIGQFGVGFY  228



>emb|CBN74418.1| Heat shock protein 90 [Ectocarpus siliculosus]
Length=767

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 97/129 (75%), Gaps = 2/129 (2%)
 Frame = +1

Query  238  LRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGE  417
            L+ GAE FEFQAEV+RLMDIIINSLY NKDIFLRELISNASDALDKIRFLS++D D LG 
Sbjct  50   LKDGAEAFEFQAEVNRLMDIIINSLYKNKDIFLRELISNASDALDKIRFLSVSDPDKLGT  109

Query  418  GDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNL  597
                ++ I    D     +     G+GMTK DL+ NLGT+A+SGT+ FVE +  +GDL L
Sbjct  110  AKDLEIRISADKDARTLTIRDA--GVGMTKADLISNLGTVARSGTTNFVEALTETGDLGL  167

Query  598  IGQFGVGFY  624
            IGQFGVGFY
Sbjct  168  IGQFGVGFY  176



>ref|XP_011311739.1| PREDICTED: endoplasmin [Fopius arisanus]
Length=794

 Score =   156 bits (395),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 128/186 (69%), Gaps = 14/186 (8%)
 Frame = +1

Query  103  ANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEK  258
            A A+++ D   D P VE+ +G       TD +V +RE+E+++         + LR  AEK
Sbjct  18   ARAQLEIDEADDVPSVEQNLGSSREASRTDDEVVQRESEAINIDGLNPSQIQELRNRAEK  77

Query  259  FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkle  438
            F FQ EV+R+M +IINSLY NK+IFLRELISNASDALDKIR LSLTDK++L      +L 
Sbjct  78   FTFQTEVNRMMKLIINSLYRNKEIFLRELISNASDALDKIRLLSLTDKNVLDTN--PELS  135

Query  439  iqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDL----NLIGQ  606
            I+IK D + KIL I D GIGMTK DL+ NLGTIAKSGT+ F+ KMQ + +     ++IGQ
Sbjct  136  IRIKADAENKILHIIDSGIGMTKTDLINNLGTIAKSGTAEFLGKMQDTKNAQEMNDMIGQ  195

Query  607  FGVGFY  624
            FGVGFY
Sbjct  196  FGVGFY  201



>ref|XP_007893493.1| PREDICTED: endoplasmin [Callorhinchus milii]
Length=805

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 126/185 (68%), Gaps = 15/185 (8%)
 Frame = +1

Query  109  AEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFE  264
            A   +D P+    VEE +G    G  TD +V KRE E++          + LR  +EKF 
Sbjct  17   ASARADEPLADETVEEDLGKSRDGSKTDDEVTKREEEAIQLDGLNPAQIKELRDKSEKFV  76

Query  265  FQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiq  444
            FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD   L  G T ++ I+
Sbjct  77   FQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDDSAL--GGTEEMTIK  134

Query  445  ikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEK---MQSSGDLN--LIGQF  609
            IK DK+K +L I D GIGMTKE+L+KNLGTIAKSGTS F+ K   MQ+ G     LIGQF
Sbjct  135  IKADKEKNMLHITDTGIGMTKEELIKNLGTIAKSGTSEFLNKMTEMQTEGQSTSELIGQF  194

Query  610  GVGFY  624
            GVGFY
Sbjct  195  GVGFY  199



>ref|XP_003907109.1| PREDICTED: endoplasmin [Papio anubis]
Length=800

 Score =   155 bits (392),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 125/187 (67%), Gaps = 20/187 (11%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK----RTLRAGAEKFE  264
            + A+ EVD D  V     EE +G    G  TD +V +RE E++      R LR  +EKF 
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAILNASQIRELREKSEKFA  73

Query  265  FQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiq  444
            FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   ++I+
Sbjct  74   FQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELTVKIK  133

Query  445  ikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDLNLIG  603
               +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ +  LIG
Sbjct  134  CDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE--LIG  189

Query  604  QFGVGFY  624
            QFGVGFY
Sbjct  190  QFGVGFY  196



>ref|XP_004373828.1| PREDICTED: endoplasmin [Trichechus manatus latirostris]
Length=803

 Score =   155 bits (391),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 96/189 (51%), Positives = 122/189 (65%), Gaps = 20/189 (11%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADGEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-----QSSGDLNL  597
            ++I+   +K+   ++    GIGMT+E+LVKNLGTIAKSGTS F+ KM      S     L
Sbjct  134  VKIKCDKEKNLLHVTDT--GIGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDSQSTSEL  191

Query  598  IGQFGVGFY  624
            IGQFGVGFY
Sbjct  192  IGQFGVGFY  200



>gb|AAH81917.1| Tra1 protein [Rattus norvegicus]
Length=643

 Score =   153 bits (387),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDREKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_010219153.1| PREDICTED: endoplasmin-like, partial [Tinamus guttatus]
Length=312

 Score =   149 bits (376),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 119/184 (65%), Gaps = 20/184 (11%)
 Frame = +1

Query  112  EVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEF  267
            EVD D  V     E+ +G    G  TD +V +RE E++          + +R  +EKF F
Sbjct  51   EVDVDGTV-----EDDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIKEIREKSEKFAF  105

Query  268  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqi  447
            QAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   ++I+ 
Sbjct  106  QAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELTVKIKC  165

Query  448  kldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-----QSSGDLNLIGQFG  612
              +K+   ++    GIGMTKE+L+KNLGTIAKSGTS F+ KM      S     LIGQFG
Sbjct  166  DKEKNMLHVTDT--GIGMTKEELIKNLGTIAKSGTSEFLNKMTEMQDDSQSTSELIGQFG  223

Query  613  VGFY  624
            VGFY
Sbjct  224  VGFY  227



>ref|XP_009065664.1| hypothetical protein LOTGIDRAFT_197084 [Lottia gigantea]
 gb|ESO83635.1| hypothetical protein LOTGIDRAFT_197084 [Lottia gigantea]
Length=792

 Score =   155 bits (391),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 116/182 (64%), Gaps = 14/182 (8%)
 Frame = +1

Query  115  VDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESM--------SKRTLRAGAEKFEFQ  270
            V ++  V  P V E IG       TD +  +RE E++          + LR  AEKF F+
Sbjct  23   VQAEEVVTEPDVVEDIGKSREASRTDDEAVQREEEAIKLDGLNVAQMKELREKAEKFAFE  82

Query  271  AEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqik  450
            AEV+R+M +IINSLY NK+IFLRELISNASDALDKIRF+SLTDK  +   D   ++I+  
Sbjct  83   AEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRFVSLTDKSAMAATDELSIKIKAD  142

Query  451  ldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDL----NLIGQFGVG  618
                   ++    GIGMTK+DLVKNLGTIAKSGTS F+ K+  S D     +LIGQFGVG
Sbjct  143  KASHVIQITDT--GIGMTKDDLVKNLGTIAKSGTSDFLSKLGESKDQAQMSDLIGQFGVG  200

Query  619  FY  624
            FY
Sbjct  201  FY  202



>dbj|BAD92771.1| tumor rejection antigen (gp96) 1 variant [Homo sapiens]
Length=576

 Score =   153 bits (386),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  45   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  99

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  100  EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  159

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  160  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  216

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  217  -LIGQFGVGFY  226



>dbj|BAP28370.1| heat shock protein 90 kDa beta member 1, partial [Canis lupus 
familiaris]
Length=663

 Score =   153 bits (387),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  12   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  66

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  67   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  126

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  127  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  183

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  184  -LIGQFGVGFY  193



>ref|XP_005358282.1| PREDICTED: endoplasmin [Microtus ochrogaster]
Length=805

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMTKE+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTKEELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_006740281.1| PREDICTED: endoplasmin isoform X2 [Leptonychotes weddellii]
Length=748

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_007109922.1| PREDICTED: endoplasmin [Physeter catodon]
Length=805

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VQADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_004326676.1| PREDICTED: endoplasmin [Tursiops truncatus]
Length=805

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VQADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>gb|KFM57735.1| Endoplasmin, partial [Stegodyphus mimosarum]
Length=785

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 123/175 (70%), Gaps = 14/175 (8%)
 Frame = +1

Query  136  DPPKVEEKIGGVPHGLSTDPDVAKREAESM--------SKRTLRAGAEKFEFQAEVSRLM  291
            D P VE  IG    G  TD +V +RE E++          + LR  AEKF FQAEV+R+M
Sbjct  24   DEPTVEPDIGSSREGSRTDDEVVQREEEAIKIDGLNVAQIKELREKAEKFTFQAEVNRMM  83

Query  292  DIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkki  471
             +IINSLY NK+IFLRELISNASDALDKIR +SLTD+  L    T  L I+IK DK+  +
Sbjct  84   KLIINSLYRNKEIFLRELISNASDALDKIRVISLTDRAALSA--TEDLSIRIKSDKENNV  141

Query  472  lsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM---QSSGDL-NLIGQFGVGFY  624
            L + D GIGMTKE+L+ NLGTIAKSGTS F++K+   QS+ +L ++IGQFGVGFY
Sbjct  142  LHVTDTGIGMTKEELINNLGTIAKSGTSDFLQKVAETQSAAELSDMIGQFGVGFY  196



>ref|XP_002428463.1| Hsp90 protein, putative [Pediculus humanus corporis]
 gb|EEB15725.1| Hsp90 protein, putative [Pediculus humanus corporis]
Length=778

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 122/176 (69%), Gaps = 14/176 (8%)
 Frame = +1

Query  133  VDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEFQAEVSRL  288
            V+   VE  +G     L TD +V +RE E++          + LR  AEKF FQAEV+R+
Sbjct  31   VETVTVEPDLGASREALRTDDNVVQREEEAIKLDGLNVAQIKELREKAEKFHFQAEVNRM  90

Query  289  MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkk  468
            M +IINSLY NK+IFLRELISNA+DALDKIR LSLTDK +L      +L I++K DKD  
Sbjct  91   MKLIINSLYRNKEIFLRELISNAADALDKIRLLSLTDKSVLDSN--PELGIRLKADKDNH  148

Query  469  ilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQ---SSGDLN-LIGQFGVGFY  624
            IL I D GIGMTK+DL+ NLGTIAKSGT+ F+ KMQ   S+ D N +IGQFGVGFY
Sbjct  149  ILHIIDSGIGMTKKDLINNLGTIAKSGTAEFLAKMQEARSTADFNDMIGQFGVGFY  204



>ref|XP_009019107.1| hypothetical protein HELRODRAFT_157169 [Helobdella robusta]
 gb|ESO02893.1| hypothetical protein HELRODRAFT_157169 [Helobdella robusta]
Length=736

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 121/175 (69%), Gaps = 18/175 (10%)
 Frame = +1

Query  142  PKVEEKIGGVPHGLSTDPDVAKREAESM--------SKRTLRAGAEKFEFQAEVSRLMDI  297
            PKV++ IG    G  TD +V +RE E++          + L+  AEK  FQAEV R+M +
Sbjct  12   PKVDDDIGKAQEGSKTDDEVVQREEEAIKLDGLSVAQMKELKDKAEKHVFQAEVDRMMKL  71

Query  298  IINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkkils  477
            IINSLY NK+IFLRELISNASDALDKIRFLSLTD   +G    A+L I+IK DKD  +L 
Sbjct  72   IINSLYKNKEIFLRELISNASDALDKIRFLSLTDNTAMGSN--AELSIKIKTDKDNHVLH  129

Query  478  irdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM------QSSGDLNLIGQFGVGFY  624
            + D G+GMTK+DL+KNLGTIAKSGTS F+ K+      Q + D  LIGQFGVGFY
Sbjct  130  VTDTGVGMTKDDLIKNLGTIAKSGTSEFLTKIGEAKSQQETSD--LIGQFGVGFY  182



>ref|XP_004269495.1| PREDICTED: endoplasmin [Orcinus orca]
Length=805

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VQADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_007165840.1| PREDICTED: endoplasmin [Balaenoptera acutorostrata scammoni]
Length=805

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VQADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_007096540.1| PREDICTED: endoplasmin [Panthera tigris altaica]
Length=804

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VQADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_004414318.1| PREDICTED: endoplasmin [Odobenus rosmarus divergens]
Length=804

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADNEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>gb|EFB13451.1| hypothetical protein PANDA_003512 [Ailuropoda melanoleuca]
Length=778

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  3    VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  57

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  58   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  117

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  118  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  174

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  175  -LIGQFGVGFY  184



>ref|XP_007619353.1| PREDICTED: endoplasmin [Cricetulus griseus]
 gb|ERE88868.1| endoplasmin [Cricetulus griseus]
Length=802

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_005068020.1| PREDICTED: endoplasmin [Mesocricetus auratus]
Length=802

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_003202424.1| PREDICTED: endoplasmin [Meleagris gallopavo]
Length=795

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 121/184 (66%), Gaps = 20/184 (11%)
 Frame = +1

Query  112  EVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEF  267
            EVD+DA V     EE +G    G  TD +V +RE E++          + +R  +EKF F
Sbjct  23   EVDADATV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIKEIREKSEKFAF  77

Query  268  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqi  447
            QAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   ++I+ 
Sbjct  78   QAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKC  137

Query  448  kldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-----QSSGDLNLIGQFG  612
              +K+   ++    GIGMTKE+L+KNLGTIAKSGTS F+ KM      S     LIGQFG
Sbjct  138  DKEKNMLHVTDT--GIGMTKEELIKNLGTIAKSGTSEFLNKMTEMQDDSQSTSELIGQFG  195

Query  613  VGFY  624
            VGFY
Sbjct  196  VGFY  199



>ref|XP_003505898.1| PREDICTED: endoplasmin [Cricetulus griseus]
 gb|EGW09701.1| Endoplasmin [Cricetulus griseus]
Length=803

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|NP_777125.1| endoplasmin precursor [Bos taurus]
 ref|XP_005899141.1| PREDICTED: endoplasmin [Bos mutus]
 ref|XP_006077264.1| PREDICTED: endoplasmin [Bubalus bubalis]
 ref|XP_010851722.1| PREDICTED: endoplasmin [Bison bison bison]
 sp|Q95M18.1|ENPL_BOVIN RecName: Full=Endoplasmin; AltName: Full=94 kDa glucose-regulated 
protein; Short=GRP-94; AltName: Full=Heat shock protein 
90 kDa beta member 1; Flags: Precursor [Bos taurus]
 dbj|BAB69766.1| glucose-regulated protein GRP94 precursor [Bos taurus]
 gb|AAI04550.1| Tumor rejection antigen (gp96) 1 [Bos taurus]
 tpg|DAA29741.1| TPA: endoplasmin precursor [Bos taurus]
Length=804

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_004006728.1| PREDICTED: endoplasmin [Ovis aries]
Length=804

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_004743081.1| PREDICTED: endoplasmin [Mustela putorius furo]
 ref|XP_004787181.1| PREDICTED: endoplasmin [Mustela putorius furo]
Length=803

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_005322404.1| PREDICTED: endoplasmin [Ictidomys tridecemlineatus]
Length=805

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 122/189 (65%), Gaps = 20/189 (11%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-----QSSGDLNL  597
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM      S     L
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDSQSTSEL  191

Query  598  IGQFGVGFY  624
            IGQFGVGFY
Sbjct  192  IGQFGVGFY  200



>gb|ELR54024.1| Endoplasmin, partial [Bos mutus]
Length=795

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_006979926.1| PREDICTED: endoplasmin [Peromyscus maniculatus bairdii]
Length=802

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|NP_001012197.2| endoplasmin precursor [Rattus norvegicus]
 sp|Q66HD0.2|ENPL_RAT RecName: Full=Endoplasmin; AltName: Full=94 kDa glucose-regulated 
protein; Short=GRP-94; AltName: Full=Heat shock protein 
90 kDa beta member 1; Flags: Precursor [Rattus norvegicus]
 gb|EDM17052.1| rCG49111 [Rattus norvegicus]
Length=804

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDREKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>gb|EPY74066.1| endoplasmin precursor [Camelus ferus]
Length=723

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 124/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A  EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRAEDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_003745792.1| PREDICTED: endoplasmin-like [Metaseiulus occidentalis]
Length=785

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 124/178 (70%), Gaps = 14/178 (8%)
 Frame = +1

Query  127  APVDPPKVEEKIGGVPHGLSTDPDVAKREAESM--------SKRTLRAGAEKFEFQAEVS  282
            A  DP +VE+ IG +  G  TD +V  RE E++          + +R  AEK  FQAEV+
Sbjct  26   ANFDPTRVEDDIGKMAEGGRTDAEVVGREEEAIKIDSLSVSQLKEIRDKAEKQVFQAEVA  85

Query  283  RLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkd  462
            R+M +IINSLY NK++FLRELISNASDALDKIR LSLT+ D L      +L I+I  DK+
Sbjct  86   RMMKLIINSLYRNKEVFLRELISNASDALDKIRLLSLTNPDALKA--LQELSIRIMADKE  143

Query  463  kkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM---QSSGDLN-LIGQFGVGFY  624
              +L I D GIGMTKEDLVKNLGTIAKSGT+ F++K+   + S DLN LIGQFGVGFY
Sbjct  144  NNVLHITDTGIGMTKEDLVKNLGTIAKSGTAEFLQKVNDGEGSKDLNDLIGQFGVGFY  201



>gb|AAH10445.1| Heat shock protein 90, beta (Grp94), member 1 [Mus musculus]
 gb|AAH11439.1| Heat shock protein 90, beta (Grp94), member 1 [Mus musculus]
Length=802

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_006934044.1| PREDICTED: endoplasmin [Felis catus]
Length=804

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_008703910.1| PREDICTED: endoplasmin [Ursus maritimus]
Length=804

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_006141474.1| PREDICTED: endoplasmin [Tupaia chinensis]
 gb|ELW71596.1| Endoplasmin [Tupaia chinensis]
Length=805

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_971540.1| PREDICTED: endoplasmin [Tribolium castaneum]
 gb|EFA10013.1| hypothetical protein TcasGA2_TC012185 [Tribolium castaneum]
 gb|AHF20221.1| heat shock protein 90 [Tribolium castaneum]
Length=782

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 122/172 (71%), Gaps = 14/172 (8%)
 Frame = +1

Query  145  KVEEKIGGVPHGLSTDPDVAKREAESM--------SKRTLRAGAEKFEFQAEVSRLMDII  300
            KV+  +G    G  TD +V KRE E++          + LR  AEKF FQ EV+R+M +I
Sbjct  31   KVDLDLGASREGSRTDDEVVKREEEAIKLDGLNVAQLKELRDKAEKFTFQTEVNRMMKLI  90

Query  301  INSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkkilsi  480
            INSLY NK+IFLRELISNASDALDKIR LSLTDK++L      +L I+IK DK+  +L I
Sbjct  91   INSLYRNKEIFLRELISNASDALDKIRLLSLTDKNVLDSN--PELNIRIKADKEAGMLHI  148

Query  481  rdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQ---SSGDLN-LIGQFGVGFY  624
             D GIGMTK+DLV NLGTIAKSGT+ F+ KMQ   ++ D+N +IGQFGVGFY
Sbjct  149  TDTGIGMTKQDLVNNLGTIAKSGTAEFLSKMQDASTAQDMNDMIGQFGVGFY  200



>dbj|BAE29874.1| unnamed protein product [Mus musculus]
Length=802

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEEIT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|NP_001003327.1| endoplasmin precursor [Canis lupus familiaris]
 sp|P41148.1|ENPL_CANFA RecName: Full=Endoplasmin; AltName: Full=94 kDa glucose-regulated 
protein; Short=GRP-94; AltName: Full=Heat shock protein 
90 kDa beta member 1; Flags: Precursor [Canis lupus familiaris]
 gb|AAA17708.1| GRP94 [Canis lupus familiaris]
Length=804

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_006888611.1| PREDICTED: endoplasmin [Elephantulus edwardii]
Length=801

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>emb|CAI64497.1| tumor rejection antigen (gp96) 1 [Homo sapiens]
Length=802

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>gb|EHH21126.1| hypothetical protein EGK_04124 [Macaca mulatta]
Length=804

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>gb|AAQ02595.1| tumor rejection antigen 1gp96, partial [synthetic construct]
Length=803

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|NP_003290.1| endoplasmin precursor [Homo sapiens]
 ref|XP_003832615.1| PREDICTED: endoplasmin [Pan paniscus]
 sp|P14625.1|ENPL_HUMAN RecName: Full=Endoplasmin; AltName: Full=94 kDa glucose-regulated 
protein; Short=GRP-94; AltName: Full=Heat shock protein 
90 kDa beta member 1; AltName: Full=Tumor rejection antigen 
1; AltName: Full=gp96 homolog; Flags: Precursor [Homo sapiens]
 emb|CAA33261.1| precursor polypeptide (AA-21 to 782) [Homo sapiens]
 gb|AAH66656.1| Heat shock protein 90kDa beta (Grp94), member 1 [Homo sapiens]
 gb|EAW97724.1| heat shock protein 90kDa beta (Grp94), member 1, isoform CRA_b 
[Homo sapiens]
 gb|ACJ13662.1| epididymis luminal protein 35 [Homo sapiens]
 gb|ACS44652.1| epididymis secretory sperm binding protein Li 125m [Homo sapiens]
Length=803

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_011385167.1| PREDICTED: endoplasmin [Pteropus vampyrus]
Length=804

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_006769416.1| PREDICTED: endoplasmin [Myotis davidii]
Length=804

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_003269991.2| PREDICTED: endoplasmin [Nomascus leucogenys]
Length=804

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_001365625.1| PREDICTED: endoplasmin [Monodelphis domestica]
Length=804

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 123/184 (67%), Gaps = 16/184 (9%)
 Frame = +1

Query  115  VDSDAPVD-PPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEF  267
            V +D PVD    VEE +G    G  TD +V +RE E++          + +R  +EKF F
Sbjct  20   VKADDPVDVEATVEEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIKEIREKSEKFAF  79

Query  268  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqi  447
            QAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   ++I+ 
Sbjct  80   QAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELTVKIKC  139

Query  448  kldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM---QSSGDLN--LIGQFG  612
              +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM   QS G     LIGQFG
Sbjct  140  DKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQSDGQSTSELIGQFG  197

Query  613  VGFY  624
            VGFY
Sbjct  198  VGFY  201



>ref|NP_001182453.1| heat shock protein 90kDa beta (Grp94), member 1 precursor [Macaca 
mulatta]
 ref|NP_001270655.1| endoplasmin precursor [Macaca fascicularis]
 ref|XP_010355583.1| PREDICTED: endoplasmin [Rhinopithecus roxellana]
 sp|Q4R520.1|ENPL_MACFA RecName: Full=Endoplasmin; AltName: Full=Heat shock protein 90 
kDa beta member 1; Flags: Precursor [Macaca fascicularis]
 dbj|BAE01805.1| unnamed protein product [Macaca fascicularis]
Length=804

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|NP_001233416.1| endoplasmin precursor [Pan troglodytes]
 dbj|BAK62934.1| endoplasmin precursor [Pan troglodytes]
Length=803

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_011218345.1| PREDICTED: endoplasmin isoform X2 [Ailuropoda melanoleuca]
Length=799

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_006084129.1| PREDICTED: endoplasmin [Myotis lucifugus]
Length=804

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_008142964.1| PREDICTED: endoplasmin [Eptesicus fuscus]
Length=804

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_003929672.1| PREDICTED: endoplasmin [Saimiri boliviensis boliviensis]
Length=804

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+AEVD D  V     E  +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADAEVDVDGTV-----EADLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|NP_035761.1| endoplasmin precursor [Mus musculus]
 sp|P08113.2|ENPL_MOUSE RecName: Full=Endoplasmin; AltName: Full=94 kDa glucose-regulated 
protein; Short=GRP-94; AltName: Full=Endoplasmic reticulum 
resident protein 99; Short=ERp99; AltName: Full=Heat shock 
protein 90 kDa beta member 1; AltName: Full=Polymorphic tumor 
rejection antigen 1; AltName: Full=Tumor rejection antigen 
gp96; Flags: Precursor [Mus musculus]
 gb|AAA37573.1| endoplasmic reticulum transmembrane protein precursor [Mus musculus]
 dbj|BAE38494.1| unnamed protein product [Mus musculus]
 dbj|BAE40874.1| unnamed protein product [Mus musculus]
 dbj|BAE27505.1| unnamed protein product [Mus musculus]
 dbj|BAE32087.1| unnamed protein product [Mus musculus]
 dbj|BAE30378.1| unnamed protein product [Mus musculus]
 dbj|BAE35526.1| unnamed protein product [Mus musculus]
 dbj|BAE40758.1| unnamed protein product [Mus musculus]
 gb|EDL21440.1| heat shock protein 90kDa beta (Grp94), member 1 [Mus musculus]
Length=802

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_008002644.1| PREDICTED: endoplasmin [Chlorocebus sabaeus]
Length=804

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_006740280.1| PREDICTED: endoplasmin isoform X1 [Leptonychotes weddellii]
Length=803

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_004879102.1| PREDICTED: endoplasmin [Heterocephalus glaber]
 ref|XP_004844894.1| PREDICTED: endoplasmin isoform X2 [Heterocephalus glaber]
Length=805

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_005865309.1| PREDICTED: endoplasmin [Myotis brandtii]
Length=804

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|NP_001157345.1| glucose-regulated protein precursor [Equus caballus]
 ref|XP_008535120.1| PREDICTED: endoplasmin [Equus przewalskii]
Length=804

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_002915502.1| PREDICTED: endoplasmin isoform X1 [Ailuropoda melanoleuca]
Length=803

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_008568503.1| PREDICTED: endoplasmin [Galeopterus variegatus]
Length=803

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_004053833.1| PREDICTED: endoplasmin [Gorilla gorilla gorilla]
Length=803

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>gb|EHA99498.1| Endoplasmin, partial [Heterocephalus glaber]
Length=792

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_003783342.1| PREDICTED: endoplasmin-like [Otolemur garnettii]
Length=804

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>gb|EHH66650.1| hypothetical protein EGM_03684 [Macaca fascicularis]
Length=804

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_004418096.1| PREDICTED: endoplasmin [Ceratotherium simum simum]
Length=805

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEEGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_004844893.1| PREDICTED: endoplasmin isoform X1 [Heterocephalus glaber]
Length=844

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_011494775.1| PREDICTED: endoplasmin [Ceratosolen solmsi marchali]
Length=786

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 121/171 (71%), Gaps = 14/171 (8%)
 Frame = +1

Query  148  VEEKIGGVPHGLSTDPDVAKREAESMS--------KRTLRAGAEKFEFQAEVSRLMDIII  303
            +++ +G     L TD  V +REAE+++         + LR  AEKF+FQ EV+R+M +II
Sbjct  31   IDDDLGASREALRTDEQVVQREAEAINIDGLNVSQVKELRDKAEKFQFQTEVNRMMKLII  90

Query  304  NSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkkilsir  483
            NSLY NK+IFLRELISNASDALDKIR LSLTDK+IL      +  I+IK D + KIL I 
Sbjct  91   NSLYRNKEIFLRELISNASDALDKIRLLSLTDKNILESN--PETCIRIKADVENKILRIS  148

Query  484  dRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDL----NLIGQFGVGFY  624
            D GIGMTK+DL+ NLGTIAKSGT+ F+ KMQ + +     ++IGQFGVGFY
Sbjct  149  DSGIGMTKKDLINNLGTIAKSGTAEFLGKMQDTSNTQEMNDMIGQFGVGFY  199



>ref|XP_006193753.1| PREDICTED: endoplasmin [Camelus ferus]
 ref|XP_010968744.1| PREDICTED: endoplasmin [Camelus bactrianus]
 ref|XP_010988330.1| PREDICTED: endoplasmin [Camelus dromedarius]
Length=804

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 124/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A  EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRAEDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_006205953.1| PREDICTED: endoplasmin [Vicugna pacos]
Length=804

 Score =   153 bits (387),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 124/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A  EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRAEDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_010629639.1| PREDICTED: endoplasmin [Fukomys damarensis]
 gb|KFO30279.1| Endoplasmin [Fukomys damarensis]
Length=806

 Score =   153 bits (387),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDLDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_001637407.1| predicted protein [Nematostella vectensis]
 gb|EDO45344.1| predicted protein [Nematostella vectensis]
Length=847

 Score =   153 bits (387),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 118/184 (64%), Gaps = 14/184 (8%)
 Frame = +1

Query  109  AEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESM--------SKRTLRAGAEKFE  264
            AE   + P   PKV++  G       TD +  +RE E++          + LR  AEK E
Sbjct  21   AEETKEEPESAPKVDDDAGKSRDASRTDDEAVQREEEAIKLDGLNVAQMKELRDKAEKHE  80

Query  265  FQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiq  444
            FQAEV+R+M +IINSLY NK+IFLRELISN+SDALDKIR +SLTDK     GD   ++I+
Sbjct  81   FQAEVNRMMKLIINSLYRNKEIFLRELISNSSDALDKIRLMSLTDKTAFDSGDELSIKIK  140

Query  445  ikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQ----SSGDLNLIGQFG  612
               + +   ++    GIGMTKE+L+KNLGTIAKSGTS F +K+Q    S    +LIGQFG
Sbjct  141  ADKENNILHVTDT--GIGMTKEELIKNLGTIAKSGTSEFFQKIQEAASSDSASDLIGQFG  198

Query  613  VGFY  624
            VGFY
Sbjct  199  VGFY  202



>gb|EPQ07146.1| Endoplasmin [Myotis brandtii]
Length=825

 Score =   153 bits (387),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>gb|ADR79285.1| Hsp90 beta [Brachionus ibericus]
Length=802

 Score =   153 bits (386),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 130/192 (68%), Gaps = 19/192 (10%)
 Frame = +1

Query  94   KIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESM--------SKRTLRAG  249
            ++HA  +++ D     PKV+E IG    G  TD +V +RE E +          + LR  
Sbjct  24   RVHAEDDIEVDES-SAPKVDEDIGKSREGSRTDDEVVQREEEQIKLDGLSVAEMKELRES  82

Query  250  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA  429
            + K EF AEV+R+M +IINSLY NK+IFLRELISNASDALDKIRF+SLTDKD+LGE  T 
Sbjct  83   S-KQEFVAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRFMSLTDKDVLGE--TE  139

Query  430  kleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSS-------GD  588
            +L I+IK DK+ ++L I D GIGMTK+D++K LGTIAKS TS F+ K Q +         
Sbjct  140  ELSIRIKSDKENRMLHITDTGIGMTKDDMIKYLGTIAKSQTSEFLTKFQEAQASDNKQSM  199

Query  589  LNLIGQFGVGFY  624
             +LIGQFGVGFY
Sbjct  200  SDLIGQFGVGFY  211



>emb|CAA62352.1| protein kinase [Sus scrofa]
Length=808

 Score =   153 bits (387),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 124/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A  EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRAEDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMAEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>sp|Q29092.3|ENPL_PIG RecName: Full=Endoplasmin; AltName: Full=94 kDa glucose-regulated 
protein; Short=GRP-94; AltName: Full=98 kDa protein kinase; 
Short=PPK 98; Short=ppk98; AltName: Full=Heat shock protein 
90 kDa beta member 1; AltName: Full=gp96 homolog; Flags: 
Precursor [Sus scrofa]
 emb|CAA53948.1| Ppk 98; a protein kinase [Sus scrofa]
Length=804

 Score =   153 bits (386),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 124/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A  EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRAEDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMAEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_004349108.2| glucose-regulated protein 94 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE91193.1| glucose-regulated protein 94 [Capsaspora owczarzaki ATCC 30864]
Length=816

 Score =   153 bits (387),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 120/174 (69%), Gaps = 13/174 (7%)
 Frame = +1

Query  136  DPPKVEEKIGGVPHGLSTDPDVAKREAESMS--------KRTLRAGAEKFEFQAEVSRLM  291
            D PKV   I G   G  TD  V +RE +++          + LR  ++KF FQ EV+R+M
Sbjct  40   DLPKVANDIAGDRVGSKTDDQVVEREEQAIHIDGLSVSEVKQLRERSDKFAFQTEVNRMM  99

Query  292  DIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkki  471
             +IINSLY NKDIFLRELISNASDALDKIRFLS++D  +LGE  T +L IQI  D   K+
Sbjct  100  KLIINSLYKNKDIFLRELISNASDALDKIRFLSVSDPKLLGE--TTQLRIQIFADAANKV  157

Query  472  lsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLN---LIGQFGVGFY  624
            L I D G+GMT++DL++NLGTIAKSGT+ F+ +MQ S   +   LIGQFGVGFY
Sbjct  158  LHITDTGVGMTRDDLIRNLGTIAKSGTAEFLHQMQESQTADASSLIGQFGVGFY  211



>ref|XP_007454336.1| PREDICTED: endoplasmin [Lipotes vexillifer]
Length=803

 Score =   153 bits (386),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     E+ +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VQADDEVDVDGTV-----EDDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_004623907.1| PREDICTED: endoplasmin [Octodon degus]
Length=806

 Score =   153 bits (386),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 124/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD+  L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDESALSGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_003405348.1| PREDICTED: endoplasmin [Loxodonta africana]
Length=801

 Score =   153 bits (386),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ +M       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNRMTEAQEEGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>gb|AAA48827.1| 108K heat shock protein [Gallus gallus]
Length=795

 Score =   153 bits (386),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 120/184 (65%), Gaps = 20/184 (11%)
 Frame = +1

Query  112  EVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEF  267
            EVD DA V     EE +G    G  TD +V +RE E++          + +R  +EKF F
Sbjct  23   EVDVDATV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIKEIREKSEKFAF  77

Query  268  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqi  447
            QAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   ++I+ 
Sbjct  78   QAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKC  137

Query  448  kldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGD-----LNLIGQFG  612
              +K+   ++    GIGMTKE+L+KNLGTIAKSGTS F+ KM    D       LIGQFG
Sbjct  138  DKEKNMLHVTDT--GIGMTKEELIKNLGTIAKSGTSEFLNKMTEMQDDSQSTSELIGQFG  195

Query  613  VGFY  624
            VGFY
Sbjct  196  VGFY  199



>ref|XP_004602837.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmin [Sorex araneus]
Length=759

 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 122/189 (65%), Gaps = 20/189 (11%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ E+D D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDELDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-----QSSGDLNL  597
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM      S     L
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDSQSTSEL  191

Query  598  IGQFGVGFY  624
            IGQFGVGFY
Sbjct  192  IGQFGVGFY  200



>ref|XP_004589651.1| PREDICTED: endoplasmin [Ochotona princeps]
Length=803

 Score =   153 bits (386),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 124/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD+  L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDEQALSGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|XP_009861771.1| PREDICTED: endoplasmin-like [Ciona intestinalis]
Length=826

 Score =   153 bits (386),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 120/187 (64%), Gaps = 14/187 (7%)
 Frame = +1

Query  100  HANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMS--------KRTLRAGAE  255
            H  ++ +     D PKVE  IG    G  TD +V +RE ES+          + LR  +E
Sbjct  21   HVKSDDEGTTSDDTPKVEPDIGKAADGSKTDDEVVQREEESIHLDGLSPSEVKQLREQSE  80

Query  256  KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkl  435
            K  FQAEV+R+M +IINSLY NK+IFLRELISN+SDALDKIR LSLTD   L   D   +
Sbjct  81   KHVFQAEVNRMMKLIINSLYRNKEIFLRELISNSSDALDKIRLLSLTDDAALAATDELSI  140

Query  436  eiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQ--SSGD--LNLIG  603
            ++++  + +   ++    GIGMTK DL+KNLGTIAKSGTS F E+M   SS D   +LIG
Sbjct  141  KVKVDKENNVLHVTDT--GIGMTKADLIKNLGTIAKSGTSDFFEQMSKASSEDSVSDLIG  198

Query  604  QFGVGFY  624
            QFGVGFY
Sbjct  199  QFGVGFY  205



>ref|NP_001039228.1| heat shock protein 90kDa beta (Grp94), member 1 precursor [Xenopus 
(Silurana) tropicalis]
 emb|CAJ82870.1| tumor rejection antigen (gp96) 1 [Xenopus (Silurana) tropicalis]
 gb|AAI21251.1| heat shock protein 90kDa beta (Grp94), member 1 [Xenopus (Silurana) 
tropicalis]
Length=803

 Score =   153 bits (386),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 124/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A  EV+ DA V     E+ IG    G  TD +V  RE E++          + LR  +
Sbjct  19   VQAEDEVEVDATV-----EDDIGKSRDGSRTDDEVVSREEEAIQIDGLNAAQIKELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAANEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    GIGMTKEDLVKNLGTIAKSGTS F+ K+       QS+ + 
Sbjct  134  IKIKCDKEKNMLHITDT--GIGMTKEDLVKNLGTIAKSGTSEFLSKLTDAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>emb|CAA28629.1| hsp 108 [Gallus gallus]
Length=792

 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 120/184 (65%), Gaps = 20/184 (11%)
 Frame = +1

Query  112  EVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEF  267
            EVD DA V     EE +G    G  TD +V +RE E++          + +R  +EKF F
Sbjct  23   EVDVDATV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIKEIREKSEKFAF  77

Query  268  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqi  447
            QAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   ++I+ 
Sbjct  78   QAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKC  137

Query  448  kldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-----QSSGDLNLIGQFG  612
              +K+   ++    GIGMTKE+L+KNLGTIAKSGTS F+ KM      S     LIGQFG
Sbjct  138  DKEKNMLHVTDT--GIGMTKEELIKNLGTIAKSGTSEFLNKMTEMQDDSQSTSELIGQFG  195

Query  613  VGFY  624
            VGFY
Sbjct  196  VGFY  199



>ref|XP_005680600.1| PREDICTED: endoplasmin [Capra hircus]
Length=800

 Score =   153 bits (386),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 124/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  15   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  69

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD+  L   +   
Sbjct  70   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDETALAGNEELT  129

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  130  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  186

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  187  -LIGQFGVGFY  196



>ref|XP_006619420.1| PREDICTED: endoplasmin-like [Apis dorsata]
Length=798

 Score =   153 bits (386),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 104/178 (58%), Positives = 126/178 (71%), Gaps = 21/178 (12%)
 Frame = +1

Query  148  VEEKIGGVPHGLS-------TDPDVAKREAESMSK--------RTLRAGAEKFEFQAEVS  282
            +EE IG V + LS       TD +V +RE E++          + LR  AEKF FQ EV+
Sbjct  24   MEEDIGTVENDLSASREGSRTDNEVIQREEEAIKLDGLNVAQIKELREKAEKFTFQTEVN  83

Query  283  RLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkd  462
            R+M +IINSLY NKDIFLRELISNASDALDKIR LSLTDK++L     ++L I+IK DK+
Sbjct  84   RIMKLIINSLYRNKDIFLRELISNASDALDKIRLLSLTDKNVLDTN--SELAIRIKSDKE  141

Query  463  kkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSG---DLN-LIGQFGVGFY  624
             KILSI D GIGMTK +L+ NLGTIAKSGT+ F+ KMQ +    DLN +IGQFGVGFY
Sbjct  142  NKILSITDSGIGMTKHELINNLGTIAKSGTAEFLGKMQETSNTQDLNDMIGQFGVGFY  199



>ref|XP_003401925.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmin-like [Bombus terrestris]
Length=798

 Score =   153 bits (386),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 121/171 (71%), Gaps = 14/171 (8%)
 Frame = +1

Query  148  VEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEFQAEVSRLMDIII  303
            VE  +G    G  TD +V +RE E++          + LR  AEKF FQ EV+R+M +II
Sbjct  31   VENDLGASREGSRTDNEVVQREEEAIKLDGLNVAQIKELREKAEKFTFQTEVNRMMKLII  90

Query  304  NSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkkilsir  483
            NSLY NKDIFLRELISNASDALDKIR LSLTDK++L      +L I+IK DK+ KILSI 
Sbjct  91   NSLYRNKDIFLRELISNASDALDKIRLLSLTDKNVLDTN--PELAIRIKTDKENKILSIT  148

Query  484  dRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSG---DLN-LIGQFGVGFY  624
            D GIGMTK +L+ NLGTIAKSGT+ F+ KMQ +    DLN +IGQFGVGFY
Sbjct  149  DSGIGMTKNELINNLGTIAKSGTAEFLGKMQDTSNAQDLNDMIGQFGVGFY  199



>ref|XP_005374635.1| PREDICTED: endoplasmin [Chinchilla lanigera]
Length=806

 Score =   153 bits (386),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 124/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD+  L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDESALSGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>dbj|BAI23208.1| heat shock protein 90kDa beta (Grp94), member 1 [Coturnix japonica]
Length=794

 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 120/184 (65%), Gaps = 20/184 (11%)
 Frame = +1

Query  112  EVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEF  267
            EVD DA V     EE +G    G  TD +V +RE E++          + +R  +EKF F
Sbjct  23   EVDVDATV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIKEIREKSEKFAF  77

Query  268  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqi  447
            QAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   ++I+ 
Sbjct  78   QAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKC  137

Query  448  kldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-----QSSGDLNLIGQFG  612
              +K+   ++    GIGMTKE+L+KNLGTIAKSGTS F+ KM      S     LIGQFG
Sbjct  138  DKEKNMLHVTDT--GIGMTKEELIKNLGTIAKSGTSEFLNKMTEMQNDSQSTSELIGQFG  195

Query  613  VGFY  624
            VGFY
Sbjct  196  VGFY  199



>ref|NP_989620.1| endoplasmin precursor [Gallus gallus]
 sp|P08110.1|ENPL_CHICK RecName: Full=Endoplasmin; AltName: Full=Heat shock 108 kDa protein; 
Short=HSP 108; Short=HSP108; AltName: Full=Heat shock 
protein 90 kDa beta member 1; AltName: Full=Transferrin-binding 
protein; Flags: Precursor [Gallus gallus]
 gb|AAA48826.1| heat shock protein 108 [Gallus gallus]
Length=795

 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 120/184 (65%), Gaps = 20/184 (11%)
 Frame = +1

Query  112  EVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEF  267
            EVD DA V     EE +G    G  TD +V +RE E++          + +R  +EKF F
Sbjct  23   EVDVDATV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIKEIREKSEKFAF  77

Query  268  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqi  447
            QAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   ++I+ 
Sbjct  78   QAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKC  137

Query  448  kldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-----QSSGDLNLIGQFG  612
              +K+   ++    GIGMTKE+L+KNLGTIAKSGTS F+ KM      S     LIGQFG
Sbjct  138  DKEKNMLHVTDT--GIGMTKEELIKNLGTIAKSGTSEFLNKMTEMQDDSQSTSELIGQFG  195

Query  613  VGFY  624
            VGFY
Sbjct  196  VGFY  199



>gb|ACF35012.1| heat shock protein 108 [Gallus gallus]
Length=790

 Score =   152 bits (385),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 120/184 (65%), Gaps = 20/184 (11%)
 Frame = +1

Query  112  EVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEF  267
            EVD DA V     EE +G    G  TD +V +RE E++          + +R  +EKF F
Sbjct  23   EVDVDATV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIKEIREKSEKFAF  77

Query  268  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqi  447
            QAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   ++I+ 
Sbjct  78   QAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKC  137

Query  448  kldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGD-----LNLIGQFG  612
              +K+   ++    GIGMTKE+L+KNLGTIAKSGTS F+ KM    D       LIGQFG
Sbjct  138  DKEKNMLHVTDT--GIGMTKEELIKNLGTIAKSGTSEFLNKMTEMQDDSQSTSELIGQFG  195

Query  613  VGFY  624
            VGFY
Sbjct  196  VGFY  199



>gb|KDD75133.1| heat shock protein 90 Hsp90 [Helicosporidium sp. ATCC 50920]
Length=774

 Score =   152 bits (385),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 98/119 (82%), Gaps = 2/119 (2%)
 Frame = +1

Query  268  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqi  447
            +AEV+R+MDI+INSLYSNKDIFLRELISNA+DALDKIRFLSLT+ D L      K++I  
Sbjct  30   RAEVNRMMDILINSLYSNKDIFLRELISNAADALDKIRFLSLTETDALAAKQDMKIQIWA  89

Query  448  kldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGVGFY  624
            + +K++  +     G+GMT+EDLV NLGTIAKSGTSAFVE+MQ  GDLNLIGQFGVGFY
Sbjct  90   EPEKNRLCIRDT--GVGMTREDLVNNLGTIAKSGTSAFVEQMQKGGDLNLIGQFGVGFY  146



>gb|KFP71026.1| Endoplasmin, partial [Acanthisitta chloris]
Length=660

 Score =   151 bits (382),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 120/184 (65%), Gaps = 20/184 (11%)
 Frame = +1

Query  112  EVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEF  267
            EVD DA V     E+ +G    G  TD +V +RE E++          + +R  +EKF F
Sbjct  10   EVDVDATV-----EDDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIKEIREKSEKFAF  64

Query  268  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqi  447
            QAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   ++I+ 
Sbjct  65   QAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKC  124

Query  448  kldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-----QSSGDLNLIGQFG  612
              +K+   ++    GIGMTKE+LVKNLGTIAKSGTS F+ KM      S     LIGQFG
Sbjct  125  DKEKNMLHVTDT--GIGMTKEELVKNLGTIAKSGTSEFLNKMTEMQDDSQSTSELIGQFG  182

Query  613  VGFY  624
            VGFY
Sbjct  183  VGFY  186



>ref|NP_999268.1| endoplasmin precursor [Sus scrofa]
 emb|CAA70347.1| gp96/GRP94 [Sus scrofa]
Length=804

 Score =   152 bits (385),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 124/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A  EVD D  V     EE +G    G  TD ++ +RE E++          R LR  +
Sbjct  19   VRAEDEVDVDGTV-----EEDLGKSREGSRTDDEIVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>ref|NP_001083114.1| uncharacterized protein LOC398753 precursor [Xenopus laevis]
 gb|AAH60352.1| MGC68448 protein [Xenopus laevis]
Length=805

 Score =   152 bits (385),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 122/189 (65%), Gaps = 20/189 (11%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A  EV+ DA V     E+ IG    G  TD +V  RE E++          + +R  +
Sbjct  19   VQAEDEVEVDATV-----EDDIGKSREGSRTDDEVVSREEEAIQLDGLNAAQIKEIREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLMSLTDENALAANEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGD-----LNL  597
            ++I+   +K+   ++    GIGMTKE+LVKNLGTIAKSGTS F+ K+  + D       L
Sbjct  134  IKIKCDKEKNMLQITDT--GIGMTKEELVKNLGTIAKSGTSEFLSKLTEAQDDGQSTSEL  191

Query  598  IGQFGVGFY  624
            IGQFGVGFY
Sbjct  192  IGQFGVGFY  200



>ref|XP_006782653.1| PREDICTED: endoplasmin-like [Neolamprologus brichardi]
Length=797

 Score =   152 bits (385),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 124/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + AN E+D D  V     EE +G    G  TD +V +RE E++          + LR  +
Sbjct  19   VKANDELDVDGTV-----EEDLGKSRDGSRTDDEVVQREEEAIQLDGLNAAQIKELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EK  FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR LSLT++D +   +   
Sbjct  74   EKHAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLLSLTNEDAMATNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    GIGMTKE+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  IKIKSDKEKNMLHITDT--GIGMTKEELVKNLGTIAKSGTSEFLNKMTEMQEEDQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



>gb|AEE63339.1| unknown [Dendroctonus ponderosae]
Length=781

 Score =   152 bits (384),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 124/181 (69%), Gaps = 15/181 (8%)
 Frame = +1

Query  118  DSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESM--------SKRTLRAGAEKFEFQA  273
            D DA  + P VE  +G    G  TD +V +RE E++          + +R  AEKF FQ 
Sbjct  21   DLDA-TETPSVEADLGAGKEGSRTDDEVVQREEEAIKLDGLNVAQLKEIRDRAEKFTFQT  79

Query  274  EVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikl  453
            EV+R+M +IINSLY NK+IFLRELISNASDA+DKIR LSLTDK +L      +L I+IK 
Sbjct  80   EVNRMMKLIINSLYRNKEIFLRELISNASDAIDKIRLLSLTDKSVLDA--VPELSIRIKA  137

Query  454  dkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQ---SSGDLN-LIGQFGVGF  621
            DK+  +L I D GIGMTK DLV NLGTIAKSGT+ F+ KMQ   SS DLN +IGQFGVGF
Sbjct  138  DKETGMLHITDTGIGMTKADLVNNLGTIAKSGTAEFLGKMQSAESSQDLNDMIGQFGVGF  197

Query  622  Y  624
            Y
Sbjct  198  Y  198



>gb|ERL91651.1| hypothetical protein D910_08979 [Dendroctonus ponderosae]
Length=781

 Score =   152 bits (384),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 124/181 (69%), Gaps = 15/181 (8%)
 Frame = +1

Query  118  DSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESM--------SKRTLRAGAEKFEFQA  273
            D DA  + P VE  +G    G  TD +V +RE E++          + +R  AEKF FQ 
Sbjct  21   DLDA-TETPSVEADLGAGKEGSRTDDEVVQREEEAIKLDGLNVAQLKEIRDRAEKFTFQT  79

Query  274  EVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikl  453
            EV+R+M +IINSLY NK+IFLRELISNASDA+DKIR LSLTDK +L      +L I+IK 
Sbjct  80   EVNRMMKLIINSLYRNKEIFLRELISNASDAIDKIRLLSLTDKSVLDA--VPELSIRIKA  137

Query  454  dkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQ---SSGDLN-LIGQFGVGF  621
            DK+  +L I D GIGMTK DLV NLGTIAKSGT+ F+ KMQ   SS DLN +IGQFGVGF
Sbjct  138  DKETGMLHITDTGIGMTKADLVNNLGTIAKSGTAEFLGKMQSAESSQDLNDMIGQFGVGF  197

Query  622  Y  624
            Y
Sbjct  198  Y  198



>ref|XP_007950582.1| PREDICTED: endoplasmin [Orycteropus afer afer]
Length=804

 Score =   152 bits (385),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 125/191 (65%), Gaps = 24/191 (13%)
 Frame = +1

Query  97   IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  252
            + A+ EVD +  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VQADDEVDVEGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  253  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  432
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  433  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  591
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  592  NLIGQFGVGFY  624
             LIGQFGVGFY
Sbjct  191  -LIGQFGVGFY  200



Lambda      K        H        a         alpha
   0.313    0.133    0.365    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897347644380