BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS072D06

Length=598
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDP29212.1|  hypothetical protein JCGZ_16601                         340   1e-113   Jatropha curcas
ref|XP_011018830.1|  PREDICTED: caffeic acid 3-O-methyltransferase      339   5e-113   Populus euphratica
ref|XP_002264566.1|  PREDICTED: caffeic acid 3-O-methyltransferase      338   5e-113   Vitis vinifera
ref|XP_006381361.1|  hypothetical protein POPTR_0006s12160g             338   1e-112   
ref|XP_010267318.1|  PREDICTED: caffeic acid 3-O-methyltransferase      337   1e-112   Nelumbo nucifera [Indian lotus]
emb|CAN65776.1|  hypothetical protein VITISV_030414                     335   9e-112   Vitis vinifera
ref|XP_002519426.1|  o-methyltransferase, putative                      335   1e-111   Ricinus communis
ref|XP_009341082.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    333   7e-111   Pyrus x bretschneideri [bai li]
ref|XP_008387516.1|  PREDICTED: caffeic acid 3-O-methyltransferase      329   3e-110   
ref|XP_008241354.1|  PREDICTED: caffeic acid 3-O-methyltransferase      330   2e-109   Prunus mume [ume]
ref|XP_009341081.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    328   9e-109   Pyrus x bretschneideri [bai li]
gb|KHN47498.1|  Caffeic acid 3-O-methyltransferase                      327   1e-108   Glycine soja [wild soybean]
ref|XP_006598126.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    327   1e-108   Glycine max [soybeans]
ref|XP_010546519.1|  PREDICTED: flavone 3'-O-methyltransferase 1        327   3e-108   Tarenaya hassleriana [spider flower]
ref|XP_007202084.1|  hypothetical protein PRUPE_ppa007420mg             326   5e-108   Prunus persica
gb|KJB62320.1|  hypothetical protein B456_009G411600                    326   5e-108   Gossypium raimondii
ref|XP_010098845.1|  Caffeic acid 3-O-methyltransferase                 325   9e-108   Morus notabilis
ref|XP_006291371.1|  hypothetical protein CARUB_v10017511mg             325   1e-107   Capsella rubella
ref|XP_004304330.1|  PREDICTED: caffeic acid 3-O-methyltransferase      325   2e-107   Fragaria vesca subsp. vesca
gb|KCW89310.1|  hypothetical protein EUGRSUZ_A01600                     322   2e-107   Eucalyptus grandis [rose gum]
ref|XP_010050337.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    324   4e-107   Eucalyptus grandis [rose gum]
ref|XP_010504072.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    324   4e-107   Camelina sativa [gold-of-pleasure]
ref|XP_010515802.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    323   7e-107   Camelina sativa [gold-of-pleasure]
ref|NP_190882.1|  putative O-diphenol-O-methyl transferase              323   8e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007027514.1|  O-methyltransferase family protein                 322   1e-106   
ref|XP_006594704.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    322   1e-106   
ref|XP_010426946.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    322   1e-106   Camelina sativa [gold-of-pleasure]
ref|XP_011101458.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    322   2e-106   Sesamum indicum [beniseed]
gb|KHG05883.1|  Caffeic acid 3-O-methyltransferase                      321   4e-106   Gossypium arboreum [tree cotton]
emb|CDX95399.1|  BnaC04g27590D                                          319   3e-105   
ref|XP_009139429.1|  PREDICTED: caffeic acid 3-O-methyltransferase      319   3e-105   Brassica rapa
ref|XP_008442758.1|  PREDICTED: caffeic acid 3-O-methyltransferase      319   3e-105   Cucumis melo [Oriental melon]
gb|KGN59032.1|  hypothetical protein Csa_3G747630                       318   5e-105   
ref|XP_006403721.1|  hypothetical protein EUTSA_v10010488mg             318   8e-105   Eutrema salsugineum [saltwater cress]
gb|KEH38506.1|  caffeic acid O-methyltransferase                        317   2e-104   Medicago truncatula
ref|XP_010312333.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1    316   3e-104   Solanum lycopersicum
ref|XP_004488687.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    315   6e-104   Cicer arietinum [garbanzo]
ref|XP_006391885.1|  hypothetical protein EUTSA_v10023542mg             315   8e-104   Eutrema salsugineum [saltwater cress]
ref|XP_009617330.1|  PREDICTED: flavone 3'-O-methyltransferase 1        315   1e-103   Nicotiana tomentosiformis
gb|KDO39806.1|  hypothetical protein CISIN_1g025363mg                   310   2e-103   Citrus sinensis [apfelsine]
ref|XP_006367254.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    314   2e-103   Solanum tuberosum [potatoes]
ref|XP_006485837.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    313   4e-103   Citrus sinensis [apfelsine]
gb|KFK34550.1|  hypothetical protein AALP_AA5G160800                    313   4e-103   Arabis alpina [alpine rockcress]
ref|XP_006436414.1|  hypothetical protein CICLE_v10033543mg             311   7e-103   Citrus clementina [clementine]
ref|XP_007149437.1|  hypothetical protein PHAVU_005G070300g             312   1e-102   Phaseolus vulgaris [French bean]
ref|XP_004137858.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    314   1e-102   
gb|KCW89309.1|  hypothetical protein EUGRSUZ_A01600                     308   2e-101   Eucalyptus grandis [rose gum]
ref|XP_006451708.1|  hypothetical protein CICLE_v10010561mg             306   3e-101   
ref|XP_006423903.1|  hypothetical protein CICLE_v10029876mg             303   6e-100   
gb|KDO41959.1|  hypothetical protein CISIN_1g021707mg                   303   8e-100   Citrus sinensis [apfelsine]
emb|CDY70033.1|  BnaCnng66420D                                          295   1e-97    Brassica napus [oilseed rape]
gb|KJB62323.1|  hypothetical protein B456_009G411600                    291   1e-94    Gossypium raimondii
ref|XP_011098295.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    289   1e-93    Sesamum indicum [beniseed]
ref|XP_010683979.1|  PREDICTED: caffeic acid 3-O-methyltransferase      286   4e-92    Beta vulgaris subsp. vulgaris [field beet]
gb|KDO38249.1|  hypothetical protein CISIN_1g043063mg                   282   1e-91    Citrus sinensis [apfelsine]
ref|XP_006367255.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    280   4e-90    Solanum tuberosum [potatoes]
gb|KDO39208.1|  hypothetical protein CISIN_1g041308mg                   275   2e-89    Citrus sinensis [apfelsine]
ref|XP_006451875.1|  hypothetical protein CICLE_v10010158mg             272   6e-89    Citrus clementina [clementine]
ref|XP_009382782.1|  PREDICTED: caffeic acid 3-O-methyltransferase      277   7e-89    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006425490.1|  hypothetical protein CICLE_v10027189mg             274   2e-88    
gb|AAP03058.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    276   4e-88    Limonium latifolium
ref|XP_011101457.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    275   5e-88    
ref|XP_006485822.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    271   1e-87    
ref|NP_001048569.1|  Os02g0823400                                       273   3e-87    
ref|XP_004954455.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    270   2e-86    Setaria italica
gb|ACN25427.1|  unknown                                                 270   6e-86    Zea mays [maize]
ref|XP_002453074.1|  hypothetical protein SORBIDRAFT_04g037820          270   7e-86    Sorghum bicolor [broomcorn]
ref|XP_010935841.1|  PREDICTED: quercetin 3-O-methyltransferase 1...    270   2e-85    Elaeis guineensis
ref|NP_001149617.1|  LOC100283243                                       268   5e-85    
dbj|BAJ96291.1|  predicted protein                                      265   5e-84    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006432602.1|  hypothetical protein CICLE_v10002505mg             259   7e-84    
ref|XP_006381360.1|  hypothetical protein POPTR_0006s12160g             260   1e-83    
ref|XP_003572969.1|  PREDICTED: caffeic acid 3-O-methyltransferase      261   2e-82    Brachypodium distachyon [annual false brome]
gb|AAP03055.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    255   4e-82    Limonium latifolium
ref|XP_006649184.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    254   2e-80    
ref|XP_008361606.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    253   2e-80    
ref|XP_006428524.1|  hypothetical protein CICLE_v10013655mg             248   1e-78    
ref|XP_008361604.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    247   3e-78    
ref|XP_004502926.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    249   5e-78    Cicer arietinum [garbanzo]
gb|KJB62324.1|  hypothetical protein B456_009G411600                    244   2e-77    Gossypium raimondii
ref|XP_006594705.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    240   3e-75    Glycine max [soybeans]
emb|CAB65279.1|  O-diphenol-O-methyl transferase                        240   1e-74    Medicago sativa subsp. x varia
gb|KDO38695.1|  hypothetical protein CISIN_1g037818mg                   234   2e-74    Citrus sinensis [apfelsine]
ref|XP_003602597.1|  Caffeic acid 3-O-methyltransferase                 237   2e-73    
ref|XP_003602595.1|  Caffeic acid 3-O-methyltransferase                 236   5e-73    Medicago truncatula
emb|CDX76223.1|  BnaA04g04870D                                          233   1e-72    
gb|KDO54338.1|  hypothetical protein CISIN_1g032721mg                   223   8e-71    Citrus sinensis [apfelsine]
gb|EEC74273.1|  hypothetical protein OsI_09508                          230   1e-70    Oryza sativa Indica Group [Indian rice]
gb|AES72848.2|  caffeic acid O-methyltransferase                        224   2e-68    Medicago truncatula
gb|AAP03056.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    213   5e-66    Limonium latifolium
ref|XP_006838729.1|  hypothetical protein AMTR_s00002p00253410          212   8e-64    Amborella trichopoda
gb|KJB62322.1|  hypothetical protein B456_009G411600                    209   2e-63    Gossypium raimondii
gb|KJB62321.1|  hypothetical protein B456_009G411600                    206   8e-63    Gossypium raimondii
ref|XP_009774776.1|  PREDICTED: caffeic acid 3-O-methyltransferase      202   3e-61    Nicotiana sylvestris
ref|XP_010935842.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    197   3e-58    
gb|AAP03051.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    175   1e-51    Limonium latifolium
ref|XP_002963872.1|  caffeic acid O-methyltransferase                   179   5e-51    Selaginella moellendorffii
ref|XP_002988275.1|  caffeic acid O-methyltransferase                   179   5e-51    Selaginella moellendorffii
gb|AAP03057.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    174   8e-51    Limonium latifolium
emb|CBI30187.3|  unnamed protein product                                172   1e-50    Vitis vinifera
ref|XP_010671332.1|  PREDICTED: caffeic acid 3-O-methyltransferase      178   1e-50    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010027213.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    170   4e-50    Eucalyptus grandis [rose gum]
ref|XP_010918594.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    176   7e-50    Elaeis guineensis
gb|AGO50639.1|  caffeic acid O-methyltransferase                        176   1e-49    Linum usitatissimum
gb|KJB23958.1|  hypothetical protein B456_004G125600                    174   2e-49    Gossypium raimondii
gb|AGS49204.1|  O-methyltransferase                                     175   4e-49    Zea mays [maize]
gb|ABI54117.1|  caffeic acid O-methyltransferase                        174   5e-49    Malus domestica [apple tree]
ref|XP_008380838.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    174   5e-49    Malus domestica [apple tree]
gb|KJB23954.1|  hypothetical protein B456_004G125600                    174   5e-49    Gossypium raimondii
gb|AGS49209.1|  O-methyltransferase                                     174   6e-49    Zea mays [maize]
gb|ABI54118.1|  caffeic acid O-methyltransferase                        174   6e-49    Malus domestica [apple tree]
gb|KDP30064.1|  hypothetical protein JCGZ_18389                         174   6e-49    Jatropha curcas
ref|XP_003602596.1|  Caffeic acid 3-O-methyltransferase                 171   6e-49    
gb|AFK48989.1|  unknown                                                 174   7e-49    Medicago truncatula
gb|ACJ84475.1|  unknown                                                 174   7e-49    Medicago truncatula
gb|ACT87981.1|  caffeic acid O-methyltransferase                        174   8e-49    Jatropha curcas
ref|XP_008362842.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    171   9e-49    
gb|KHG13289.1|  Caffeic acid 3-O-methyltransferase                      173   1e-48    Gossypium arboreum [tree cotton]
gb|AGJ84131.1|  putative caffeic acid O-methyltransferase               173   1e-48    Hibiscus cannabinus [bimli-jute]
gb|ACN41351.2|  putative caffeic acid O-methyltransferase               173   2e-48    Betula pendula [white birch]
gb|AHM25237.1|  noraucuparin O-methyltransferase                        173   2e-48    Sorbus aucuparia [European mountain ash]
gb|KHG13754.1|  Caffeic acid 3-O-methyltransferase                      174   2e-48    Gossypium arboreum [tree cotton]
gb|AGG91492.1|  caffeic acid 3-O-methyltransferase                      173   2e-48    Betula platyphylla [Asian white birch]
ref|XP_003621331.1|  Isoliquiritigenin 2'-O-methyltransferase           173   2e-48    Medicago truncatula
gb|AGS49206.1|  O-methyltransferase                                     173   2e-48    Zea mays [maize]
gb|AAQ24345.1|  O-methyltransferase                                     172   2e-48    Zea mays [maize]
gb|AGS49202.1|  O-methyltransferase                                     172   2e-48    Zea mays [maize]
gb|AAQ24337.1|  O-methyltransferase                                     172   2e-48    Zea mays [maize]
ref|XP_008381500.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    174   2e-48    
gb|ACT32029.1|  caffeic acid O-methyltransferase 2                      172   2e-48    Gossypium hirsutum [American cotton]
ref|XP_002864307.1|  O-methyltransferase 1                              172   2e-48    Arabidopsis lyrata subsp. lyrata
ref|XP_008803442.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    171   3e-48    
gb|AAQ24338.1|  O-methyltransferase                                     172   3e-48    Zea mays [maize]
ref|XP_010241050.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1    172   3e-48    Nelumbo nucifera [Indian lotus]
gb|ABI54119.1|  caffeic acid O-methyltransferase                        172   3e-48    Malus domestica [apple tree]
gb|AGS49214.1|  O-methyltransferase                                     172   3e-48    Zea mays [maize]
gb|AGS49210.1|  O-methyltransferase                                     172   4e-48    Zea mays [maize]
gb|AGS49190.1|  O-methyltransferase                                     172   4e-48    Zea mays [maize]
gb|AIJ28474.1|  O-methyltransferase                                     172   4e-48    Vaccinium corymbosum [American blueberry]
ref|XP_002864309.1|  O-methyltransferase 1                              172   4e-48    
dbj|BAC78827.1|  caffeic acid O-methyltransferase                       172   4e-48    Rosa chinensis var. spontanea
gb|AFM73597.1|  caffeate O-methyltransferase                            170   4e-48    Populus simonii
gb|KFK27028.1|  hypothetical protein AALP_AA8G324800                    172   5e-48    Arabis alpina [alpine rockcress]
gb|AAQ24339.1|  O-methyltransferase                                     172   5e-48    Zea mays [maize]
sp|Q8GU25.1|COMT1_ROSCH  RecName: Full=Caffeic acid 3-O-methyltra...    172   5e-48    Rosa chinensis [China rose]
ref|XP_003634161.1|  PREDICTED: caffeic acid 3-O-methyltransferase      172   5e-48    Vitis vinifera
ref|XP_008803441.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    171   5e-48    Phoenix dactylifera
gb|AAQ24355.1|  O-methyltransferase                                     171   5e-48    Zea mays [maize]
gb|AAA80579.1|  3' flavonoid O-methyltransferase                        171   6e-48    Chrysosplenium americanum [water-carpet]
dbj|BAM05581.1|  caffeic acid O-methyltransferase 1                     170   6e-48    Eucalyptus pilularis
ref|XP_010482824.1|  PREDICTED: flavone 3'-O-methyltransferase 1        171   7e-48    Camelina sativa [gold-of-pleasure]
ref|XP_009418616.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    171   7e-48    Musa acuminata subsp. malaccensis [pisang utan]
gb|AGS49196.1|  O-methyltransferase                                     171   8e-48    Zea mays [maize]
dbj|BAM05582.1|  caffeic acid O-methyltransferase 2                     169   9e-48    Eucalyptus pilularis
gb|AGW45465.1|  beta-alanine n-methyltransferase                        166   9e-48    Reaumuria trigyna
gb|AEO14871.1|  caffeic acid O-methyltransferase                        171   9e-48    Salvia miltiorrhiza [Chinese salvia]
gb|ADE88153.1|  caffeyl alcohol/5-hydroxyconiferyl alcohol 3/5-O-...    171   9e-48    Selaginella moellendorffii
gb|KJB52492.1|  hypothetical protein B456_008G264900                    171   1e-47    Gossypium raimondii
ref|XP_010442991.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    171   1e-47    Camelina sativa [gold-of-pleasure]
ref|NP_200227.1|  caffeic acid/5-hydroxyferulic acid O-methyltran...    171   1e-47    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010446534.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    171   1e-47    Camelina sativa [gold-of-pleasure]
dbj|BAM05583.1|  caffeic acid O-methyltransferase 2                     169   1e-47    Eucalyptus pyrocarpa
gb|KHN17090.1|  Isoliquiritigenin 2'-O-methyltransferase                170   1e-47    Glycine soja [wild soybean]
gb|AGS49219.1|  O-methyltransferase                                     171   1e-47    Zea mays [maize]
ref|XP_006280681.1|  hypothetical protein CARUB_v10026645mg             171   1e-47    Capsella rubella
gb|AAQ67347.1|  caffeic acid 3-O-methyltransferase                      171   1e-47    Saccharum hybrid cultivar [sugarcane]
gb|AEO14870.1|  caffeic acid O-methyltransferase                        170   2e-47    Salvia miltiorrhiza [Chinese salvia]
gb|ADN27527.1|  caffeic acid O-methyltransferase                        170   2e-47    Camellia sinensis [black tea]
ref|XP_007136428.1|  hypothetical protein PHAVU_009G044400g             170   2e-47    Phaseolus vulgaris [French bean]
gb|ABI54120.1|  caffeic acid O-methyltransferase                        170   2e-47    Malus domestica [apple tree]
ref|XP_003536383.1|  PREDICTED: isoliquiritigenin 2'-O-methyltran...    170   2e-47    Glycine max [soybeans]
gb|ABG27066.1|  caffeic acid O-methyltransferase                        170   2e-47    Boehmeria nivea [Chinese silk-plant]
ref|XP_010934981.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    167   2e-47    
ref|XP_007218166.1|  hypothetical protein PRUPE_ppa007511mg             170   2e-47    
sp|O82054.1|COMT1_SACOF  RecName: Full=Caffeic acid 3-O-methyltra...    170   2e-47    Saccharum officinarum [noble cane]
gb|AER35881.1|  S-adenosyl-L-methionine:flavonoid O-methyltransfe...    170   2e-47    Ginkgo biloba [ginkgo]
ref|XP_009392797.1|  PREDICTED: flavone O-methyltransferase 1-like      170   2e-47    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002525818.1|  o-methyltransferase, putative                      170   2e-47    Ricinus communis
gb|AGS49187.1|  O-methyltransferase                                     170   2e-47    Zea mays [maize]
gb|AGF25396.1|  caffeic acid 3-O-methyltransferase                      170   2e-47    Zea nicaraguensis
sp|Q06509.1|COMT1_MAIZE  RecName: Full=Caffeic acid 3-O-methyltra...    170   2e-47    Zea mays [maize]
gb|AGS49191.1|  O-methyltransferase                                     170   2e-47    Zea mays [maize]
gb|AAQ24343.1|  O-methyltransferase                                     170   2e-47    Zea mays [maize]
gb|AGS49185.1|  O-methyltransferase                                     170   2e-47    Zea mays [maize]
gb|AAQ24342.1|  O-methyltransferase                                     170   2e-47    Zea mays [maize]
gb|AAQ24344.1|  O-methyltransferase                                     170   2e-47    Zea mays [maize]
dbj|BAG71895.1|  5-hydroxyconiferaldehyde O-methyltransferase           169   3e-47    Carthamus tinctorius
gb|AGS49211.1|  O-methyltransferase                                     170   3e-47    Zea mays [maize]
ref|NP_001106047.1|  catechol O-methyltransferase                       170   3e-47    Zea mays [maize]
gb|AAQ01670.1|  catechol O-methyltransferase                            169   3e-47    Papaver somniferum
gb|AGS49194.1|  O-methyltransferase                                     170   3e-47    Zea mays [maize]
ref|XP_006478090.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    170   3e-47    Citrus sinensis [apfelsine]
gb|AID68566.1|  caffeic O-methyltransferase                             170   3e-47    Punica granatum [granado]
gb|AGS49186.1|  O-methyltransferase                                     170   3e-47    Zea mays [maize]
dbj|BAM05579.1|  caffeic acid O-methyltransferase 1                     168   3e-47    Eucalyptus globulus subsp. globulus
gb|AAQ24348.1|  O-methyltransferase                                     169   3e-47    Zea mays [maize]
sp|Q9XGW0.1|COMT1_OCIBA  RecName: Full=Caffeic acid 3-O-methyltra...    169   3e-47    Ocimum basilicum [basil]
gb|AAQ24361.1|  O-methyltransferase                                     169   3e-47    Zea mays [maize]
ref|XP_007039215.1|  Caffeic acid 3-O-methyltransferase 1               169   3e-47    
gb|AGS49197.1|  O-methyltransferase                                     169   3e-47    Zea mays [maize]
gb|ADK97702.1|  putative caffeic acid O-methyltransferase               169   3e-47    Citrus aurantium [bitter orange]
gb|AGS49216.1|  O-methyltransferase                                     169   3e-47    Zea mays [maize]
gb|AAQ24351.1|  O-methyltransferase                                     169   3e-47    Zea mays [maize]
ref|NP_001266643.1|  quercetin 3-O-methyltransferase 1                  169   3e-47    
gb|AGS49195.1|  O-methyltransferase                                     169   3e-47    Zea mays [maize]
sp|Q43609.1|COMT1_PRUDU  RecName: Full=Caffeic acid 3-O-methyltra...    169   3e-47    Prunus dulcis [sweet almond]
gb|AGS49215.1|  O-methyltransferase                                     169   3e-47    Zea mays [maize]
gb|AAC18863.1|  caffeic acid 3-O-methyltransferase                      169   4e-47    Mesembryanthemum crystallinum
sp|Q43046.1|COMT1_POPKI  RecName: Full=Caffeic acid 3-O-methyltra...    169   4e-47    Populus sieboldii x Populus grandidentata
dbj|BAM05584.1|  caffeic acid O-methyltransferase 2                     168   4e-47    Eucalyptus globulus subsp. globulus
ref|XP_006829216.1|  hypothetical protein AMTR_s00001p00272250          169   4e-47    Amborella trichopoda
ref|XP_004137204.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    169   4e-47    Cucumis sativus [cucumbers]
gb|AAD50440.1|AF168777_1  caffeic acid O-methyltransferase              168   4e-47    Eucalyptus globulus [blue gum]
ref|XP_008462913.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1    169   5e-47    Cucumis melo [Oriental melon]
gb|AAB96879.1|  O-methyltransferase 1                                   169   5e-47    Arabidopsis thaliana [mouse-ear cress]
gb|AGS49181.1|  O-methyltransferase                                     169   5e-47    Zea mays [maize]
ref|XP_008234634.1|  PREDICTED: caffeic acid 3-O-methyltransferase      169   5e-47    Prunus mume [ume]
gb|AFZ78575.1|  caffeic acid O-methyltransferase                        169   5e-47    Populus tomentosa [Chinese white poplar]
gb|AGS49205.1|  O-methyltransferase                                     169   5e-47    Zea mays [maize]
ref|XP_007218167.1|  hypothetical protein PRUPE_ppa007511mg             169   5e-47    Prunus persica
ref|XP_006441596.1|  hypothetical protein CICLE_v10023568mg             169   5e-47    Citrus clementina [clementine]
ref|XP_010934913.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    169   6e-47    Elaeis guineensis
gb|KHN23296.1|  Caffeic acid 3-O-methyltransferase                      169   6e-47    Glycine soja [wild soybean]
dbj|BAM05580.1|  caffeic acid O-methyltransferase 1                     167   6e-47    Eucalyptus pyrocarpa
ref|XP_002317838.1|  Chain A family protein                             169   6e-47    Populus trichocarpa [western balsam poplar]
ref|XP_004156527.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    169   6e-47    
gb|ACT32028.1|  caffeic acid O-methyltransferase 1                      169   6e-47    Gossypium hirsutum [American cotton]
ref|XP_010035325.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    169   6e-47    Eucalyptus grandis [rose gum]
gb|ADX98508.1|  caffeic acid 3-O-methyltransferase                      169   7e-47    Panicum virgatum
ref|XP_004307899.1|  PREDICTED: caffeic acid 3-O-methyltransferase      169   7e-47    Fragaria vesca subsp. vesca
gb|AGS49200.1|  O-methyltransferase                                     169   7e-47    Zea mays [maize]
gb|AGS49199.1|  O-methyltransferase                                     169   7e-47    Zea mays [maize]
sp|Q00763.1|COMT1_POPTM  RecName: Full=Caffeic acid 3-O-methyltra...    169   8e-47    Populus tremuloides
gb|KDO41090.1|  hypothetical protein CISIN_1g018681mg                   168   8e-47    Citrus sinensis [apfelsine]
emb|CAJ43721.1|  caffeoyl-CoA O-methyltransferase                       165   8e-47    Plantago major [cart-track plant]
prf||1906376A  O-methyltransferase                                      168   8e-47    Populus trichocarpa x Populus deltoides
gb|AAF60951.1|  O-methyltransferase                                     168   9e-47    Populus trichocarpa x Populus deltoides
sp|Q9SWC2.1|COMT1_EUCGL  RecName: Full=Caffeic acid 3-O-methyltra...    167   9e-47    Eucalyptus globulus [blue gum]
gb|AGS49189.1|  O-methyltransferase                                     168   9e-47    Zea mays [maize]
sp|P28002.1|COMT1_MEDSA  RecName: Full=Caffeic acid 3-O-methyltra...    168   1e-46    Medicago sativa [alfalfa]
gb|ACY06328.1|  S-adenosyl-L-methionine: caffeic acid 3-0-methylt...    168   1e-46    Medicago sativa [alfalfa]
ref|XP_006401613.1|  hypothetical protein EUTSA_v10013897mg             168   1e-46    Eutrema salsugineum [saltwater cress]
emb|CBI23095.3|  unnamed protein product                                165   1e-46    Vitis vinifera
ref|XP_011043758.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1    168   1e-46    Populus euphratica
gb|AFK40372.1|  unknown                                                 168   1e-46    Lotus japonicus
ref|XP_003602396.1|  Caffeic acid O-methyltransferase                   168   1e-46    Medicago truncatula
dbj|BAJ34520.1|  unnamed protein product                                168   1e-46    Eutrema halophilum
gb|AFK39235.1|  unknown                                                 168   1e-46    Medicago truncatula
gb|AGS49183.1|  O-methyltransferase                                     168   1e-46    Zea mays [maize]
ref|XP_010034911.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    168   1e-46    Eucalyptus grandis [rose gum]
gb|AAF28353.1|AF220491_1  O-methyltransferase                           168   1e-46    Fragaria x ananassa
gb|AEI54336.1|  S-adenosyl-L-methionine: caffeic acid 3-0-methylt...    168   1e-46    Glycine max [soybeans]
gb|ADB82906.1|  caffeic O-methyltransferase1                            168   1e-46    Eucalyptus camaldulensis
sp|P59049.1|OMT1_CHRAE  RecName: Full=Quercetin 3-O-methyltransfe...    167   1e-46    Chrysosplenium americanum [water-carpet]
ref|XP_010048429.1|  PREDICTED: caffeic acid 3-O-methyltransferase      168   1e-46    Eucalyptus grandis [rose gum]
gb|AGS49184.1|  O-methyltransferase                                     168   1e-46    Zea mays [maize]
gb|ACY66932.1|  caffeic O-methyltransferase 1                           168   1e-46    Eucalyptus camaldulensis
gb|ABU53653.1|  caffeic acid O-3-methyltransferase                      168   1e-46    Populus deltoides
gb|EMS55685.1|  Tricetin 3',4',5'-O-trimethyltransferase                167   1e-46    Triticum urartu
emb|CDY18306.1|  BnaC09g30560D                                          168   1e-46    Brassica napus [oilseed rape]
ref|XP_006478221.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    167   2e-46    Citrus sinensis [apfelsine]
gb|ADI24332.1|  caffeic acid 3-O-methyltransferase                      167   2e-46    Miscanthus sinensis
gb|AEV93478.1|  caffeic acid O-methyltransferase                        167   2e-46    Caragana korshinskii
ref|XP_006478241.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    169   2e-46    
emb|CDY43839.1|  BnaC03g14720D                                          167   2e-46    Brassica napus [oilseed rape]
ref|NP_001289246.1|  caffeic acid 3-O-methyltransferase                 167   2e-46    Pyrus x bretschneideri [bai li]
dbj|BAE94403.1|  Caffeic acid 3-O-methyltransferase                     167   2e-46    Ipomoea nil [qian niu]
emb|CAA52462.1|  catechol O-methyltransferase                           167   2e-46    Nicotiana tabacum [American tobacco]
gb|ABS57468.1|  caffeic acid O-methyl transferase                       167   2e-46    Leucaena leucocephala [cassie]
gb|KDP32878.1|  hypothetical protein JCGZ_12170                         167   2e-46    Jatropha curcas
ref|XP_009608171.1|  PREDICTED: caffeic acid 3-O-methyltransferase      167   2e-46    
gb|AAD48913.1|AF139533_1  caffeate O-methyltransferase                  167   2e-46    Liquidambar styraciflua [American sweet gum]
gb|AGS49208.1|  O-methyltransferase                                     167   2e-46    Zea mays [maize]
sp|Q42653.1|OMT2_CHRAE  RecName: Full=Quercetin 3-O-methyltransfe...    167   2e-46    Chrysosplenium americanum [water-carpet]
gb|AIY22649.1|  caffeic acid 3-O-methyl transferase                     163   2e-46    Saccharum arundinaceum
ref|NP_001240003.1|  uncharacterized protein LOC100780100               167   3e-46    Glycine max [soybeans]
gb|AGS49207.1|  O-methyltransferase                                     167   3e-46    Zea mays [maize]
ref|XP_009132451.1|  PREDICTED: flavone 3'-O-methyltransferase 1        167   3e-46    Brassica rapa
dbj|BAO79382.1|  hypothetical plant O-methyltransferase                 167   3e-46    Anthriscus sylvestris
gb|AGS49198.1|  O-methyltransferase                                     167   3e-46    
ref|XP_009119948.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    167   3e-46    
gb|AGS49188.1|  O-methyltransferase                                     167   3e-46    
gb|AAF63200.1|  caffeic acid O-3-methyltransferase                      167   3e-46    
gb|AAN03726.1|  caffeic acid O-methyltransferase                        166   3e-46    
ref|XP_010537046.1|  PREDICTED: flavone 3'-O-methyltransferase 1        167   4e-46    
gb|AIY22648.1|  caffeic acid 3-O-methyl transferase                     163   4e-46    
sp|Q8W013.1|COMT1_CATRO  RecName: Full=Caffeic acid 3-O-methyltra...    167   4e-46    
ref|XP_006441599.1|  hypothetical protein CICLE_v10020870mg             166   4e-46    
sp|P46484.1|COMT1_EUCGU  RecName: Full=Caffeic acid 3-O-methyltra...    167   4e-46    
emb|CDM87233.1|  unnamed protein product                                166   4e-46    
gb|AAY86361.1|  caffeic acid O-methyltransferase                        166   4e-46    
gb|EMT17011.1|  Caffeic acid 3-O-methyltransferase                      166   5e-46    
dbj|BAE94400.1|  Caffeic acid 3-O-methyltransferase                     166   5e-46    
ref|XP_003559686.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    166   5e-46    
gb|AGS49217.1|  O-methyltransferase                                     166   5e-46    
gb|AAK68907.1|  caffeic acid O-methyltransferase                        166   5e-46    
sp|Q38J50.1|FOMT2_WHEAT  RecName: Full=Tricetin 3',4',5'-O-trimet...    166   5e-46    
gb|EYU31472.1|  hypothetical protein MIMGU_mgv1a019059mg                163   5e-46    
gb|KCW89068.1|  hypothetical protein EUGRSUZ_A01397                     168   5e-46    
ref|XP_006472905.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    166   6e-46    
ref|XP_006434352.1|  hypothetical protein CICLE_v10001555mg             166   6e-46    
ref|XP_010662844.1|  PREDICTED: caffeic acid O-methyltransferase ...    166   6e-46    
sp|O23760.1|COMT1_CLABR  RecName: Full=Caffeic acid 3-O-methyltra...    166   6e-46    
gb|AAC18623.1|  bispecific caffeic acid/5-hydroxyferulic acid O-m...    166   6e-46    
emb|CAE51884.1|  putative caffeate o-methyltransferase                  164   6e-46    
ref|XP_003526767.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    166   6e-46    
ref|XP_009119951.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    166   6e-46    
emb|CAA52461.1|  catechol O-methyltransferase                           166   7e-46    
gb|AGS49213.1|  O-methyltransferase                                     166   8e-46    
gb|AGS49203.1|  O-methyltransferase                                     166   8e-46    
ref|XP_010934914.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    166   8e-46    
ref|XP_006441468.1|  hypothetical protein CICLE_v10020874mg             166   9e-46    
ref|XP_009757562.1|  PREDICTED: caffeic acid 3-O-methyltransferase      166   1e-45    
ref|NP_001242325.1|  uncharacterized protein LOC100805999               166   1e-45    
gb|AGS49182.1|  O-methyltransferase                                     165   1e-45    
gb|AGS49192.1|  O-methyltransferase                                     165   1e-45    
gb|AAK68910.1|  caffeic acid O-methyltransferase                        165   1e-45    
ref|XP_011075886.1|  PREDICTED: LOW QUALITY PROTEIN: caffeic acid...    165   1e-45    
gb|AJK93384.1|  caffeic acid O-methyltransferase                        165   2e-45    
sp|Q9XGV9.1|COMT2_OCIBA  RecName: Full=Caffeic acid 3-O-methyltra...    165   2e-45    
gb|ADO16247.1|  caffeic acid O-methyltransferase                        165   2e-45    
ref|XP_004972800.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    165   2e-45    
gb|KCW90804.1|  hypothetical protein EUGRSUZ_A02870                     164   2e-45    
gb|AAK68908.1|  caffeic acid O-methyltransferase                        164   2e-45    
ref|XP_010061962.1|  PREDICTED: caffeic acid 3-O-methyltransferase      164   3e-45    
gb|ABP63535.1|  caffeic acid 3-O-methyltransferase                      164   3e-45    
ref|XP_011084579.1|  PREDICTED: LOW QUALITY PROTEIN: caffeic acid...    164   3e-45    
ref|XP_008376825.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    164   3e-45    
sp|Q8LL87.1|COMT1_COFCA  RecName: Full=Caffeic acid 3-O-methyltra...    164   4e-45    
gb|AAG43822.1|AF212316_1  caffeic acid O-methyltransferase              164   4e-45    
ref|XP_011003285.1|  PREDICTED: caffeic acid 3-O-methyltransferase 3    164   5e-45    
ref|XP_003528001.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    164   5e-45    
gb|AAK68909.1|  caffeic acid O-methyltransferase                        164   5e-45    
gb|AAD10253.1|  caffeic acid O-methyltransferase                        164   5e-45    
pdb|3P9C|A  Chain A, Crystal Structure Of Perennial Ryegrass Lpom...    164   6e-45    
ref|XP_008382714.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    160   6e-45    
gb|ABO41845.1|  putative caffeic acid methyltransferase                 163   7e-45    
gb|ADR31598.1|  caffeic acid 5-hydroxyferulic acid 35-O-methyltra...    159   8e-45    
gb|ADR31595.1|  caffeic acid 5-hydroxyferulic acid 35-O-methyltra...    159   8e-45    
gb|AEW26164.1|  caffeic acid-O-methyltransferase                        157   1e-44    
gb|AEW26161.1|  caffeic acid-O-methyltransferase                        159   1e-44    
dbj|BAO79380.1|  5-hydroxyconiferylaldehyde O-methyltransferase         163   1e-44    
ref|XP_003621323.1|  Isoliquiritigenin 2'-O-methyltransferase           163   1e-44    
gb|AEW26163.1|  caffeic acid-O-methyltransferase                        159   1e-44    
gb|ADR31604.1|  caffeic acid 5-hydroxyferulic acid 35-O-methyltra...    159   1e-44    
ref|XP_010520935.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    162   1e-44    
ref|XP_004502769.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    163   1e-44    
gb|ABO41834.1|  putative caffeic acid methyltransferase                 162   1e-44    
gb|ABO41852.1|  putative caffeic acid methyltransferase                 162   1e-44    
ref|XP_008376828.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    162   1e-44    
gb|ACD56610.1|  putative caffeic acid protein                           162   1e-44    
ref|XP_008788729.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    162   1e-44    
gb|AAD29842.1|AF064694_1  catechol O-methyltransferase                  162   1e-44    
dbj|BAK42963.1|  caffeic acid O-methylltransferase                      162   1e-44    
gb|ABO41840.1|  putative caffeic acid methyltransferase                 162   1e-44    
emb|CBI23096.3|  unnamed protein product                                157   2e-44    
gb|KEH43550.1|  caffeic acid O-methyltransferase                        162   2e-44    
gb|ACJ76442.1|  caffeic acid 3-O-methyltransferase 2                    162   2e-44    
ref|XP_003621340.1|  Caffeate O-methyltransferase-1                     162   2e-44    
gb|ACI42878.1|  caffeic acid ortho-methyltransferase                    161   2e-44    
gb|AEW26209.1|  caffeic acid-O-methyltransferase                        159   2e-44    
ref|XP_002321948.1|  Chain A family protein                             162   2e-44    
sp|Q43047.1|COMT3_POPKI  RecName: Full=Caffeic acid 3-O-methyltra...    162   2e-44    
ref|XP_006478226.1|  PREDICTED: anthranilate N-methyltransferase-...    162   3e-44    
gb|AAD29841.1|AF064693_1  catechol O-methyltransferase                  162   3e-44    
gb|AAD29845.1|AF064697_1  O-methyltransferase                           162   3e-44    
ref|XP_003621334.1|  O-methyltransferase                                162   3e-44    
gb|ABK25932.1|  unknown                                                 161   3e-44    
gb|EYU45322.1|  hypothetical protein MIMGU_mgv1a009747mg                161   3e-44    
gb|AGS49201.1|  O-methyltransferase                                     162   3e-44    
sp|P93324.1|CHOMT_MEDSA  RecName: Full=Isoliquiritigenin 2'-O-met...    162   3e-44    
gb|AAD29844.1|AF064696_1  catechol O-methyltransferase                  162   3e-44    
ref|XP_008775842.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    162   3e-44    
gb|ABK22490.1|  unknown                                                 162   3e-44    
gb|KJB16304.1|  hypothetical protein B456_002G222400                    162   3e-44    
emb|CAI30878.1|  caffeate O-methyltransferase                           162   3e-44    
gb|AGS49193.1|  O-methyltransferase                                     161   4e-44    
sp|Q6T1F5.1|COMT1_AMMMJ  RecName: Full=Caffeic acid 3-O-methyltra...    161   4e-44    
gb|ACF04799.1|  caffeic acid 3-O-methytransferase                       161   4e-44    
ref|XP_006477839.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    161   4e-44    
ref|XP_004235028.1|  PREDICTED: caffeic acid 3-O-methyltransferase      161   4e-44    
ref|XP_006478347.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    161   4e-44    
emb|CAE51883.1|  putative caffeate o-methyltransferase                  159   5e-44    
sp|O81646.1|COMT1_CAPCH  RecName: Full=Caffeic acid 3-O-methyltra...    161   5e-44    
gb|AFZ78574.1|  caffeic acid O-methyltransferase                        161   5e-44    
gb|ABS18316.1|  caffeic acid-3-O-methyltransferase                      161   5e-44    
ref|XP_007143664.1|  hypothetical protein PHAVU_007G091000g             161   5e-44    
sp|Q9FQY8.2|COMT1_CAPAN  RecName: Full=Caffeic acid 3-O-methyltra...    161   5e-44    
ref|XP_006420931.1|  hypothetical protein CICLE_v10005230mg             161   6e-44    
ref|XP_010911558.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    161   6e-44    
ref|XP_003621343.1|  O-methyltransferase                                161   6e-44    
ref|XP_009395003.1|  PREDICTED: flavone O-methyltransferase 1-like      162   6e-44    
ref|XP_008347272.1|  PREDICTED: caffeic acid 3-O-methyltransferase      161   7e-44    
ref|XP_010520933.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    160   7e-44    
dbj|BAO31650.1|  O-methyltransferase                                    160   8e-44    
ref|XP_003552548.1|  PREDICTED: isoliquiritigenin 2'-O-methyltran...    161   8e-44    
ref|XP_011084580.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    160   9e-44    
ref|XP_010048400.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    160   9e-44    
ref|XP_004491872.1|  PREDICTED: isoliquiritigenin 2'-O-methyltran...    161   9e-44    
gb|KDP36008.1|  hypothetical protein JCGZ_10407                         160   1e-43    
gb|AAD10255.1|  caffeic acid O-methyltransferase                        160   1e-43    
sp|A8J6X1.1|BMT_GLELI  RecName: Full=Bergaptol O-methyltransferas...    160   1e-43    
emb|CCC55423.1|  caffeic acid O-3-methyltransferase                     160   1e-43    
ref|XP_006478222.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    160   1e-43    
dbj|BAD18975.1|  phloroglucinol O-methyltransferase                     160   1e-43    
sp|Q41086.1|COMT2_POPTM  RecName: Full=Caffeic acid 3-O-methyltra...    160   1e-43    
gb|AFD61598.1|  caffeic acid 3-O-methyltransferase                      160   2e-43    
gb|ABK21417.1|  unknown                                                 160   2e-43    
emb|CBI19007.3|  unnamed protein product                                159   2e-43    
gb|AFM73596.1|  caffeate O-methyltransferase                            158   2e-43    
ref|XP_006442372.1|  hypothetical protein CICLE_v10020761mg             160   2e-43    
gb|AFO69477.1|  caffeic acid O-methyltransferase                        160   2e-43    
gb|KHN00805.1|  Isoliquiritigenin 2'-O-methyltransferase                159   2e-43    
ref|XP_006441603.1|  hypothetical protein CICLE_v10020875mg             159   2e-43    
ref|NP_001268100.1|  caffeic acid O-methyltransferase                   160   2e-43    
ref|XP_009361272.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    159   2e-43    
gb|AEW26176.1|  caffeic acid-O-methyltransferase                        155   2e-43    
gb|AAO43609.1|  caffeic acid O-methyltransferase                        159   2e-43    
emb|CAN76660.1|  hypothetical protein VITISV_032827                     159   2e-43    
gb|AAQ07451.1|  caffeic acid O-methyltransferase                        155   2e-43    
ref|XP_003634428.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    159   2e-43    
gb|KDP35860.1|  hypothetical protein JCGZ_10599                         159   3e-43    
gb|ABR18103.1|  unknown                                                 159   3e-43    
ref|XP_003556202.1|  PREDICTED: isoliquiritigenin 2'-O-methyltran...    159   3e-43    
dbj|BAA13683.1|  O-methyltransferase                                    159   3e-43    
pdb|4PGH|A  Chain A, Caffeic Acid O-methyltransferase From Sorghu...    159   3e-43    
pdb|4PGG|A  Chain A, Caffeic Acid O-methyltransferase From Sorghu...    159   3e-43    
gb|AFD53036.1|  caffeic acid-O-methyltransferase                        159   3e-43    
emb|CDY19037.1|  BnaC01g20310D                                          159   3e-43    
gb|EMT30204.1|  Caffeic acid 3-O-methyltransferase                      158   3e-43    
gb|AFX98069.1|  caffeic acid O-methyltransferase                        159   3e-43    
ref|XP_002445083.1|  hypothetical protein SORBIDRAFT_07g003860          159   3e-43    
ref|XP_006442371.1|  hypothetical protein CICLE_v10024037mg             159   3e-43    
gb|AAL57301.1|AF387790_1  O-methyltransferase                           159   4e-43    
emb|CAN69214.1|  hypothetical protein VITISV_033821                     159   4e-43    
gb|ABI54121.1|  caffeic acid O-methyltransferase                        155   4e-43    
ref|XP_008382917.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    155   4e-43    
ref|XP_006659136.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    159   5e-43    
ref|XP_008376824.1|  PREDICTED: caffeic acid 3-O-methyltransferase      159   5e-43    
gb|ABR18380.1|  unknown                                                 158   6e-43    
ref|XP_009802353.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    158   7e-43    
gb|AAD29843.1|AF064695_1  catechol O-methyltransferase                  158   7e-43    
gb|ABK23795.1|  unknown                                                 158   7e-43    
gb|AEO21927.1|  bergaptol-O-methyltransferase                           158   8e-43    
sp|Q6T1F6.1|BMT_AMMMJ  RecName: Full=Bergaptol O-methyltransferas...    157   8e-43    
ref|XP_008357058.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    158   9e-43    
ref|XP_004148286.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    158   9e-43    
gb|KHN00804.1|  Isoliquiritigenin 2'-O-methyltransferase                157   1e-42    
ref|XP_004494877.1|  PREDICTED: anthranilate N-methyltransferase-...    158   1e-42    
ref|XP_010527383.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    157   1e-42    
emb|CDP20700.1|  unnamed protein product                                158   1e-42    
ref|XP_009388361.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    157   1e-42    
gb|ABP93667.1|  O-methyltransferase 5                                   157   1e-42    
gb|AJK93385.1|  caffeic acid O-methyltransferase                        157   1e-42    
gb|KHN19569.1|  Caffeic acid 3-O-methyltransferase                      154   1e-42    
ref|XP_009361271.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    157   1e-42    
gb|AGR85824.1|  caffeic acid O-methyltransferase                        155   2e-42    
ref|XP_008364840.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    157   2e-42    
emb|CBI22124.3|  unnamed protein product                                156   2e-42    
dbj|BAJ95117.1|  predicted protein                                      157   2e-42    
sp|Q43239.1|COMT1_ZINVI  RecName: Full=Caffeic acid 3-O-methyltra...    157   2e-42    
gb|ABK23414.1|  unknown                                                 157   2e-42    
ref|XP_011070409.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    157   3e-42    
gb|ABY74431.1|  inositol methyl transferase                             157   3e-42    
ref|XP_006413044.1|  hypothetical protein EUTSA_v10027501mg             157   3e-42    
ref|XP_009384387.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    156   3e-42    
ref|XP_007223223.1|  hypothetical protein PRUPE_ppa007212mg             157   3e-42    
ref|XP_011097031.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    156   3e-42    
ref|XP_009361268.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    156   3e-42    
gb|ADR31603.1|  caffeic acid 5-hydroxyferulic acid 35-O-methyltra...    152   3e-42    
gb|EMT10034.1|  Caffeic acid 3-O-methyltransferase                      156   3e-42    
emb|CDP16374.1|  unnamed protein product                                156   3e-42    
sp|P45986.1|IMT1_MESCR  RecName: Full=Inositol 4-methyltransferase      156   4e-42    
ref|XP_002268308.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    156   4e-42    
gb|ABP93668.1|  O-methytransferase 4                                    156   4e-42    
gb|AFQ94040.1|  monolignol 4-O-methyltransferase 4                      156   4e-42    
gb|EMT10032.1|  Caffeic acid 3-O-methyltransferase                      154   4e-42    
ref|XP_010068758.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    156   5e-42    
dbj|BAO31651.1|  O-methyltransferase                                    155   5e-42    
ref|XP_004499845.1|  PREDICTED: isoliquiritigenin 2'-O-methyltran...    156   5e-42    
gb|AHM25236.1|  3,5-dihydroxybiphenyl O-methyltransferase               156   5e-42    
dbj|BAO79385.1|  hypothetical plant O-methyltransferase                 155   6e-42    
gb|KHN06374.1|  Anthranilate N-methyltransferase                        155   7e-42    
ref|XP_004496361.1|  PREDICTED: isoliquiritigenin 2'-O-methyltran...    155   7e-42    
ref|NP_001240974.1|  isoliquiritigenin 2'-O-methyltransferase-like      155   7e-42    
sp|O04385.2|IEMT_CLABR  RecName: Full=(Iso)eugenol O-methyltransf...    155   8e-42    
ref|XP_007019090.1|  Caffeic acid 3-O-methyltransferase 1               155   8e-42    
ref|XP_010107135.1|  Caffeic acid 3-O-methyltransferase                 156   8e-42    
pdb|3REO|A  Chain A, Monolignol O-Methyltransferase (Momt)              155   8e-42    
ref|XP_008219627.1|  PREDICTED: LOW QUALITY PROTEIN: caffeic acid...    155   9e-42    
ref|XP_010107139.1|  Caffeic acid 3-O-methyltransferase                 155   1e-41    
ref|XP_010433307.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    155   1e-41    
ref|XP_009361274.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    155   1e-41    
ref|XP_009784058.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    155   1e-41    
ref|XP_010438549.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    155   1e-41    
gb|KDP32876.1|  hypothetical protein JCGZ_12168                         155   1e-41    
ref|XP_010448093.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    155   1e-41    
ref|XP_007015113.1|  Caffeic acid 3-O-methyltransferase 1 isoform 1     156   1e-41    
ref|XP_003598824.1|  O-methyltransferase                                155   1e-41    
ref|XP_009387259.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    154   2e-41    



>gb|KDP29212.1| hypothetical protein JCGZ_16601 [Jatropha curcas]
Length=357

 Score =   340 bits (872),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 153/198 (77%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            +YVLQHHQDALM+AWPLVHEAVVD ++EPFVKAN EPAY+YYGK+PEMNGLM KAMSGVS
Sbjct  117  SYVLQHHQDALMRAWPLVHEAVVDPTTEPFVKANDEPAYAYYGKQPEMNGLMQKAMSGVS  176

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            VPFMKA L+GY GF+G+ +LVDVGGSAGDCLRMI++K+P+I +GINFDLPEVV KAPNIP
Sbjct  177  VPFMKAILNGYDGFQGMEKLVDVGGSAGDCLRMILKKYPNIREGINFDLPEVVAKAPNIP  236

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+THVGGDMFKSIP+ D IFMKW+LTTW DEECK+IM +CY AL  GGK+ ACEP+LP Q
Sbjct  237  GVTHVGGDMFKSIPSADGIFMKWVLTTWTDEECKQIMENCYKALPVGGKLIACEPVLPKQ  296

Query  543  TDYTHRTRLLLVGDMFVM  596
            +D +HRTR LL GD+FVM
Sbjct  297  SDDSHRTRALLEGDIFVM  314



>ref|XP_011018830.1| PREDICTED: caffeic acid 3-O-methyltransferase [Populus euphratica]
Length=364

 Score =   339 bits (869),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 155/197 (79%), Positives = 174/197 (88%), Gaps = 0/197 (0%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  185
            YVLQHHQDALMKAWPLVHEAV+D ++EPFVKANGEPAY YYGK+PEMN LMLKAMSGVSV
Sbjct  125  YVLQHHQDALMKAWPLVHEAVLDPTTEPFVKANGEPAYDYYGKQPEMNELMLKAMSGVSV  184

Query  186  PFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPG  365
            PFM+A LDGY GF+GV RLVDVGGSAGDCLRMI++KHP + QGINFDLPEVV KAP IPG
Sbjct  185  PFMEAMLDGYDGFKGVERLVDVGGSAGDCLRMILKKHPGVRQGINFDLPEVVAKAPIIPG  244

Query  366  ITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQT  545
            +T+VGGDMFKSIP+GDAIFMKW+LTTW D ECK IM +CY AL  GGK+ ACEP+LP  +
Sbjct  245  VTNVGGDMFKSIPDGDAIFMKWILTTWTDNECKLIMENCYKALPMGGKLVACEPVLPKDS  304

Query  546  DYTHRTRLLLVGDMFVM  596
            D +HRTR LL GD+FVM
Sbjct  305  DDSHRTRALLEGDIFVM  321



>ref|XP_002264566.1| PREDICTED: caffeic acid 3-O-methyltransferase [Vitis vinifera]
Length=358

 Score =   338 bits (868),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 155/198 (78%), Positives = 177/198 (89%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            AYVLQH+Q+ LM AWPLVHEAVVDS++EPFVKANGEPAYSYYGKKPEMN LM +AMSGVS
Sbjct  118  AYVLQHYQEELMTAWPLVHEAVVDSTTEPFVKANGEPAYSYYGKKPEMNDLMQRAMSGVS  177

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            VPFMKA L+GY+GF+GV RLVDVGGSAGDCLRMI++KH +I +GINFDLPEVV KAPNIP
Sbjct  178  VPFMKAILNGYNGFDGVQRLVDVGGSAGDCLRMILQKHTNIKEGINFDLPEVVAKAPNIP  237

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+THVGGDMFKS+P+GDAIFMKW+LTTW DEECK IM +CY AL  GGKM ACEP+LP +
Sbjct  238  GVTHVGGDMFKSVPDGDAIFMKWVLTTWTDEECKLIMKNCYNALPVGGKMIACEPVLPKE  297

Query  543  TDYTHRTRLLLVGDMFVM  596
            +D + RTR LL GD+FVM
Sbjct  298  SDNSLRTRALLEGDIFVM  315



>ref|XP_006381361.1| hypothetical protein POPTR_0006s12160g [Populus trichocarpa]
 gb|ERP59158.1| hypothetical protein POPTR_0006s12160g [Populus trichocarpa]
Length=364

 Score =   338 bits (866),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 155/197 (79%), Positives = 174/197 (88%), Gaps = 0/197 (0%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  185
            YVLQHHQDALMKAWPLVHEAV+D ++EPFVKANGEPAY YYGK+PEMN LMLKAMSGVSV
Sbjct  125  YVLQHHQDALMKAWPLVHEAVLDPTTEPFVKANGEPAYDYYGKQPEMNELMLKAMSGVSV  184

Query  186  PFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPG  365
            PFM+A LDGY GF+GV RLVDVGGSAGDCLRMI++KHP + QGINFDLPEVV KAP IPG
Sbjct  185  PFMEAMLDGYDGFKGVERLVDVGGSAGDCLRMILKKHPGVRQGINFDLPEVVAKAPIIPG  244

Query  366  ITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQT  545
            +T+VGGDMFKSIP+GDAIFMKW+LTTW D ECK IM +CY AL  GGK+ ACEP+LP  +
Sbjct  245  VTNVGGDMFKSIPDGDAIFMKWILTTWTDNECKLIMENCYKALPVGGKLIACEPVLPKDS  304

Query  546  DYTHRTRLLLVGDMFVM  596
            D +HRTR LL GD+FVM
Sbjct  305  DDSHRTRALLEGDIFVM  321



>ref|XP_010267318.1| PREDICTED: caffeic acid 3-O-methyltransferase [Nelumbo nucifera]
Length=354

 Score =   337 bits (865),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 155/198 (78%), Positives = 173/198 (87%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            AYVLQHHQDALMKAWP++HEAVVD   EPFVKANGEPAYSYYG K EMN LM KAMSGVS
Sbjct  114  AYVLQHHQDALMKAWPILHEAVVDPKEEPFVKANGEPAYSYYGDKSEMNELMQKAMSGVS  173

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            VPFMKA L+GY+GF+GV RLVDVGGSAGDCLRMI+ KHP + +GINFDLPEVV KAPNIP
Sbjct  174  VPFMKAILEGYNGFKGVERLVDVGGSAGDCLRMILHKHPHVREGINFDLPEVVAKAPNIP  233

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+THVGGDMF+SIP GDAIFMKW+LTTW D+ECK IM +CY AL  GGKM ACEP+LP +
Sbjct  234  GVTHVGGDMFESIPAGDAIFMKWVLTTWTDDECKLIMRNCYEALPPGGKMIACEPVLPKE  293

Query  543  TDYTHRTRLLLVGDMFVM  596
            +D +HRTR LL GD+FVM
Sbjct  294  SDRSHRTRALLEGDIFVM  311



>emb|CAN65776.1| hypothetical protein VITISV_030414 [Vitis vinifera]
Length=358

 Score =   335 bits (860),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 154/198 (78%), Positives = 175/198 (88%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            AYVLQH+Q+ LM AWPLVHEAVVDS++EPFVKANGEPAYSYYGKKPEMN LM +AMSGVS
Sbjct  118  AYVLQHYQEELMTAWPLVHEAVVDSTTEPFVKANGEPAYSYYGKKPEMNDLMQRAMSGVS  177

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            VPFMKA L+GY GF+GV RLVDVGGSAGDCLRMI++KH +I +GINFDLPEVV KAP IP
Sbjct  178  VPFMKAILNGYSGFDGVQRLVDVGGSAGDCLRMILQKHTNIKEGINFDLPEVVAKAPTIP  237

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+THVGGDMFKS+P+GDAIFMKW+LTTW DEECK IM +CY AL  GGKM ACEP+LP +
Sbjct  238  GVTHVGGDMFKSVPDGDAIFMKWVLTTWTDEECKLIMKNCYNALPVGGKMIACEPVLPKE  297

Query  543  TDYTHRTRLLLVGDMFVM  596
            +D + RTR LL GD+FVM
Sbjct  298  SDNSLRTRALLEGDIFVM  315



>ref|XP_002519426.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF42840.1| o-methyltransferase, putative [Ricinus communis]
Length=357

 Score =   335 bits (859),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 149/198 (75%), Positives = 176/198 (89%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            AYVLQHHQDALM+AWPLVHEAV+DS++EPF KANGEPAY YYGK+PEMN LM KAMSG+S
Sbjct  117  AYVLQHHQDALMRAWPLVHEAVLDSTTEPFAKANGEPAYDYYGKRPEMNELMQKAMSGLS  176

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            VPFMKA L+GY GF+GV ++VDVGGSAGDCL+ I++K+P++ +GINFDLPEVV KAPNIP
Sbjct  177  VPFMKAVLNGYDGFQGVEKIVDVGGSAGDCLKTILQKYPNVREGINFDLPEVVAKAPNIP  236

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+THVGGDMFKS+P+ DAIFMKW+LTTW D+ECK IM +CY AL  GGK+ ACEP+LP Q
Sbjct  237  GVTHVGGDMFKSVPSADAIFMKWILTTWTDDECKVIMENCYKALPVGGKLIACEPVLPNQ  296

Query  543  TDYTHRTRLLLVGDMFVM  596
            TD +HRTR LL GD+FVM
Sbjct  297  TDDSHRTRALLEGDIFVM  314



>ref|XP_009341082.1| PREDICTED: caffeic acid 3-O-methyltransferase isoform X2 [Pyrus 
x bretschneideri]
Length=369

 Score =   333 bits (855),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 151/197 (77%), Positives = 171/197 (87%), Gaps = 0/197 (0%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  185
            YVLQHHQD LM AWP+VHEAVVDS+ EPFVKANGEPAY YYGKKPEMNGLM KAMSGVSV
Sbjct  130  YVLQHHQDVLMGAWPMVHEAVVDSTVEPFVKANGEPAYEYYGKKPEMNGLMQKAMSGVSV  189

Query  186  PFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPG  365
            PFMKA LDGY GFEGV RLVDVGGSAGDCLRMI++KHP++ +GINFDLPEVV KAP I G
Sbjct  190  PFMKAILDGYDGFEGVERLVDVGGSAGDCLRMILQKHPNVKEGINFDLPEVVAKAPTIAG  249

Query  366  ITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQT  545
            ++HVGGDMFKSIP GDAIF KW+L+TW D ECK I+ +CY AL +GGK+ ACEP+LP ++
Sbjct  250  VSHVGGDMFKSIPRGDAIFFKWILSTWTDSECKVILENCYKALPEGGKLIACEPVLPKKS  309

Query  546  DYTHRTRLLLVGDMFVM  596
            D +HRTR LL  D+FVM
Sbjct  310  DESHRTRALLENDIFVM  326



>ref|XP_008387516.1| PREDICTED: caffeic acid 3-O-methyltransferase [Malus domestica]
Length=284

 Score =   329 bits (843),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 150/197 (76%), Positives = 171/197 (87%), Gaps = 0/197 (0%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  185
            YVLQHHQD LM AWP+VHEAVVDS+ EPFVKANGE AY YYGKKPEMNGLM KAMSGVSV
Sbjct  45   YVLQHHQDVLMGAWPMVHEAVVDSTVEPFVKANGELAYEYYGKKPEMNGLMQKAMSGVSV  104

Query  186  PFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPG  365
            PFMKA LDGY GFEGV RLVDVGGSAGDCLRMI++KHP++ +GINFDLPEVV KAP I G
Sbjct  105  PFMKAILDGYDGFEGVERLVDVGGSAGDCLRMILQKHPNVREGINFDLPEVVAKAPTIAG  164

Query  366  ITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQT  545
            ++HVGGDMFKSIP GDAIF+KW+L+TW D ECK I+ +CY AL +GGK+ ACEP+LP ++
Sbjct  165  VSHVGGDMFKSIPRGDAIFLKWILSTWTDSECKVILENCYKALPEGGKLIACEPVLPKKS  224

Query  546  DYTHRTRLLLVGDMFVM  596
            D +HRTR LL  D+FVM
Sbjct  225  DESHRTRALLENDIFVM  241



>ref|XP_008241354.1| PREDICTED: caffeic acid 3-O-methyltransferase [Prunus mume]
Length=368

 Score =   330 bits (845),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 150/197 (76%), Positives = 170/197 (86%), Gaps = 0/197 (0%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  185
            Y+LQHHQD LM AWP+VHEAVVD + EPFVKANGEPAY YYGKKPEMNGLM +AMSGVSV
Sbjct  129  YILQHHQDVLMGAWPMVHEAVVDPTVEPFVKANGEPAYEYYGKKPEMNGLMQRAMSGVSV  188

Query  186  PFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPG  365
            PFMKA LDGY GFEGV RLVDVGGSAGDCLRMI++KHPS+ +GINFDLPEVV KAP I G
Sbjct  189  PFMKAILDGYDGFEGVGRLVDVGGSAGDCLRMILQKHPSVREGINFDLPEVVAKAPTIAG  248

Query  366  ITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQT  545
            ++HVGGDMFKSIP+GDAIFMKW+L+TW D ECK IM +CY AL  GGK+ ACEP+LP ++
Sbjct  249  VSHVGGDMFKSIPSGDAIFMKWVLSTWTDSECKLIMENCYKALPVGGKLIACEPVLPTKS  308

Query  546  DYTHRTRLLLVGDMFVM  596
            D + RTR LL  D+FVM
Sbjct  309  DDSSRTRALLENDVFVM  325



>ref|XP_009341081.1| PREDICTED: caffeic acid 3-O-methyltransferase isoform X1 [Pyrus 
x bretschneideri]
Length=372

 Score =   328 bits (841),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 151/200 (76%), Positives = 171/200 (86%), Gaps = 3/200 (2%)
 Frame = +3

Query  6    YVLQHHQ---DALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSG  176
            YVLQHHQ   D LM AWP+VHEAVVDS+ EPFVKANGEPAY YYGKKPEMNGLM KAMSG
Sbjct  130  YVLQHHQLFKDVLMGAWPMVHEAVVDSTVEPFVKANGEPAYEYYGKKPEMNGLMQKAMSG  189

Query  177  VSVPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPN  356
            VSVPFMKA LDGY GFEGV RLVDVGGSAGDCLRMI++KHP++ +GINFDLPEVV KAP 
Sbjct  190  VSVPFMKAILDGYDGFEGVERLVDVGGSAGDCLRMILQKHPNVKEGINFDLPEVVAKAPT  249

Query  357  IPGITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILP  536
            I G++HVGGDMFKSIP GDAIF KW+L+TW D ECK I+ +CY AL +GGK+ ACEP+LP
Sbjct  250  IAGVSHVGGDMFKSIPRGDAIFFKWILSTWTDSECKVILENCYKALPEGGKLIACEPVLP  309

Query  537  IQTDYTHRTRLLLVGDMFVM  596
             ++D +HRTR LL  D+FVM
Sbjct  310  KKSDESHRTRALLENDIFVM  329



>gb|KHN47498.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=337

 Score =   327 bits (837),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 148/197 (75%), Positives = 170/197 (86%), Gaps = 0/197 (0%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  185
            YVLQHHQDALM+AWPLVHEAVVD + EPF  ANGEPAY YY K+PEMN LM++AMSGVSV
Sbjct  98   YVLQHHQDALMRAWPLVHEAVVDPTKEPFEMANGEPAYGYYLKQPEMNDLMVRAMSGVSV  157

Query  186  PFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPG  365
            PFM+A L+GY GF+GV +LVDVGGS GDCLRMI++KHP+I +GINFDLPEVV KAP IP 
Sbjct  158  PFMRAMLEGYDGFQGVEKLVDVGGSGGDCLRMILQKHPTIKEGINFDLPEVVAKAPQIPC  217

Query  366  ITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQT  545
            +THVGGDMFKSIP GDAIFMKW+LTTW DEECK IM SC+ AL +GGK+ ACEP+LP  +
Sbjct  218  VTHVGGDMFKSIPQGDAIFMKWVLTTWTDEECKHIMQSCHKALPEGGKLIACEPVLPEHS  277

Query  546  DYTHRTRLLLVGDMFVM  596
            D +HRTR LL GD+FVM
Sbjct  278  DESHRTRALLEGDIFVM  294



>ref|XP_006598126.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Glycine max]
Length=356

 Score =   327 bits (839),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 148/197 (75%), Positives = 170/197 (86%), Gaps = 0/197 (0%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  185
            YVLQHHQDALM+AWPLVHEAVVD + EPF  ANGEPAY YY K+PEMN LM++AMSGVSV
Sbjct  117  YVLQHHQDALMRAWPLVHEAVVDPTKEPFEMANGEPAYGYYLKQPEMNDLMVRAMSGVSV  176

Query  186  PFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPG  365
            PFM+A L+GY GF+GV +LVDVGGS GDCLRMI++KHP+I +GINFDLPEVV KAP IP 
Sbjct  177  PFMRAMLEGYDGFQGVEKLVDVGGSGGDCLRMILQKHPTIKEGINFDLPEVVAKAPQIPC  236

Query  366  ITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQT  545
            +THVGGDMFKSIP GDAIFMKW+LTTW DEECK IM SC+ AL +GGK+ ACEP+LP  +
Sbjct  237  VTHVGGDMFKSIPQGDAIFMKWVLTTWTDEECKHIMQSCHKALPEGGKLIACEPVLPEHS  296

Query  546  DYTHRTRLLLVGDMFVM  596
            D +HRTR LL GD+FVM
Sbjct  297  DESHRTRALLEGDIFVM  313



>ref|XP_010546519.1| PREDICTED: flavone 3'-O-methyltransferase 1 [Tarenaya hassleriana]
Length=354

 Score =   327 bits (837),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 149/198 (75%), Positives = 171/198 (86%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            +YVLQHHQ+ALM+AWPLVH AV D + EP+VKANGEPAY+ YGK  EMNGLML+AMSGVS
Sbjct  114  SYVLQHHQEALMRAWPLVHTAVEDPTREPYVKANGEPAYAQYGKSEEMNGLMLRAMSGVS  173

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            VPFM+A LDGY GF+ V  LVDVGGSAGDCLRMI+ K P++ QGINFDLPEVV KAP IP
Sbjct  174  VPFMRAILDGYDGFKSVEHLVDVGGSAGDCLRMILRKFPNVRQGINFDLPEVVSKAPPIP  233

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+THVGGDMFKSIP+GDAIFMKW+LTTW DEECK+IM +CY AL  GGK+ ACEP+LP +
Sbjct  234  GVTHVGGDMFKSIPSGDAIFMKWVLTTWTDEECKQIMRNCYNALPPGGKLIACEPVLPKE  293

Query  543  TDYTHRTRLLLVGDMFVM  596
            TD +HRTR LL GD+FVM
Sbjct  294  TDDSHRTRALLEGDIFVM  311



>ref|XP_007202084.1| hypothetical protein PRUPE_ppa007420mg [Prunus persica]
 gb|EMJ03283.1| hypothetical protein PRUPE_ppa007420mg [Prunus persica]
Length=368

 Score =   326 bits (836),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 149/197 (76%), Positives = 169/197 (86%), Gaps = 0/197 (0%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  185
            Y+LQHHQD LM AWP+VHEAVVD + EPFVK NGEPAY YYGKKPEMNGLM +AMSGVSV
Sbjct  129  YILQHHQDVLMGAWPMVHEAVVDPTIEPFVKVNGEPAYEYYGKKPEMNGLMQRAMSGVSV  188

Query  186  PFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPG  365
            PFMKA LDGY GFEGV RLVDVGGSAGDCLRMI++KHPS+ +GINFDLPEVV KAP I G
Sbjct  189  PFMKAILDGYDGFEGVGRLVDVGGSAGDCLRMILQKHPSVREGINFDLPEVVAKAPTIAG  248

Query  366  ITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQT  545
            ++HVGGDMFKSIP+GDAIFMKW+L+TW D ECK IM +CY AL  GGK+ ACEP+LP ++
Sbjct  249  VSHVGGDMFKSIPSGDAIFMKWVLSTWTDSECKLIMENCYKALPVGGKLIACEPVLPTKS  308

Query  546  DYTHRTRLLLVGDMFVM  596
            D + RTR LL  D+FVM
Sbjct  309  DDSPRTRALLENDIFVM  325



>gb|KJB62320.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=361

 Score =   326 bits (835),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 151/197 (77%), Positives = 174/197 (88%), Gaps = 1/197 (1%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  185
            YVLQHHQDALM+AWPLVHEAV++ +SEPFVKANGE AYSYYGKKPEMNGLM KAMSGVSV
Sbjct  123  YVLQHHQDALMRAWPLVHEAVLNPTSEPFVKANGEGAYSYYGKKPEMNGLMQKAMSGVSV  182

Query  186  PFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPG  365
            PFM+A LDGY G +GV RLVDVGGSAGDCLRMI++K+P + +GINFDLPEVV KAP+IPG
Sbjct  183  PFMRAILDGYDGLKGVKRLVDVGGSAGDCLRMILQKYPHV-EGINFDLPEVVAKAPSIPG  241

Query  366  ITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQT  545
            +THVGGDMF+SIP  DAIFMKW+LTTW D+ECK IM +CY AL  GGK+ ACEP+LP ++
Sbjct  242  VTHVGGDMFESIPAADAIFMKWVLTTWTDDECKAIMENCYKALPVGGKLIACEPVLPKES  301

Query  546  DYTHRTRLLLVGDMFVM  596
            D +HRTR LL GD+FVM
Sbjct  302  DDSHRTRALLEGDIFVM  318



>ref|XP_010098845.1| Caffeic acid 3-O-methyltransferase [Morus notabilis]
 gb|EXB75933.1| Caffeic acid 3-O-methyltransferase [Morus notabilis]
Length=359

 Score =   325 bits (833),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 171/197 (87%), Gaps = 0/197 (0%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  185
            YVLQHHQDALM+AW L+HEAVVD ++EPF KANGEPAY YYGK PEMNGLM +AMSGVSV
Sbjct  120  YVLQHHQDALMRAWSLLHEAVVDPTTEPFAKANGEPAYKYYGKMPEMNGLMQRAMSGVSV  179

Query  186  PFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPG  365
            PFMKA L+GY GFEGV RLVDVGGSAGDCLRMI++K+P++T+ INFDLPEVV +AP++PG
Sbjct  180  PFMKAILNGYDGFEGVRRLVDVGGSAGDCLRMILQKYPNVTEAINFDLPEVVARAPHVPG  239

Query  366  ITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQT  545
            +THVGGDMFK IP  DAIFMKW+LTTW D+EC+ IM SC  A+  GGK+ ACEP+LP +T
Sbjct  240  VTHVGGDMFKLIPEADAIFMKWILTTWTDDECQAIMESCCKAVPGGGKLIACEPVLPKET  299

Query  546  DYTHRTRLLLVGDMFVM  596
            D +HRTR LL GD+FVM
Sbjct  300  DDSHRTRALLSGDIFVM  316



>ref|XP_006291371.1| hypothetical protein CARUB_v10017511mg [Capsella rubella]
 gb|EOA24269.1| hypothetical protein CARUB_v10017511mg [Capsella rubella]
Length=359

 Score =   325 bits (833),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 171/198 (86%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            AY+LQHHQ+ALM+AWPLVH AVV+  +EP+VKANGE AY  YGK  EMN LMLKAMSGVS
Sbjct  119  AYILQHHQEALMRAWPLVHTAVVEPETEPYVKANGEAAYVQYGKSEEMNSLMLKAMSGVS  178

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            VPFMKA L+GY GF+ V RLVDVGGSAGDCLRMI++  P++ +GINFDLPEVV KAPNIP
Sbjct  179  VPFMKAILEGYEGFKSVERLVDVGGSAGDCLRMILQHFPNVREGINFDLPEVVAKAPNIP  238

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G++HVGGDMF+S+P+GDAIFMKW+LTTW DEECKEIM +CY AL  GGK+ ACEP+LP +
Sbjct  239  GVSHVGGDMFQSVPSGDAIFMKWVLTTWTDEECKEIMKNCYNALPVGGKLIACEPVLPKE  298

Query  543  TDYTHRTRLLLVGDMFVM  596
            TD +HRTR LL GD+FVM
Sbjct  299  TDDSHRTRALLEGDIFVM  316



>ref|XP_004304330.1| PREDICTED: caffeic acid 3-O-methyltransferase [Fragaria vesca 
subsp. vesca]
Length=358

 Score =   325 bits (832),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 170/197 (86%), Gaps = 0/197 (0%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  185
            YVLQHHQD LM AWPLVHEAV+D S EPFVKANGEPAY YYGK+PEMNGLM KAMSGVSV
Sbjct  119  YVLQHHQDVLMGAWPLVHEAVIDPSVEPFVKANGEPAYQYYGKRPEMNGLMQKAMSGVSV  178

Query  186  PFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPG  365
            PF+KA LDGY GF+GVTRLVDVGGSAGDCL+MIM+++P++ +GINFDLPEVV KAP I G
Sbjct  179  PFIKAVLDGYDGFQGVTRLVDVGGSAGDCLKMIMDRYPNVREGINFDLPEVVAKAPTIAG  238

Query  366  ITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQT  545
            +THVGGDMFKSIP+ D IFMKW+L+TW D ECK I+ +CY AL  GGK+ ACEP++P ++
Sbjct  239  VTHVGGDMFKSIPSADVIFMKWILSTWTDCECKLILENCYKALPAGGKLIACEPVVPRKS  298

Query  546  DYTHRTRLLLVGDMFVM  596
            D +HRTR LL  D+FVM
Sbjct  299  DDSHRTRALLENDIFVM  315



>gb|KCW89310.1| hypothetical protein EUGRSUZ_A01600 [Eucalyptus grandis]
Length=285

 Score =   322 bits (824),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 147/197 (75%), Positives = 170/197 (86%), Gaps = 0/197 (0%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  185
            YVLQHHQDALM+AWPLVHEAV+D ++EPFVKANG+ AY++YGK PEMN LM +AMSGVSV
Sbjct  46   YVLQHHQDALMRAWPLVHEAVLDPATEPFVKANGDTAYAHYGKNPEMNKLMQRAMSGVSV  105

Query  186  PFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPG  365
            PFMKA LDGY GF GV RLVDVGGSAGDCLRMIM KH  + +GINFDLPEVV KAP IPG
Sbjct  106  PFMKAILDGYDGFSGVGRLVDVGGSAGDCLRMIMGKHTHVREGINFDLPEVVAKAPPIPG  165

Query  366  ITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQT  545
            +THVGGDMFKSIP GDAIFM+W+LTTW D+ECK+I+ +C+ AL  GGK+ ACEP+LP  +
Sbjct  166  VTHVGGDMFKSIPAGDAIFMRWILTTWTDDECKQILENCFKALPAGGKLIACEPVLPQDS  225

Query  546  DYTHRTRLLLVGDMFVM  596
            D +HRTR LL GD+FVM
Sbjct  226  DDSHRTRALLEGDIFVM  242



>ref|XP_010050337.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Eucalyptus 
grandis]
Length=360

 Score =   324 bits (830),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 147/197 (75%), Positives = 170/197 (86%), Gaps = 0/197 (0%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  185
            YVLQHHQDALM+AWPLVHEAV+D ++EPFVKANG+ AY++YGK PEMN LM +AMSGVSV
Sbjct  121  YVLQHHQDALMRAWPLVHEAVLDPATEPFVKANGDTAYAHYGKNPEMNKLMQRAMSGVSV  180

Query  186  PFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPG  365
            PFMKA LDGY GF GV RLVDVGGSAGDCLRMIM KH  + +GINFDLPEVV KAP IPG
Sbjct  181  PFMKAILDGYDGFSGVGRLVDVGGSAGDCLRMIMGKHTHVREGINFDLPEVVAKAPPIPG  240

Query  366  ITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQT  545
            +THVGGDMFKSIP GDAIFM+W+LTTW D+ECK+I+ +C+ AL  GGK+ ACEP+LP  +
Sbjct  241  VTHVGGDMFKSIPAGDAIFMRWILTTWTDDECKQILENCFKALPAGGKLIACEPVLPQDS  300

Query  546  DYTHRTRLLLVGDMFVM  596
            D +HRTR LL GD+FVM
Sbjct  301  DDSHRTRALLEGDIFVM  317



>ref|XP_010504072.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Camelina 
sativa]
Length=385

 Score =   324 bits (831),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 171/198 (86%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            AYVLQHHQDALM+AWPLVH AVV+  +EP+VKANGE AY  YGK  EMN LMLKAMSGVS
Sbjct  145  AYVLQHHQDALMRAWPLVHTAVVEPETEPYVKANGEAAYVQYGKNEEMNDLMLKAMSGVS  204

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            VPFMKA L+GY GF+ V RLVDVGGSAG CLRMI+E+ P++ +GINFDLPEVV KAP+IP
Sbjct  205  VPFMKAILEGYDGFKSVERLVDVGGSAGVCLRMILEQFPNVREGINFDLPEVVAKAPSIP  264

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+THVGGDMF+SIP+GDAIFMKW+LTTW DEECK+IM +CY AL  GGK+ ACEP+LP +
Sbjct  265  GVTHVGGDMFQSIPSGDAIFMKWVLTTWTDEECKQIMKNCYNALPVGGKLIACEPVLPKE  324

Query  543  TDYTHRTRLLLVGDMFVM  596
            TD +HRTR LL GD+FVM
Sbjct  325  TDDSHRTRALLEGDIFVM  342



>ref|XP_010515802.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Camelina 
sativa]
Length=355

 Score =   323 bits (827),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 171/198 (86%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            AYVLQHHQDALM+AWPLVH AVV+  +EP+VKAN E AY  YGK  EMN LMLKAMSGVS
Sbjct  115  AYVLQHHQDALMRAWPLVHTAVVEPETEPYVKANSEAAYVQYGKNEEMNDLMLKAMSGVS  174

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            VPFMKA L+GY GF+ V +L+DVGGSAGDCLRMI+E+ P++ +GINFDLPEVV KAP+IP
Sbjct  175  VPFMKAILEGYDGFKSVEQLIDVGGSAGDCLRMILEQFPNVREGINFDLPEVVAKAPSIP  234

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+THVGGDMF+SIP+GDAIFMKW+LTTW DEECK+IM +CY AL  GGK+ ACEP+LP +
Sbjct  235  GVTHVGGDMFQSIPSGDAIFMKWVLTTWTDEECKQIMKNCYNALPVGGKLIACEPVLPKE  294

Query  543  TDYTHRTRLLLVGDMFVM  596
            TD +HRTR LL GD+FVM
Sbjct  295  TDDSHRTRALLEGDIFVM  312



>ref|NP_190882.1| putative O-diphenol-O-methyl transferase [Arabidopsis thaliana]
 gb|AAK56277.1|AF367289_1 AT3g53140/T4D2_70 [Arabidopsis thaliana]
 emb|CAB64217.1| caffeic acid O-methyltransferase-like protein [Arabidopsis thaliana]
 gb|AAM91448.1| AT3g53140/T4D2_70 [Arabidopsis thaliana]
 gb|AEE79041.1| putative O-diphenol-O-methyl transferase [Arabidopsis thaliana]
Length=359

 Score =   323 bits (827),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 171/198 (86%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            AYVLQHHQ+ALM+AWPLVH AVV+  +EP+VKANGE AY+ YGK  EMNGLM KAMSGVS
Sbjct  119  AYVLQHHQEALMRAWPLVHTAVVEPETEPYVKANGEAAYAQYGKSEEMNGLMQKAMSGVS  178

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            VPFMKA LDGY GF+ V  LVDVGGSAGDCLRMI+++ P++ +GINFDLPEVV KAPNIP
Sbjct  179  VPFMKAILDGYDGFKSVDILVDVGGSAGDCLRMILQQFPNVREGINFDLPEVVAKAPNIP  238

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+THVGGDMF+S+P+ DAIFMKW+LTTW DEECK+IM +CY AL  GGK+ ACEP+LP +
Sbjct  239  GVTHVGGDMFQSVPSADAIFMKWVLTTWTDEECKQIMKNCYNALPVGGKLIACEPVLPKE  298

Query  543  TDYTHRTRLLLVGDMFVM  596
            TD +HRTR LL GD+FVM
Sbjct  299  TDESHRTRALLEGDIFVM  316



>ref|XP_007027514.1| O-methyltransferase family protein [Theobroma cacao]
 gb|EOY08016.1| O-methyltransferase family protein [Theobroma cacao]
Length=356

 Score =   322 bits (826),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 169/197 (86%), Gaps = 0/197 (0%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  185
            YVLQHHQDALM+ WPL+HEAV+D +SEPFVK NGE AYSYYGKKPEMNGLM KAMSGVSV
Sbjct  117  YVLQHHQDALMRVWPLMHEAVLDPTSEPFVKVNGEAAYSYYGKKPEMNGLMQKAMSGVSV  176

Query  186  PFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPG  365
            PFM+A L+ Y GF+GV RLVDVGGS G+CLRMI++KHP + +GINFDLPEVV KAP IPG
Sbjct  177  PFMRAILNSYDGFKGVKRLVDVGGSVGECLRMILQKHPHVEEGINFDLPEVVAKAPTIPG  236

Query  366  ITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQT  545
            ++HVGGDMFKSIP+GD IFMKW+L TW D+ECK IM +CY AL  GGK+ ACEP+LP  +
Sbjct  237  VSHVGGDMFKSIPSGDGIFMKWVLVTWTDDECKLIMENCYKALPVGGKLIACEPVLPKDS  296

Query  546  DYTHRTRLLLVGDMFVM  596
            D +HRTR LL GD+FVM
Sbjct  297  DDSHRTRALLEGDIFVM  313



>ref|XP_006594704.1| PREDICTED: caffeic acid 3-O-methyltransferase-like isoform X1 
[Glycine max]
Length=355

 Score =   322 bits (826),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 169/197 (86%), Gaps = 0/197 (0%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  185
            YVLQHHQDALM+AWP+VHEAVVD + EPF +ANGEPAY YY K PEMN LM++AMSGVSV
Sbjct  116  YVLQHHQDALMRAWPMVHEAVVDPTKEPFERANGEPAYGYYLKHPEMNDLMVRAMSGVSV  175

Query  186  PFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPG  365
            PF++A L+GY GF+GV +LVDVGGS GDCLRMI+EKHP+I +GINFDLPEVV KAP IP 
Sbjct  176  PFIRAMLEGYDGFQGVEKLVDVGGSGGDCLRMILEKHPTIKEGINFDLPEVVAKAPQIPF  235

Query  366  ITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQT  545
            +THVGGDMFK IP GDAIFMKW+LTTW DEECK IM +C+ AL +GGK+ ACEP+LP  +
Sbjct  236  VTHVGGDMFKFIPQGDAIFMKWVLTTWTDEECKHIMQNCHKALPEGGKLIACEPVLPEDS  295

Query  546  DYTHRTRLLLVGDMFVM  596
            D +HRTR LL GD+FVM
Sbjct  296  DESHRTRALLEGDIFVM  312



>ref|XP_010426946.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Camelina 
sativa]
Length=356

 Score =   322 bits (825),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 169/198 (85%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            AYVLQHHQDALM+AWPLVH AVV+  +EP+VKANGE AY  YGK  EMNGLMLKAMSGVS
Sbjct  116  AYVLQHHQDALMRAWPLVHTAVVEPETEPYVKANGEGAYVQYGKNEEMNGLMLKAMSGVS  175

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            VPFMKA LDGY GF+ V RLVDVGGSAGDCLRMI+E+ P++ +GINFDL EVV KAP IP
Sbjct  176  VPFMKAILDGYDGFKSVERLVDVGGSAGDCLRMILEQFPNVREGINFDLHEVVAKAPTIP  235

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF+SIP G+AIFMKW+LTTW DEECK+IM +CY AL  GGK+ ACEP+LP +
Sbjct  236  GVIHVGGDMFQSIPTGEAIFMKWVLTTWTDEECKQIMKNCYNALPVGGKLIACEPVLPKE  295

Query  543  TDYTHRTRLLLVGDMFVM  596
            TD +HRTR LL GD+FVM
Sbjct  296  TDDSHRTRALLEGDIFVM  313



>ref|XP_011101458.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Sesamum indicum]
Length=354

 Score =   322 bits (825),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 170/198 (86%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            AYVLQHHQDALM+AW LVHEAV+D SSEPFVKANGE AYSYYGKKPEMN LMLKAMSGVS
Sbjct  113  AYVLQHHQDALMRAWTLVHEAVLDPSSEPFVKANGEGAYSYYGKKPEMNELMLKAMSGVS  172

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            VPFMKAFL+ Y GF+GV  LVDVGGSAGDCLRMIM K+PSI +G+NFDLPEVV+KAP IP
Sbjct  173  VPFMKAFLNSYDGFQGVGTLVDVGGSAGDCLRMIMSKNPSIKKGVNFDLPEVVEKAPKIP  232

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGD+ K+IP+   IFMKW+LTTW D+ECK I+ +C+ AL  GGK+ ACEP+LP  
Sbjct  233  GVEHVGGDLLKTIPSAVDIFMKWILTTWTDDECKHILKNCHDALPPGGKVVACEPVLPNH  292

Query  543  TDYTHRTRLLLVGDMFVM  596
            TD +HR+R LL GD+FVM
Sbjct  293  TDNSHRSRALLEGDIFVM  310



>gb|KHG05883.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=361

 Score =   321 bits (823),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 149/197 (76%), Positives = 173/197 (88%), Gaps = 1/197 (1%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  185
            YVLQHHQDALM+AWPLVHEAV++ +SEPFVKANGE AYSYYGKKPEMNGLM KAMSGVSV
Sbjct  123  YVLQHHQDALMRAWPLVHEAVLNPTSEPFVKANGEGAYSYYGKKPEMNGLMQKAMSGVSV  182

Query  186  PFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPG  365
            PFM+A LDGY G +GV RLVDVGGSAGDCLRMI++K+P + +GINFDLPEVV KAP+IPG
Sbjct  183  PFMRAILDGYDGLKGVKRLVDVGGSAGDCLRMILQKYPHV-EGINFDLPEVVAKAPSIPG  241

Query  366  ITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQT  545
            +T+VGGDM +SIP  DAIFMKW+LTTW D+ECK IM +CY AL  GGK+ ACEP+LP ++
Sbjct  242  VTYVGGDMLESIPVADAIFMKWVLTTWTDDECKAIMENCYKALPVGGKLIACEPVLPKES  301

Query  546  DYTHRTRLLLVGDMFVM  596
            D +HRTR LL GD+FVM
Sbjct  302  DDSHRTRALLEGDIFVM  318



>emb|CDX95399.1| BnaC04g27590D [Brassica napus]
Length=359

 Score =   319 bits (817),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 171/198 (86%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            AYVLQHHQ+ALM+AWPLVH AVV+  +EP+VKANGE AY+ YGK  EMNGLM KAMSGVS
Sbjct  119  AYVLQHHQEALMRAWPLVHTAVVEPETEPYVKANGEAAYAQYGKCEEMNGLMQKAMSGVS  178

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            VPFMKA LDGY GF+ V  LVDVGGSAGDCLRMI+++ P++ QGINFDLPEVV KAP IP
Sbjct  179  VPFMKAILDGYDGFKYVEHLVDVGGSAGDCLRMIIKQFPNVRQGINFDLPEVVAKAPKIP  238

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+TH+GGDMF+S+P+GDAIFMKW+LTTW DEECK+IM +CY AL  GGK+ ACEP+LP +
Sbjct  239  GVTHMGGDMFQSVPSGDAIFMKWVLTTWTDEECKQIMKNCYKALPVGGKLVACEPVLPKE  298

Query  543  TDYTHRTRLLLVGDMFVM  596
            TD +HRTR LL GD+FVM
Sbjct  299  TDDSHRTRALLEGDIFVM  316



>ref|XP_009139429.1| PREDICTED: caffeic acid 3-O-methyltransferase [Brassica rapa]
Length=359

 Score =   319 bits (817),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 171/198 (86%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            AYVLQHHQ+ALM+AWPLVH AVV+  +EP+VKANGE AY+ YGK  EMNGLM KAMSGVS
Sbjct  119  AYVLQHHQEALMRAWPLVHTAVVEPETEPYVKANGEAAYAQYGKCEEMNGLMQKAMSGVS  178

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            VPFMKA LDGY GF+ V  LVDVGGSAGDCLRMI+++ P++ QGINFDLPEVV KAP IP
Sbjct  179  VPFMKAILDGYDGFKYVEHLVDVGGSAGDCLRMIIKQFPNVRQGINFDLPEVVAKAPKIP  238

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+TH+GGDMF+S+P+GDAIFMKW+LTTW DEECK+IM +CY AL  GGK+ ACEP+LP +
Sbjct  239  GVTHMGGDMFQSVPSGDAIFMKWVLTTWTDEECKQIMKNCYKALPVGGKLVACEPVLPQE  298

Query  543  TDYTHRTRLLLVGDMFVM  596
            TD +HRTR LL GD+FVM
Sbjct  299  TDDSHRTRALLEGDIFVM  316



>ref|XP_008442758.1| PREDICTED: caffeic acid 3-O-methyltransferase [Cucumis melo]
Length=371

 Score =   319 bits (818),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 142/197 (72%), Positives = 170/197 (86%), Gaps = 0/197 (0%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  185
            YVLQHHQDALM+AWP VHEA +DS++EPFV+ANGEPAYSYYGKK EMN LM +AM+GVSV
Sbjct  132  YVLQHHQDALMRAWPRVHEAAIDSTTEPFVRANGEPAYSYYGKKTEMNELMQRAMAGVSV  191

Query  186  PFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPG  365
            PFMKA LDGY GF+GV +LVDVGGSAGDCLRMI++K+PSI +GINFDLPEVV +AP IPG
Sbjct  192  PFMKAVLDGYDGFKGVEKLVDVGGSAGDCLRMILQKYPSIKEGINFDLPEVVARAPPIPG  251

Query  366  ITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQT  545
            ++HVGGDMFKSIP  DA+FMKW+L+TW D+ECK I+ +C  +L  GGK+ ACEP LP +T
Sbjct  252  VSHVGGDMFKSIPTADAMFMKWVLSTWTDDECKIILENCCKSLPVGGKLIACEPTLPEKT  311

Query  546  DYTHRTRLLLVGDMFVM  596
            D +HRTR LL  D+F+M
Sbjct  312  DESHRTRALLASDVFIM  328



>gb|KGN59032.1| hypothetical protein Csa_3G747630 [Cucumis sativus]
Length=370

 Score =   318 bits (816),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 142/197 (72%), Positives = 169/197 (86%), Gaps = 0/197 (0%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  185
            YVLQHHQDALM+AWP VHEA +DS++EPFV+ANGE AYSYYGKK EMN LM +AM+GVSV
Sbjct  131  YVLQHHQDALMRAWPRVHEAAIDSTTEPFVRANGEAAYSYYGKKTEMNELMQRAMAGVSV  190

Query  186  PFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPG  365
            PFMKA LDGY GF+GV +LVDVGGSAGDCLRMI++K+P I +GINFDLPEVV +AP IPG
Sbjct  191  PFMKAVLDGYDGFKGVEKLVDVGGSAGDCLRMILQKYPHIKEGINFDLPEVVARAPTIPG  250

Query  366  ITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQT  545
            ++HVGGDMFKSIP GDAIFMKW+L+TW D+ECK I+ +C  +L  GGK+ ACEP LP +T
Sbjct  251  VSHVGGDMFKSIPTGDAIFMKWVLSTWTDDECKIILENCCKSLPVGGKLIACEPTLPEKT  310

Query  546  DYTHRTRLLLVGDMFVM  596
            D +HRTR LL  D+F+M
Sbjct  311  DESHRTRALLASDVFIM  327



>ref|XP_006403721.1| hypothetical protein EUTSA_v10010488mg [Eutrema salsugineum]
 gb|ESQ45174.1| hypothetical protein EUTSA_v10010488mg [Eutrema salsugineum]
Length=361

 Score =   318 bits (814),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 169/198 (85%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            AYVLQHHQ+ALM+AWPLVH AV++  +EP+VKANGE AYS YGK  EMNGLM KAMSGVS
Sbjct  121  AYVLQHHQEALMRAWPLVHTAVMEPETEPYVKANGEAAYSQYGKCEEMNGLMQKAMSGVS  180

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
             PFMKA LDGY GF+ V  LVDVGGSAGDCLRMI+E+ P++ +GINFDL EVV KAP IP
Sbjct  181  APFMKAILDGYDGFKSVEHLVDVGGSAGDCLRMIIEQFPNVRRGINFDLLEVVAKAPKIP  240

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+TH+GGDMF+S+P+GDAIFMKW+LTTW DEECK+IM +CY AL  GGK+ ACEP+LP +
Sbjct  241  GVTHIGGDMFQSVPSGDAIFMKWVLTTWTDEECKQIMKNCYNALPAGGKLIACEPVLPKE  300

Query  543  TDYTHRTRLLLVGDMFVM  596
            TD +HRTR LL GD+FVM
Sbjct  301  TDDSHRTRALLEGDIFVM  318



>gb|KEH38506.1| caffeic acid O-methyltransferase [Medicago truncatula]
Length=354

 Score =   317 bits (811),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 164/198 (83%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            AYVLQHHQDALM+AWPLVHEAV+D S EPF +ANGE AY YY KKPEMN LMLKAM+GVS
Sbjct  114  AYVLQHHQDALMRAWPLVHEAVLDPSKEPFERANGEGAYDYYLKKPEMNELMLKAMAGVS  173

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            VPFMKA  + YHGF+ V +LVDVGGS GDCLRMI++K+P+I QG NFDLPEVV KAP IP
Sbjct  174  VPFMKALFESYHGFQNVEKLVDVGGSGGDCLRMILQKYPNIKQGFNFDLPEVVAKAPQIP  233

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+THVGGDMFK IP  DAIFMKW+LTTW DEE K IM +CY AL  GGK+ ACEP+LP  
Sbjct  234  GVTHVGGDMFKYIPQADAIFMKWVLTTWTDEEIKHIMLNCYKALPAGGKLIACEPVLPET  293

Query  543  TDYTHRTRLLLVGDMFVM  596
            +D +HRTR  L GD+FVM
Sbjct  294  SDDSHRTRASLAGDIFVM  311



>ref|XP_010312333.1| PREDICTED: caffeic acid 3-O-methyltransferase 1 [Solanum lycopersicum]
Length=361

 Score =   316 bits (810),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 149/198 (75%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            +YVLQHHQDALMKAW +VHEAV DSS EPF KANGEPAYSYYGK  EMN LML AMSGVS
Sbjct  120  SYVLQHHQDALMKAWTMVHEAVNDSSIEPFAKANGEPAYSYYGKNSEMNSLMLNAMSGVS  179

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            VPFMKA L GY GF+GV  LVDVGGS GDCL+MI+EKH  I  GINFDLPEVV+KAP IP
Sbjct  180  VPFMKAILQGYDGFQGVKTLVDVGGSGGDCLKMILEKHTDIELGINFDLPEVVEKAPQIP  239

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
             I HVGGDMF  IP GDAIFMKW+LTTW D+ECKEIM SCY AL + GK  ACEP+LP  
Sbjct  240  SIKHVGGDMFDYIPKGDAIFMKWVLTTWTDDECKEIMKSCYNALPEKGKFIACEPVLPHH  299

Query  543  TDYTHRTRLLLVGDMFVM  596
            TD + RTR LL GD+FVM
Sbjct  300  TDDSKRTRALLEGDIFVM  317



>ref|XP_004488687.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cicer arietinum]
Length=353

 Score =   315 bits (808),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 165/198 (83%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            +YVLQHHQDALM+AWPLVHEAVVD S EPF +ANGE AY YY KKPEMN LMLKAMSGVS
Sbjct  113  SYVLQHHQDALMRAWPLVHEAVVDPSKEPFERANGEAAYDYYLKKPEMNELMLKAMSGVS  172

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            VPFMKA L  Y+GF+GV +LVDVGGS GDCLRMI+ K+PSI + INFDLP+VV KAP IP
Sbjct  173  VPFMKALLASYNGFQGVEKLVDVGGSGGDCLRMILHKYPSIKEAINFDLPQVVAKAPQIP  232

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+THVGGDMFK +P GDAIFMKW+L TW D+E K IM +CY AL  GGK+ ACEP+LP  
Sbjct  233  GVTHVGGDMFKYVPQGDAIFMKWVLITWTDKEIKHIMQNCYKALPAGGKLIACEPVLPED  292

Query  543  TDYTHRTRLLLVGDMFVM  596
            +D +HRTR LL GD+FVM
Sbjct  293  SDDSHRTRALLQGDIFVM  310



>ref|XP_006391885.1| hypothetical protein EUTSA_v10023542mg [Eutrema salsugineum]
 gb|ESQ29171.1| hypothetical protein EUTSA_v10023542mg [Eutrema salsugineum]
Length=363

 Score =   315 bits (808),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 169/198 (85%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            AYVLQHHQ++LM+AWPLVH AVV+  +EP+VKANGE AY  YGK  EMNGLM KAMSGVS
Sbjct  123  AYVLQHHQESLMRAWPLVHTAVVEPETEPYVKANGEAAYVQYGKCEEMNGLMQKAMSGVS  182

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            VPFMKA LDGY GF+ V  LVDVGGSAGDCLRMI+++ P++ +GINFDLPEVV KAP IP
Sbjct  183  VPFMKAILDGYDGFKSVEHLVDVGGSAGDCLRMILKQFPNVREGINFDLPEVVAKAPKIP  242

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+THVGGDMF S+P+GDAIFMKW+LTTW DEECK+IM +CY AL  GGK+ ACEP+LP +
Sbjct  243  GVTHVGGDMFLSVPSGDAIFMKWVLTTWTDEECKQIMKNCYNALPVGGKLIACEPVLPKE  302

Query  543  TDYTHRTRLLLVGDMFVM  596
            TD +HRTR LL G++FVM
Sbjct  303  TDDSHRTRALLEGNIFVM  320



>ref|XP_009617330.1| PREDICTED: flavone 3'-O-methyltransferase 1 [Nicotiana tomentosiformis]
Length=366

 Score =   315 bits (807),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 164/198 (83%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            +YVLQHHQDALM AW +V EAV DSS+EPF KANGEPAY+YYGK+PEMN LML AMSGVS
Sbjct  125  SYVLQHHQDALMSAWTMVDEAVNDSSTEPFAKANGEPAYNYYGKRPEMNNLMLNAMSGVS  184

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            VPFMKA L+ Y GF+GV  LVDVGGS GDCL+MI+EKH SI  GINFDLPEVV KAP IP
Sbjct  185  VPFMKAILESYEGFQGVKILVDVGGSGGDCLKMILEKHQSIQLGINFDLPEVVGKAPKIP  244

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
             I H+GGDMFK +P GDAIFMKW+LTTW D+ECK+IM SCY AL + GK+ ACEP+LP  
Sbjct  245  RINHIGGDMFKYVPKGDAIFMKWVLTTWTDDECKQIMKSCYNALPEKGKLIACEPVLPHH  304

Query  543  TDYTHRTRLLLVGDMFVM  596
            TD + RTR LL GD+FVM
Sbjct  305  TDDSKRTRALLEGDIFVM  322



>gb|KDO39806.1| hypothetical protein CISIN_1g025363mg [Citrus sinensis]
Length=254

 Score =   310 bits (795),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 142/197 (72%), Positives = 168/197 (85%), Gaps = 0/197 (0%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  185
            YVLQHHQDALM  WPLVH+A++D + EPF+K +GEPAYSYYGK PEMNGLM KAMSGVSV
Sbjct  23   YVLQHHQDALMSMWPLVHKAILDPTIEPFLKVHGEPAYSYYGKIPEMNGLMRKAMSGVSV  82

Query  186  PFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPG  365
            PFM + L+GY+GF+GV RLVDVGGSAGDCLRMI++KH  I +GINFDLPEVV +AP+IPG
Sbjct  83   PFMTSVLEGYNGFKGVKRLVDVGGSAGDCLRMILQKHRFICEGINFDLPEVVAEAPSIPG  142

Query  366  ITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQT  545
            +TH+GGDMFKSIP  DAIFMKW+LTTW D+ECK IM +CY AL  GGK+ ACEP+LP  +
Sbjct  143  VTHIGGDMFKSIPAADAIFMKWVLTTWTDDECKLIMENCYKALPAGGKLIACEPVLPDDS  202

Query  546  DYTHRTRLLLVGDMFVM  596
            + + RTR LL GD+FVM
Sbjct  203  NESQRTRALLEGDIFVM  219



>ref|XP_006367254.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Solanum tuberosum]
Length=361

 Score =   314 bits (805),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 147/198 (74%), Positives = 164/198 (83%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            +YVLQHHQDALM+AW +VHEAV DSS EPFVKANGEPAY+YYGK  EMN LML AMSGVS
Sbjct  120  SYVLQHHQDALMRAWTMVHEAVNDSSIEPFVKANGEPAYNYYGKNSEMNSLMLNAMSGVS  179

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            VPFMKA L+GY GF+GV  LVDVGGS GDCL+MI++KH +I  GINFDLPEVV+KAP IP
Sbjct  180  VPFMKAILEGYDGFQGVKTLVDVGGSGGDCLKMILDKHTNIELGINFDLPEVVEKAPQIP  239

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
             I HVGGDMF  IP GDAIFMKW+LTTW D+ECKEIM SCY AL + GK  ACEP+LP  
Sbjct  240  SIKHVGGDMFDYIPKGDAIFMKWVLTTWTDDECKEIMKSCYIALPEKGKFIACEPVLPHH  299

Query  543  TDYTHRTRLLLVGDMFVM  596
            TD + RTR LL GD+FVM
Sbjct  300  TDDSKRTRALLEGDIFVM  317



>ref|XP_006485837.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Citrus sinensis]
Length=337

 Score =   313 bits (801),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 142/197 (72%), Positives = 168/197 (85%), Gaps = 0/197 (0%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  185
            YVLQHHQDALM  WPLVH+A++D + EPF+K +GEPAYSYYGK PEMNGLM KAMSGVSV
Sbjct  86   YVLQHHQDALMSMWPLVHKAILDPTIEPFLKVHGEPAYSYYGKIPEMNGLMRKAMSGVSV  145

Query  186  PFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPG  365
            PFM + L+GY+GF+GV RLVDVGGSAGDCLRMI++KH  I +GINFDLPEVV +AP+IPG
Sbjct  146  PFMTSVLEGYNGFKGVKRLVDVGGSAGDCLRMILQKHRFICEGINFDLPEVVAEAPSIPG  205

Query  366  ITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQT  545
            +TH+GGDMFKSIP  DAIFMKW+LTTW D+ECK IM +CY AL  GGK+ ACEP+LP  +
Sbjct  206  VTHIGGDMFKSIPAADAIFMKWVLTTWTDDECKLIMENCYKALPAGGKLIACEPVLPDDS  265

Query  546  DYTHRTRLLLVGDMFVM  596
            + + RTR LL GD+FVM
Sbjct  266  NESQRTRALLEGDIFVM  282



>gb|KFK34550.1| hypothetical protein AALP_AA5G160800 [Arabis alpina]
Length=360

 Score =   313 bits (803),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 143/198 (72%), Positives = 168/198 (85%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            AYVLQHHQ+ALM+AWPLVH AVV   +EP++KANGE AY+ YGK  EMN LM KAMSGVS
Sbjct  120  AYVLQHHQEALMRAWPLVHTAVVQPETEPYMKANGETAYAQYGKCEEMNCLMQKAMSGVS  179

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            VPFMKA LDGY GF+ V  LVDVGGSAGDCLRMI+E+ P++ +GINFDLPEVV KAP IP
Sbjct  180  VPFMKAILDGYDGFKSVDHLVDVGGSAGDCLRMILEQFPNVREGINFDLPEVVAKAPKIP  239

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ H+GGDMF+S+P+GDAIFMKW+LTTW DEECK+IM +CY AL  GGK+ ACEP+LP +
Sbjct  240  GVIHMGGDMFQSVPSGDAIFMKWVLTTWTDEECKQIMKNCYNALPVGGKLIACEPVLPKE  299

Query  543  TDYTHRTRLLLVGDMFVM  596
            TD +HRTR LL GD+FVM
Sbjct  300  TDDSHRTRALLEGDIFVM  317



>ref|XP_006436414.1| hypothetical protein CICLE_v10033543mg [Citrus clementina]
 gb|ESR49654.1| hypothetical protein CICLE_v10033543mg [Citrus clementina]
Length=317

 Score =   311 bits (797),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 142/197 (72%), Positives = 168/197 (85%), Gaps = 0/197 (0%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  185
            YVLQHHQDALM  WPLVH+A++D + EPF+K +GEPAYSYYGK PEMNGLM KAMSGVSV
Sbjct  86   YVLQHHQDALMSMWPLVHKAILDPTIEPFLKVHGEPAYSYYGKIPEMNGLMRKAMSGVSV  145

Query  186  PFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPG  365
            PFM + L+GY+GF+GV RLVDVGGSAGDCLRMI++KH  I +GINFDLPEVV +AP+IPG
Sbjct  146  PFMTSVLEGYNGFKGVKRLVDVGGSAGDCLRMILQKHRFICEGINFDLPEVVAEAPSIPG  205

Query  366  ITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQT  545
            +TH+GGDMFKSIP  DAIFMKW+LTTW D+ECK IM +CY AL  GGK+ ACEP+LP  +
Sbjct  206  VTHIGGDMFKSIPAADAIFMKWVLTTWTDDECKLIMENCYKALPAGGKLIACEPVLPDDS  265

Query  546  DYTHRTRLLLVGDMFVM  596
            + + RTR LL GD+FVM
Sbjct  266  NESQRTRALLEGDIFVM  282



>ref|XP_007149437.1| hypothetical protein PHAVU_005G070300g [Phaseolus vulgaris]
 gb|ESW21431.1| hypothetical protein PHAVU_005G070300g [Phaseolus vulgaris]
Length=354

 Score =   312 bits (799),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 168/198 (85%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            AYVLQHHQDALM+AW LVHEAVVD + EPF +ANGE AY+YY K+ EMN LM+KAMSGVS
Sbjct  114  AYVLQHHQDALMRAWTLVHEAVVDPTKEPFERANGEGAYAYYLKQAEMNELMVKAMSGVS  173

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            VPFM+A L+GY GF+GV RLVDVGGS GDCLRMI+ K+P+I +GINFDLPEVV KAP  P
Sbjct  174  VPFMRAMLEGYDGFQGVERLVDVGGSGGDCLRMILLKYPNIKEGINFDLPEVVAKAPPTP  233

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
             +THVGGDMFKSIP GDAIFMKW+LTTW DEE K+IM +C+ AL +GGK+ ACEP+LP  
Sbjct  234  CVTHVGGDMFKSIPQGDAIFMKWVLTTWTDEEIKQIMQNCHKALPEGGKLIACEPVLPEH  293

Query  543  TDYTHRTRLLLVGDMFVM  596
            +D +HRTR LL GD+FVM
Sbjct  294  SDESHRTRALLEGDIFVM  311



>ref|XP_004137858.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cucumis sativus]
 ref|XP_004169388.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cucumis sativus]
Length=409

 Score =   314 bits (804),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 142/199 (71%), Positives = 169/199 (85%), Gaps = 2/199 (1%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  185
            YVLQHHQDALM+AWP VHEA +DS++EPFV+ANGE AYSYYGKK EMN LM +AM+GVSV
Sbjct  168  YVLQHHQDALMRAWPRVHEAAIDSTTEPFVRANGEAAYSYYGKKTEMNELMQRAMAGVSV  227

Query  186  PFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP-  362
            PFMKA LDGY GF+GV +LVDVGGSAGDCLRMI++K+P I +GINFDLPEVV +AP IP 
Sbjct  228  PFMKAVLDGYDGFKGVEKLVDVGGSAGDCLRMILQKYPHIKEGINFDLPEVVARAPTIPE  287

Query  363  -GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPI  539
             G++HVGGDMFKSIP GDAIFMKW+L+TW D+ECK I+ +C  +L  GGK+ ACEP LP 
Sbjct  288  TGVSHVGGDMFKSIPTGDAIFMKWVLSTWTDDECKIILENCCKSLPVGGKLIACEPTLPE  347

Query  540  QTDYTHRTRLLLVGDMFVM  596
            +TD +HRTR LL  D+F+M
Sbjct  348  KTDESHRTRALLASDVFIM  366



>gb|KCW89309.1| hypothetical protein EUGRSUZ_A01600 [Eucalyptus grandis]
Length=345

 Score =   308 bits (790),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 163/190 (86%), Gaps = 0/190 (0%)
 Frame = +3

Query  27   DALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFL  206
            DALM+AWPLVHEAV+D ++EPFVKANG+ AY++YGK PEMN LM +AMSGVSVPFMKA L
Sbjct  113  DALMRAWPLVHEAVLDPATEPFVKANGDTAYAHYGKNPEMNKLMQRAMSGVSVPFMKAIL  172

Query  207  DGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGD  386
            DGY GF GV RLVDVGGSAGDCLRMIM KH  + +GINFDLPEVV KAP IPG+THVGGD
Sbjct  173  DGYDGFSGVGRLVDVGGSAGDCLRMIMGKHTHVREGINFDLPEVVAKAPPIPGVTHVGGD  232

Query  387  MFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDYTHRTR  566
            MFKSIP GDAIFM+W+LTTW D+ECK+I+ +C+ AL  GGK+ ACEP+LP  +D +HRTR
Sbjct  233  MFKSIPAGDAIFMRWILTTWTDDECKQILENCFKALPAGGKLIACEPVLPQDSDDSHRTR  292

Query  567  LLLVGDMFVM  596
             LL GD+FVM
Sbjct  293  ALLEGDIFVM  302



>ref|XP_006451708.1| hypothetical protein CICLE_v10010561mg, partial [Citrus clementina]
 gb|ESR64948.1| hypothetical protein CICLE_v10010561mg, partial [Citrus clementina]
Length=305

 Score =   306 bits (785),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 166/197 (84%), Gaps = 0/197 (0%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  185
            YVLQHHQDALM  WPLVHEAV+D + EP VK +G+PAYSYYGK PEMNGLM KAMSGVSV
Sbjct  74   YVLQHHQDALMSMWPLVHEAVLDPTIEPLVKVHGKPAYSYYGKMPEMNGLMRKAMSGVSV  133

Query  186  PFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPG  365
            PFM + LDGY+GF+GV RLV+VGGSAGDCLRMI++KH  I +G+NFDLPEVV +AP+IPG
Sbjct  134  PFMTSVLDGYNGFKGVKRLVEVGGSAGDCLRMILQKHRFICEGMNFDLPEVVGEAPSIPG  193

Query  366  ITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQT  545
            +TH+GGDMFKSIP  DAIFMKW+LTTW D+ECK IM +CY AL  GGK+ ACEP+LP  +
Sbjct  194  VTHIGGDMFKSIPATDAIFMKWVLTTWTDDECKLIMENCYKALPTGGKLIACEPVLPDDS  253

Query  546  DYTHRTRLLLVGDMFVM  596
            + + RTR LL GD+F M
Sbjct  254  NESQRTRALLEGDIFFM  270



>ref|XP_006423903.1| hypothetical protein CICLE_v10029876mg [Citrus clementina]
 gb|ESR37143.1| hypothetical protein CICLE_v10029876mg [Citrus clementina]
Length=294

 Score =   303 bits (776),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 164/197 (83%), Gaps = 0/197 (0%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  185
            YVLQHHQDA M AWPLVHEAV+D + EPFVK +GEPAYSYYGK PEMNGLM +A+SGVSV
Sbjct  86   YVLQHHQDAFMSAWPLVHEAVLDPTIEPFVKVHGEPAYSYYGKMPEMNGLMRRAISGVSV  145

Query  186  PFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPG  365
            PFM + LD Y+GF+GV RLVDVGGSAGDCLRMI++KH  I +GINFDLPEVV +AP+IPG
Sbjct  146  PFMTSVLDSYNGFKGVKRLVDVGGSAGDCLRMILQKHHFICEGINFDLPEVVGEAPSIPG  205

Query  366  ITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQT  545
            +TH+GGDMF SIP  +AIFMKW+L TW D+ECK IM +CY AL  GGK+ ACEP+L   +
Sbjct  206  VTHIGGDMFNSIPAANAIFMKWVLATWTDDECKLIMENCYKALLAGGKLIACEPVLLDDS  265

Query  546  DYTHRTRLLLVGDMFVM  596
            + + RTR LL GD+FVM
Sbjct  266  NESQRTRALLEGDIFVM  282



>gb|KDO41959.1| hypothetical protein CISIN_1g021707mg [Citrus sinensis]
Length=309

 Score =   303 bits (776),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 164/197 (83%), Gaps = 0/197 (0%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  185
            YVLQHHQDA M AWPLVHEAV+D + EPFVK +GEPAYSYYGK PEMNGLM +A+SGVSV
Sbjct  86   YVLQHHQDAFMSAWPLVHEAVLDPTIEPFVKVHGEPAYSYYGKMPEMNGLMRRAISGVSV  145

Query  186  PFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPG  365
            PFM + LD Y+GF+GV RLVDVGGSAGDCLRMI++KH  I +GINFDLPEVV +AP+IPG
Sbjct  146  PFMTSVLDSYNGFKGVKRLVDVGGSAGDCLRMILQKHHFICEGINFDLPEVVGEAPSIPG  205

Query  366  ITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQT  545
            +TH+GGDMF SIP  +AIFMKW+L TW D+ECK IM +CY AL  GGK+ ACEP+L   +
Sbjct  206  VTHIGGDMFNSIPAANAIFMKWVLATWTDDECKLIMENCYKALLAGGKLIACEPVLLDDS  265

Query  546  DYTHRTRLLLVGDMFVM  596
            + + RTR LL GD+FVM
Sbjct  266  NESQRTRALLEGDIFVM  282



>emb|CDY70033.1| BnaCnng66420D [Brassica napus]
Length=230

 Score =   295 bits (754),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = +3

Query  36   MKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGY  215
            M+AWPLVH AVV+  +EP+VKANGE AY+ YGK  EMNGLM KAMSGVSVPFMKA LDGY
Sbjct  1    MRAWPLVHTAVVEPETEPYVKANGEAAYAQYGKCEEMNGLMQKAMSGVSVPFMKAILDGY  60

Query  216  HGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFK  395
             GF+ V  LVDVGGSAGDCLRMI+++ P++ QGINFDLPEVV KAP IPG+TH+GGDMF+
Sbjct  61   DGFKYVEHLVDVGGSAGDCLRMIIKQFPNVRQGINFDLPEVVAKAPKIPGVTHMGGDMFQ  120

Query  396  SIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDYTHRTRLLL  575
            S+P+GDAIFMKW+LTTW DEECK+IM +CY AL  GGK+ ACEP+LP +TD +HRTR LL
Sbjct  121  SVPSGDAIFMKWVLTTWTDEECKQIMKNCYKALPVGGKLVACEPVLPKETDDSHRTRALL  180

Query  576  VGDMFVM  596
             GD+FVM
Sbjct  181  EGDIFVM  187



>gb|KJB62323.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=347

 Score =   291 bits (745),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 160/197 (81%), Gaps = 15/197 (8%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  185
            YVLQHHQDALM+AWPLVHEAV++ +SEPFVKANGE AYSYYGKKPEMNGLM KAMSGVSV
Sbjct  123  YVLQHHQDALMRAWPLVHEAVLNPTSEPFVKANGEGAYSYYGKKPEMNGLMQKAMSGVSV  182

Query  186  PFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPG  365
            PFM+A LDGY G +GV RLVDVGGSAGDCLRMI++K+P + +GINFDLPEVV KAP    
Sbjct  183  PFMRAILDGYDGLKGVKRLVDVGGSAGDCLRMILQKYPHV-EGINFDLPEVVAKAP----  237

Query  366  ITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQT  545
                      SIP  DAIFMKW+LTTW D+ECK IM +CY AL  GGK+ ACEP+LP ++
Sbjct  238  ----------SIPAADAIFMKWVLTTWTDDECKAIMENCYKALPVGGKLIACEPVLPKES  287

Query  546  DYTHRTRLLLVGDMFVM  596
            D +HRTR LL GD+FVM
Sbjct  288  DDSHRTRALLEGDIFVM  304



>ref|XP_011098295.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Sesamum indicum]
Length=355

 Score =   289 bits (740),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 159/198 (80%), Gaps = 1/198 (1%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  185
            Y+LQHHQDALM AWP VHEAV+D SSEPFVK +GE  YSYYGK PEMN LM KAMSGVSV
Sbjct  114  YILQHHQDALMLAWPRVHEAVLDPSSEPFVKVHGELPYSYYGKNPEMNLLMQKAMSGVSV  173

Query  186  PFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPG  365
            PFM+ FLD Y GF+GV  LVDVGG++GDCLR+IM K+ SI +GINFDLPEVV+KAP IPG
Sbjct  174  PFMETFLDRYDGFQGVETLVDVGGNSGDCLRLIMNKYKSIKKGINFDLPEVVEKAPKIPG  233

Query  366  ITHVGGDMFKS-IPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            I HVGGD+ KS IP GDAIFMKW+L T  DEECK I+ +C  AL  GGK+  C+P+LP  
Sbjct  234  IEHVGGDLLKSNIPPGDAIFMKWLLVTCTDEECKHILKNCSDALPSGGKLIICDPLLPNH  293

Query  543  TDYTHRTRLLLVGDMFVM  596
            TD +HR+R +L  D+++M
Sbjct  294  TDDSHRSRAILEADIYIM  311



>ref|XP_010683979.1| PREDICTED: caffeic acid 3-O-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=383

 Score =   286 bits (732),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 137/199 (69%), Positives = 162/199 (81%), Gaps = 2/199 (1%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSE-PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            YVLQHHQ+AL++AW  V  AVV  +S+ PF  ANGEPAY YYGK  EMNGLM +AM+GVS
Sbjct  142  YVLQHHQEALVRAWLQVDRAVVGPTSKTPFEVANGEPAYDYYGKNEEMNGLMQRAMAGVS  201

Query  183  VPFMKAFLDG-YHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNI  359
            VPFMKA ++G Y GF+GV +LVDVGGSAGDCL+MIM K+  I +GINFDLPEVV +AP I
Sbjct  202  VPFMKAVVEGGYDGFDGVVKLVDVGGSAGDCLKMIMSKYGGIKEGINFDLPEVVAQAPQI  261

Query  360  PGITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPI  539
            PG+THVGGDMFKSIP GDAIFMKW+LTTW D+E K IM +CY +L  GGK+ ACEP+LP 
Sbjct  262  PGVTHVGGDMFKSIPCGDAIFMKWVLTTWTDDEIKLIMKNCYDSLPAGGKLIACEPVLPE  321

Query  540  QTDYTHRTRLLLVGDMFVM  596
             +D +HRTR LL GD+FVM
Sbjct  322  TSDDSHRTRALLSGDIFVM  340



>gb|KDO38249.1| hypothetical protein CISIN_1g043063mg [Citrus sinensis]
Length=301

 Score =   282 bits (722),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 154/197 (78%), Gaps = 16/197 (8%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  185
            YVLQHHQDALM AWPLVHEA++D + EPFVK +GEP YSYYGK PEMNGLM KAMSGVSV
Sbjct  86   YVLQHHQDALMSAWPLVHEAILDPTIEPFVKVHGEPTYSYYGKMPEMNGLMRKAMSGVSV  145

Query  186  PFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPG  365
            PFM + LDGY GF+GV RLVDVGGSA                GINFDLPEVV +AP+IPG
Sbjct  146  PFMTSILDGYDGFKGVKRLVDVGGSA----------------GINFDLPEVVAEAPSIPG  189

Query  366  ITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQT  545
            +TH+GGDMFKSIP  DAIFMKW+LTTW D+ECK IM +CY A+  GGK+ ACEP+LP  +
Sbjct  190  VTHIGGDMFKSIPAADAIFMKWVLTTWTDDECKLIMENCYKAIPAGGKLIACEPVLPDDS  249

Query  546  DYTHRTRLLLVGDMFVM  596
            + + RTR LL GD+FVM
Sbjct  250  NESQRTRALLEGDIFVM  266



>ref|XP_006367255.1| PREDICTED: caffeic acid 3-O-methyltransferase 2-like [Solanum 
tuberosum]
Length=360

 Score =   280 bits (716),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 151/197 (77%), Gaps = 0/197 (0%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  185
            YVLQHHQDALM+ W +VHE V DSSS+PFVK  GE  YSYYGK PEMN LM  AMSGVS+
Sbjct  121  YVLQHHQDALMRVWTMVHETVNDSSSDPFVKVYGEQPYSYYGKNPEMNSLMFNAMSGVSM  180

Query  186  PFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPG  365
            PFMK  L+ Y GFEGV  LVDVGGS GDCL+MI+EKHPSI  GINFDLP+VV+KAP IP 
Sbjct  181  PFMKVMLERYDGFEGVKTLVDVGGSVGDCLKMILEKHPSIELGINFDLPKVVEKAPQIPR  240

Query  366  ITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQT  545
            I HVGGDM   IP GDAIFMKW+L  + ++ECK+IM SCY AL + GK   C+P+LP  T
Sbjct  241  IKHVGGDMLDYIPKGDAIFMKWILAIFTEDECKQIMKSCYNALPEKGKFIICDPVLPHHT  300

Query  546  DYTHRTRLLLVGDMFVM  596
            D + RTR LL  D++ M
Sbjct  301  DDSKRTRALLEIDIYGM  317



>gb|KDO39208.1| hypothetical protein CISIN_1g041308mg [Citrus sinensis]
Length=244

 Score =   275 bits (702),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 152/187 (81%), Gaps = 0/187 (0%)
 Frame = +3

Query  36   MKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGY  215
            M AWPLVHEAV+D + EPF K +GEPAYSYYGKKP+MNGLM KAMS V VPFM + LDGY
Sbjct  1    MSAWPLVHEAVLDPTIEPFAKVHGEPAYSYYGKKPKMNGLMRKAMSRVFVPFMTSVLDGY  60

Query  216  HGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFK  395
             GF+GV RLVDVGGSAGDCLR+I++KH  I +GINFDLPEVV KAP+IP +TH+GGDMFK
Sbjct  61   DGFKGVKRLVDVGGSAGDCLRIILQKHCFICEGINFDLPEVVAKAPSIPEVTHIGGDMFK  120

Query  396  SIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDYTHRTRLLL  575
            SI   DAIFMKW+LTTW D+ECK IM + Y AL  G K+ ACEP+LP  ++ + RTR LL
Sbjct  121  SIHVVDAIFMKWVLTTWTDDECKLIMENYYKALLAGRKLIACEPVLPDDSNESQRTRALL  180

Query  576  VGDMFVM  596
             GD+FVM
Sbjct  181  EGDIFVM  187



>ref|XP_006451875.1| hypothetical protein CICLE_v10010158mg [Citrus clementina]
 gb|ESR65115.1| hypothetical protein CICLE_v10010158mg [Citrus clementina]
Length=222

 Score =   272 bits (696),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = +3

Query  36   MKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGY  215
            M AWPLVHEAV+D + EPFVK +GEPAYSYYGK PEMNGLM KAMSGVSVPFM + LD Y
Sbjct  1    MSAWPLVHEAVLDPTIEPFVKVHGEPAYSYYGKMPEMNGLMRKAMSGVSVPFMTSVLDSY  60

Query  216  HGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFK  395
            + F+GV +LVDVGGSAGDCLRMI++KH  I +GINFD+PEVV +AP+I G+TH+GGD FK
Sbjct  61   NRFKGVKQLVDVGGSAGDCLRMILQKHRFIYEGINFDVPEVVGEAPSILGVTHIGGDTFK  120

Query  396  SIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDYTHRTRLLL  575
            SIP  DAIFMKW+LTTW D+E K IM +CY AL  GGK+ AC+P+L   ++ + RTR LL
Sbjct  121  SIPAADAIFMKWVLTTWTDDEYKLIMENCYKALPAGGKLIACKPVLLDDSNESQRTRALL  180

Query  576  VGDMFVM  596
             GD+FVM
Sbjct  181  EGDIFVM  187



>ref|XP_009382782.1| PREDICTED: caffeic acid 3-O-methyltransferase [Musa acuminata 
subsp. malaccensis]
Length=370

 Score =   277 bits (709),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 131/202 (65%), Positives = 159/202 (79%), Gaps = 4/202 (2%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSS-EPFVKANGE-PAYSYYGKKPEMNGLMLKAMSG  176
            AYVLQHHQDAL++AWP +HEAV+D +  EPF +ANG  PAY+YYG   E N LM +AM G
Sbjct  126  AYVLQHHQDALVRAWPRLHEAVLDPAGPEPFARANGGVPAYAYYGGDREANALMQRAMWG  185

Query  177  VSVPFMKAFLDGY--HGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKA  350
            VS PFM+A LDGY   GF  V  LVDVGGS+G CL MIM + PS+ +GINFDLPEVV +A
Sbjct  186  VSEPFMEALLDGYGSAGFGSVETLVDVGGSSGACLDMIMRRFPSVKRGINFDLPEVVAEA  245

Query  351  PNIPGITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPI  530
            P + G+THVGG+MF+SIP GDAIFMKW+LTTW DEEC  I+ +CY AL +GGK+ ACEP+
Sbjct  246  PPLAGVTHVGGNMFESIPTGDAIFMKWVLTTWTDEECTAILRNCYNALPEGGKVIACEPV  305

Query  531  LPIQTDYTHRTRLLLVGDMFVM  596
            LP++TD + RTR LL GD+FVM
Sbjct  306  LPVETDNSRRTRALLEGDIFVM  327



>ref|XP_006425490.1| hypothetical protein CICLE_v10027189mg, partial [Citrus clementina]
 gb|ESR38730.1| hypothetical protein CICLE_v10027189mg, partial [Citrus clementina]
Length=298

 Score =   274 bits (700),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 152/197 (77%), Gaps = 11/197 (6%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  185
            YVLQHH DALM AWPLVHE V+D + E FVK +G PAYSYYGK PE+N LM KAMSGVSV
Sbjct  54   YVLQHHHDALMSAWPLVHEVVLDPTIELFVKVHGVPAYSYYGKMPEINSLMRKAMSGVSV  113

Query  186  PFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPG  365
            PFM + LDGY+GF+GV RLVDVGGS GDCLRMI++KH  I +GINFDLPEVV +AP+IPG
Sbjct  114  PFMTSVLDGYNGFKGVKRLVDVGGSVGDCLRMILQKHHFICEGINFDLPEVVGEAPSIPG  173

Query  366  ITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQT  545
            +TH+GGDMFKSIP  DAIFMKW+           IM  CY AL  GGK+  CEP+LP  +
Sbjct  174  VTHIGGDMFKSIPAADAIFMKWL-----------IMEKCYKALPAGGKLIVCEPVLPDDS  222

Query  546  DYTHRTRLLLVGDMFVM  596
            + + RTR LL GD+FVM
Sbjct  223  NESQRTRALLEGDIFVM  239



>gb|AAP03058.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=375

 Score =   276 bits (705),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 155/199 (78%), Gaps = 1/199 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            AYVLQHHQ+ L+KAWP +H A++D+S+EPF + NGEPAY YYGK  E+N  M  AMSGVS
Sbjct  134  AYVLQHHQETLLKAWPFLHTAILDASTEPFARVNGEPAYQYYGKNDELNKNMQYAMSGVS  193

Query  183  VPFMKAFL-DGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNI  359
            VP+MKA L  GY GFEGV  LVDVGGS+GDCLRMI+ K+  I + INFDLPEVV KAP I
Sbjct  194  VPYMKALLGSGYDGFEGVKTLVDVGGSSGDCLRMIINKYKDIPKAINFDLPEVVAKAPKI  253

Query  360  PGITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPI  539
            PGITHVGG+MF+S+P+GDAIF+KW+LT + DEE   +M +C  AL  GGK+   EP LP 
Sbjct  254  PGITHVGGNMFESVPSGDAIFVKWVLTCFTDEEVITLMRNCNKALPVGGKLICSEPTLPE  313

Query  540  QTDYTHRTRLLLVGDMFVM  596
             +D +HRTR LLV D+F+M
Sbjct  314  NSDESHRTRALLVADIFIM  332



>ref|XP_011101457.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Sesamum indicum]
Length=360

 Score =   275 bits (703),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 132/216 (61%), Positives = 159/216 (74%), Gaps = 19/216 (9%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLM---------  158
            YVLQHHQDA+M AWPLVHEAV+D SSEPFVK +GE AYSYYGK PEMN LM         
Sbjct  101  YVLQHHQDAIMLAWPLVHEAVLDPSSEPFVKVHGELAYSYYGKYPEMNLLMHGELPYSYY  160

Query  159  ----------LKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSIT  308
                       KAMSGVSVPFMKAFLDGY GF+GV  LVDVGG++G+CLRMIM K+ SI 
Sbjct  161  GKYPEMNLLMQKAMSGVSVPFMKAFLDGYDGFQGVETLVDVGGNSGECLRMIMSKYQSIK  220

Query  309  QGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYG  488
            +G+ FDLPEVV+KAP IPGI HVGGD+ KS+P GDAIFMKW+L    D+ECK+I  +C+ 
Sbjct  221  KGVKFDLPEVVEKAPKIPGIEHVGGDVLKSVPPGDAIFMKWILVACTDDECKQIFKNCFD  280

Query  489  ALSQGGKMAACEPILPIQTDYTHRTRLLLVGDMFVM  596
            AL  GGK+  C+P+LP + D    +R +L  D+++M
Sbjct  281  ALPPGGKLIVCDPLLPDRADDNRSSRAILEADIYIM  316



>ref|XP_006485822.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Citrus sinensis]
Length=274

 Score =   271 bits (692),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  185
            YVLQHHQDALM  WPLV+EAV+D + EP VK +G+PAYSYYGK PEMNGLM KAMSGVSV
Sbjct  86   YVLQHHQDALMSMWPLVYEAVLDPTIEPLVKVHGKPAYSYYGKMPEMNGLMRKAMSGVSV  145

Query  186  PFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPG  365
            PFM + LDGY+GF+GV RLV+VGGSAGDCLRMI++KH  I +G+NFDLPEVV +AP+IPG
Sbjct  146  PFMTSVLDGYNGFKGVKRLVEVGGSAGDCLRMILQKHRFICEGMNFDLPEVVGEAPSIPG  205

Query  366  ITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKM  512
            +TH+GGDMFKSIP  DAIFMKW+LTTW D+ECK IM +CY AL  GG++
Sbjct  206  VTHIGGDMFKSIPATDAIFMKWVLTTWTDDECKLIMENCYKALLAGGEL  254



>ref|NP_001048569.1| Os02g0823400 [Oryza sativa Japonica Group]
 dbj|BAD22923.1| putative O-diphenol-O-methyl transferase [Oryza sativa Japonica 
Group]
 dbj|BAD22855.1| putative O-diphenol-O-methyl transferase [Oryza sativa Japonica 
Group]
 dbj|BAF10483.1| Os02g0823400 [Oryza sativa Japonica Group]
 dbj|BAG97074.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58073.1| hypothetical protein OsJ_08933 [Oryza sativa Japonica Group]
Length=365

 Score =   273 bits (698),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/201 (65%), Positives = 160/201 (80%), Gaps = 4/201 (2%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSS-EPFVKAN-GEPAYSYYGKKPEMNGLMLKAMSGV  179
            YVLQHHQDAL++AWPL+HEAV+D S  EPF +AN G PAY+YYGK  E N +ML+AM+GV
Sbjct  122  YVLQHHQDALVRAWPLLHEAVLDPSGPEPFARANAGVPAYAYYGKDREANEVMLRAMTGV  181

Query  180  SVPFMKAFLDGYH--GFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAP  353
            S PFM+A L+GY   GFEGV+ LVDVGGS+G CL MIM +  +I  G+NFDLP+VV  AP
Sbjct  182  SEPFMEALLEGYGDGGFEGVSTLVDVGGSSGACLEMIMRRVRTIRDGVNFDLPDVVAAAP  241

Query  354  NIPGITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPIL  533
             IPG+ HVGGDMFKSIP+GDAIFMKW+LTTW +EEC  I+S+C+ AL  GGK+ ACEP++
Sbjct  242  PIPGVRHVGGDMFKSIPSGDAIFMKWVLTTWTNEECTAILSNCHKALPGGGKVIACEPVV  301

Query  534  PIQTDYTHRTRLLLVGDMFVM  596
            P  TD + RTR LL  D+FVM
Sbjct  302  PDTTDGSTRTRALLENDIFVM  322



>ref|XP_004954455.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Setaria italica]
Length=344

 Score =   270 bits (691),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/200 (65%), Positives = 157/200 (79%), Gaps = 3/200 (2%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSS-EPFVKAN-GEPAYSYYGKKPEMNGLMLKAMSGV  179
            YVLQHHQDAL+ AWP +HEAV+D +  EPF +AN G PAY+YYG+  E N +ML+AM+GV
Sbjct  100  YVLQHHQDALVSAWPRLHEAVLDPAGPEPFARANAGVPAYAYYGRDREANEVMLRAMTGV  159

Query  180  SVPFMKAFLDGYH-GFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPN  356
            S PFM+A LDGY  GFEGV  LVDVGGS+G CL MIM +  +I +GINFDLP+VV  AP 
Sbjct  160  SEPFMEALLDGYAAGFEGVATLVDVGGSSGACLEMIMRRVDTIREGINFDLPDVVAAAPP  219

Query  357  IPGITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILP  536
            I G+ HVGGDMFKSIP+GDAIFMKW+LTTW +EEC  I+ +CY AL  GGK+ ACEP++P
Sbjct  220  IVGVRHVGGDMFKSIPSGDAIFMKWVLTTWTNEECTAILGNCYSALPDGGKVIACEPVVP  279

Query  537  IQTDYTHRTRLLLVGDMFVM  596
             +TD + RTR LL  D+FVM
Sbjct  280  EETDGSTRTRALLENDIFVM  299



>gb|ACN25427.1| unknown [Zea mays]
 gb|AFW63931.1| caffeic acid 3-O-methyltransferase [Zea mays]
Length=374

 Score =   270 bits (690),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 156/202 (77%), Gaps = 5/202 (2%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSS-EPFVKAN-GEPAYSYYGKKPEMNGLMLKAMSGV  179
            YVLQHHQDAL+ AWP +HEAV+D +  EPF +AN G  AY+YYGK  + N +ML+AM+GV
Sbjct  129  YVLQHHQDALVAAWPRLHEAVLDPAGPEPFARANAGVTAYAYYGKDQDANRVMLRAMAGV  188

Query  180  SVPFMKAFLDGYH---GFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKA  350
            S PFM A LDGY    GF GV  LVDVGGS+G CL MIM + P+IT+GINFDLP+VV  A
Sbjct  189  SEPFMGALLDGYGAAGGFRGVATLVDVGGSSGACLEMIMRRVPTITEGINFDLPDVVAAA  248

Query  351  PNIPGITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPI  530
            P I G+ HVGGDMFKSIP+GDAIFMKW+LTTW D+EC  I+ +C+ AL  GGK+ ACEP+
Sbjct  249  PPIAGVRHVGGDMFKSIPSGDAIFMKWVLTTWTDDECTAILRNCHAALPDGGKLVACEPV  308

Query  531  LPIQTDYTHRTRLLLVGDMFVM  596
            +P +TD + RTR LL  D+FVM
Sbjct  309  VPEETDSSTRTRALLENDIFVM  330



>ref|XP_002453074.1| hypothetical protein SORBIDRAFT_04g037820 [Sorghum bicolor]
 gb|EES06050.1| hypothetical protein SORBIDRAFT_04g037820 [Sorghum bicolor]
Length=377

 Score =   270 bits (690),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 155/202 (77%), Gaps = 5/202 (2%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSS-EPFVKAN-GEPAYSYYGKKPEMNGLMLKAMSGV  179
            YVLQHHQDAL+ AWP +HEAV+D    EPF +AN G PAY+YYGK  E N +ML+AM+GV
Sbjct  133  YVLQHHQDALVAAWPRLHEAVLDPRGPEPFARANAGVPAYAYYGKDREANQVMLRAMTGV  192

Query  180  SVPFMKAFLDGYH---GFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKA  350
            S PFM A LDGY    GF GV  LVDVGGS+G CL MIM + P+I +GINFDLP+VV  A
Sbjct  193  SEPFMHALLDGYGFDGGFHGVATLVDVGGSSGACLEMIMRRVPTIKEGINFDLPDVVADA  252

Query  351  PNIPGITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPI  530
            P I G+ HVGGDMFKSIP+GDAIFMKW+LTTW ++EC  I+ +C+ AL  GGK+ ACEP+
Sbjct  253  PAIAGVRHVGGDMFKSIPSGDAIFMKWVLTTWTNDECTAILRNCHAALPDGGKLVACEPV  312

Query  531  LPIQTDYTHRTRLLLVGDMFVM  596
            +P +TD + RTR LL  D+FVM
Sbjct  313  VPEETDSSTRTRALLENDIFVM  334



>ref|XP_010935841.1| PREDICTED: quercetin 3-O-methyltransferase 1 isoform X1 [Elaeis 
guineensis]
Length=409

 Score =   270 bits (689),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 157/201 (78%), Gaps = 3/201 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSS-EPFVKANG-EPAYSYYGKKPEMNGLMLKAMSG  176
            AYVLQHHQDAL++AWP +HEAV+D +  EPF +ANG  PAY+YYG   E N LM +AM G
Sbjct  166  AYVLQHHQDALVRAWPRLHEAVLDPAGPEPFARANGGTPAYAYYGGDGEANELMQRAMWG  225

Query  177  VSVPFMKAFLDGYHG-FEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAP  353
            VS PFM AFL+G+   F GV  +VDVGGS+GDCLR IM++ P++ +G+NFDLPEVV KAP
Sbjct  226  VSKPFMDAFLNGHAAAFAGVRTVVDVGGSSGDCLRAIMQRVPTVQRGVNFDLPEVVAKAP  285

Query  354  NIPGITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPIL  533
              PG+THVGGDMFK+IP GDAIFMKW+L TW DEEC  I+ +CY AL + GK+ ACEP+L
Sbjct  286  KYPGMTHVGGDMFKAIPAGDAIFMKWVLMTWTDEECMLILKNCYKALPEKGKVIACEPVL  345

Query  534  PIQTDYTHRTRLLLVGDMFVM  596
            P +TD + RTR LL  D+FVM
Sbjct  346  PEETDNSQRTRALLENDIFVM  366



>ref|NP_001149617.1| LOC100283243 [Zea mays]
 gb|ACG36095.1| caffeic acid 3-O-methyltransferase [Zea mays]
Length=374

 Score =   268 bits (684),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 155/202 (77%), Gaps = 5/202 (2%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSS-EPFVKAN-GEPAYSYYGKKPEMNGLMLKAMSGV  179
            YVLQHHQDAL+ AWP +HEAV+D +  EPF +AN G  AY+YYGK  + N +ML+AM+GV
Sbjct  129  YVLQHHQDALVAAWPRLHEAVLDPAGPEPFARANAGVTAYAYYGKDQDANRVMLRAMAGV  188

Query  180  SVPFMKAFLDGYH---GFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKA  350
            S PFM A LDGY    GF GV  LVDVGGS+G CL MIM + P+IT+GINFDLP+VV  A
Sbjct  189  SEPFMGALLDGYGAAGGFRGVATLVDVGGSSGACLEMIMRRVPTITEGINFDLPDVVAAA  248

Query  351  PNIPGITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPI  530
            P I G+ HVGGDMFKSIP+GDAIFMKW+LTTW D+EC  I+ +C+  L  GGK+ ACEP+
Sbjct  249  PPIAGVRHVGGDMFKSIPSGDAIFMKWVLTTWTDDECTAILRNCHAXLPDGGKLVACEPV  308

Query  531  LPIQTDYTHRTRLLLVGDMFVM  596
            +P +TD + RTR LL  D+FVM
Sbjct  309  VPEETDSSTRTRALLENDIFVM  330



>dbj|BAJ96291.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00225.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=367

 Score =   265 bits (677),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 156/200 (78%), Gaps = 3/200 (2%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSS-EPFVKAN-GEPAYSYYGKKPEMNGLMLKAMSGV  179
            YVLQHHQDAL+ AWP +HEAV+D +  EPF +A+ G PAY+YYG+  + N +ML+AM+GV
Sbjct  125  YVLQHHQDALVLAWPRLHEAVLDPAGPEPFARAHAGVPAYAYYGQDRDANEVMLRAMTGV  184

Query  180  SVPFMKAFLDGYHG-FEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPN  356
            S PFM+A LDGY G FEGV  LVDVGGS+G CL MIM + P+I +G+NFDLP+VV  AP 
Sbjct  185  SEPFMEALLDGYEGGFEGVGTLVDVGGSSGACLEMIMRRVPTIREGVNFDLPDVVAAAPP  244

Query  357  IPGITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILP  536
            I G+ HVGGDMFKSIP+GDAIFMKW+LTTW ++EC  I+  C+ AL  GGK+ ACEP++P
Sbjct  245  IAGVKHVGGDMFKSIPSGDAIFMKWVLTTWTNDECTAILKKCHDALPDGGKLVACEPVVP  304

Query  537  IQTDYTHRTRLLLVGDMFVM  596
              TD + RTR LL  D+FVM
Sbjct  305  ETTDASTRTRALLENDIFVM  324



>ref|XP_006432602.1| hypothetical protein CICLE_v10002505mg [Citrus clementina]
 gb|ESR45842.1| hypothetical protein CICLE_v10002505mg [Citrus clementina]
Length=206

 Score =   259 bits (661),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 144/187 (77%), Gaps = 16/187 (9%)
 Frame = +3

Query  36   MKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGY  215
            M AWPLVHEA++D + EPFVK +GEP YSYYGK PEMNGLM KAMSGVSVPFM + LDGY
Sbjct  1    MSAWPLVHEAILDPTIEPFVKVHGEPTYSYYGKMPEMNGLMRKAMSGVSVPFMTSILDGY  60

Query  216  HGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFK  395
             GF+GV RLVDVGGSAG                INFDLPEVV +AP+IPG+TH+GGDMFK
Sbjct  61   DGFKGVKRLVDVGGSAG----------------INFDLPEVVAEAPSIPGVTHIGGDMFK  104

Query  396  SIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDYTHRTRLLL  575
            SIP  DAIFMKW+LTTW D+ECK IM +CY A+  GGK+ ACEP+LP  ++ + RTR LL
Sbjct  105  SIPAADAIFMKWVLTTWTDDECKLIMENCYKAIPAGGKLIACEPVLPDDSNESQRTRALL  164

Query  576  VGDMFVM  596
             GD+FVM
Sbjct  165  EGDIFVM  171



>ref|XP_006381360.1| hypothetical protein POPTR_0006s12160g [Populus trichocarpa]
 gb|ERP59157.1| hypothetical protein POPTR_0006s12160g [Populus trichocarpa]
Length=270

 Score =   260 bits (665),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  185
            YVLQHHQDALMKAWPLVHEAV+D ++EPFVKANGEPAY YYGK+PEMN LMLKAMSGVSV
Sbjct  125  YVLQHHQDALMKAWPLVHEAVLDPTTEPFVKANGEPAYDYYGKQPEMNELMLKAMSGVSV  184

Query  186  PFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPG  365
            PFM+A LDGY GF+GV RLVDVGGSAGDCLRMI++KHP + QGINFDLPEVV KAP IPG
Sbjct  185  PFMEAMLDGYDGFKGVERLVDVGGSAGDCLRMILKKHPGVRQGINFDLPEVVAKAPIIPG  244

Query  366  ITHVGGDMFKSIPNGDAIFMKWM  434
            +T+VGGDMFKSIP+GDAIFMK M
Sbjct  245  VTNVGGDMFKSIPDGDAIFMKTM  267



>ref|XP_003572969.1| PREDICTED: caffeic acid 3-O-methyltransferase [Brachypodium distachyon]
Length=362

 Score =   261 bits (666),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 155/200 (78%), Gaps = 3/200 (2%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSS-EPFVKAN-GEPAYSYYGKKPEMNGLMLKAMSGV  179
            YVLQHHQDAL+ AWP +HEA++D +  EPF +A+ G PAY++Y +  E N +ML+ M+GV
Sbjct  120  YVLQHHQDALVLAWPRLHEALLDPAGPEPFARAHRGLPAYAFYAQDKEANEVMLRGMTGV  179

Query  180  SVPFMKAFLDGYHG-FEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPN  356
            S PFM+A LDGY G FE V  LVDVGGS+G CL MIM +  +I QGINFDLP+VV  AP 
Sbjct  180  SEPFMEALLDGYAGGFEDVRTLVDVGGSSGACLDMIMRRVGTIAQGINFDLPDVVAAAPP  239

Query  357  IPGITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILP  536
            I G+ HVGGDMFKSIP+GDAIFMKW+LTTW ++EC  I+ +CYGAL +GGK+ ACEP++P
Sbjct  240  IAGVRHVGGDMFKSIPSGDAIFMKWVLTTWTNDECTAILKNCYGALPEGGKLIACEPVVP  299

Query  537  IQTDYTHRTRLLLVGDMFVM  596
              TD + RTR LL  D+FVM
Sbjct  300  ETTDTSTRTRALLENDIFVM  319



>gb|AAP03055.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=234

 Score =   255 bits (652),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 147/191 (77%), Gaps = 1/191 (1%)
 Frame = +3

Query  27   DALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFL  206
            + L+KAWP +H A++D+S+EPF + NGEPAY YYGK  E+N  M  AMSGVSVP+MKA L
Sbjct  1    ETLLKAWPFLHTAILDASTEPFARVNGEPAYQYYGKNDELNKNMQYAMSGVSVPYMKALL  60

Query  207  -DGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGG  383
              GY GFEGV  LVDVGGS+GDCLRMI+ K+  I + INFDLPEVV KAP IPGITHVGG
Sbjct  61   GSGYDGFEGVKTLVDVGGSSGDCLRMIINKYKDIPKAINFDLPEVVAKAPKIPGITHVGG  120

Query  384  DMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDYTHRT  563
            +MF+S+P+GDAIF+KW+LT + DEE   +M +C  AL  GGK+   EP LP  +D +HRT
Sbjct  121  NMFESVPSGDAIFVKWVLTCFTDEEVITLMRNCNKALPVGGKLICSEPTLPENSDESHRT  180

Query  564  RLLLVGDMFVM  596
            R LLV D+F+M
Sbjct  181  RALLVADIFIM  191



>ref|XP_006649184.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Oryza brachyantha]
Length=313

 Score =   254 bits (649),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 154/200 (77%), Gaps = 3/200 (2%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSS-EPFVKAN-GEPAYSYYGKKPEMNGLMLKAMSGV  179
            YVLQHHQDAL++AWP +HEAV+D +  EPF +AN G PAY+YYG+  E N +ML+AM+GV
Sbjct  71   YVLQHHQDALVRAWPRLHEAVLDPAGPEPFARANAGVPAYAYYGQDREANEVMLRAMTGV  130

Query  180  SVPFMKAFLDGYHGFEGVT-RLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPN  356
            S PFM+A LDGY G       LVDVGGS+G CL MIM +  +I +G+NFDLP+VV  AP 
Sbjct  131  SEPFMEALLDGYGGGFEGVGTLVDVGGSSGACLEMIMRRVRTIREGLNFDLPDVVAAAPP  190

Query  357  IPGITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILP  536
            IPG+ HVGGDMFKSIP+GDAIFMKW+LTTW ++EC  I+ +CY AL  GGK+ ACEP++P
Sbjct  191  IPGVKHVGGDMFKSIPSGDAIFMKWVLTTWTNDECTAILRNCYAALPAGGKLVACEPVVP  250

Query  537  IQTDYTHRTRLLLVGDMFVM  596
              TD + RTR LL  D+FVM
Sbjct  251  DTTDGSTRTRALLENDIFVM  270



>ref|XP_008361606.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like isoform 
X2 [Malus domestica]
Length=278

 Score =   253 bits (645),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  185
            YVLQHHQD LM AWP+VHEAVVDS+ EPFVKANGE AY YYGKKPEMNGLM KAMSGVSV
Sbjct  129  YVLQHHQDVLMGAWPMVHEAVVDSTVEPFVKANGELAYEYYGKKPEMNGLMQKAMSGVSV  188

Query  186  PFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPG  365
            PFMKA LDGY GFEGV RLVDVGGSAGDCLRMI++KHP++ +GINFDLPEVV KAP I G
Sbjct  189  PFMKAILDGYDGFEGVERLVDVGGSAGDCLRMILQKHPNVREGINFDLPEVVAKAPTIAG  248

Query  366  ITHVGGDMFKSIPNGDAIFMK  428
            ++HVGGDMFKSIP GDAIF+K
Sbjct  249  VSHVGGDMFKSIPRGDAIFLK  269



>ref|XP_006428524.1| hypothetical protein CICLE_v10013655mg [Citrus clementina]
 gb|ESR41764.1| hypothetical protein CICLE_v10013655mg [Citrus clementina]
Length=261

 Score =   248 bits (632),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  185
            YVLQHHQDALM AWPLVHEAV+D + EPFVK +GEPAYSYYGKKPEMNGLM KAMSGVSV
Sbjct  117  YVLQHHQDALMSAWPLVHEAVLDPTIEPFVKVHGEPAYSYYGKKPEMNGLMRKAMSGVSV  176

Query  186  PFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPG  365
            PFM + LDGY GF+GV RLVDVGGSAGDCLRMI++KHP I +GINFDLPEVV +AP+IPG
Sbjct  177  PFMTSVLDGYDGFKGVKRLVDVGGSAGDCLRMILQKHPFICEGINFDLPEVVAEAPSIPG  236

Query  366  ITHVGGDMFKSIPNGDAIFMK  428
            +TH+GGDMFKSIP  DAIFMK
Sbjct  237  VTHIGGDMFKSIPAADAIFMK  257



>ref|XP_008361604.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like isoform 
X1 [Malus domestica]
Length=281

 Score =   247 bits (631),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 127/144 (88%), Gaps = 3/144 (2%)
 Frame = +3

Query  6    YVLQHHQ---DALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSG  176
            YVLQHHQ   D LM AWP+VHEAVVDS+ EPFVKANGE AY YYGKKPEMNGLM KAMSG
Sbjct  129  YVLQHHQLFKDVLMGAWPMVHEAVVDSTVEPFVKANGELAYEYYGKKPEMNGLMQKAMSG  188

Query  177  VSVPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPN  356
            VSVPFMKA LDGY GFEGV RLVDVGGSAGDCLRMI++KHP++ +GINFDLPEVV KAP 
Sbjct  189  VSVPFMKAILDGYDGFEGVERLVDVGGSAGDCLRMILQKHPNVREGINFDLPEVVAKAPT  248

Query  357  IPGITHVGGDMFKSIPNGDAIFMK  428
            I G++HVGGDMFKSIP GDAIF+K
Sbjct  249  IAGVSHVGGDMFKSIPRGDAIFLK  272



>ref|XP_004502926.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cicer arietinum]
Length=361

 Score =   249 bits (636),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 145/198 (73%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            AYVLQHHQ+ALM+AW LV EAV D + EPF KANGE A +YY K+ ++  L+  +++G+S
Sbjct  121  AYVLQHHQEALMRAWALVGEAVEDPTVEPFEKANGESAVAYYIKRADVMSLIYSSLAGMS  180

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            VPFM+  L+ Y GF+GV  L DVGG++G CL MIM K+P+I +GIN+D P +V  AP  P
Sbjct  181  VPFMREMLENYDGFQGVETLADVGGNSGVCLNMIMNKYPNIRKGINYDFPAMVSSAPEFP  240

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
             ITH+GGD  +S+P GDAIFMKW+   W DEECK+ + +CY AL   GK+  CEP+LP  
Sbjct  241  DITHIGGDALQSVPAGDAIFMKWIFLAWTDEECKKTLQNCYKALPVDGKLIVCEPVLPEL  300

Query  543  TDYTHRTRLLLVGDMFVM  596
            TD + RTR LL GD+F+M
Sbjct  301  TDESQRTRALLGGDIFIM  318



>gb|KJB62324.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=269

 Score =   244 bits (624),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 129/141 (91%), Gaps = 1/141 (1%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  185
            YVLQHHQDALM+AWPLVHEAV++ +SEPFVKANGE AYSYYGKKPEMNGLM KAMSGVSV
Sbjct  123  YVLQHHQDALMRAWPLVHEAVLNPTSEPFVKANGEGAYSYYGKKPEMNGLMQKAMSGVSV  182

Query  186  PFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPG  365
            PFM+A LDGY G +GV RLVDVGGSAGDCLRMI++K+P + +GINFDLPEVV KAP+IPG
Sbjct  183  PFMRAILDGYDGLKGVKRLVDVGGSAGDCLRMILQKYPHV-EGINFDLPEVVAKAPSIPG  241

Query  366  ITHVGGDMFKSIPNGDAIFMK  428
            +THVGGDMF+SIP  DAIFMK
Sbjct  242  VTHVGGDMFESIPAADAIFMK  262



>ref|XP_006594705.1| PREDICTED: caffeic acid 3-O-methyltransferase-like isoform X2 
[Glycine max]
Length=298

 Score =   240 bits (612),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  185
            YVLQHHQDALM+AWP+VHEAVVD + EPF +ANGEPAY YY K PEMN LM++AMSGVSV
Sbjct  116  YVLQHHQDALMRAWPMVHEAVVDPTKEPFERANGEPAYGYYLKHPEMNDLMVRAMSGVSV  175

Query  186  PFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPG  365
            PF++A L+GY GF+GV +LVDVGGS GDCLRMI+EKHP+I +GINFDLPEVV KAP IP 
Sbjct  176  PFIRAMLEGYDGFQGVEKLVDVGGSGGDCLRMILEKHPTIKEGINFDLPEVVAKAPQIPF  235

Query  366  ITHVGGDMFKSIPNGDAIFMK  428
            +THVGGDMFK IP GDAIFMK
Sbjct  236  VTHVGGDMFKFIPQGDAIFMK  256



>emb|CAB65279.1| O-diphenol-O-methyl transferase [Medicago sativa subsp. x varia]
Length=358

 Score =   240 bits (613),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 144/198 (73%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
             YVLQH+QD  ++AWPLV +AV D+S EPF K +GE AY+Y  K+P+   L   +MSG+S
Sbjct  118  TYVLQHYQDQYLRAWPLVGDAVEDASVEPFEKLHGEGAYAYCMKRPDEMSLFYASMSGLS  177

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            +P M   L+ Y GF+GV  LVDVGG++G  L MIM K+P+I +GINFDLP+++  AP +P
Sbjct  178  MPHMNEMLEKYDGFKGVETLVDVGGNSGVILNMIMNKYPNILKGINFDLPDMISSAPQLP  237

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            GITHVGGD  +S+P GDAIF KW + TW DEECK+++ +CY AL   GK+  CEP+ P  
Sbjct  238  GITHVGGDALESVPAGDAIFTKWTMLTWTDEECKKVLQNCYKALPVNGKLIVCEPVSPEL  297

Query  543  TDYTHRTRLLLVGDMFVM  596
            TD + RTR LL GD+F+M
Sbjct  298  TDESQRTRALLSGDIFIM  315



>gb|KDO38695.1| hypothetical protein CISIN_1g037818mg, partial [Citrus sinensis]
Length=199

 Score =   234 bits (598),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  185
            Y+LQHHQDALM AWPLVHEAV+D + EPFVK +GEPAYSYYGK PEMNGLM KAMSGVSV
Sbjct  58   YMLQHHQDALMSAWPLVHEAVLDPTIEPFVKVHGEPAYSYYGKMPEMNGLMRKAMSGVSV  117

Query  186  PFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPG  365
            PF+ + LDGY+GF+GV +LVDVGGSAGDCLRMI++KH  I +GINFDLPEVV +AP+I G
Sbjct  118  PFITSVLDGYNGFKGVKQLVDVGGSAGDCLRMILQKHRFICEGINFDLPEVVGEAPSILG  177

Query  366  ITHVGGDMFKSIPNGDAIFMKW  431
            +TH+GGD FKSIP  DAIFMKW
Sbjct  178  VTHIGGDTFKSIPAADAIFMKW  199



>ref|XP_003602597.1| Caffeic acid 3-O-methyltransferase [Medicago truncatula]
Length=358

 Score =   237 bits (605),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 142/198 (72%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
             YVLQH+QD  ++AWPLV EAV D + EPF K +GE AY+Y  K+P+   L   +MSG+S
Sbjct  118  TYVLQHYQDQYLRAWPLVGEAVEDPTVEPFEKLHGEGAYAYCMKRPDEMSLFYASMSGMS  177

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            +P M   L+ Y GF+GV  LVDVGG++G  L MIM K+P+I +GINFDLP+++  AP +P
Sbjct  178  MPHMNEMLEKYDGFKGVESLVDVGGNSGVILNMIMNKYPNILKGINFDLPDMISSAPQLP  237

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            GITHVGGD  + +P GDAIF KW + TW DEECK+++ +CY AL   GK+  CEP+ P  
Sbjct  238  GITHVGGDALELVPAGDAIFTKWTMLTWTDEECKKVLQNCYKALPVNGKLIVCEPVSPEL  297

Query  543  TDYTHRTRLLLVGDMFVM  596
            TD + RTR LL GD+F+M
Sbjct  298  TDESQRTRALLSGDIFIM  315



>ref|XP_003602595.1| Caffeic acid 3-O-methyltransferase [Medicago truncatula]
 gb|ACJ84599.1| unknown [Medicago truncatula]
 gb|AES72846.1| caffeic acid O-methyltransferase [Medicago truncatula]
 gb|AFK37235.1| unknown [Medicago truncatula]
Length=358

 Score =   236 bits (602),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 143/198 (72%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            ++ +QHHQD  ++AWPLV +AV D + EPF K +GE AY+Y  K PE   L   +MSG+S
Sbjct  118  SFFVQHHQDPYLRAWPLVGDAVEDPTVEPFEKLHGEAAYAYCTKGPEEMSLFYASMSGMS  177

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            +P+M+  L+ Y GF+GV  LVDVGG++G  L MIM K+P+I +GINFDLP+++  AP  P
Sbjct  178  LPYMREMLENYDGFKGVETLVDVGGNSGVSLNMIMNKYPNILKGINFDLPDMISSAPQYP  237

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            GITHVGGD  +S+P GDAIF+KW + TW DEE K+ + SCY AL   GK+  CEP+LP Q
Sbjct  238  GITHVGGDALESVPAGDAIFIKWTVLTWTDEEFKKALQSCYKALPVAGKLILCEPVLPEQ  297

Query  543  TDYTHRTRLLLVGDMFVM  596
            TD + RTR LL  D+++M
Sbjct  298  TDESKRTRALLAADIWIM  315



>emb|CDX76223.1| BnaA04g04870D [Brassica napus]
Length=268

 Score =   233 bits (593),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            AYVLQHHQ+ALM+AWPLVH AVV+  +EP+VKANGE AY+ YGK  EMNGLM KAMSGVS
Sbjct  119  AYVLQHHQEALMRAWPLVHTAVVEPETEPYVKANGEAAYAQYGKCEEMNGLMQKAMSGVS  178

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            VPFMKA LDGY GF+ V  LVDVGGSAGDCLRMI+++ P++ QGINFDLPEVV KAP IP
Sbjct  179  VPFMKAILDGYDGFKYVEHLVDVGGSAGDCLRMIIKQFPNVRQGINFDLPEVVAKAPKIP  238

Query  363  GITHVGGDMFKSIPNGDAIFMK  428
            G+TH+GGDMF+S+P+GDAIFMK
Sbjct  239  GVTHMGGDMFQSVPSGDAIFMK  260



>gb|KDO54338.1| hypothetical protein CISIN_1g032721mg [Citrus sinensis]
Length=135

 Score =   223 bits (568),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +3

Query  36   MKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGY  215
            M AWPLVHEAV+D + EPFVK +GEPAYSYYGKKPEMNGLM KAMSGVSVPFM + LDGY
Sbjct  1    MSAWPLVHEAVLDPTIEPFVKVHGEPAYSYYGKKPEMNGLMRKAMSGVSVPFMTSVLDGY  60

Query  216  HGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFK  395
             GF+GV RLVDVGGSAGDCLRMI++KHP I +GINFDLPEVV +AP+IPG+TH+GGDMFK
Sbjct  61   DGFKGVKRLVDVGGSAGDCLRMILQKHPFICEGINFDLPEVVAEAPSIPGVTHIGGDMFK  120

Query  396  SIPNGDAIFMK  428
            SIP  DAIFMK
Sbjct  121  SIPAADAIFMK  131



>gb|EEC74273.1| hypothetical protein OsI_09508 [Oryza sativa Indica Group]
Length=345

 Score =   230 bits (586),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/201 (59%), Positives = 144/201 (72%), Gaps = 24/201 (12%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSS-EPFVKAN-GEPAYSYYGKKPEMNGLMLKAMSGV  179
            YVLQHHQDAL++AWPL+HEAV+D S  EPF +AN G PAY+YYGK  E N +ML+AM+GV
Sbjct  122  YVLQHHQDALVRAWPLLHEAVLDPSGPEPFARANAGVPAYAYYGKDREANEVMLRAMTGV  181

Query  180  SVPFMKAFLDGYH--GFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAP  353
            S PFM+A L+GY   GFEGV+ LVDVGGS+G CL M+M +  +I  G+NFDLP+VV  AP
Sbjct  182  SEPFMEALLEGYGDGGFEGVSTLVDVGGSSGACLEMMMRRVRTIRDGVNFDLPDVVAAAP  241

Query  354  NIPGITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPIL  533
             IPG+ HVGGDMFKSIP+GDAIFMK                    AL  GGK+ ACEP++
Sbjct  242  PIPGVRHVGGDMFKSIPSGDAIFMK--------------------ALPGGGKVIACEPVV  281

Query  534  PIQTDYTHRTRLLLVGDMFVM  596
            P  TD + RTR LL  D+FVM
Sbjct  282  PDTTDGSTRTRALLENDIFVM  302



>gb|AES72848.2| caffeic acid O-methyltransferase [Medicago truncatula]
Length=335

 Score =   224 bits (571),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 136/191 (71%), Gaps = 0/191 (0%)
 Frame = +3

Query  24   QDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAF  203
            +D  ++AWPLV EAV D + EPF K +GE AY+Y  K+P+   L   +MSG+S+P M   
Sbjct  102  EDQYLRAWPLVGEAVEDPTVEPFEKLHGEGAYAYCMKRPDEMSLFYASMSGMSMPHMNEM  161

Query  204  LDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGG  383
            L+ Y GF+GV  LVDVGG++G  L MIM K+P+I +GINFDLP+++  AP +PGITHVGG
Sbjct  162  LEKYDGFKGVESLVDVGGNSGVILNMIMNKYPNILKGINFDLPDMISSAPQLPGITHVGG  221

Query  384  DMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDYTHRT  563
            D  + +P GDAIF KW + TW DEECK+++ +CY AL   GK+  CEP+ P  TD + RT
Sbjct  222  DALELVPAGDAIFTKWTMLTWTDEECKKVLQNCYKALPVNGKLIVCEPVSPELTDESQRT  281

Query  564  RLLLVGDMFVM  596
            R LL GD+F+M
Sbjct  282  RALLSGDIFIM  292



>gb|AAP03056.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=206

 Score =   213 bits (543),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 123/162 (76%), Gaps = 1/162 (1%)
 Frame = +3

Query  114  AYSYYGKKPEMNGLMLKAMSGVSVPFMKAFL-DGYHGFEGVTRLVDVGGSAGDCLRMIME  290
            AY YYGK  E+N  M  AMSGVSVP+MKA L  GY GFEGV  LVDVGGS+GDCLRMI+ 
Sbjct  2    AYQYYGKNDELNKNMQYAMSGVSVPYMKALLGSGYDGFEGVKTLVDVGGSSGDCLRMIIN  61

Query  291  KHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEI  470
            K+  I + INFDLPEVV KAP IPGITHVGG+MF+S+P+GDAIF+KW+LT + DEE   +
Sbjct  62   KYKDIPKAINFDLPEVVAKAPKIPGITHVGGNMFESVPSGDAIFVKWVLTCFTDEEVITL  121

Query  471  MSSCYGALSQGGKMAACEPILPIQTDYTHRTRLLLVGDMFVM  596
            M +C  AL  GGK+   EP LP  +D +HRTR LLV D+F+M
Sbjct  122  MRNCNKALPVGGKLICSEPTLPENSDESHRTRALLVADIFIM  163



>ref|XP_006838729.1| hypothetical protein AMTR_s00002p00253410 [Amborella trichopoda]
 gb|ERN01298.1| hypothetical protein AMTR_s00002p00253410 [Amborella trichopoda]
Length=352

 Score =   212 bits (540),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 140/198 (71%), Gaps = 1/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A++L    DAL+ AW L+HEAV++ SSEPF+KA+G+PAY Y+   P  N  M++AMS  S
Sbjct  113  AFILYRLDDALLDAWRLLHEAVLEPSSEPFIKAHGKPAYHYHADDPVFNERMMEAMSSSS  172

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
               M  FL+ Y GFEGV R+VD+GGS+G CL+ I++KH  + +GINFDLP+VV+ AP   
Sbjct  173  GAVMDWFLERYDGFEGVRRVVDLGGSSGFCLKKILDKHKGL-EGINFDLPKVVEAAPPYL  231

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            GI HVGGDM + +P GD IFMK +L +W D+EC  ++ +CY AL + GK+ A E +LP+ 
Sbjct  232  GIEHVGGDMLEWVPQGDVIFMKGILCSWDDDECVGLLKNCYKALPEKGKVIALEQVLPMH  291

Query  543  TDYTHRTRLLLVGDMFVM  596
            TD +  TR LL  D+F+M
Sbjct  292  TDTSPSTRALLQADVFLM  309



>gb|KJB62322.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=258

 Score =   209 bits (531),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 111/124 (90%), Gaps = 1/124 (1%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  185
            YVLQHHQDALM+AWPLVHEAV++ +SEPFVKANGE AYSYYGKKPEMNGLM KAMSGVSV
Sbjct  123  YVLQHHQDALMRAWPLVHEAVLNPTSEPFVKANGEGAYSYYGKKPEMNGLMQKAMSGVSV  182

Query  186  PFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPG  365
            PFM+A LDGY G +GV RLVDVGGSAGDCLRMI++K+P + +GINFDLPEVV KAP+IPG
Sbjct  183  PFMRAILDGYDGLKGVKRLVDVGGSAGDCLRMILQKYPHV-EGINFDLPEVVAKAPSIPG  241

Query  366  ITHV  377
               V
Sbjct  242  CVAV  245



>gb|KJB62321.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=248

 Score =   206 bits (525),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 109/119 (92%), Gaps = 1/119 (1%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  185
            YVLQHHQDALM+AWPLVHEAV++ +SEPFVKANGE AYSYYGKKPEMNGLM KAMSGVSV
Sbjct  123  YVLQHHQDALMRAWPLVHEAVLNPTSEPFVKANGEGAYSYYGKKPEMNGLMQKAMSGVSV  182

Query  186  PFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            PFM+A LDGY G +GV RLVDVGGSAGDCLRMI++K+P + +GINFDLPEVV KAP+IP
Sbjct  183  PFMRAILDGYDGLKGVKRLVDVGGSAGDCLRMILQKYPHV-EGINFDLPEVVAKAPSIP  240



>ref|XP_009774776.1| PREDICTED: caffeic acid 3-O-methyltransferase [Nicotiana sylvestris]
Length=252

 Score =   202 bits (515),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            +Y+LQHHQDALM AW +V EAV DSS+EPF KANGEPAY+YYGKKPEMN LML AMSGVS
Sbjct  125  SYILQHHQDALMSAWTMVDEAVNDSSTEPFAKANGEPAYNYYGKKPEMNNLMLNAMSGVS  184

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            VPFMKA L+ Y+GF+GV  LVDVGGS GDCL+MI+EKH SI  GINFDLPEVV+KAP IP
Sbjct  185  VPFMKAILESYNGFQGVKTLVDVGGSGGDCLKMILEKHQSIQLGINFDLPEVVEKAPKIP  244



>ref|XP_010935842.1| PREDICTED: caffeic acid 3-O-methyltransferase isoform X2 [Elaeis 
guineensis]
Length=346

 Score =   197 bits (502),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 116/145 (80%), Gaps = 3/145 (2%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSS-EPFVKANG-EPAYSYYGKKPEMNGLMLKAMSG  176
            AYVLQHHQDAL++AWP +HEAV+D +  EPF +ANG  PAY+YYG   E N LM +AM G
Sbjct  166  AYVLQHHQDALVRAWPRLHEAVLDPAGPEPFARANGGTPAYAYYGGDGEANELMQRAMWG  225

Query  177  VSVPFMKAFLDGYHG-FEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAP  353
            VS PFM AFL+G+   F GV  +VDVGGS+GDCLR IM++ P++ +G+NFDLPEVV KAP
Sbjct  226  VSKPFMDAFLNGHAAAFAGVRTVVDVGGSSGDCLRAIMQRVPTVQRGVNFDLPEVVAKAP  285

Query  354  NIPGITHVGGDMFKSIPNGDAIFMK  428
              PG+THVGGDMFK+IP GDAIFMK
Sbjct  286  KYPGMTHVGGDMFKAIPAGDAIFMK  310



>gb|AAP03051.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=167

 Score =   175 bits (444),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 99/129 (77%), Gaps = 0/129 (0%)
 Frame = +3

Query  210  GYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDM  389
            GY GFEGV  LVDVGGS+GDCLRMI+ K+  I + INFDLPEVV KAP IPGITHVGG+ 
Sbjct  1    GYDGFEGVKTLVDVGGSSGDCLRMIINKYKDIPKAINFDLPEVVAKAPKIPGITHVGGNT  60

Query  390  FKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDYTHRTRL  569
            F+S+P+GDAIF+KW+LT + DEE   +M +C  AL  GGK+   EP LP  +D +HRTR 
Sbjct  61   FESVPSGDAIFVKWVLTCFTDEEVITLMRNCNKALPVGGKLICSEPTLPENSDESHRTRA  120

Query  570  LLVGDMFVM  596
            LLV D+F+M
Sbjct  121  LLVADIFIM  129



>ref|XP_002963872.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
 gb|ADE88151.1| caffeyl alcohol/5-hydroxyconiferyl alcohol 3/5-O-methyltransferase 
[Selaginella moellendorffii]
 gb|EFJ35743.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
Length=353

 Score =   179 bits (455),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 88/197 (45%), Positives = 122/197 (62%), Gaps = 2/197 (1%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  185
            +VL +     M+ W  +HEAV+D   EPF KA G+  +    +   +N L   AMS  S 
Sbjct  117  HVLMNQDKVFMETWQYLHEAVLDGG-EPFTKAFGQTEFELGKENSRVNNLFHAAMSNHSK  175

Query  186  PFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPG  365
             +M A L+ YHGF+G+  LVDVGG  G  L +I++K+P I +GINFDLP VV KAP IPG
Sbjct  176  LYMNAILEAYHGFKGIGTLVDVGGGVGTSLTVILKKYPEI-KGINFDLPHVVAKAPQIPG  234

Query  366  ITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQT  545
            + HVGGDMF S+P GDAIFMKW+L  W DE C  ++ +CY ++ + GK+   + +LP   
Sbjct  235  VEHVGGDMFVSVPQGDAIFMKWILHDWSDEACITLLKNCYKSIPEHGKVIVVDSVLPSVL  294

Query  546  DYTHRTRLLLVGDMFVM  596
            D     R+ L  D+ ++
Sbjct  295  DTGAGARVALSIDLLML  311



>ref|XP_002988275.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
 gb|EFJ10694.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
Length=353

 Score =   179 bits (454),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 88/197 (45%), Positives = 122/197 (62%), Gaps = 2/197 (1%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  185
            +VL +     M+ W  +HEAV+D   EPF KA G+  +    +   +N L   AMS  S 
Sbjct  117  HVLMNQDKVFMETWQYLHEAVLDGG-EPFTKAFGQTEFELGKENSRVNNLFHAAMSNHSK  175

Query  186  PFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPG  365
             +M A L+ YHGF+G+  LVDVGG  G  L +I++K+P I +GINFDLP VV KAP IPG
Sbjct  176  LYMNAILEAYHGFKGIGTLVDVGGGVGTSLAVILKKYPEI-KGINFDLPHVVAKAPQIPG  234

Query  366  ITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQT  545
            + HVGGDMF S+P GDAIFMKW+L  W DE C  ++ +CY ++ + GK+   + +LP   
Sbjct  235  VEHVGGDMFVSVPQGDAIFMKWILHDWSDEACITLLKNCYKSIPEHGKVIVVDSVLPSVL  294

Query  546  DYTHRTRLLLVGDMFVM  596
            D     R+ L  D+ ++
Sbjct  295  DTGAGARVALSIDLLML  311



>gb|AAP03057.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=188

 Score =   174 bits (440),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +3

Query  216  HGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFK  395
            +GFEGV  LVDVGGS+GDCLRMI+ K+  I + INFDLPEVV KAP IPGITHVGG+MF+
Sbjct  19   NGFEGVKTLVDVGGSSGDCLRMIINKYKDIPKAINFDLPEVVAKAPKIPGITHVGGNMFE  78

Query  396  SIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDYTHRTRLLL  575
            S+P+GDAIF+KW+LT + DEE   +M +C  AL  GGK+   EP LP  +D +HRTR LL
Sbjct  79   SVPSGDAIFVKWVLTCFTDEEVITLMRNCNKALPVGGKLICSEPTLPENSDESHRTRALL  138

Query  576  VGDMFVM  596
            V D+F+M
Sbjct  139  VADIFIM  145



>emb|CBI30187.3| unnamed protein product [Vitis vinifera]
Length=149

 Score =   172 bits (436),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = +3

Query  279  MIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTWMDEE  458
            MI++KH +I +GINFDLPEVV KAPNIPG+THVGGDMFKS+P+GDAIFMKW+LTTW DEE
Sbjct  1    MILQKHTNIKEGINFDLPEVVAKAPNIPGVTHVGGDMFKSVPDGDAIFMKWVLTTWTDEE  60

Query  459  CKEIMSSCYGALSQGGKMAACEPILPIQTDYTHRTRLLLVGDMFVM  596
            CK IM +CY AL  GGKM ACEP+LP ++D + RTR LL GD+FVM
Sbjct  61   CKLIMKNCYNALPVGGKMIACEPVLPKESDNSLRTRALLEGDIFVM  106



>ref|XP_010671332.1| PREDICTED: caffeic acid 3-O-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=365

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 119/198 (60%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +    MS  S
Sbjct  123  ALSLMNQDKILMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNNGMSNHS  181

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
               MK  LD Y GFEG++ LVDVGG  G  L MI+ KHP+I +GINFDLP V++ AP   
Sbjct  182  TITMKRILDTYKGFEGLSTLVDVGGGTGATLNMIISKHPTI-KGINFDLPHVIEDAPAYN  240

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF+S+P GDAIFMKW+   W DE C + + +CY +L   GK+  CE ILP+ 
Sbjct  241  GVEHVGGDMFESVPKGDAIFMKWICHDWSDEHCLKFLKNCYASLPDHGKVIVCEYILPVA  300

Query  543  TDYTHRTRLLLVGDMFVM  596
             +  H  R +   D  ++
Sbjct  301  PETNHAARTVFHVDAIML  318



>ref|XP_010027213.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Eucalyptus 
grandis]
Length=128

 Score =   170 bits (430),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 95/123 (77%), Gaps = 0/123 (0%)
 Frame = +3

Query  36   MKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGY  215
            M+AWPLVHEA+++ +SEPFVKANG+ AY++YGK PEMN LM +AMSGVSVPFMKA LDGY
Sbjct  1    MRAWPLVHEAMLNPTSEPFVKANGDTAYAHYGKNPEMNELMQQAMSGVSVPFMKAILDGY  60

Query  216  HGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFK  395
             GF  V RLVDVGGSA DCLRMI  KH  + +GINFDLP+VV K P IP   HV      
Sbjct  61   DGFSEVRRLVDVGGSARDCLRMIKGKHTHVREGINFDLPQVVAKVPPIPAEMHVSWSDRS  120

Query  396  SIP  404
            S+P
Sbjct  121  SVP  123



>ref|XP_010918594.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Elaeis guineensis]
Length=362

 Score =   176 bits (447),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 122/198 (62%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A VL +    L+ +W  + +AV++    PF KA+G  A+ Y+G  P  N +  + MS  +
Sbjct  125  ALVLMNQDKVLLDSWQHLKDAVLEGVI-PFTKAHGMTAFEYHGTDPRFNKVFNQGMSNHT  183

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
              F+K  LD Y GFE +  LVDVGG  G  L+MI+ K+P I QGINFDLP V+  AP IP
Sbjct  184  TLFVKKMLDTYKGFEDLKHLVDVGGGLGATLQMIVSKYPHI-QGINFDLPHVISGAPLIP  242

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF SIP+ DAIFMKW+L  W DE C +I+ +C+ AL   GK+   E +LP  
Sbjct  243  GVVHVGGDMFSSIPSADAIFMKWILHDWSDEHCLKILKNCWKALPNNGKVIVAECLLPEA  302

Query  543  TDYTHRTRLLLVGDMFVM  596
                  T++L  GD+ ++
Sbjct  303  PKANAETQVLYYGDLAML  320



>gb|AGO50639.1| caffeic acid O-methyltransferase [Linum usitatissimum]
Length=367

 Score =   176 bits (446),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 116/188 (62%), Gaps = 2/188 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  K MS  S
Sbjct  127  ALALMNQDKVLMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHS  185

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
               MK  L+ Y GF+ +  LVDVGG  G  L MI+ KHPSI +GINFDLP V++ AP +P
Sbjct  186  TITMKKILETYTGFDVLKSLVDVGGGTGAVLSMILSKHPSI-KGINFDLPHVIEDAPALP  244

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAIFMKW+   W D+ C + + +C+ AL   GK+  CE I+P+ 
Sbjct  245  GVQHVGGDMFASVPTGDAIFMKWICHDWSDQHCLKFLKNCFDALPANGKVIVCECIMPVA  304

Query  543  TDYTHRTR  566
             D +  TR
Sbjct  305  PDTSLATR  312



>gb|KJB23958.1| hypothetical protein B456_004G125600 [Gossypium raimondii]
Length=318

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 120/198 (61%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV++    PF KA G  A+ Y+G  P  N +  + MS  S
Sbjct  79   ALSLMNQDKVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHS  137

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
               MK  L+ Y GFEG+  LVDVGG  G  L MI+ KHPSI +GINFDLP V++ AP  P
Sbjct  138  TITMKKILETYDGFEGLKTLVDVGGGTGATLNMIVTKHPSI-KGINFDLPHVIEDAPAYP  196

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF+S+P GDAIFMKW+   W DE C + +  CY AL   GK+   E ILP  
Sbjct  197  GVEHVGGDMFESVPKGDAIFMKWICHDWSDEHCSKFLKKCYEALPDSGKVIVAECILPDY  256

Query  543  TDYTHRTRLLLVGDMFVM  596
             D +  T+L++  D  ++
Sbjct  257  PDPSLATKLVVHIDCIML  274



>gb|AGS49204.1| O-methyltransferase [Zea mays]
Length=364

 Score =   175 bits (443),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/198 (44%), Positives = 118/198 (60%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  + M   S
Sbjct  127  ALALMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNRVFNEGMKNHS  185

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            V   K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  P
Sbjct  186  VIITKKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFP  244

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAI MKW+L  W D  C  ++ +CY AL + GK+   E +LP+ 
Sbjct  245  GVRHVGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVN  304

Query  543  TDYTHRTRLLLVGDMFVM  596
            T+ T + R +   DM ++
Sbjct  305  TEATPKARGVFHVDMIML  322



>gb|ABI54117.1| caffeic acid O-methyltransferase [Malus domestica]
Length=365

 Score =   174 bits (442),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 86/185 (46%), Positives = 116/185 (63%), Gaps = 2/185 (1%)
 Frame = +3

Query  12   LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  191
            L +    LM++W  + +AV++    PF KA G  A+ Y+G  P  N +  K M+  S   
Sbjct  129  LMNQDKVLMESWYNLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNRVFNKGMADHSTIT  187

Query  192  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  371
            MK  L+ Y+GFEG+T +VDVGG  G  L MI+ K+PSI +GINFDLP V++ AP  PG+ 
Sbjct  188  MKKLLENYNGFEGLTSIVDVGGGTGAVLNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVE  246

Query  372  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDY  551
            HVGGDMF S+P GDAIFMKW+   W DE C + + +CY AL   GK+   E ILP+  D 
Sbjct  247  HVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDNGKVIVAECILPVAPDS  306

Query  552  THRTR  566
            +  T+
Sbjct  307  SLATK  311



>ref|XP_008380838.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=365

 Score =   174 bits (441),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 120/188 (64%), Gaps = 2/188 (1%)
 Frame = +3

Query  33   LMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDG  212
            LM++W  + +AV++    PF KA G  A+ Y+G +P  N +  K M+  S   MK  L+ 
Sbjct  136  LMESWYHLKDAVLEGGI-PFNKAYGMTAFEYHGTEPRFNKVFNKGMADNSTITMKKLLEN  194

Query  213  YHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMF  392
            Y+GFEG+T +VDVGG  G  L MI+ K+PSI +GINFDLP V++ AP  PG+ HVGGDMF
Sbjct  195  YNGFEGLTSIVDVGGGTGAVLNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVEHVGGDMF  253

Query  393  KSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDYTHRTRLL  572
             S+P GDAIFMKW+   W DE C + + +CY AL   GK+   E ILP+  D +  T+ +
Sbjct  254  VSVPKGDAIFMKWICHDWTDEHCLKFLKNCYAALPDNGKVIVAEYILPVAPDGSLATKEV  313

Query  573  LVGDMFVM  596
            +  D  ++
Sbjct  314  VHSDAIML  321



>gb|KJB23954.1| hypothetical protein B456_004G125600 [Gossypium raimondii]
Length=365

 Score =   174 bits (441),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 120/198 (61%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV++    PF KA G  A+ Y+G  P  N +  + MS  S
Sbjct  126  ALSLMNQDKVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHS  184

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
               MK  L+ Y GFEG+  LVDVGG  G  L MI+ KHPSI +GINFDLP V++ AP  P
Sbjct  185  TITMKKILETYDGFEGLKTLVDVGGGTGATLNMIVTKHPSI-KGINFDLPHVIEDAPAYP  243

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF+S+P GDAIFMKW+   W DE C + +  CY AL   GK+   E ILP  
Sbjct  244  GVEHVGGDMFESVPKGDAIFMKWICHDWSDEHCSKFLKKCYEALPDSGKVIVAECILPDY  303

Query  543  TDYTHRTRLLLVGDMFVM  596
             D +  T+L++  D  ++
Sbjct  304  PDPSLATKLVVHIDCIML  321



>gb|AGS49209.1| O-methyltransferase [Zea mays]
Length=364

 Score =   174 bits (441),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 118/198 (60%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  + M   S
Sbjct  127  ALALMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNRVFNEGMKNHS  185

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            V   K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  P
Sbjct  186  VIITKKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPQFP  244

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAI MKW+L  W D  C  ++ +CY AL + GK+   E +LP+ 
Sbjct  245  GVRHVGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVN  304

Query  543  TDYTHRTRLLLVGDMFVM  596
            T+ T + + +   DM ++
Sbjct  305  TEATPKAQGVFHVDMIML  322



>gb|ABI54118.1| caffeic acid O-methyltransferase [Malus domestica]
Length=365

 Score =   174 bits (441),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 120/188 (64%), Gaps = 2/188 (1%)
 Frame = +3

Query  33   LMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDG  212
            LM++W  + +AV++    PF KA G  A+ Y+G +P  N +  K M+  S   MK  L+ 
Sbjct  136  LMESWYHLKDAVLEGGI-PFNKAYGMTAFEYHGTEPRFNKVFNKGMADNSTITMKKLLEN  194

Query  213  YHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMF  392
            Y+GFEG+T +VDVGG  G  L MI+ K+PSI +GINFDLP V++ AP  PG+ HVGGDMF
Sbjct  195  YNGFEGLTSIVDVGGGTGAVLNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVEHVGGDMF  253

Query  393  KSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDYTHRTRLL  572
             S+P GDAIFMKW+   W DE C + + +CY AL   GK+   E ILP+  D +  T+ +
Sbjct  254  VSVPKGDAIFMKWICHDWTDEHCLKFLKNCYAALPDNGKVIVAEYILPVAPDGSLATKEV  313

Query  573  LVGDMFVM  596
            +  D  ++
Sbjct  314  VHSDAIML  321



>gb|KDP30064.1| hypothetical protein JCGZ_18389 [Jatropha curcas]
Length=365

 Score =   174 bits (441),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 87/185 (47%), Positives = 115/185 (62%), Gaps = 2/185 (1%)
 Frame = +3

Query  12   LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  191
            L +    LM++W  + EAV++    PF KA G  A+ Y+G  P  N +  K MS  S   
Sbjct  129  LMNQDKVLMESWYHLKEAVLEGGI-PFNKAYGMTAFEYHGTDPRFNTVFNKGMSDHSTIT  187

Query  192  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  371
            MK  L+ Y GFEG+T LVDVGG  G  + MI+ K+PS+ +GINFDLP V+Q AP+ PG+ 
Sbjct  188  MKKILETYKGFEGLTSLVDVGGGTGAVINMIVSKYPSL-KGINFDLPHVIQDAPSYPGVE  246

Query  372  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDY  551
            HVGGDMF S+P  DAIFMKW+   W DE C + + +CY AL   GK+   E ILP+  D 
Sbjct  247  HVGGDMFVSVPKADAIFMKWICHDWSDEHCLKFLKNCYNALPANGKVIVAECILPVAPDT  306

Query  552  THRTR  566
            +  T+
Sbjct  307  SLATK  311



>ref|XP_003602596.1| Caffeic acid 3-O-methyltransferase [Medicago truncatula]
 gb|AES72847.1| caffeic acid O-methyltransferase [Medicago truncatula]
Length=264

 Score =   171 bits (434),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 107/146 (73%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            ++ +QHHQD  ++AWPLV +AV D + EPF K +GE AY+Y  K PE   L   +MSG+S
Sbjct  118  SFFVQHHQDPYLRAWPLVGDAVEDPTVEPFEKLHGEAAYAYCTKGPEEMSLFYASMSGMS  177

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            +P+M+  L+ Y GF+GV  LVDVGG++G  L MIM K+P+I +GINFDLP+++  AP  P
Sbjct  178  LPYMREMLENYDGFKGVETLVDVGGNSGVSLNMIMNKYPNILKGINFDLPDMISSAPQYP  237

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLT  440
            GITHVGGD  +S+P GDAIF+K  L+
Sbjct  238  GITHVGGDALESVPAGDAIFIKVSLS  263



>gb|AFK48989.1| unknown [Medicago truncatula]
Length=367

 Score =   174 bits (441),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 87/190 (46%), Positives = 124/190 (65%), Gaps = 3/190 (2%)
 Frame = +3

Query  30   ALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLD  209
            AL+ +W    +AV+D   + F K NG   Y Y+GK P++N +  K+M+ ++   MK  L+
Sbjct  138  ALIGSWLNFKDAVLDPEIDLFKKVNGISKYEYFGKDPQINQIFNKSMTNMTKIHMKEILE  197

Query  210  GYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDM  389
             Y G+EG++ LVD+GG  G  L+MI+EK+PSI +GINFDLP+V++ A  IPGI HVGG M
Sbjct  198  KYKGYEGISTLVDIGGGNGQTLKMIIEKYPSI-KGINFDLPQVIENASPIPGIEHVGGSM  256

Query  390  FKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDYTHRTRL  569
            F+S+P GDAI +K +   W DE+C EI S+CY AL Q GK+   E  LP   + T+ +R 
Sbjct  257  FESVPQGDAIMLKAVCHNWSDEKCIEIFSNCYKALPQNGKVILVELALPECPEPTNASRF  316

Query  570  LLVGD--MFV  593
              + D  MF+
Sbjct  317  ASIIDNIMFI  326



>gb|ACJ84475.1| unknown [Medicago truncatula]
Length=367

 Score =   174 bits (441),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 87/190 (46%), Positives = 124/190 (65%), Gaps = 3/190 (2%)
 Frame = +3

Query  30   ALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLD  209
            AL+ +W    +AV+D   + F K NG   Y Y+GK P++N +  K+M+ ++   MK  L+
Sbjct  138  ALIGSWLNFKDAVLDPEIDLFKKVNGISKYEYFGKDPQINQIFNKSMTNMTKIHMKEILE  197

Query  210  GYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDM  389
             Y G+EG++ LVD+GG  G  L+MI+EK+PSI +GINFDLP+V++ A  IPGI HVGG M
Sbjct  198  KYKGYEGISTLVDIGGGNGQTLKMIIEKYPSI-KGINFDLPQVIENASPIPGIEHVGGSM  256

Query  390  FKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDYTHRTRL  569
            F+S+P GDAI +K +   W DE+C EI S+CY AL Q GK+   E  LP   + T+ +R 
Sbjct  257  FESVPQGDAIMLKAVCHNWSDEKCIEIFSNCYKALPQNGKVILVELALPECPEPTNASRF  316

Query  570  LLVGD--MFV  593
              + D  MF+
Sbjct  317  ASIIDNIMFI  326



>gb|ACT87981.1| caffeic acid O-methyltransferase [Jatropha curcas]
Length=365

 Score =   174 bits (440),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 87/185 (47%), Positives = 115/185 (62%), Gaps = 2/185 (1%)
 Frame = +3

Query  12   LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  191
            L +    LM++W  + EAV++    PF KA G  A+ Y+G  P  N +  K MS  S   
Sbjct  129  LMNQDKVLMESWYHLKEAVLEGGI-PFNKAYGMTAFEYHGTDPRFNTVFNKGMSDHSTIT  187

Query  192  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  371
            MK  L+ Y GFEG+T LVDVGG  G  + MI+ K+PS+ +GINFDLP V+Q AP+ PG+ 
Sbjct  188  MKKILETYKGFEGLTSLVDVGGGTGAVINMIVSKYPSL-KGINFDLPHVIQDAPSYPGVE  246

Query  372  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDY  551
            HVGGDMF S+P  DAIFMKW+   W DE C + + +CY AL   GK+   E ILP+  D 
Sbjct  247  HVGGDMFVSVPKADAIFMKWICHDWSDEHCLKFLKNCYSALPANGKVIVAECILPVAPDA  306

Query  552  THRTR  566
            +  T+
Sbjct  307  SLATK  311



>ref|XP_008362842.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=253

 Score =   171 bits (432),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 115/188 (61%), Gaps = 2/188 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            +  L +    LM++W  + + VV     PF KA G  A+ Y+G  P  N +  K M+  S
Sbjct  14   SLCLMNQDKVLMESWYHLKD-VVPEGGIPFNKACGMTAFEYHGTDPRFNKVFNKGMADHS  72

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
               MK  L+ Y+GFEG+T +VDVGG  G  L MI+ K+PSI +GINFDLP V++ AP  P
Sbjct  73   TITMKKLLENYNGFEGLTCIVDVGGGTGAILNMIVSKYPSI-KGINFDLPHVIEDAPQYP  131

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAIFMKW+   W DE C + + +CY AL   GK+   E ILP+ 
Sbjct  132  GVEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDNGKVIVAECILPVA  191

Query  543  TDYTHRTR  566
             D +  T+
Sbjct  192  PDSSLATK  199



>gb|KHG13289.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=365

 Score =   173 bits (439),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 120/198 (61%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV++    PF KA G  A+ Y+G  P  N +  + MS  S
Sbjct  126  ALSLMNQDKVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHS  184

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
               MK  L+ Y GFEG+  LVDVGG  G  L M++ KHPSI +GINFDLP V++ AP  P
Sbjct  185  TITMKKILETYDGFEGLKTLVDVGGGTGATLNMLVTKHPSI-KGINFDLPHVIEDAPAYP  243

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF+S+P GDAIFMKW+   W DE C + +  CY AL   GK+   E ILP  
Sbjct  244  GVEHVGGDMFESVPKGDAIFMKWICHDWSDEHCSKFLKKCYEALPDNGKVIVAECILPDY  303

Query  543  TDYTHRTRLLLVGDMFVM  596
             D +  T+L++  D  ++
Sbjct  304  PDPSLATKLVVHIDCIML  321



>gb|AGJ84131.1| putative caffeic acid O-methyltransferase [Hibiscus cannabinus]
Length=365

 Score =   173 bits (439),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/191 (46%), Positives = 118/191 (62%), Gaps = 2/191 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV++    PF KA G  A+ Y+G  P  N +  + MS  S
Sbjct  126  ALSLMNQDKVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHS  184

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
               MK  L+ Y GF+G+  LVDVGG  G  + MI+ KHPSI +GINFDLP V++ AP  P
Sbjct  185  TITMKKILETYDGFDGLKTLVDVGGGTGATINMIVSKHPSI-KGINFDLPHVIEDAPAYP  243

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF+S+P GDAIFMKW+   W DE C + ++ CY AL   GK+   E ILP  
Sbjct  244  GVEHVGGDMFESVPKGDAIFMKWICHDWSDEHCSKFLNKCYEALPDNGKVIVAECILPDY  303

Query  543  TDYTHRTRLLL  575
             D +  T+L++
Sbjct  304  PDASLATKLVV  314



>gb|ACN41351.2| putative caffeic acid O-methyltransferase [Betula pendula]
Length=365

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/198 (44%), Positives = 124/198 (63%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV++    PF KA+G  ++ Y+GK    N +  K MS  S
Sbjct  126  ALNLMNQDKVLMESWYYLKDAVLEGGI-PFNKAHGMTSFEYHGKDLRFNKVFNKGMSDHS  184

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
               MK  L+ Y GFEG+T +VDVGG  G  L MI+ K+PSI +GINFDLP V++ AP+ P
Sbjct  185  TITMKKILETYKGFEGLTSVVDVGGGTGAVLSMIVSKYPSI-RGINFDLPHVIEDAPSYP  243

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAIFMKW+   W DE C + + +CY AL   GK+   E ILP+ 
Sbjct  244  GVDHVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYDALPNNGKVIVAECILPVA  303

Query  543  TDYTHRTRLLLVGDMFVM  596
             D +  T+ ++  D+ ++
Sbjct  304  PDTSLATKGVIHIDVIML  321



>gb|AHM25237.1| noraucuparin O-methyltransferase [Sorbus aucuparia]
Length=365

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/185 (46%), Positives = 116/185 (63%), Gaps = 2/185 (1%)
 Frame = +3

Query  12   LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  191
            L +    LM++W  + +AV++    PF KA G  A+ Y+G  P  N +  K M+  S   
Sbjct  129  LMNQDKVLMESWYHLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMADHSTIT  187

Query  192  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  371
            MK  L+ Y+GFEG+T +VDVGG  G  L MI+ K+PSI +GINFDLP V++ AP  PG+ 
Sbjct  188  MKKLLEIYNGFEGLTSIVDVGGGTGAVLNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVE  246

Query  372  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDY  551
            HVGGDMF S+P GDAIFMKW+   W DE C + + +CY AL   GK+   E ILP+  D 
Sbjct  247  HVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDNGKVIVAECILPVAPDS  306

Query  552  THRTR  566
            +  T+
Sbjct  307  SLATK  311



>gb|KHG13754.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=387

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 118/191 (62%), Gaps = 2/191 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  + MS  S
Sbjct  148  ALSLMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHS  206

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
               MK  LD Y GF+G+  LVDVGG  G  L MI+ K+P+I +GINFDLP V++ AP+ P
Sbjct  207  TITMKKILDTYDGFQGLKTLVDVGGGTGATLSMIVSKYPTI-KGINFDLPHVIEDAPSCP  265

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAIFMKW+   W DE C + + +CY AL   GK+   E ILP  
Sbjct  266  GVEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCAKFLKNCYEALPDNGKVIVAECILPDY  325

Query  543  TDYTHRTRLLL  575
             D +  T+L++
Sbjct  326  PDPSLATKLVV  336



>gb|AGG91492.1| caffeic acid 3-O-methyltransferase [Betula platyphylla]
Length=365

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/198 (44%), Positives = 124/198 (63%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV++    PF KA+G  ++ Y+GK    N +  K MS  S
Sbjct  126  ALNLMNQDKVLMESWYYLKDAVLEGGI-PFNKAHGMTSFEYHGKDLRFNKVFNKGMSDHS  184

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
               MK  L+ Y GFEG+T +VDVGG  G  L MI+ K+PSI +GINFDLP V++ AP+ P
Sbjct  185  TITMKKILETYKGFEGLTSVVDVGGGTGAVLSMIVSKYPSI-RGINFDLPHVIEDAPSYP  243

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAIFMKW+   W DE C + + +CY AL   GK+   E ILP+ 
Sbjct  244  GVDHVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYDALPNNGKVIVAECILPVA  303

Query  543  TDYTHRTRLLLVGDMFVM  596
             D +  T+ ++  D+ ++
Sbjct  304  PDTSLATKGVIHIDVIML  321



>ref|XP_003621331.1| Isoliquiritigenin 2'-O-methyltransferase [Medicago truncatula]
 gb|AES77549.1| caffeic acid O-methyltransferase [Medicago truncatula]
Length=367

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/190 (46%), Positives = 123/190 (65%), Gaps = 3/190 (2%)
 Frame = +3

Query  30   ALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLD  209
            AL+  W    +AV+D   + F K NG   Y Y+GK P++N +  K+M+ ++   MK  L+
Sbjct  138  ALIGLWLNFKDAVLDPEIDLFKKVNGISKYEYFGKDPQINQIFNKSMTNMTKIHMKEILE  197

Query  210  GYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDM  389
             Y G+EG++ LVD+GG  G  L+MI+EK+PSI +GINFDLP+V++ A  IPGI HVGG M
Sbjct  198  KYKGYEGISTLVDIGGGNGQTLKMIIEKYPSI-KGINFDLPQVIENASPIPGIEHVGGSM  256

Query  390  FKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDYTHRTRL  569
            F+S+P GDAI +K +   W DE+C EI S+CY AL Q GK+   E  LP   + T+ +R 
Sbjct  257  FESVPQGDAIMLKAVCHNWSDEKCIEIFSNCYKALPQNGKVILVELALPECPEPTNASRF  316

Query  570  LLVGD--MFV  593
              + D  MF+
Sbjct  317  ASIIDNIMFI  326



>gb|AGS49206.1| O-methyltransferase [Zea mays]
Length=364

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 118/198 (60%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  + M   S
Sbjct  127  ALALMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNRVFNEGMKNHS  185

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            V   K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  P
Sbjct  186  VIITKKLLDFYTGFEGVSTLVDVGGGVGATLHAIASRHPHIS-GVNFDLPHVISEAPPFP  244

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAI MKW+L  W D  C  ++ +CY AL + GK+   E +LP+ 
Sbjct  245  GVRHVGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVN  304

Query  543  TDYTHRTRLLLVGDMFVM  596
            T+ T + + +   DM ++
Sbjct  305  TETTPKAQGVFHVDMIML  322



>gb|AAQ24345.1| O-methyltransferase [Zea mays]
 gb|AAQ24354.1| O-methyltransferase [Zea mays]
Length=358

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 118/198 (60%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  + M   S
Sbjct  127  ALALMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNRVFNEGMKNHS  185

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            V   K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  P
Sbjct  186  VIITKKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFP  244

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAI MKW+L  W D  C  ++ +CY AL + GK+   E +LP+ 
Sbjct  245  GVRHVGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVN  304

Query  543  TDYTHRTRLLLVGDMFVM  596
            T+ T + + +   DM ++
Sbjct  305  TEATPKAQGVFHVDMIML  322



>gb|AGS49202.1| O-methyltransferase [Zea mays]
Length=364

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 118/198 (60%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  + M   S
Sbjct  127  ALALMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNRVFNEGMKNHS  185

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            V   K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  P
Sbjct  186  VIITKKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFP  244

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAI MKW+L  W D  C  ++ +CY AL + GK+   E +LP+ 
Sbjct  245  GVRHVGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVN  304

Query  543  TDYTHRTRLLLVGDMFVM  596
            T+ T + + +   DM ++
Sbjct  305  TEATPKAQGVFHVDMIML  322



>gb|AAQ24337.1| O-methyltransferase [Zea mays]
 gb|AAQ24349.1| O-methyltransferase [Zea mays]
 gb|AAQ24352.1| O-methyltransferase [Zea mays]
 gb|AAQ24367.1| O-methyltransferase [Zea mays]
 gb|AAQ24369.1| O-methyltransferase [Zea mays]
Length=364

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 118/198 (60%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  + M   S
Sbjct  127  ALALMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNRVFNEGMKNHS  185

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            V   K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  P
Sbjct  186  VIITKKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFP  244

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAI MKW+L  W D  C  ++ +CY AL + GK+   E +LP+ 
Sbjct  245  GVRHVGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVN  304

Query  543  TDYTHRTRLLLVGDMFVM  596
            T+ T + + +   DM ++
Sbjct  305  TEATPKAQGVFHVDMIML  322



>ref|XP_008381500.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=433

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/195 (45%), Positives = 121/195 (62%), Gaps = 2/195 (1%)
 Frame = +3

Query  12   LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  191
            L +    LM++W  + +AV++    PF KA G  A+ Y+G  P  N +  K M+  S   
Sbjct  197  LMNQDKVLMESWYNLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMADHSTIT  255

Query  192  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  371
            MK  L+ Y+GFEG+T +VDVGG  G  L MI+ K+PSI +GINFDLP V++ AP  PG+ 
Sbjct  256  MKKLLENYNGFEGLTSIVDVGGGTGAVLXMIVSKYPSI-KGINFDLPHVIEDAPQYPGVE  314

Query  372  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDY  551
            HVGGDMF S+P GDAIFMKW+   W DE C + + +CY AL   GK+   E ILP+  D 
Sbjct  315  HVGGDMFVSVPKGDAIFMKWICHDWXDEHCLKFLKNCYAALPDNGKVIVAEYILPVAPDG  374

Query  552  THRTRLLLVGDMFVM  596
            +  T+ ++  D  ++
Sbjct  375  SLATKEVVHSDAIML  389



>gb|ACT32029.1| caffeic acid O-methyltransferase 2 [Gossypium hirsutum]
Length=365

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 119/198 (60%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV++    PF K  G  A+ Y+G  P  N +  + MS  S
Sbjct  126  ALSLMNQDKVLMESWYYLKDAVLEGGI-PFNKVYGMTAFEYHGTDPRFNKVFNRGMSDHS  184

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
               MK  L+ Y GFEG+  LVDVGG  G  L MI+ KHPSI +GINFDLP V++ AP  P
Sbjct  185  TITMKKILETYDGFEGLKTLVDVGGGTGATLNMIVTKHPSI-KGINFDLPHVIEDAPAYP  243

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF+S+P GDAIFMKW+   W DE C + +  CY AL   GK+   E ILP  
Sbjct  244  GVEHVGGDMFESVPKGDAIFMKWICHDWSDEHCSKFLKKCYEALPDSGKVIVAECILPDY  303

Query  543  TDYTHRTRLLLVGDMFVM  596
             D +  T+L++  D  ++
Sbjct  304  PDPSLATKLVVHIDCIML  321



>ref|XP_002864307.1| O-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40566.1| O-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
Length=362

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/195 (45%), Positives = 121/195 (62%), Gaps = 2/195 (1%)
 Frame = +3

Query  12   LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  191
            L      LM++W  + +A++D    PF KA G  A+ Y+G  P  N +    MS  S   
Sbjct  127  LTSQDKVLMESWYHLKDAILDGGI-PFNKAYGMSAFEYHGTDPRFNKVFNNGMSNHSTIT  185

Query  192  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  371
            MK  L+ Y GFEG+T LVDVGG  G  L+MI+ K+P++ +GINFDLP V++ AP+ PGI 
Sbjct  186  MKKILETYKGFEGLTSLVDVGGGIGATLKMIVSKYPNL-KGINFDLPHVIEDAPSHPGIE  244

Query  372  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDY  551
            HVGGDMF S+P GDAIFMKW+   W DE C + + +CY ALS+ GK+   E ILP   D 
Sbjct  245  HVGGDMFVSVPKGDAIFMKWICHDWSDEHCVKFLKNCYEALSEDGKVILAECILPETPDS  304

Query  552  THRTRLLLVGDMFVM  596
            +  T+ ++  D  ++
Sbjct  305  SLSTKQVVHVDCIML  319



>ref|XP_008803442.1| PREDICTED: caffeic acid 3-O-methyltransferase-like isoform X2 
[Phoenix dactylifera]
Length=330

 Score =   171 bits (434),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 119/198 (60%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A VL +    L+ +W  + +AV++    PF KA+G  A+ Y+G  P  N +  + M+  +
Sbjct  93   AMVLMNQDKVLLDSWQHLKDAVLEGVI-PFTKAHGMTAFEYHGTDPRFNKVFNQGMANHA  151

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
              F+K  LD Y GFEG+  LVDVGG  G  L MI  K+P I +GINFDLP V+ +AP IP
Sbjct  152  TLFVKKMLDTYEGFEGLKDLVDVGGGLGATLHMIASKYPHI-KGINFDLPHVISEAPVIP  210

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF SIP  DAIFMKW+L  W DE C  I+ +C+ AL   GK+   E +LP  
Sbjct  211  GVVHVGGDMFSSIPRADAIFMKWILHDWSDEHCLNILKNCWKALPDNGKVIVAECLLPEA  270

Query  543  TDYTHRTRLLLVGDMFVM  596
             +    T++    D+ ++
Sbjct  271  PETNAETQIRYYADLAML  288



>gb|AAQ24338.1| O-methyltransferase [Zea mays]
 gb|AAQ24360.1| O-methyltransferase [Zea mays]
Length=364

 Score =   172 bits (437),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 118/198 (60%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  + M   S
Sbjct  127  ALALMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNRVFDEGMKNHS  185

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            V   K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  P
Sbjct  186  VIIAKKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFP  244

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAI MKW+L  W D  C  ++ +CY AL + GK+   E +LP+ 
Sbjct  245  GVRHVGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVN  304

Query  543  TDYTHRTRLLLVGDMFVM  596
            T+ T + + +   DM ++
Sbjct  305  TEATPKAQGVFHVDMIML  322



>ref|XP_010241050.1| PREDICTED: caffeic acid 3-O-methyltransferase 1 [Nelumbo nucifera]
Length=364

 Score =   172 bits (437),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 112/177 (63%), Gaps = 2/177 (1%)
 Frame = +3

Query  9    VLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVP  188
            VL +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  + MS  S  
Sbjct  127  VLMNQDKVLMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTI  185

Query  189  FMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGI  368
             MK  L+ Y GFEG+  +VDVGG  G  L MI+ K+PSI +GINFDLP V++ AP+ PG+
Sbjct  186  TMKKILETYKGFEGLNSVVDVGGGTGATLNMIISKYPSI-KGINFDLPHVIEDAPSYPGV  244

Query  369  THVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPI  539
             HVGGDMF S+P GDAIFMKW+   W D  C E + +CY AL + GK+   E ILP+
Sbjct  245  EHVGGDMFVSVPKGDAIFMKWICHDWSDAHCLEFLKNCYQALPENGKIIVVESILPV  301



>gb|ABI54119.1| caffeic acid O-methyltransferase [Malus domestica]
Length=365

 Score =   172 bits (437),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 116/185 (63%), Gaps = 2/185 (1%)
 Frame = +3

Query  12   LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  191
            L +    LM++W  + +AV++    PF KA G  A+ Y+G  P  N +  K M+  S   
Sbjct  129  LMNQDKVLMESWYNLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMADHSTIT  187

Query  192  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  371
            MK  L+ Y+GFEG+T +VDVGG  G  L MI+ K+PSI +GINFDLP V++ AP  PG+ 
Sbjct  188  MKKLLENYNGFEGLTSIVDVGGGTGAVLNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVE  246

Query  372  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDY  551
            HVGGDMF S+P GDAIFMKW+   W DE C + + +C+ AL   GK+   E ILP+  D 
Sbjct  247  HVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCHAALPDNGKVIVAECILPVAPDT  306

Query  552  THRTR  566
            +  T+
Sbjct  307  SLATK  311



>gb|AGS49214.1| O-methyltransferase [Zea mays]
Length=364

 Score =   172 bits (437),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 118/198 (60%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  + M   S
Sbjct  127  ALALMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNRVFNEGMKNHS  185

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            V   K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  P
Sbjct  186  VIIAKKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFP  244

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAI MKW+L  W D  C  ++ +CY AL + GK+   E +LP+ 
Sbjct  245  GVRHVGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVS  304

Query  543  TDYTHRTRLLLVGDMFVM  596
            T+ T + + +   DM ++
Sbjct  305  TEATPKAQGVFHVDMIML  322



>gb|AGS49210.1| O-methyltransferase [Zea mays]
Length=364

 Score =   172 bits (435),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 118/198 (60%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  + M   S
Sbjct  127  ALALMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNRVFNEGMKNHS  185

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            V   K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  P
Sbjct  186  VIITKKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFP  244

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAI MKW+L  W D  C  ++ +CY AL + GK+   E +LP+ 
Sbjct  245  GVRHVGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVN  304

Query  543  TDYTHRTRLLLVGDMFVM  596
            T+ T + + +   DM ++
Sbjct  305  TEATPKAQGVFHVDMTML  322



>gb|AGS49190.1| O-methyltransferase [Zea mays]
Length=364

 Score =   172 bits (435),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 117/198 (59%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM+ W  + +AV+D    PF KA G  A+ Y+G  P  N +  + M   S
Sbjct  127  ALALMNQDKVLMENWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNRVFNEGMKNHS  185

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            V   K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  P
Sbjct  186  VIITKKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFP  244

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAI MKW+L  W D  C  ++ +CY AL + GK+   E +LP+ 
Sbjct  245  GVRHVGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVN  304

Query  543  TDYTHRTRLLLVGDMFVM  596
            T+ T + + +   DM ++
Sbjct  305  TEATPKAQGVFHVDMIML  322



>gb|AIJ28474.1| O-methyltransferase [Vaccinium corymbosum]
Length=370

 Score =   172 bits (436),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 86/196 (44%), Positives = 120/196 (61%), Gaps = 2/196 (1%)
 Frame = +3

Query  9    VLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVP  188
            +L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  + MS  S  
Sbjct  133  LLMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNQGMSNHSTI  191

Query  189  FMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGI  368
             MK  L+ Y GFEG+T LVDVGG  G  L MI  K+P+I +GINFDLP V++ AP  PG+
Sbjct  192  TMKKILEIYQGFEGLTSLVDVGGGTGATLHMIRSKYPTI-KGINFDLPHVIEDAPTYPGV  250

Query  369  THVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTD  548
             HVGGDMF S+P GDAIFMKW+   W DE C + + +CY AL   GK+   E  LP+  D
Sbjct  251  EHVGGDMFVSVPKGDAIFMKWICHDWSDEHCAKFLKNCYDALPNNGKVIVAECNLPVAPD  310

Query  549  YTHRTRLLLVGDMFVM  596
             +  ++ ++  D+ ++
Sbjct  311  TSLASKNVIHIDVIML  326



>ref|XP_002864309.1| O-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40568.1| O-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
Length=363

 Score =   172 bits (435),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 88/198 (44%), Positives = 122/198 (62%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +A++D    PF KA G  A+ Y+G  P  N +    MS  S
Sbjct  124  ALCLMNQDKVLMESWYHLKDAILDGGI-PFNKAYGMSAFEYHGTDPRFNKVFNNGMSNHS  182

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
               MK  L+ Y GFEG+T LVDVGG  G  L+MI+ K+P++ +GINFDLP V++ AP+ P
Sbjct  183  TITMKKILETYKGFEGLTSLVDVGGGIGATLKMIVSKYPNL-KGINFDLPHVIEDAPSHP  241

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            GI HVGGDMF S+P GDAIFMKW+   W DE C + + +CY AL + GK+   E ILP  
Sbjct  242  GIEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCVKFLKNCYEALPEDGKVILAECILPET  301

Query  543  TDYTHRTRLLLVGDMFVM  596
             D +  T+ ++  D  ++
Sbjct  302  PDSSLSTKQVVHVDCIML  319



>dbj|BAC78827.1| caffeic acid O-methyltransferase [Rosa chinensis var. spontanea]
Length=365

 Score =   172 bits (435),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 116/188 (62%), Gaps = 2/188 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    L+++W  + +AV+D    PF KA G  A+ Y+G  P  N +  K M+  S
Sbjct  126  ALCLMNQDKVLVESWYHLKDAVLDGGI-PFNKAYGMTAFDYHGTDPRFNKVFNKGMADHS  184

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
               MK  L+ Y GFEG+T +VDVGG  G  + MI+ K+PSI +GINFDLP V++ AP  P
Sbjct  185  TITMKKILETYKGFEGLTSIVDVGGGTGAVVNMIVSKYPSI-KGINFDLPHVIEDAPQYP  243

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAIFMKW+   W DE C + + +CY AL   GK+   E ILP+ 
Sbjct  244  GVQHVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDNGKVILGECILPVA  303

Query  543  TDYTHRTR  566
             D +  T+
Sbjct  304  PDTSLATK  311



>gb|AFM73597.1| caffeate O-methyltransferase, partial [Populus simonii]
Length=284

 Score =   170 bits (430),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 115/182 (63%), Gaps = 2/182 (1%)
 Frame = +3

Query  9    VLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVP  188
            VL +    LM++W  + +AV++    PF KA G  A+ Y+G  P  N +  + M+  S  
Sbjct  47   VLMNQDKVLMESWYHLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMADHSTI  105

Query  189  FMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGI  368
             MK  L+ Y+GFEG+ ++VDVGG  G  L MI+ K+P I +G NFDLP VV   P+ PG+
Sbjct  106  TMKKILETYNGFEGLKKVVDVGGGTGAILNMIISKYPHI-KGTNFDLPHVVADGPDYPGV  164

Query  369  THVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTD  548
             HVGGDMF S+P+GDAIFMKW+L  W DE C +I+ +CY AL   GK+   E ILP+  +
Sbjct  165  NHVGGDMFVSVPSGDAIFMKWILHDWSDEHCAKILKNCYKALPDSGKVIIAESILPVAPE  224

Query  549  YT  554
             T
Sbjct  225  TT  226



>gb|KFK27028.1| hypothetical protein AALP_AA8G324800 [Arabis alpina]
Length=365

 Score =   172 bits (435),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 87/198 (44%), Positives = 122/198 (62%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +A++D    PF KA G  A+ Y+G  P  N +    MS  S
Sbjct  126  ALCLMNQDKVLMESWYHLKDAILDGGI-PFNKAYGMSAFEYHGTDPRFNKVFNNGMSNHS  184

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
               MK  L+ Y GFEG+T LVDVGG  G  L+MI+ K+P++ +GINFDLP V+  AP+ P
Sbjct  185  TITMKKILETYKGFEGLTSLVDVGGGIGATLKMIVSKYPNL-KGINFDLPHVIDDAPSHP  243

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            GI HVGGDMF S+P GDAIFMKW+   W DE C++ + +CY AL + GK+   E I+P  
Sbjct  244  GIEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCEKFLKNCYEALPENGKVILAECIVPET  303

Query  543  TDYTHRTRLLLVGDMFVM  596
             D +  T+ ++  D  ++
Sbjct  304  LDSSLSTKQVVHVDCIML  321



>gb|AAQ24339.1| O-methyltransferase [Zea mays]
Length=364

 Score =   172 bits (435),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 117/198 (59%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  + M   S
Sbjct  127  ALALMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNRVFNEGMKDHS  185

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            V   K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  P
Sbjct  186  VIITKKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFP  244

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAI MKW+L  W D  C  ++ +CY AL + GK    E +LP+ 
Sbjct  245  GVRHVGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKAIVVECVLPVN  304

Query  543  TDYTHRTRLLLVGDMFVM  596
            T+ T + + +   DM ++
Sbjct  305  TEATPKAQGVFHVDMIML  322



>sp|Q8GU25.1|COMT1_ROSCH RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Rosa chinensis]
 emb|CAD29457.1| caffeic acid O-methyltransferase [Rosa chinensis]
Length=365

 Score =   172 bits (435),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 116/188 (62%), Gaps = 2/188 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    L+++W  + +AV+D    PF KA G  A+ Y+G  P  N +  K M+  S
Sbjct  126  ALCLMNQDKVLVESWYHLKDAVLDGGI-PFNKAYGMTAFDYHGTDPRFNKVFNKGMADHS  184

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
               MK  L+ Y GFEG+T +VDVGG  G  + MI+ K+PSI +GINFDLP V++ AP  P
Sbjct  185  TITMKKILETYKGFEGLTSIVDVGGGTGAVVNMIVSKYPSI-KGINFDLPHVIEDAPQYP  243

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAIFMKW+   W DE C + + +CY AL   GK+   E ILP+ 
Sbjct  244  GVQHVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDNGKVILGECILPVA  303

Query  543  TDYTHRTR  566
             D +  T+
Sbjct  304  PDTSLATK  311



>ref|XP_003634161.1| PREDICTED: caffeic acid 3-O-methyltransferase [Vitis vinifera]
Length=364

 Score =   172 bits (435),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 115/186 (62%), Gaps = 2/186 (1%)
 Frame = +3

Query  9    VLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVP  188
            +L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +    MSG S  
Sbjct  127  LLMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNNGMSGHSTI  185

Query  189  FMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGI  368
             MK  L+ Y GFEG+T +VDVGG  G  L MI+ K+P+I +GINFDLP V+  AP+ PG+
Sbjct  186  TMKKILEAYKGFEGLTSIVDVGGGTGATLNMIISKYPTI-KGINFDLPHVIDDAPSYPGV  244

Query  369  THVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTD  548
             +VGGDMF S+P GDAIFMKW+   W D  C + + +CY AL   GK+   E ILP+  D
Sbjct  245  ENVGGDMFVSVPKGDAIFMKWICHDWSDAHCLKFLKNCYQALPDNGKVIVAECILPVAPD  304

Query  549  YTHRTR  566
             +  T+
Sbjct  305  TSLATK  310



>ref|XP_008803441.1| PREDICTED: caffeic acid 3-O-methyltransferase-like isoform X1 
[Phoenix dactylifera]
Length=362

 Score =   171 bits (434),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 119/198 (60%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A VL +    L+ +W  + +AV++    PF KA+G  A+ Y+G  P  N +  + M+  +
Sbjct  125  AMVLMNQDKVLLDSWQHLKDAVLEGVI-PFTKAHGMTAFEYHGTDPRFNKVFNQGMANHA  183

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
              F+K  LD Y GFEG+  LVDVGG  G  L MI  K+P I +GINFDLP V+ +AP IP
Sbjct  184  TLFVKKMLDTYEGFEGLKDLVDVGGGLGATLHMIASKYPHI-KGINFDLPHVISEAPVIP  242

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF SIP  DAIFMKW+L  W DE C  I+ +C+ AL   GK+   E +LP  
Sbjct  243  GVVHVGGDMFSSIPRADAIFMKWILHDWSDEHCLNILKNCWKALPDNGKVIVAECLLPEA  302

Query  543  TDYTHRTRLLLVGDMFVM  596
             +    T++    D+ ++
Sbjct  303  PETNAETQIRYYADLAML  320



>gb|AAQ24355.1| O-methyltransferase [Zea mays]
Length=358

 Score =   171 bits (434),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 117/198 (59%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  + M   S
Sbjct  127  ALALMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNRVFNEGMKDHS  185

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            V   K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  P
Sbjct  186  VIITKKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFP  244

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAI MKW+L  W D  C  ++ +CY AL + GK    E +LP+ 
Sbjct  245  GVRHVGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKAIVVECVLPVN  304

Query  543  TDYTHRTRLLLVGDMFVM  596
            T+ T + + +   DM ++
Sbjct  305  TEATPKAQGVFHVDMIML  322



>gb|AAA80579.1| 3' flavonoid O-methyltransferase [Chrysosplenium americanum]
Length=343

 Score =   171 bits (433),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 120/198 (61%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  +      LM+ W  + +AV+D    PF KA G P + Y+ K    N +  K MS  S
Sbjct  102  ALCVAAQDKVLMECWYHMKDAVLDGGI-PFNKAYGMPIFDYFAKDLGSNKVFNKGMSDFS  160

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
               +K  L+ Y GF+G+T LVDVGG  G  L  I+ K+P+I +GINFDLP V+Q AP  P
Sbjct  161  SMIIKKILETYKGFQGLTSLVDVGGGTGATLTKILSKYPTI-RGINFDLPHVIQDAPEYP  219

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            GI HVGGDMF S+P GDAIFMKW+   W +E+C +++ +CY AL   GK+   E ILP+ 
Sbjct  220  GIEHVGGDMFVSVPKGDAIFMKWICHDWNEEQCLKLLKNCYDALPNNGKVIVAEYILPVV  279

Query  543  TDYTHRTRLLLVGDMFVM  596
             D +  ++L +  D+ ++
Sbjct  280  PDSSLASKLSVTADVMIV  297



>dbj|BAM05581.1| caffeic acid O-methyltransferase 1, partial [Eucalyptus pilularis]
Length=312

 Score =   170 bits (431),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 118/185 (64%), Gaps = 2/185 (1%)
 Frame = +3

Query  12   LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  191
            L +    L+++W  + +A+++    PF KA+G  A+ Y G  P  N +  +AMS  S   
Sbjct  110  LINQDRVLLESWYYLKDAILEGGI-PFNKAHGMTAFDYLGTDPRFNKIFNRAMSDHSTIT  168

Query  192  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  371
            MK  L+ Y+GFEG+  +VDVGG  G  L MI+ K+PSI +GINFDLP V++ AP+  G+ 
Sbjct  169  MKKILETYNGFEGLKTVVDVGGGTGAVLNMIVAKYPSI-KGINFDLPHVIEDAPSYRGVE  227

Query  372  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDY  551
            H+GGDMF +IPNGDAIFMKW+   W DE C +++ +CY AL   G++   E ILP+  D 
Sbjct  228  HIGGDMFVNIPNGDAIFMKWICHNWSDEHCAKLLKNCYDALPVNGRLIVAEYILPVYPDQ  287

Query  552  THRTR  566
            +  T+
Sbjct  288  SLSTK  292



>ref|XP_010482824.1| PREDICTED: flavone 3'-O-methyltransferase 1 [Camelina sativa]
Length=363

 Score =   171 bits (434),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 88/198 (44%), Positives = 121/198 (61%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +    MS  S
Sbjct  124  ALCLMNQDKVLMESWYHLKDAVLDGGI-PFNKAYGMSAFEYHGTDPRFNKVFNNGMSNHS  182

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
               MK  L+ Y GFEG+T LVDVGG  G  L+MI+ K+P++ +GINFDLP V+  AP+ P
Sbjct  183  TITMKKLLETYKGFEGLTSLVDVGGGIGATLKMIVSKYPNL-KGINFDLPHVIDDAPSHP  241

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            GI HVGGDMF S+P GDAIFMKW+   W DE C + + +CY AL + GK+   E ILP  
Sbjct  242  GIEHVGGDMFASVPKGDAIFMKWICHDWSDEHCVKFLKNCYEALPEDGKVILAECILPET  301

Query  543  TDYTHRTRLLLVGDMFVM  596
             D +  ++ ++  D  ++
Sbjct  302  PDSSLSSKQVIHVDCIML  319



>ref|XP_009418616.1| PREDICTED: tricetin 3',4',5'-O-trimethyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=362

 Score =   171 bits (433),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 88/198 (44%), Positives = 117/198 (59%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ YYG     N +  + M   S
Sbjct  125  ALTLMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMSAFEYYGADARFNKVFNEGMRNHS  183

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
                K  LD Y GFEGV  LVDVGG  G  L MI  KHP I +GINFDLP V+ +AP  P
Sbjct  184  TILTKKLLDIYRGFEGVKVLVDVGGGIGATLYMITTKHPRI-RGINFDLPHVISEAPPFP  242

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ H+GGDMF S+P GDAIFMKW+L  W DE C +I+ +C  AL + GK+   E +LP+ 
Sbjct  243  GVEHIGGDMFASVPRGDAIFMKWILHDWSDEHCTKILKNCCEALPEKGKVIVVECVLPVV  302

Query  543  TDYTHRTRLLLVGDMFVM  596
             + T R + +   D+ ++
Sbjct  303  PEPTPRAQGVFNIDLIML  320



>gb|AGS49196.1| O-methyltransferase [Zea mays]
Length=364

 Score =   171 bits (433),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 117/198 (59%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  + M   S
Sbjct  127  ALALMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNRVFNEGMKNHS  185

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            V   K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  P
Sbjct  186  VIITKKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFP  244

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S P GDAI MKW+L  W D  C  ++ +CY AL + GK+   E +LP+ 
Sbjct  245  GVRHVGGDMFASAPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVN  304

Query  543  TDYTHRTRLLLVGDMFVM  596
            T+ T + + +   DM ++
Sbjct  305  TEATPKAQGVFHVDMIML  322



>dbj|BAM05582.1| caffeic acid O-methyltransferase 2, partial [Eucalyptus pilularis]
Length=312

 Score =   169 bits (429),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 117/188 (62%), Gaps = 2/188 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV++    PF KA G  A+ Y+G  P  N +  + MS  S
Sbjct  108  ALNLMNQDKILMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHS  166

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
               MK  L+ Y+GFEG+  +VDVGG  G  L MI+ K+PSI +GINFDLP V++ AP +P
Sbjct  167  TITMKKILETYNGFEGLETVVDVGGGTGAVLSMIVAKYPSI-KGINFDLPHVIEDAPPLP  225

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAIFMKW+   W D+ C + + +CY AL   GK+   E +LP+ 
Sbjct  226  GVKHVGGDMFVSVPKGDAIFMKWICHDWSDDHCAKFLKNCYDALPNNGKVIVAECVLPVY  285

Query  543  TDYTHRTR  566
             D +  T+
Sbjct  286  PDTSLATK  293



>gb|AGW45465.1| beta-alanine n-methyltransferase, partial [Reaumuria trigyna]
Length=204

 Score =   166 bits (421),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 96/120 (80%), Gaps = 2/120 (2%)
 Frame = +3

Query  6    YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  185
            Y++QHHQDAL+++WPLVH AVVD  +EPFV+ANGE AY YYGK  EMN LM KAM+G SV
Sbjct  85   YIMQHHQDALVRSWPLVHMAVVDPVTEPFVRANGESAYWYYGKDEEMNELMQKAMAGFSV  144

Query  186  PFMKAFLD-GYHGFE-GVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNI  359
            PFM+  LD GY GFE  V RLVDVGGSAGDCL+MIM+K  +I +GINFDLP+VV   P I
Sbjct  145  PFMRELLDGGYDGFERDVERLVDVGGSAGDCLKMIMQKFGNIKEGINFDLPDVVAAGPPI  204



>gb|AEO14871.1| caffeic acid O-methyltransferase [Salvia miltiorrhiza]
Length=364

 Score =   171 bits (433),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 87/195 (45%), Positives = 121/195 (62%), Gaps = 2/195 (1%)
 Frame = +3

Query  12   LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  191
            L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  + MSG S   
Sbjct  130  LMNQDKVLMESWYHLKDAVLDGEI-PFNKAYGMSAFEYHGTDPRFNKVFNQGMSGHSTIT  188

Query  192  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  371
            MK  L+ Y GF+G+  +VDVGG  G  L MI+ K+PSI +GINFDLP V++ AP+ PG+ 
Sbjct  189  MKKILETYKGFDGLNSVVDVGGGIGATLHMIVSKYPSI-KGINFDLPHVIEDAPSYPGVE  247

Query  372  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDY  551
            HVGGDMF S+P GDAIFMKW+   W DE C + + +CY AL Q GK+   E +LP   D 
Sbjct  248  HVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYDALPQNGKVILAECVLPEAPDS  307

Query  552  THRTRLLLVGDMFVM  596
               T+ ++  D+ ++
Sbjct  308  GLATKNVVHIDVIML  322



>gb|ADE88153.1| caffeyl alcohol/5-hydroxyconiferyl alcohol 3/5-O-methyltransferase-like 
2 [Selaginella moellendorffii]
Length=357

 Score =   171 bits (432),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 120/198 (61%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            ++V+ +     MK W  ++++V  + ++PF  A+G+P +      P   G+   AMS  S
Sbjct  115  SWVIVNQDVVFMKTWEFLYQSVT-TGADPFTAAHGKPLFDLTADNPRFRGIFDSAMSDNS  173

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
              +M+  ++ Y GF+GV  LVDVGG  G+ LR+I+ +H  I +GINFDLP V+ KAP  P
Sbjct  174  NAYMRLIVEAYDGFQGVRTLVDVGGGIGNSLRVILGRHKGI-KGINFDLPHVISKAPAFP  232

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HV GDMF  +P GD IFMKW+L  W DE C  ++ +CY +L   GK+   + ILP  
Sbjct  233  GVEHVSGDMFDKVPQGDVIFMKWILHDWKDEACITLLKNCYESLPSRGKVVVVDSILPSG  292

Query  543  TDYTHRTRLLLVGDMFVM  596
            T+++  +R  L  D+ ++
Sbjct  293  TNHSFGSRFALNMDLLML  310



>gb|KJB52492.1| hypothetical protein B456_008G264900 [Gossypium raimondii]
Length=387

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 117/191 (61%), Gaps = 2/191 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G     N +  K MS  S
Sbjct  148  ALSLMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDTRFNKVFNKGMSDHS  206

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
               MK  LD Y GF+G+  LVDVGG  G  L MI+ K+P+I +GINFDLP V++ AP+ P
Sbjct  207  TITMKKILDTYDGFQGLKTLVDVGGGTGATLSMIVSKYPTI-KGINFDLPHVIEDAPSCP  265

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAIFMKW+   W DE C + + +CY AL   GK+   E ILP  
Sbjct  266  GVEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCAKFLKNCYEALPDNGKVIVAECILPDY  325

Query  543  TDYTHRTRLLL  575
             D +  T+L++
Sbjct  326  PDPSLATKLVV  336



>ref|XP_010442991.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Camelina sativa]
Length=363

 Score =   171 bits (433),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 120/198 (61%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +    MS  S
Sbjct  124  ALCLMNQDKVLMESWYHLKDAVLDGGI-PFNKAYGMSAFEYHGTDPRFNKVFNNGMSNHS  182

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
               MK  L+ Y GFEG+T LVDVGG  G  L+MI+ K+P I +GINFDLP V+  AP+ P
Sbjct  183  TITMKKLLETYKGFEGLTSLVDVGGGIGATLKMIVSKYP-ILKGINFDLPHVIDDAPSHP  241

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            GI HVGGDMF S+P GDAIFMKW+   W DE C + + +CY AL + GK+   E ILP  
Sbjct  242  GIEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCVKFLKNCYEALPEDGKVILAECILPET  301

Query  543  TDYTHRTRLLLVGDMFVM  596
             D +  ++ ++  D  ++
Sbjct  302  PDSSLSSKQVIHVDCIML  319



>ref|NP_200227.1| caffeic acid/5-hydroxyferulic acid O-methyltransferase [Arabidopsis 
thaliana]
 sp|Q9FK25.1|OMT1_ARATH RecName: Full=Flavone 3'-O-methyltransferase 1; Short=AtOMT1; 
AltName: Full=Caffeate O-methyltransferase 1; AltName: Full=Quercetin 
3'-O-methyltransferase 1 [Arabidopsis thaliana]
 dbj|BAB11578.1| O-methyltransferase [Arabidopsis thaliana]
 gb|AAL32915.1| O-methyltransferase [Arabidopsis thaliana]
 gb|AAM10127.1| O-methyltransferase [Arabidopsis thaliana]
 gb|AAM64849.1| O-methyltransferase [Arabidopsis thaliana]
 gb|AED96460.1| caffeic acid/5-hydroxyferulic acid O-methyltransferase [Arabidopsis 
thaliana]
Length=363

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/198 (44%), Positives = 122/198 (62%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +A++D    PF KA G  A+ Y+G  P  N +    MS  S
Sbjct  124  ALCLMNQDKVLMESWYHLKDAILDGGI-PFNKAYGMSAFEYHGTDPRFNKVFNNGMSNHS  182

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
               MK  L+ Y GFEG+T LVDVGG  G  L+MI+ K+P++ +GINFDLP V++ AP+ P
Sbjct  183  TITMKKILETYKGFEGLTSLVDVGGGIGATLKMIVSKYPNL-KGINFDLPHVIEDAPSHP  241

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            GI HVGGDMF S+P GDAIFMKW+   W DE C + + +CY +L + GK+   E ILP  
Sbjct  242  GIEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCVKFLKNCYESLPEDGKVILAECILPET  301

Query  543  TDYTHRTRLLLVGDMFVM  596
             D +  T+ ++  D  ++
Sbjct  302  PDSSLSTKQVVHVDCIML  319



>ref|XP_010446534.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Camelina sativa]
Length=363

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/198 (44%), Positives = 122/198 (62%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +    MS  S
Sbjct  124  ALCLMNQDKVLMESWYHLKDAVLDGGI-PFNKAYGMSAFEYHGTDPRFNKVFNNGMSNHS  182

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
               MK  L+ Y GFEG+T LVDVGG  G  L++I+ K+P++ +GINFDLP V+  AP+ P
Sbjct  183  TITMKKLLETYKGFEGLTSLVDVGGGIGATLKLIVSKYPNL-KGINFDLPHVIDDAPSHP  241

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            GI HVGGDMF S+P GDAIFMKW+   W DE C + + +CY AL + GK+   E ILP  
Sbjct  242  GIEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCVKFLKNCYEALPEDGKVILAECILPET  301

Query  543  TDYTHRTRLLLVGDMFVM  596
             D + +++ ++  D  ++
Sbjct  302  PDSSLKSKQVIHVDCIML  319



>dbj|BAM05583.1| caffeic acid O-methyltransferase 2, partial [Eucalyptus pyrocarpa]
Length=312

 Score =   169 bits (429),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 116/188 (62%), Gaps = 2/188 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV++    PF KA G  A+ Y+G  P  N +  + MS  S
Sbjct  108  ALNLMNQDKILMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHS  166

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
               MK  L+ Y GFEG+  +VDVGG  G  L MI+ K+PSI +GINFDLP V++ AP +P
Sbjct  167  TITMKKLLETYKGFEGLETVVDVGGGTGAVLSMIVAKYPSI-KGINFDLPHVIEDAPPLP  225

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAIFMKW+   W D+ C + + +CY AL   GK+   E +LP+ 
Sbjct  226  GVKHVGGDMFVSVPKGDAIFMKWICHDWSDDHCAKFLKNCYDALPNNGKVIVAECVLPVY  285

Query  543  TDYTHRTR  566
             D +  T+
Sbjct  286  PDTSLATK  293



>gb|KHN17090.1| Isoliquiritigenin 2'-O-methyltransferase [Glycine soja]
Length=342

 Score =   170 bits (430),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 121/189 (64%), Gaps = 3/189 (2%)
 Frame = +3

Query  33   LMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDG  212
            L++ W    EAVVD+  + F K +G   Y Y  K P+MN +  K+M+ V    M   L+ 
Sbjct  114  LLQVWLNFKEAVVDADIDLFKKLHGVTKYQYMEKDPKMNQIFNKSMADVCATEMTRILEI  173

Query  213  YHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMF  392
            Y GFEG++ LVDVGG  G  L+MI+ K+P I +GINFDLP+V++ AP +PGI HVGGDMF
Sbjct  174  YTGFEGISTLVDVGGGNGQNLKMILSKYPLI-KGINFDLPQVIENAPPLPGIEHVGGDMF  232

Query  393  KSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDYTHRTRLL  572
              +P GDAI +K +   W+DE+C E +S+C+ ALS  GK+   E ILP + + T  +RL+
Sbjct  233  VRVPQGDAIILKAVCHNWLDEKCLEFLSNCHKALSPNGKVIVVEFILPEEPEPTEASRLV  292

Query  573  LVGD--MFV  593
               D  MF+
Sbjct  293  STLDNLMFI  301



>gb|AGS49219.1| O-methyltransferase [Zea mays]
Length=364

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 118/198 (60%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  + +  + M   S
Sbjct  127  ALALMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFDRVFNEGMKNHS  185

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            V   K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  P
Sbjct  186  VIITKKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFP  244

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAI MKW+L  W D  C  ++ +CY AL + GK+   E +LP+ 
Sbjct  245  GVRHVGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVN  304

Query  543  TDYTHRTRLLLVGDMFVM  596
            T+ T + + +   DM ++
Sbjct  305  TEATPKAQGVFHVDMIML  322



>ref|XP_006280681.1| hypothetical protein CARUB_v10026645mg [Capsella rubella]
 gb|EOA13579.1| hypothetical protein CARUB_v10026645mg [Capsella rubella]
Length=363

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 120/198 (61%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +    MS  S
Sbjct  124  ALCLMNQDKVLMESWYHLKDAVLDGGI-PFNKAYGMSAFEYHGTDPRFNKVFNNGMSNHS  182

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
               MK FL+ Y GFEG+T LVDVGG  G  L MI+ K+P++ +GINFDL  V+  AP+ P
Sbjct  183  TIAMKKFLETYKGFEGLTSLVDVGGGIGATLNMIVSKYPNL-KGINFDLQHVIDDAPSYP  241

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            GI HVGGDMF S+P GDAIFMKW+   W DE C + + +CY AL + GK+   E ILP  
Sbjct  242  GIEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCVKFLKNCYEALPEDGKVILAECILPET  301

Query  543  TDYTHRTRLLLVGDMFVM  596
             D +  T+ ++  D  ++
Sbjct  302  PDSSLSTKQVVHVDCIML  319



>gb|AAQ67347.1| caffeic acid 3-O-methyltransferase [Saccharum hybrid cultivar]
 gb|AIX94080.1| caffeic acid-0-methyltransferase [Saccharum hybrid cultivar]
Length=362

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 117/198 (59%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  + M   S
Sbjct  125  ALTLMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNRVFNEGMKNHS  183

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            V   K  L+ Y GFEGV+ LVDVGG  G  L  I   HP I +GINFDLP V+ +AP  P
Sbjct  184  VIITKKLLEFYTGFEGVSTLVDVGGGIGATLHAITSHHPQI-KGINFDLPHVISEAPPFP  242

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMFKS+P GDAI MKW+L  W D  C  ++ +CY AL + GK+   E +LP+ 
Sbjct  243  GVQHVGGDMFKSVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVN  302

Query  543  TDYTHRTRLLLVGDMFVM  596
            T+   + + +   DM ++
Sbjct  303  TEAVPKAQGVFHVDMIML  320



>gb|AEO14870.1| caffeic acid O-methyltransferase [Salvia miltiorrhiza]
Length=364

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 113/179 (63%), Gaps = 2/179 (1%)
 Frame = +3

Query  12   LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  191
            L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  + MSG S   
Sbjct  130  LMNQDKVLMESWYHLKDAVLDGEI-PFNKAYGMSAFEYHGTDPRFNKVFNQGMSGHSTIT  188

Query  192  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  371
            MK  L+ Y GF+G+  +VDVGG  G  L MI+ K+PSI +GINFDLP V++ AP+ PG+ 
Sbjct  189  MKKILETYKGFDGLNSVVDVGGGIGATLHMIVSKYPSI-KGINFDLPHVIEDAPSYPGVE  247

Query  372  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTD  548
            HVGGDMF S+P GDAIFMKW+   W DE C + + +CY AL Q GK+   E +LP   D
Sbjct  248  HVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYDALPQNGKVILAECVLPEAPD  306



>gb|ADN27527.1| caffeic acid O-methyltransferase [Camellia sinensis]
Length=363

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 121/196 (62%), Gaps = 2/196 (1%)
 Frame = +3

Query  9    VLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVP  188
            +L +    LM++W  + + V++    PF KA G  A+ Y+G  P  N +  + MS  S  
Sbjct  126  LLMNQDKVLMESWYYLKDTVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNQGMSNHSTI  184

Query  189  FMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGI  368
             MK  LD Y GF+G+T +VDVGG  G  L MI+ KHP+I +GINFDLP V++ AP+ PG+
Sbjct  185  TMKKILDIYGGFDGLTTVVDVGGGTGATLNMIVSKHPTI-KGINFDLPHVIEDAPSYPGV  243

Query  369  THVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTD  548
             HVGGDMF S+P GDAIFMKW+   W D+ C + + +CY AL   GK+   E ILP+  D
Sbjct  244  EHVGGDMFVSVPKGDAIFMKWICHDWSDDHCLKFLKNCYDALPHNGKVIIAECILPVAPD  303

Query  549  YTHRTRLLLVGDMFVM  596
                T+ ++  D+ ++
Sbjct  304  TKLATKNVVHIDVIML  319



>ref|XP_007136428.1| hypothetical protein PHAVU_009G044400g [Phaseolus vulgaris]
 gb|ESW08422.1| hypothetical protein PHAVU_009G044400g [Phaseolus vulgaris]
Length=365

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 116/188 (62%), Gaps = 2/188 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  K M+  S
Sbjct  126  ALNLMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMADHS  184

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
               MK  L+ Y GFEG+  LVDVGG  G  + MI+ K+P+I +GINFDLP V++ AP+ P
Sbjct  185  TITMKKILETYTGFEGLKSLVDVGGGTGAIINMIVSKYPNI-KGINFDLPHVIEDAPSYP  243

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P  DA+FMKW+   W DE C + + +CY AL + GK+   E ILP+ 
Sbjct  244  GVEHVGGDMFVSVPKADAVFMKWICHDWSDEHCLKFLKNCYDALPENGKVIVAECILPVA  303

Query  543  TDYTHRTR  566
             D +  T+
Sbjct  304  PDSSLATK  311



>gb|ABI54120.1| caffeic acid O-methyltransferase [Malus domestica]
Length=365

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 118/188 (63%), Gaps = 2/188 (1%)
 Frame = +3

Query  33   LMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDG  212
            LM++W  + +AV++    PF KA G  A+ Y+G  P  N +  K M+  S   MK  L+ 
Sbjct  136  LMESWYHLKDAVLEGGI-PFNKAYGITAFEYHGTDPRFNKVFNKGMADNSTITMKKLLEN  194

Query  213  YHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMF  392
            Y+GFEG+T +VDVGG  G  L MI+ K+PSI +GINFDLP V++ AP  PG+ HVGGDMF
Sbjct  195  YNGFEGLTSIVDVGGGTGAVLNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVEHVGGDMF  253

Query  393  KSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDYTHRTRLL  572
             S+  GDAIFMKW+   W DE C + + +CY AL   GK+   E ILP+  D +  T+ +
Sbjct  254  VSVSKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDNGKVIVAEYILPVAPDGSLATKEV  313

Query  573  LVGDMFVM  596
            +  D  ++
Sbjct  314  VHSDAIML  321



>ref|XP_003536383.1| PREDICTED: isoliquiritigenin 2'-O-methyltransferase-like [Glycine 
max]
Length=369

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 121/189 (64%), Gaps = 3/189 (2%)
 Frame = +3

Query  33   LMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDG  212
            L++ W    EAVVD+  + F K +G   Y Y  K P+MN +  K+M+ V    M   L+ 
Sbjct  141  LLQVWLNFKEAVVDADIDLFKKLHGVTKYQYMEKDPKMNQIFNKSMADVCATEMTRILEI  200

Query  213  YHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMF  392
            Y GFEG++ LVDVGG  G  L+MI+ K+P I +GINFDLP+V++ AP +PGI HVGGDMF
Sbjct  201  YTGFEGISTLVDVGGGNGQNLKMILSKYPLI-KGINFDLPQVIENAPPLPGIEHVGGDMF  259

Query  393  KSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDYTHRTRLL  572
              +P GDAI +K +   W+DE+C E +S+C+ ALS  GK+   E ILP + + T  +RL+
Sbjct  260  VRVPQGDAIILKAVCHNWLDEKCLEFLSNCHKALSPNGKVIVVEFILPEEPEPTEASRLV  319

Query  573  LVGD--MFV  593
               D  MF+
Sbjct  320  STLDNLMFI  328



>gb|ABG27066.1| caffeic acid O-methyltransferase [Boehmeria nivea]
Length=365

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 113/185 (61%), Gaps = 2/185 (1%)
 Frame = +3

Query  12   LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  191
            L +    LM++W  + +AV++    PF KA G  A+ Y+G  P  N +  + MS  S   
Sbjct  129  LMNQDKVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTIT  187

Query  192  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  371
            MK  L+ Y GFEG+  +VDVGG  G  L MI+  +PSI +GINFDLP V++ AP  PG+ 
Sbjct  188  MKKLLETYKGFEGLNSVVDVGGGTGAVLSMIVSNYPSI-KGINFDLPHVIEDAPAYPGVE  246

Query  372  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDY  551
            HVGGDMF S+P GDAIFMKW+   W DE C + + SCY AL   GK+   E ILP+  D 
Sbjct  247  HVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKSCYDALPNNGKVIVAECILPVAPDT  306

Query  552  THRTR  566
            +  T+
Sbjct  307  SLATK  311



>ref|XP_010934981.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Elaeis guineensis]
Length=240

 Score =   167 bits (422),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 115/198 (58%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L      LM++W    +AV+D    PF KA G  A+ Y+G  P  N +  + M   S
Sbjct  3    ALALVDQDKVLMESWYYSKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFSEGMKNHS  61

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            +   K  L+ Y GFE V  LVDVGG  G  L MI  K+P I +GINFDLP V+ +AP  P
Sbjct  62   IIITKKLLEFYKGFEDVNVLVDVGGGIGATLHMITSKYPHI-KGINFDLPHVISEAPPFP  120

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P+GDAI MKW++  W DE C +I+ +CY AL   GK+  CE ILP+ 
Sbjct  121  GVEHVGGDMFTSVPSGDAILMKWIMHDWSDEHCAKILENCYKALPNNGKVILCECILPVA  180

Query  543  TDYTHRTRLLLVGDMFVM  596
             +     + +   DM ++
Sbjct  181  PEPVPSAQSVFHLDMIML  198



>ref|XP_007218166.1| hypothetical protein PRUPE_ppa007511mg [Prunus persica]
 gb|EMJ19365.1| hypothetical protein PRUPE_ppa007511mg [Prunus persica]
Length=365

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 115/185 (62%), Gaps = 2/185 (1%)
 Frame = +3

Query  12   LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  191
            L +    L+++W  + +AV++    PF KA G  A+ Y+G  P  N +  + M+  S   
Sbjct  129  LMNQDKVLVESWYHLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMADHSTIT  187

Query  192  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  371
            MK  L+ Y GFEG+T +VDVGG  G  L MI+ K+PSI +GINFDLP V++ AP  PGI 
Sbjct  188  MKKILETYKGFEGLTSVVDVGGGTGAVLNMIVSKYPSI-KGINFDLPHVIEDAPQYPGIN  246

Query  372  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDY  551
            HVGGDMF S+P GDAIFMKW+   W DE C + + +CY AL   GK+   E ILP+  D 
Sbjct  247  HVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDNGKVILGECILPVAPDS  306

Query  552  THRTR  566
            +  T+
Sbjct  307  SLATK  311



>sp|O82054.1|COMT1_SACOF RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Saccharum officinarum]
 emb|CAA13175.1| caffeic acid 3-O-Methyltransferase [Saccharum officinarum]
Length=362

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 117/198 (59%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  + M   S
Sbjct  125  ALTLMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNRVFNEGMKNHS  183

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            V   K  L+ Y GFEGV+ LVDVGG  G  L  I   HP I +GINFDLP V+ +AP  P
Sbjct  184  VIITKKLLEFYTGFEGVSTLVDVGGGIGATLHAITSHHPQI-KGINFDLPHVISEAPPFP  242

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMFKS+P GDAI MKW+L  W D  C  ++ +CY AL + GK+   E +LP+ 
Sbjct  243  GVQHVGGDMFKSVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIIVECVLPVN  302

Query  543  TDYTHRTRLLLVGDMFVM  596
            T+   + + +   DM ++
Sbjct  303  TEAVPKAQGVFHVDMIML  320



>gb|AER35881.1| S-adenosyl-L-methionine:flavonoid O-methyltransferase [Ginkgo 
biloba]
Length=362

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/196 (42%), Positives = 121/196 (62%), Gaps = 2/196 (1%)
 Frame = +3

Query  9    VLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVP  188
            VL +     M++W  + +AV+D S +PF KA+G  A+ Y  K P  N +  +AM+  S  
Sbjct  124  VLMNQDKVFMESWYYLKDAVLDGS-QPFTKAHGVNAFEYPAKDPRFNNVFNRAMAEHSTM  182

Query  189  FMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGI  368
             M+  LD Y GF+ V  +VDVGG  G  L +I+ K+P I +G+NFD+P VV +AP  PG+
Sbjct  183  LMQKILDTYPGFKDVQEIVDVGGGIGSTLNLIVSKYPHI-KGVNFDMPHVVAEAPQSPGL  241

Query  369  THVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTD  548
             HVGGDMF S+P+G AIFMKW+L  W DE C  ++ +C+ AL +GGK+   + ILP+  +
Sbjct  242  RHVGGDMFDSVPSGQAIFMKWILHDWSDEHCLRLLKNCHKALPEGGKVIVVDSILPVAAE  301

Query  549  YTHRTRLLLVGDMFVM  596
             +   R     D+ ++
Sbjct  302  TSPYARQAFHCDLLML  317



>ref|XP_009392797.1| PREDICTED: flavone O-methyltransferase 1-like [Musa acuminata 
subsp. malaccensis]
Length=362

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 117/198 (59%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF +A G  A+ Y+G  P  N +    M   S
Sbjct  125  ALALMNQDKVLMESWYYLKDAVLDGGI-PFNRAYGMTAFEYHGTDPRFNAVFNDGMKNHS  183

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            +   K  LD Y GF+ V RLVDVGG  G  L MI  KHP I   INFDLP V+ +AP  P
Sbjct  184  IIITKKLLDIYRGFDDVNRLVDVGGGIGATLFMITSKHPHI-HAINFDLPHVISEAPPFP  242

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P+GDAI MKW+L  W DE C +I+ SC+ AL + GK+   E +LP+ 
Sbjct  243  GVEHVGGDMFASVPSGDAILMKWILHDWSDEHCAKILKSCWEALPEKGKVIVVECVLPVV  302

Query  543  TDYTHRTRLLLVGDMFVM  596
             + T R + +   D+ ++
Sbjct  303  PEPTPRAQGVFHVDLIML  320



>ref|XP_002525818.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF36570.1| o-methyltransferase, putative [Ricinus communis]
Length=365

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 113/185 (61%), Gaps = 2/185 (1%)
 Frame = +3

Query  12   LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  191
            L +    LM++W  + +AV+     PF KA G  A+ Y+G  P  N +  + MS  S   
Sbjct  129  LMNQDKVLMESWYYLKDAVL-LGGIPFNKAYGMTAFDYHGTDPRFNKVFNRGMSDHSTIT  187

Query  192  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  371
            MK  L+ Y GFEG+T +VDVGG  G  L MI+ K+PSI +G NFDLP V++ AP+ PG+ 
Sbjct  188  MKKILETYKGFEGLTSVVDVGGGTGAVLSMIVSKYPSI-KGTNFDLPHVIEDAPSFPGVE  246

Query  372  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDY  551
            HVGGDMF S+P GDAIFMKW+   W DE C   + +CY AL   GK+   E ILP+  D 
Sbjct  247  HVGGDMFASVPKGDAIFMKWICHDWSDEHCLNFLKNCYDALPANGKVIVAECILPVAPDS  306

Query  552  THRTR  566
            +  T+
Sbjct  307  SLATK  311



>gb|AGS49187.1| O-methyltransferase [Zea mays]
Length=364

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 117/198 (59%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G     N +  + M   S
Sbjct  127  ALALMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDARFNRVFNEGMKNHS  185

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            V   K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  P
Sbjct  186  VIITKKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFP  244

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAI MKW+L  W D  C  ++ +CY AL + GK+   E +LP+ 
Sbjct  245  GVRHVGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVN  304

Query  543  TDYTHRTRLLLVGDMFVM  596
            T+ T + + +   DM ++
Sbjct  305  TEATPKAQGVFHVDMIML  322



>gb|AGF25396.1| caffeic acid 3-O-methyltransferase [Zea nicaraguensis]
Length=364

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 117/198 (59%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G     N +  + M   S
Sbjct  127  ALALMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDARFNRVFNEGMKNHS  185

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            V   K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  P
Sbjct  186  VIITKKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFP  244

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAI MKW+L  W D  C  ++ +CY AL + GK+   E +LP+ 
Sbjct  245  GVRHVGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVN  304

Query  543  TDYTHRTRLLLVGDMFVM  596
            T+ T + + +   DM ++
Sbjct  305  TEATPKAQGVFHVDMIML  322



>sp|Q06509.1|COMT1_MAIZE RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Zea mays]
 gb|AAB03364.1| O-methyltransferase [Zea mays]
 gb|AAQ24346.1| O-methyltransferase [Zea mays]
 gb|AAQ24347.1| O-methyltransferase [Zea mays]
 gb|AGS49180.1| O-methyltransferase [Zea mays]
 gb|AGS49218.1| O-methyltransferase [Zea mays]
Length=364

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 117/198 (59%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G     N +  + M   S
Sbjct  127  ALALMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDARFNRVFNEGMKNHS  185

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            V   K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  P
Sbjct  186  VIITKKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFP  244

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAI MKW+L  W D  C  ++ +CY AL + GK+   E +LP+ 
Sbjct  245  GVRHVGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVN  304

Query  543  TDYTHRTRLLLVGDMFVM  596
            T+ T + + +   DM ++
Sbjct  305  TEATPKAQGVFHVDMIML  322



>gb|AGS49191.1| O-methyltransferase [Zea mays]
Length=364

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 117/198 (59%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G     N +  + M   S
Sbjct  127  ALALMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDARFNRVFNEGMKNHS  185

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            V   K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  P
Sbjct  186  VIITKKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFP  244

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAI MKW+L  W D  C  ++ +CY AL + GK+   E +LP+ 
Sbjct  245  GVRHVGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVN  304

Query  543  TDYTHRTRLLLVGDMFVM  596
            T+ T + + +   DM ++
Sbjct  305  TEATPKAQGVFHVDMIML  322



>gb|AAQ24343.1| O-methyltransferase [Zea mays]
 gb|AAQ24353.1| O-methyltransferase [Zea mays]
 gb|AAQ24364.1| O-methyltransferase [Zea mays]
Length=359

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 117/198 (59%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G     N +  + M   S
Sbjct  127  ALALMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDSRFNRVFNEGMKNHS  185

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            V   K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  P
Sbjct  186  VIITKKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFP  244

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAI MKW+L  W D  C  ++ +CY AL + GK+   E +LP+ 
Sbjct  245  GVRHVGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVN  304

Query  543  TDYTHRTRLLLVGDMFVM  596
            T+ T + + +   DM ++
Sbjct  305  TEATPKAQGVFHVDMIML  322



>gb|AGS49185.1| O-methyltransferase [Zea mays]
Length=364

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 117/198 (59%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G     N +  + M   S
Sbjct  127  ALALMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDARFNRVFNEGMKNHS  185

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            V   K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  P
Sbjct  186  VIITKKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFP  244

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAI MKW+L  W D  C  ++ +CY AL + GK+   E +LP+ 
Sbjct  245  GVRHVGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVN  304

Query  543  TDYTHRTRLLLVGDMFVM  596
            T+ T + + +   DM ++
Sbjct  305  TEATPKAQGVFHVDMIML  322



>gb|AAQ24342.1| O-methyltransferase [Zea mays]
Length=359

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 117/198 (59%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G     N +  + M   S
Sbjct  127  ALALMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDARFNRVFNEGMKNHS  185

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            V   K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  P
Sbjct  186  VIITKKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFP  244

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAI MKW+L  W D  C  ++ +CY AL + GK+   E +LP+ 
Sbjct  245  GVRHVGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVN  304

Query  543  TDYTHRTRLLLVGDMFVM  596
            T+ T + + +   DM ++
Sbjct  305  TEATPKAQGVFHVDMIML  322



>gb|AAQ24344.1| O-methyltransferase [Zea mays]
 gb|AAQ24358.1| O-methyltransferase [Zea mays]
 gb|AAQ24362.1| O-methyltransferase [Zea mays]
Length=359

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 117/198 (59%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G     N +  + M   S
Sbjct  127  ALALMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDARFNRVFNEGMKNHS  185

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            V   K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  P
Sbjct  186  VIITKKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFP  244

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAI MKW+L  W D  C  ++ +CY AL + GK+   E +LP+ 
Sbjct  245  GVRHVGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVN  304

Query  543  TDYTHRTRLLLVGDMFVM  596
            T+ T + + +   DM ++
Sbjct  305  TEATPKAQGVFHVDMIML  322



>dbj|BAG71895.1| 5-hydroxyconiferaldehyde O-methyltransferase [Carthamus tinctorius]
Length=356

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/196 (46%), Positives = 118/196 (60%), Gaps = 2/196 (1%)
 Frame = +3

Query  9    VLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVP  188
            +L +    LM++W  + +AV+D    PF KA G  A+ Y+GK    N +    M   S  
Sbjct  121  LLMNQDKILMESWYHLKDAVLDGGI-PFNKAYGMSAFEYHGKDERFNKVFNSGMFNHSTM  179

Query  189  FMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGI  368
             MK  LD Y GF GV  LVDVGG  G  L MI+ KHPSI +GINFDLP V+Q A N PGI
Sbjct  180  TMKKILDVYPGFNGVKTLVDVGGGTGASLSMILSKHPSI-KGINFDLPHVIQDATNYPGI  238

Query  369  THVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTD  548
             HVGGDMF+S+P GDAIFMKW+   W D  C + + +CY AL + GK+   E ILP   D
Sbjct  239  EHVGGDMFESVPKGDAIFMKWICHDWSDAHCLKFLKNCYKALPENGKVIVAECILPETPD  298

Query  549  YTHRTRLLLVGDMFVM  596
             +  T+ ++  D+ ++
Sbjct  299  SSLATKNVVHIDVIML  314



>gb|AGS49211.1| O-methyltransferase [Zea mays]
Length=364

 Score =   170 bits (430),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 117/198 (59%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G     N +  + M   S
Sbjct  127  ALALMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDSRFNRVFNEGMKNHS  185

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            V   K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  P
Sbjct  186  VIITKKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFP  244

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAI MKW+L  W D  C  ++ +CY AL + GK+   E +LP+ 
Sbjct  245  GVRHVGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVN  304

Query  543  TDYTHRTRLLLVGDMFVM  596
            T+ T + + +   DM ++
Sbjct  305  TEATPKAQGVFHVDMIML  322



>ref|NP_001106047.1| catechol O-methyltransferase [Zea mays]
 gb|AAQ24340.1| O-methyltransferase [Zea mays]
 gb|AAQ24341.1| O-methyltransferase [Zea mays]
 gb|ABQ58826.1| flavonoid O-methyltransferase [Zea mays]
 gb|AFW61191.1| brown midrib3 [Zea mays]
 gb|AGS49212.1| O-methyltransferase [Zea mays]
Length=364

 Score =   170 bits (430),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 117/198 (59%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G     N +  + M   S
Sbjct  127  ALALMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDSRFNRVFNEGMKNHS  185

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            V   K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  P
Sbjct  186  VIITKKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFP  244

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAI MKW+L  W D  C  ++ +CY AL + GK+   E +LP+ 
Sbjct  245  GVRHVGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVN  304

Query  543  TDYTHRTRLLLVGDMFVM  596
            T+ T + + +   DM ++
Sbjct  305  TEATPKAQGVFHVDMIML  322



>gb|AAQ01670.1| catechol O-methyltransferase [Papaver somniferum]
Length=360

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 115/182 (63%), Gaps = 2/182 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A +L +    LM++W  + +A++D    PF KA G  A+ Y+GK    N +  K MS  +
Sbjct  122  ALLLMNQDKVLMESWYHLKDAILDGGI-PFNKAYGVHAFEYHGKDLRFNKVFNKGMSDHT  180

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
               M   L+ Y GFEG+  +VDVGG  G  + MI+ K+P+I QGINFDLP V+Q AP+ P
Sbjct  181  TITMNKILETYKGFEGLNSIVDVGGGVGATVSMIISKYPTI-QGINFDLPHVIQDAPSFP  239

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            GI HVGGDMF S+PN DAIFMKW+L  W DE   +I+ +CY AL + GK+   E I+P  
Sbjct  240  GIKHVGGDMFASVPNADAIFMKWILHDWSDEHSVKILKNCYDALPKNGKVIIVECIIPEV  299

Query  543  TD  548
            +D
Sbjct  300  SD  301



>gb|AGS49194.1| O-methyltransferase [Zea mays]
Length=364

 Score =   170 bits (430),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 117/198 (59%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G     N +  + M   S
Sbjct  127  ALALMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDARFNRVFNEGMKNHS  185

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            V   K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  P
Sbjct  186  VIITKKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFP  244

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAI MKW+L  W D  C  ++ +CY AL + GK+   E +LP+ 
Sbjct  245  GVRHVGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVN  304

Query  543  TDYTHRTRLLLVGDMFVM  596
            T+ T + + +   DM ++
Sbjct  305  TEATPKAQGVFHVDMIML  322



>ref|XP_006478090.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Citrus sinensis]
 gb|KDO46359.1| hypothetical protein CISIN_1g017777mg [Citrus sinensis]
Length=366

 Score =   170 bits (430),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/195 (44%), Positives = 119/195 (61%), Gaps = 2/195 (1%)
 Frame = +3

Query  12   LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  191
            L +    LM++W  + +AV++    PF KA G  A+ Y+GK    N +    MS  S   
Sbjct  130  LMNQDKVLMESWYYLKDAVLEGGI-PFNKAYGMNAFDYHGKDLRFNKIFNNGMSSHSTIT  188

Query  192  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  371
            MK  L+ Y GFEG+  +VDVGG  G  L MI+ K+PSI +GINFDLP V+Q AP  PG+ 
Sbjct  189  MKKILENYKGFEGLNSVVDVGGGIGATLNMIISKYPSI-KGINFDLPHVIQDAPAFPGVE  247

Query  372  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDY  551
            HVGGDMF S+P GDAIF+KW+   W DE C + + +CY AL   GK+   E ILP+  D 
Sbjct  248  HVGGDMFVSVPKGDAIFIKWICHDWSDEHCVKFLKNCYEALPVNGKVIVAESILPVTPDT  307

Query  552  THRTRLLLVGDMFVM  596
            +  +++++  D  ++
Sbjct  308  SLASKVVIHVDCIML  322



>gb|AID68566.1| caffeic O-methyltransferase [Punica granatum]
Length=370

 Score =   170 bits (430),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 116/185 (63%), Gaps = 2/185 (1%)
 Frame = +3

Query  12   LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  191
            L +    LM++W  + +A+++    PF KA G  A+ Y+G  P  N +  + MS  S   
Sbjct  134  LMNQDKVLMESWYHLKDAILEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTIT  192

Query  192  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  371
            MK  L+ Y GFEG+  +VDVGG  G  L MI+ K+PSI +GINFDLP V++ AP++PG+ 
Sbjct  193  MKKILETYKGFEGLNTIVDVGGGTGAVLSMIVAKYPSI-KGINFDLPHVIEDAPSLPGVE  251

Query  372  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDY  551
            HVGGDMF S+P GDAIFMKW+   W DE C + + +CY AL   GK+   E ILP+  D 
Sbjct  252  HVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDHGKVIVAECILPLSPDP  311

Query  552  THRTR  566
            +  T+
Sbjct  312  SLATK  316



>gb|AGS49186.1| O-methyltransferase [Zea mays]
Length=364

 Score =   170 bits (430),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 117/198 (59%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G     N +  + M   S
Sbjct  127  ALALMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDARFNRVFNEGMKNHS  185

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            V   K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  P
Sbjct  186  VIITKKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFP  244

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAI MKW+L  W D  C  ++ +CY AL + GK+   E +LP+ 
Sbjct  245  GVRHVGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVN  304

Query  543  TDYTHRTRLLLVGDMFVM  596
            T+ T + + +   DM ++
Sbjct  305  TEATPKAQGVFHVDMIML  322



>dbj|BAM05579.1| caffeic acid O-methyltransferase 1, partial [Eucalyptus globulus 
subsp. globulus]
Length=313

 Score =   168 bits (426),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 117/185 (63%), Gaps = 2/185 (1%)
 Frame = +3

Query  12   LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  191
            L       +++W  + +A+++    PF KA+G  A+ Y G  P  N +  +AMS  S   
Sbjct  111  LIDQDRVFLESWYYMKDAILEGGI-PFHKAHGMTAFDYPGTDPRFNKIFNRAMSDHSTIM  169

Query  192  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  371
            MK  L+ Y+GFEG+  +VDVGG  G  L MI+ K+PSI +GINFDLP V++ AP+ PG+ 
Sbjct  170  MKKILETYNGFEGLKTVVDVGGGTGAMLNMIVAKYPSI-KGINFDLPHVIEDAPSYPGVE  228

Query  372  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDY  551
            HVGGDMF +IPNGDA+FMKW+   W DE C +++ +CY AL   G++   E ILP+  D 
Sbjct  229  HVGGDMFVNIPNGDAVFMKWICHDWSDEHCAKLLKNCYDALPVNGRVIVAEYILPVYPDQ  288

Query  552  THRTR  566
            +  T+
Sbjct  289  SLSTK  293



>gb|AAQ24348.1| O-methyltransferase [Zea mays]
 gb|AAQ24350.1| O-methyltransferase [Zea mays]
 gb|AAQ24356.1| O-methyltransferase [Zea mays]
 gb|AAQ24363.1| O-methyltransferase [Zea mays]
 gb|AAQ24365.1| O-methyltransferase [Zea mays]
 gb|AAQ24366.1| O-methyltransferase [Zea mays]
 gb|AAQ24368.1| O-methyltransferase [Zea mays]
 gb|AAQ24370.1| O-methyltransferase [Zea mays]
Length=358

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 117/198 (59%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G     N +  + M   S
Sbjct  127  ALALMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDARFNRVFNEGMKNHS  185

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            V   K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  P
Sbjct  186  VIITKKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFP  244

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAI MKW+L  W D  C  ++ +CY AL + GK+   E +LP+ 
Sbjct  245  GVRHVGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVN  304

Query  543  TDYTHRTRLLLVGDMFVM  596
            T+ T + + +   DM ++
Sbjct  305  TEATPKAQGVFHVDMIML  322



>sp|Q9XGW0.1|COMT1_OCIBA RecName: Full=Caffeic acid 3-O-methyltransferase 1; Short=CAOMT-1; 
Short=COMT-1; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase 1 [Ocimum basilicum]
 gb|AAD38189.1|AF154917_1 caffeic acid O-methyltransferase [Ocimum basilicum]
Length=361

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 120/196 (61%), Gaps = 2/196 (1%)
 Frame = +3

Query  9    VLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVP  188
             L +    LM++W  + +AVVD    PF KA G  A+ Y+G  P  N +  + MS  S  
Sbjct  126  TLMNQDKVLMESWYHLSDAVVDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNQGMSNHSTI  184

Query  189  FMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGI  368
             MK  L+ Y GF+G+  +VDVGG  G  L MI+ K+PSI +GINFDLP V++ AP+ PG+
Sbjct  185  TMKKILETYTGFDGLKTVVDVGGGTGATLNMIVSKYPSI-KGINFDLPHVIEDAPSYPGV  243

Query  369  THVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTD  548
             HVGGDMF S+P GDAIFMKW+   W DE C + + +CY AL Q GK+   E +LP   D
Sbjct  244  EHVGGDMFVSVPKGDAIFMKWICHDWSDEHCVKFLKNCYDALPQNGKVILAECVLPEAPD  303

Query  549  YTHRTRLLLVGDMFVM  596
                T+ ++  D+ ++
Sbjct  304  TGLATKNVVHIDVIML  319



>gb|AAQ24361.1| O-methyltransferase [Zea mays]
Length=359

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 117/198 (59%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G     N +  + M   S
Sbjct  127  ALALMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDARFNRVFNEGMKNHS  185

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            V   K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  P
Sbjct  186  VIITKKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFP  244

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAI MKW+L  W D  C  ++ +CY AL + GK+   E +LP+ 
Sbjct  245  GVRHVGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVN  304

Query  543  TDYTHRTRLLLVGDMFVM  596
            T+ T + + +   DM ++
Sbjct  305  TEATPKAQGVFHVDMIML  322



>ref|XP_007039215.1| Caffeic acid 3-O-methyltransferase 1 [Theobroma cacao]
 gb|EOY23716.1| Caffeic acid 3-O-methyltransferase 1 [Theobroma cacao]
Length=365

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 115/188 (61%), Gaps = 2/188 (1%)
 Frame = +3

Query  12   LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  191
            L +    LM++W  + +AV++    PF KA G  A+ Y+G  P  N +  + M+  S   
Sbjct  129  LMNQDKVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMNDHSTTT  187

Query  192  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  371
            M+  L+ Y GFEGV  LVDVGG  G  L MI+ KHPSI +GINFDLP V++ AP  PG+ 
Sbjct  188  MRKILETYDGFEGVKTLVDVGGGIGASLSMIISKHPSI-KGINFDLPHVIEDAPAYPGVE  246

Query  372  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDY  551
            HVGGDMF S+P GDAIFMKW+   W DE C + + +CY AL   GK+   E  LP   D 
Sbjct  247  HVGGDMFVSVPKGDAIFMKWICHDWSDEHCSKFLKNCYQALPDNGKVIVAECNLPDYPDP  306

Query  552  THRTRLLL  575
            +  T+L++
Sbjct  307  SLATKLVV  314



>gb|AGS49197.1| O-methyltransferase [Zea mays]
Length=364

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 117/198 (59%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  + M   S
Sbjct  127  ALALMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNRVFNEGMKNHS  185

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            V   K  LD Y GFEGV+ LVDVGG  G  L  I   HP I+ G+NF+LP V+ +AP  P
Sbjct  186  VIITKKLLDFYTGFEGVSTLVDVGGGVGATLHAITSHHPHIS-GVNFNLPHVISEAPPFP  244

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAI MKW+L  W D  C  ++ +CY AL + GK+   E +LP+ 
Sbjct  245  GVRHVGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVN  304

Query  543  TDYTHRTRLLLVGDMFVM  596
            T+ T + + +   DM ++
Sbjct  305  TEATPKAQGVFHVDMIML  322



>gb|ADK97702.1| putative caffeic acid O-methyltransferase [Citrus aurantium]
Length=366

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/195 (44%), Positives = 119/195 (61%), Gaps = 2/195 (1%)
 Frame = +3

Query  12   LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  191
            L +    LM++W  + +AV++    PF KA G  A+ Y+GK    N +    MS  S   
Sbjct  130  LMNQDKVLMESWYYLKDAVLEGGI-PFNKAYGMNAFDYHGKDLRFNKIFNNGMSSHSTIT  188

Query  192  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  371
            MK  L+ Y GFEG+  +VDVGG  G  L MI+ K+PSI +GINFDLP V+Q AP  PG+ 
Sbjct  189  MKKILENYKGFEGLNSVVDVGGGIGATLNMIISKYPSI-KGINFDLPHVIQDAPAFPGVE  247

Query  372  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDY  551
            HVGGDMF S+P GDAIF+KW+   W DE C + + +CY AL   GK+   E ILP+  D 
Sbjct  248  HVGGDMFVSVPKGDAIFIKWICHDWSDEHCVKFLKNCYEALPVNGKVIVAESILPVTPDT  307

Query  552  THRTRLLLVGDMFVM  596
            +  +++++  D  ++
Sbjct  308  SLASKVVIHVDCIML  322



>gb|AGS49216.1| O-methyltransferase [Zea mays]
Length=364

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 117/198 (59%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  + M   S
Sbjct  127  ALALMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNRVFNEGMKNHS  185

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            V   K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ + P  P
Sbjct  186  VIITKKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISETPPFP  244

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAI +KW+L  W D  C  ++ +CY AL + GK+   E +LP+ 
Sbjct  245  GVRHVGGDMFASVPAGDAILVKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVN  304

Query  543  TDYTHRTRLLLVGDMFVM  596
            T+ T + + +   DM ++
Sbjct  305  TEATPKAQGVFHVDMIML  322



>gb|AAQ24351.1| O-methyltransferase [Zea mays]
 gb|AAQ24357.1| O-methyltransferase [Zea mays]
 gb|AAQ24359.1| O-methyltransferase [Zea mays]
Length=358

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 117/198 (59%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G     N +  + M   S
Sbjct  127  ALALMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDSRFNRVFNEGMKNHS  185

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            V   K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  P
Sbjct  186  VIITKKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFP  244

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAI MKW+L  W D  C  ++ +CY AL + GK+   E +LP+ 
Sbjct  245  GVRHVGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVN  304

Query  543  TDYTHRTRLLLVGDMFVM  596
            T+ T + + +   DM ++
Sbjct  305  TEATPKAQGVFHVDMIML  322



>ref|NP_001266643.1| quercetin 3-O-methyltransferase 1 [Zea mays]
 gb|ACG37598.1| quercetin 3-O-methyltransferase 1 [Zea mays]
Length=364

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 117/198 (59%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G     N +  + M   S
Sbjct  127  ALALMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDSRFNRVFNEGMKNHS  185

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            V   K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  P
Sbjct  186  VIITKKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFP  244

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAI MKW+L  W D  C  ++ +CY AL + GK+   E +LP+ 
Sbjct  245  GVRHVGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVN  304

Query  543  TDYTHRTRLLLVGDMFVM  596
            T+ T + + +   DM ++
Sbjct  305  TEATPKAQGVFHVDMIML  322



>gb|AGS49195.1| O-methyltransferase [Zea mays]
Length=364

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 117/198 (59%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G     N +  + M   S
Sbjct  127  ALALMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDSRFNRVFNEGMKNHS  185

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            V   K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  P
Sbjct  186  VIITKKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFP  244

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAI MKW+L  W D  C  ++ +CY AL + GK+   E +LP+ 
Sbjct  245  GVRHVGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVN  304

Query  543  TDYTHRTRLLLVGDMFVM  596
            T+ T + + +   DM ++
Sbjct  305  TEATPKAQGVFHVDMIML  322



>sp|Q43609.1|COMT1_PRUDU RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Prunus dulcis]
 emb|CAA58218.1| caffeic O-methyltransferase [Prunus dulcis]
Length=365

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 115/185 (62%), Gaps = 2/185 (1%)
 Frame = +3

Query  12   LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  191
            L +    L+++W  + +AV++    PF KA G  A+ Y+G  P  N +  + M+  S   
Sbjct  129  LMNQDKVLLESWYHLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMADHSTIT  187

Query  192  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  371
            MK  L+ Y GFEG+T +VDVGG  G  L MI+ K+PSI +GINFDLP V++ AP  PG+ 
Sbjct  188  MKKILETYKGFEGLTSVVDVGGGTGAVLNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVE  246

Query  372  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDY  551
            HVGGDMF S+P GDAIFMKW+   W DE C + + +CY AL   GK+   E ILP+  D 
Sbjct  247  HVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDNGKVILGECILPVAPDS  306

Query  552  THRTR  566
            +  T+
Sbjct  307  SLATK  311



>gb|AGS49215.1| O-methyltransferase [Zea mays]
Length=364

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 117/198 (59%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+  +G  P  N +  + M   S
Sbjct  127  ALALMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFENHGTDPRFNRVFNEGMKNHS  185

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            V   K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  P
Sbjct  186  VIITKKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFP  244

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAI MKW+L  W D  C  ++ +CY AL + GK+   E +LP+ 
Sbjct  245  GVRHVGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVN  304

Query  543  TDYTHRTRLLLVGDMFVM  596
            T+ T + + +   DM ++
Sbjct  305  TEATPKAQGVFHVDMIML  322



>gb|AAC18863.1| caffeic acid 3-O-methyltransferase [Mesembryanthemum crystallinum]
Length=350

 Score =   169 bits (428),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 87/198 (44%), Positives = 115/198 (58%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +    MS  S
Sbjct  111  ALSLMNQDKILMESWYHLKDAVLDGGI-PFNKAYGMSAFEYHGTDPRFNKVFNSGMSNHS  169

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
               MK  LD Y GFEG++ LVDVGG       MI+ KH +I +GINFDLP V++ AP  P
Sbjct  170  TITMKKILDDYQGFEGLSTLVDVGGRHWGYPNMIISKHTTI-KGINFDLPHVIEDAPAYP  228

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HV GDMF S+P GDAIFMKW+   W DE C   + +CY AL   GK+  CE ILP+ 
Sbjct  229  GVEHVEGDMFVSVPKGDAIFMKWICHDWSDEHCLSFLKNCYAALPNHGKVIVCEYILPVA  288

Query  543  TDYTHRTRLLLVGDMFVM  596
             + +H  R +   D  ++
Sbjct  289  PETSHAARTVFHVDAIML  306



>sp|Q43046.1|COMT1_POPKI RecName: Full=Caffeic acid 3-O-methyltransferase 1; Short=CAOMT-1; 
Short=COMT-1; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase 1 [Populus sieboldii x Populus 
grandidentata]
 dbj|BAA08558.1| caffeic acid O-methyltransferase [Populus kitakamiensis]
Length=365

 Score =   169 bits (429),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/195 (43%), Positives = 121/195 (62%), Gaps = 2/195 (1%)
 Frame = +3

Query  12   LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  191
            L +    LM++W  + +A+++    PF KA G  A+ Y+G  P  N +  K MS  S   
Sbjct  129  LMNQDKVLMESWYYLKDAILEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTIT  187

Query  192  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  371
            MK  L+ Y GFEG+T LVDVGG  G  +  I+ K+PSI +GINFDLP V++ AP+ PG+ 
Sbjct  188  MKKILETYKGFEGLTSLVDVGGGTGAVVNTIVSKYPSI-KGINFDLPHVIEDAPSYPGVE  246

Query  372  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDY  551
            HVGGDMF S+PN DA+FMKW+   W D  C + + +CY AL + GK+   E ILP+  D 
Sbjct  247  HVGGDMFVSVPNADAVFMKWICHDWSDAHCLKFLKNCYDALPENGKVILVECILPVAPDT  306

Query  552  THRTRLLLVGDMFVM  596
            +  T+ ++  D+ ++
Sbjct  307  SLATKGVVHVDVIML  321



>dbj|BAM05584.1| caffeic acid O-methyltransferase 2, partial [Eucalyptus globulus 
subsp. globulus]
Length=312

 Score =   168 bits (425),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 116/188 (62%), Gaps = 2/188 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV++    PF KA G  A+ Y+G  P  N +  + MS  S
Sbjct  108  ALNLMNQDKILMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKIFNRGMSDHS  166

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
               MK  L+ Y GFEG+  +VDVGG  G  L MI+ K+PS+ +GINFDLP V++ AP +P
Sbjct  167  TITMKKILETYKGFEGLETVVDVGGGTGAVLSMIVAKYPSM-KGINFDLPHVIEDAPPLP  225

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAIFMKW+   W D+ C + + +CY AL   GK+   E +LP+ 
Sbjct  226  GVKHVGGDMFVSVPKGDAIFMKWICHDWSDDHCAKFLKNCYDALPNNGKVIVAECVLPVY  285

Query  543  TDYTHRTR  566
             D +  T+
Sbjct  286  PDTSLATK  293



>ref|XP_006829216.1| hypothetical protein AMTR_s00001p00272250 [Amborella trichopoda]
 gb|ERM96632.1| hypothetical protein AMTR_s00001p00272250 [Amborella trichopoda]
Length=358

 Score =   169 bits (428),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 114/180 (63%), Gaps = 2/180 (1%)
 Frame = +3

Query  9    VLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVP  188
            VL +    LM++W  + +AV++    PF +A G  A+ Y+GK P  N +  + MS  S  
Sbjct  123  VLMNQDKVLMESWYHLKDAVLEGGV-PFNRAYGMTAFEYHGKDPRFNKVFNRGMSDHSTI  181

Query  189  FMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGI  368
             MK  LD Y GFEG+  +VDVGG  G  L MI+ K+  I +GINFDLP V+  AP  PG+
Sbjct  182  TMKKILDDYPGFEGLNCIVDVGGGIGATLNMIVGKYGHI-KGINFDLPHVIADAPEFPGV  240

Query  369  THVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTD  548
            THVGGDMF+S+P GDAIFMKW+L  W DE C +++ +CY AL   GK+   E ILPI  +
Sbjct  241  THVGGDMFESVPTGDAIFMKWILHDWGDEYCHKLLKNCYKALPDSGKVIIAESILPIAAE  300



>ref|XP_004137204.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cucumis sativus]
 gb|KGN53621.1| hypothetical protein Csa_4G091880 [Cucumis sativus]
Length=359

 Score =   169 bits (428),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 120/195 (62%), Gaps = 2/195 (1%)
 Frame = +3

Query  12   LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  191
            L +    LM++W  + +AV++    PF +A G  A+ Y+G  P  N +  K MS  S   
Sbjct  123  LMNQDKVLMESWYHLKDAVLEGGI-PFNRAYGMSAFEYHGTDPRFNKVFNKGMSDHSTIT  181

Query  192  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  371
            MK  L+ Y GFEG+  +VDVGG  G  L MI+ K+PSI +GINFDLP V+Q AP  PG+ 
Sbjct  182  MKKILETYKGFEGLNSVVDVGGGTGAVLNMIVSKYPSI-RGINFDLPHVIQDAPPYPGVE  240

Query  372  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDY  551
            HVGGDMF S+P GDAIFMKW+   W D  C + + +CY AL + GK+   E ILP+  D 
Sbjct  241  HVGGDMFVSVPKGDAIFMKWICHDWSDHHCLKFLKNCYDALPEHGKVIVAECILPLAPDA  300

Query  552  THRTRLLLVGDMFVM  596
            +  T+ ++  D+ ++
Sbjct  301  SLATKGVIHIDLIML  315



>gb|AAD50440.1|AF168777_1 caffeic acid O-methyltransferase [Eucalyptus globulus]
Length=312

 Score =   168 bits (425),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 116/188 (62%), Gaps = 2/188 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV++    PF KA G  A+ Y+G  P  N +  + MS  S
Sbjct  108  ALNLMNQDKILMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKIFNRGMSDHS  166

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
               MK  L+ Y GFEG+  +VDVGG  G  L MI+ K+PS+ +GINFDLP V++ AP +P
Sbjct  167  TITMKKILETYKGFEGLETVVDVGGGTGAVLSMIVAKYPSM-KGINFDLPHVIEDAPPLP  225

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAIFMKW+   W D+ C + + +CY AL   GK+   E +LP+ 
Sbjct  226  GVKHVGGDMFVSVPKGDAIFMKWICHDWSDDHCAKFLKNCYDALPNNGKVIVAECVLPVY  285

Query  543  TDYTHRTR  566
             D +  T+
Sbjct  286  PDTSLATK  293



>ref|XP_008462913.1| PREDICTED: caffeic acid 3-O-methyltransferase 1 [Cucumis melo]
Length=359

 Score =   169 bits (428),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 120/195 (62%), Gaps = 2/195 (1%)
 Frame = +3

Query  12   LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  191
            L +    LM++W  + +AV++    PF +A G  A+ Y+G  P  N +  K MS  S   
Sbjct  123  LMNQDKVLMESWYHLKDAVLEGGI-PFNRAYGISAFEYHGTDPRFNKVFNKGMSDHSTIT  181

Query  192  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  371
            MK  L+ Y GFEG+  +VDVGG  G  L MI+ K+PSI +GINFDLP V+Q AP  PG+ 
Sbjct  182  MKKILETYKGFEGLNSVVDVGGGTGAVLNMIVSKYPSI-RGINFDLPHVIQDAPPYPGVE  240

Query  372  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDY  551
            HVGGDMF S+P GDAIFMKW+   W D  C + + +CY AL + GK+   E ILP+  D 
Sbjct  241  HVGGDMFVSVPKGDAIFMKWICHDWSDHHCLKFLKNCYDALPEHGKVIVAECILPVAPDA  300

Query  552  THRTRLLLVGDMFVM  596
            +  T+ ++  D+ ++
Sbjct  301  SLATKGVIHIDLIML  315



>gb|AAB96879.1| O-methyltransferase 1 [Arabidopsis thaliana]
Length=363

 Score =   169 bits (428),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 122/198 (62%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +A++D    PF KA G  A+ Y+G  P  N +    MS  S
Sbjct  124  ALCLMNQDKVLMESWYHLKDAILDGGI-PFNKAYGMSAFEYHGTDPRFNKVFNNGMSNHS  182

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
               MK  L+ Y GFEG+T LVDVGG  G  L+MI+ K+P++ +GINF+LP V++ AP+ P
Sbjct  183  TITMKKILETYKGFEGLTSLVDVGGGIGATLKMIVSKYPNL-KGINFNLPHVIEDAPSHP  241

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            GI HVGGDMF S+P GDAIFMKW+   W DE C + + +CY +L + GK+   E ILP  
Sbjct  242  GIEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCVKFLKNCYESLPEDGKVILAECILPET  301

Query  543  TDYTHRTRLLLVGDMFVM  596
             D +  T+ ++  D  ++
Sbjct  302  PDSSLSTKQVVHVDCIML  319



>gb|AGS49181.1| O-methyltransferase [Zea mays]
Length=364

 Score =   169 bits (428),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 117/198 (59%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G     N +  + M   S
Sbjct  127  ALALMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDARFNRVFNEGMKNHS  185

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            V   K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  P
Sbjct  186  VIITKKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFP  244

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAI MKW+L  W D  C  ++ +CY AL + GK+   E +LP+ 
Sbjct  245  GVRHVGGDMFASVPAGDAILMKWILHDWSDLHCATLLKNCYDALPENGKVIVVECVLPVN  304

Query  543  TDYTHRTRLLLVGDMFVM  596
            T+ T + + +   DM ++
Sbjct  305  TEATPKAQGVFHVDMIML  322



>ref|XP_008234634.1| PREDICTED: caffeic acid 3-O-methyltransferase [Prunus mume]
Length=365

 Score =   169 bits (428),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 115/185 (62%), Gaps = 2/185 (1%)
 Frame = +3

Query  12   LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  191
            L +    L+++W  + +AV++    PF KA G  A+ Y+G  P  N +  + M+  S   
Sbjct  129  LMNQDKVLVESWYHLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMADHSTIT  187

Query  192  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  371
            MK  L+ Y GFEG+T +VDVGG  G  L MI+ K+PSI +GINFDLP V++ AP  PG+ 
Sbjct  188  MKKILETYKGFEGLTSVVDVGGGTGAVLNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVE  246

Query  372  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDY  551
            HVGGDMF S+P GDAIFMKW+   W DE C + + +CY AL   GK+   E ILP+  D 
Sbjct  247  HVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDNGKVILGECILPVAPDS  306

Query  552  THRTR  566
            +  T+
Sbjct  307  SLATK  311



>gb|AFZ78575.1| caffeic acid O-methyltransferase [Populus tomentosa]
Length=365

 Score =   169 bits (428),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 84/195 (43%), Positives = 120/195 (62%), Gaps = 2/195 (1%)
 Frame = +3

Query  12   LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  191
            L +    LM++W  + +A++D    PF KA G  A+ Y+G  P  N +  K MS  S   
Sbjct  129  LMNQDKVLMESWYYLKDAILDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTIT  187

Query  192  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  371
            MK  L+ Y GFEG+T LVDVGG  G  +  I+ K+PSI +GINFDLP V++ AP+ PG+ 
Sbjct  188  MKKILETYKGFEGLTSLVDVGGGTGAVVNTIVSKYPSI-KGINFDLPHVIEDAPSFPGVE  246

Query  372  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDY  551
            HVGGDMF S+P  DA+FMKW+   W D  C + + +CY AL + GK+   E ILP+  D 
Sbjct  247  HVGGDMFVSVPKADAVFMKWICHDWSDAHCLKFLKNCYDALPENGKVILVECILPVAPDT  306

Query  552  THRTRLLLVGDMFVM  596
            +  T+ ++  D+ ++
Sbjct  307  SLATKGVVHVDVIML  321



>gb|AGS49205.1| O-methyltransferase [Zea mays]
Length=364

 Score =   169 bits (428),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 117/198 (59%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G     N +  + M   S
Sbjct  127  ALALMNQDKVLMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGTDSRFNRVFNEGMKNHS  185

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            V   K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  P
Sbjct  186  VIITKKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFP  244

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAI MKW+L  W D  C  ++ +CY AL + GK+   E +LP+ 
Sbjct  245  GVRHVGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVN  304

Query  543  TDYTHRTRLLLVGDMFVM  596
            T+ T + + +   DM ++
Sbjct  305  TEATPKAQGVFHVDMIML  322



>ref|XP_007218167.1| hypothetical protein PRUPE_ppa007511mg [Prunus persica]
 gb|EMJ19366.1| hypothetical protein PRUPE_ppa007511mg [Prunus persica]
Length=365

 Score =   169 bits (428),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 115/185 (62%), Gaps = 2/185 (1%)
 Frame = +3

Query  12   LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  191
            L +    L+++W  + +AV++    PF KA G  A+ Y+G  P  N +  + M+  S   
Sbjct  129  LMNQDKVLVESWYHLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMADHSTIT  187

Query  192  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  371
            MK  L+ Y GFEG+T +VDVGG  G  L MI+ K+PSI +GINFDLP V++ AP  PG+ 
Sbjct  188  MKKILETYKGFEGLTSVVDVGGGTGAVLNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVE  246

Query  372  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDY  551
            HVGGDMF S+P GDAIFMKW+   W DE C + + +CY AL   GK+   E ILP+  D 
Sbjct  247  HVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDNGKVILGECILPVAPDS  306

Query  552  THRTR  566
            +  T+
Sbjct  307  SLATK  311



>ref|XP_006441596.1| hypothetical protein CICLE_v10023568mg [Citrus clementina]
 gb|ESR54836.1| hypothetical protein CICLE_v10023568mg [Citrus clementina]
Length=352

 Score =   169 bits (427),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 80/197 (41%), Positives = 124/197 (63%), Gaps = 3/197 (2%)
 Frame = +3

Query  9    VLQHHQD-ALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  185
            VL   QD A + +W  + E +++    PF + +G  A+ Y G  P  N +   AM   + 
Sbjct  116  VLALIQDKAFLDSWSQLKETIIEGGV-PFDRVHGTHAFEYLGLDPRFNEVFSTAMYNHTT  174

Query  186  PFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPG  365
              ++  L+ Y GFE + +LVDVGGS G+ L+ I+ K+P I +GINFDLP V+Q AP  PG
Sbjct  175  LVIQKILEAYKGFEHIKQLVDVGGSLGNTLKAIISKYPHI-KGINFDLPHVIQHAPEYPG  233

Query  366  ITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQT  545
            + HVGGDMF+S+PNGDAI +KW+L  W DE C +++ +C+ ++ +GGK+   E +LP   
Sbjct  234  VKHVGGDMFRSVPNGDAILIKWILHDWSDEHCLKLLKNCHKSIPEGGKVIVVESVLPELP  293

Query  546  DYTHRTRLLLVGDMFVM  596
            + +  +++  +GD+ VM
Sbjct  294  ETSTHSKINFLGDVLVM  310



>ref|XP_010934913.1| PREDICTED: tricetin 3',4',5'-O-trimethyltransferase-like [Elaeis 
guineensis]
Length=367

 Score =   169 bits (428),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 84/196 (43%), Positives = 117/196 (60%), Gaps = 2/196 (1%)
 Frame = +3

Query  9    VLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVP  188
             L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  + M   S+ 
Sbjct  132  TLMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNNVFNEGMKNHSIV  190

Query  189  FMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGI  368
              K  L+ Y GFE +  LVDVGG  G  L MI  K+P I +GINFDLP V+ +AP +PG+
Sbjct  191  ITKKLLESYKGFEDINVLVDVGGGIGATLHMITSKYPHI-KGINFDLPHVISEAPPLPGV  249

Query  369  THVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTD  548
             HVGGDMF SIP+GDAI MKW++  W DE C +I+ +CY AL   G++  CE ILP+  +
Sbjct  250  EHVGGDMFASIPSGDAILMKWIMHDWSDEHCAKILENCYKALPNNGRVILCECILPVAPE  309

Query  549  YTHRTRLLLVGDMFVM  596
                 + +   DM ++
Sbjct  310  PVPSAQGVFHLDMIML  325



>gb|KHN23296.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=365

 Score =   169 bits (428),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 114/188 (61%), Gaps = 2/188 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV++    PF KA G  A+ Y+G  P  N +  K M+  S
Sbjct  126  ALNLMNQDKVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMADHS  184

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
               MK  L+ Y GFE +  LVDVGG  G  + MI+ KHP+I +GINFDLP V++ AP+ P
Sbjct  185  TITMKKILETYTGFESLKSLVDVGGGTGAVINMIVSKHPTI-KGINFDLPHVIEDAPSYP  243

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P  DAIFMKW+   W DE C + + +CY AL   GK+   E ILP+ 
Sbjct  244  GVEHVGGDMFASVPKADAIFMKWICHDWSDEHCLKFLKNCYEALPDNGKVIVAECILPVA  303

Query  543  TDYTHRTR  566
             D +  T+
Sbjct  304  PDSSLATK  311



>dbj|BAM05580.1| caffeic acid O-methyltransferase 1, partial [Eucalyptus pyrocarpa]
Length=312

 Score =   167 bits (424),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 118/185 (64%), Gaps = 2/185 (1%)
 Frame = +3

Query  12   LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  191
            L +    L+++W  + +A+++    PF KA+G  A+ Y G  P  N +  +AMS  S   
Sbjct  110  LINQDRVLLESWYYLKDAILEGGI-PFNKAHGMTAFDYPGIDPRFNKIFNRAMSDHSTIT  168

Query  192  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  371
            MK  L+ Y+GFEG+  +VDVGG  G  L MI+ K+PSI +GINFDLP V++ AP+  G+ 
Sbjct  169  MKKILETYNGFEGLKTVVDVGGGTGAVLNMIVAKYPSI-KGINFDLPHVIEDAPSYRGVE  227

Query  372  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDY  551
            HVGGDMF +IPNGDA+FMKW+   W DE C +++ +CY AL   G++   E ILP+  D 
Sbjct  228  HVGGDMFVNIPNGDAVFMKWICHDWSDEHCAKLLKNCYDALPVNGRLIVAEYILPVYPDQ  287

Query  552  THRTR  566
            +  T+
Sbjct  288  SLSTK  292



>ref|XP_002317838.1| Chain A family protein [Populus trichocarpa]
 gb|ABK92533.1| unknown [Populus trichocarpa]
 gb|ACC63886.1| caffeic acid 3-O-methyltransferase [Populus trichocarpa]
 gb|ACJ76441.1| caffeic acid 3-O-methyltransferase 1 [Populus trichocarpa]
 gb|EEE96058.1| Chain A family protein [Populus trichocarpa]
Length=364

 Score =   169 bits (427),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 114/185 (62%), Gaps = 2/185 (1%)
 Frame = +3

Query  12   LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  191
            L +    LM++W  + +A++D    PF KA G  A+ Y+G  P  N +  K MS  S   
Sbjct  129  LMNQDKVLMESWYYLKDAILDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTIT  187

Query  192  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  371
            MK  L+ Y GFEG+T LVDVGG  G  +  I+ K+PSI +GINFDLP V++ AP+ PG+ 
Sbjct  188  MKKLLETYKGFEGLTSLVDVGGGTGAVVNTIVSKYPSI-KGINFDLPHVIEDAPSYPGVE  246

Query  372  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDY  551
            HVGGDMF S+P  DA+FMKW+   W D  C + + +CY AL + GK+   E ILP+  D 
Sbjct  247  HVGGDMFVSVPKADAVFMKWICHDWSDAHCLKFLKNCYDALPENGKVILVECILPVAPDT  306

Query  552  THRTR  566
            +  T+
Sbjct  307  SLATK  311



>ref|XP_004156527.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cucumis sativus]
Length=359

 Score =   169 bits (427),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 120/195 (62%), Gaps = 2/195 (1%)
 Frame = +3

Query  12   LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  191
            L +    LM++W  + +AV++    PF +A G  A+ Y+G  P  N +  K MS  S   
Sbjct  123  LMNQDKVLMESWYHLKDAVLEGGI-PFNRAYGMSAFEYHGTDPRFNKVFNKRMSDHSTIT  181

Query  192  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  371
            MK  L+ Y GFEG+  +VDVGG  G  L MI+ K+PSI +GINFDLP V+Q AP  PG+ 
Sbjct  182  MKKILETYKGFEGLNSVVDVGGGTGAVLNMIVSKYPSI-RGINFDLPHVIQDAPPYPGVE  240

Query  372  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDY  551
            HVGGDMF S+P GDAIFMKW+   W D  C + + +CY AL + GK+   E ILP+  D 
Sbjct  241  HVGGDMFVSVPKGDAIFMKWICHDWSDHHCLKFLKNCYDALPEHGKVIVAECILPLAPDA  300

Query  552  THRTRLLLVGDMFVM  596
            +  T+ ++  D+ ++
Sbjct  301  SLATKGVIHIDLIML  315



>gb|ACT32028.1| caffeic acid O-methyltransferase 1 [Gossypium hirsutum]
Length=366

 Score =   169 bits (427),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 118/192 (61%), Gaps = 3/192 (2%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  + MS  S
Sbjct  126  ALSLMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHS  184

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
               MK  LD Y GF+G+  LVDVGG  G  L MI+ K+P+I +GINFDLP V++ AP+ P
Sbjct  185  TITMKKILDTYDGFQGLKTLVDVGGGTGATLSMIVSKYPTI-KGINFDLPHVIEDAPSCP  243

Query  363  -GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPI  539
             G+ HVGGDMF S+P GDAIFMKW+   W DE C + + +CY AL   GK+   E ILP 
Sbjct  244  VGVEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCAKFLKNCYEALPDNGKVIVAECILPD  303

Query  540  QTDYTHRTRLLL  575
              D +  T+L++
Sbjct  304  YPDPSLATKLVV  315



>ref|XP_010035325.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like [Eucalyptus 
grandis]
 gb|KCW46638.1| hypothetical protein EUGRSUZ_K00449 [Eucalyptus grandis]
Length=365

 Score =   169 bits (427),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 85/195 (44%), Positives = 119/195 (61%), Gaps = 2/195 (1%)
 Frame = +3

Query  12   LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  191
            L +H   LM++W  + +AV++     F +A G  A+ Y    P  N +  KAMS VS   
Sbjct  131  LMNHDKVLMESWYHLKDAVLEGGVS-FDRAYGMNAFEYTRTDPRFNKVFNKAMSDVSTIT  189

Query  192  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  371
            MK  L+ Y GF+G+  +VD+GG  G  L MI+ K+PSI +GINFDLP V+  AP+ PG+ 
Sbjct  190  MKQVLETYKGFDGLKSVVDIGGGTGAVLNMIVSKYPSI-KGINFDLPHVIANAPSYPGVE  248

Query  372  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDY  551
            HVGGDMF S+P GDAIFMKW+   W DE C + + +CY AL + GK+   + ILP   D 
Sbjct  249  HVGGDMFVSVPTGDAIFMKWICHDWSDEHCLKFLKNCYNALPEHGKVIVADCILPELPDT  308

Query  552  THRTRLLLVGDMFVM  596
            +  T++    D+ +M
Sbjct  309  SFATKVAFHADLIMM  323



>gb|ADX98508.1| caffeic acid 3-O-methyltransferase [Panicum virgatum]
Length=361

 Score =   169 bits (427),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 118/198 (60%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV++    PF KA G  A+ Y+G  P  N +  + M   S
Sbjct  124  ALALMNQDKVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNRVFNEGMKNHS  182

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            V   K  L+ Y GFEGV  LVDVGG  G  L  I  ++P I +G+NFDLP V+ +AP  P
Sbjct  183  VIITKKLLEFYAGFEGVGTLVDVGGGVGATLHAITSRYPGI-RGVNFDLPHVISEAPPFP  241

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMFK++P GDAI MKW+L  W D  C  I+ +CY AL  GGK+ A E ILP+ 
Sbjct  242  GVEHVGGDMFKAVPAGDAILMKWILHDWSDAHCAAILKNCYDALPAGGKVIAVECILPVN  301

Query  543  TDYTHRTRLLLVGDMFVM  596
             + T + + +   DM ++
Sbjct  302  PEATPKAQGVFHVDMIML  319



>ref|XP_004307899.1| PREDICTED: caffeic acid 3-O-methyltransferase [Fragaria vesca 
subsp. vesca]
Length=365

 Score =   169 bits (427),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 115/188 (61%), Gaps = 2/188 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    L+++W  + +AV+D    PF KA G  A+ Y+G  P  N +  K M+  S
Sbjct  126  ALCLMNQDKVLVESWYHLKDAVLDGGI-PFNKAYGMTAFDYHGTDPRFNKVFNKGMADHS  184

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
               MK  L+ Y GFEG+  +VDVGG  G  + MI+ K+PSI +GINFDLP V++ AP  P
Sbjct  185  TITMKKILETYKGFEGLKSIVDVGGGTGAVVNMIVAKYPSI-KGINFDLPHVIEDAPQYP  243

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAIFMKW+   W DE C + + +CY AL   GK+   E ILP+ 
Sbjct  244  GVQHVGGDMFVSVPKGDAIFMKWICHDWSDEHCIKFLKNCYAALPDDGKVILGECILPVA  303

Query  543  TDYTHRTR  566
             D +  T+
Sbjct  304  PDTSLATK  311



>gb|AGS49200.1| O-methyltransferase [Zea mays]
Length=364

 Score =   169 bits (427),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 117/198 (59%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G     N +  + M   S
Sbjct  127  ALALMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDSRFNRVFNEGMKNHS  185

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            V   K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  P
Sbjct  186  VIITKKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVIFEAPPFP  244

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAI MKW+L  W D  C  ++ +CY AL + GK+   E +LP+ 
Sbjct  245  GVRHVGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVN  304

Query  543  TDYTHRTRLLLVGDMFVM  596
            T+ T + + +   DM ++
Sbjct  305  TEATPKAQGVFHVDMIML  322



>gb|AGS49199.1| O-methyltransferase [Zea mays]
Length=364

 Score =   169 bits (427),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 117/198 (59%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  + M   S
Sbjct  127  ALALMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTGPRFNRVFNEGMKNHS  185

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            V   K  LD   GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  P
Sbjct  186  VIITKKLLDFCTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFP  244

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAI MKW+L  W D  C  ++ +CY AL + GK+   E +LP+ 
Sbjct  245  GVRHVGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVN  304

Query  543  TDYTHRTRLLLVGDMFVM  596
            T+ T + + +   DM ++
Sbjct  305  TEATPKAQGVFHVDMIML  322



>sp|Q00763.1|COMT1_POPTM RecName: Full=Caffeic acid 3-O-methyltransferase 1; Short=CAOMT-1; 
Short=COMT-1; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase 1 [Populus tremuloides]
 emb|CAA44006.1| lignin bispecific acid/5-hydroxyferulic acid methyltransferase 
[Populus tremuloides]
 gb|AAB61731.1| caffeic acid/5-hydroxyferulic acid O-methyltransferase [Populus 
tremuloides]
Length=365

 Score =   169 bits (427),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 84/195 (43%), Positives = 120/195 (62%), Gaps = 2/195 (1%)
 Frame = +3

Query  12   LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  191
            L +    LM++W  + +A++D    PF KA G  A+ Y+G  P  N +  K MS  S   
Sbjct  129  LMNQDKVLMESWYYLKDAILDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTIT  187

Query  192  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  371
            MK  L+ Y GFEG+T LVDVGG  G  +  I+ K+PSI +GINFDLP V++ AP+ PG+ 
Sbjct  188  MKKILETYKGFEGLTSLVDVGGGTGAVVNTIVSKYPSI-KGINFDLPHVIEDAPSYPGVE  246

Query  372  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDY  551
            HVGGDMF S+P  DA+FMKW+   W D  C + + +CY AL + GK+   E ILP+  D 
Sbjct  247  HVGGDMFVSVPKADAVFMKWICHDWSDAHCLKFLKNCYDALPENGKVILVECILPVAPDT  306

Query  552  THRTRLLLVGDMFVM  596
            +  T+ ++  D+ ++
Sbjct  307  SLATKGVVHVDVIML  321



>gb|KDO41090.1| hypothetical protein CISIN_1g018681mg [Citrus sinensis]
Length=352

 Score =   168 bits (426),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 75/189 (40%), Positives = 120/189 (63%), Gaps = 2/189 (1%)
 Frame = +3

Query  30   ALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLD  209
            A + +W  + E +++    PF + +G  A+ Y G  P  N +   AM   +   ++  L+
Sbjct  124  AFLDSWSQLKETIIEGGV-PFDRVHGTHAFEYLGLDPRFNEVFSTAMYNHTTLVIQKILE  182

Query  210  GYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDM  389
             Y GFE + +LVDVGGS G+ L+ I+ K+P I +GINFDLP V+Q AP  PG+ HVGGDM
Sbjct  183  AYKGFEHIKQLVDVGGSLGNTLKAIISKYPHI-EGINFDLPHVIQHAPEYPGVKHVGGDM  241

Query  390  FKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDYTHRTRL  569
            F+++PNGDAI +KW+L  W DE C +++ +C+ ++ +GGK+   E +LP   + +  +++
Sbjct  242  FRNVPNGDAILIKWILHDWSDEHCLKLLKNCHKSIHEGGKVIVVESVLPELPETSTHSKI  301

Query  570  LLVGDMFVM  596
              +GD+ VM
Sbjct  302  NFLGDVLVM  310



>emb|CAJ43721.1| caffeoyl-CoA O-methyltransferase [Plantago major]
Length=227

 Score =   165 bits (417),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 110/176 (63%), Gaps = 2/176 (1%)
 Frame = +3

Query  9    VLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVP  188
            +L +    LM++W  V +AV+D    PF KA G  A+ Y+G  P  N +  + MS  S  
Sbjct  40   LLMNQDKILMESWYHVKDAVLDGGI-PFNKAYGMTAFDYHGTDPRFNKVFNQGMSNHSTI  98

Query  189  FMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGI  368
             MK  L+ Y GFEG+  +VDVGG  G  L MI+ K+PSI +GINFDLP V++ AP+  G+
Sbjct  99   IMKKILETYDGFEGLNSVVDVGGGTGATLSMILSKYPSI-KGINFDLPHVIEDAPSYAGV  157

Query  369  THVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILP  536
             HVGGDMF S+P GDAIFMKW+   W D  C + + +CY AL + GK+   E ILP
Sbjct  158  EHVGGDMFVSVPEGDAIFMKWICHDWSDAHCLKFLKNCYKALPENGKVILAECILP  213



>prf||1906376A O-methyltransferase
Length=364

 Score =   168 bits (426),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 114/185 (62%), Gaps = 2/185 (1%)
 Frame = +3

Query  12   LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  191
            L +    LM++W  + +A++D    PF KA G  A+ Y+G  P  N +  K MS  S   
Sbjct  129  LMNQDKVLMESWYYLKDAILDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTIT  187

Query  192  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  371
            MK  L+ Y GFEG+T LVDVGG  G  +  I+ K+PSI +GINFDLP V++ AP+ PG+ 
Sbjct  188  MKKILETYKGFEGLTSLVDVGGGTGAVVNTIVSKYPSI-KGINFDLPHVIEDAPSYPGVE  246

Query  372  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDY  551
            HVGGDMF S+P  DA+FMKW+   W D  C + + +CY AL + GK+   E ILP+  D 
Sbjct  247  HVGGDMFVSVPKADAVFMKWICHDWSDAHCLKFLKNCYDALPENGKVILVECILPVAPDT  306

Query  552  THRTR  566
            +  T+
Sbjct  307  SLATK  311



>gb|AAF60951.1| O-methyltransferase [Populus trichocarpa x Populus deltoides]
Length=364

 Score =   168 bits (426),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 114/185 (62%), Gaps = 2/185 (1%)
 Frame = +3

Query  12   LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  191
            L +    LM++W  + +A++D    PF KA G  A+ Y+G  P  N +  K MS  S   
Sbjct  129  LMNQDKVLMESWYYLKDAILDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTIT  187

Query  192  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  371
            MK  L+ Y GFEG+T LVDVGG  G  +  I+ K+PSI +GINFDLP V++ AP+ PG+ 
Sbjct  188  MKKILETYKGFEGLTSLVDVGGGTGAVVNTIVSKYPSI-KGINFDLPHVIEDAPSYPGVE  246

Query  372  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDY  551
            HVGGDMF S+P  DA+FMKW+   W D  C + + +CY AL + GK+   E ILP+  D 
Sbjct  247  HVGGDMFVSVPKADAVFMKWICHDWSDAHCLKFLKNCYDALPENGKVILVECILPVAPDT  306

Query  552  THRTR  566
            +  T+
Sbjct  307  SLATK  311



>sp|Q9SWC2.1|COMT1_EUCGL RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase, partial [Eucalyptus globulus]
 gb|AAD50439.1|AF168776_1 caffeic acid O-methyltransferase [Eucalyptus globulus]
Length=313

 Score =   167 bits (423),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 116/185 (63%), Gaps = 2/185 (1%)
 Frame = +3

Query  12   LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  191
            L       +++W  + +A+++    PF KA+G  A+ Y G  P  N +  +AMS  S   
Sbjct  111  LIDQDRVFLESWYYMKDAILEGGI-PFHKAHGMTAFDYPGTDPRFNKIFNRAMSDHSTIM  169

Query  192  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  371
            MK  L+ Y+GFEG+  +VDVGG  G  L MI+ K+PSI +GINFDLP V++ AP+ PG+ 
Sbjct  170  MKKILETYNGFEGLKTVVDVGGGTGAILNMIVAKYPSI-KGINFDLPHVIEDAPSYPGVE  228

Query  372  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDY  551
            HVGGDMF +IPNGDA+FMKW+   W DE C +++ +CY AL   G++   E ILP   D 
Sbjct  229  HVGGDMFVNIPNGDAVFMKWICHDWSDEHCAKLLKNCYDALPVNGRVIVAEYILPAYPDQ  288

Query  552  THRTR  566
            +  T+
Sbjct  289  SLSTK  293



>gb|AGS49189.1| O-methyltransferase [Zea mays]
Length=364

 Score =   168 bits (426),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 117/198 (59%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +A++D    PF KA G  A+ Y+G     N +  + M   S
Sbjct  127  ALALMNQDKVLMESWYYLKDAMLDGGI-PFNKAYGMTAFEYHGTDSRFNRVFNEGMKNHS  185

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            V   K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  P
Sbjct  186  VIITKKLLDFYAGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFP  244

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAI MKW+L  W D  C  ++ +CY AL + GK+   E +LP+ 
Sbjct  245  GVRHVGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVN  304

Query  543  TDYTHRTRLLLVGDMFVM  596
            T+ T + + +   DM ++
Sbjct  305  TEATPKAQGVFHVDMIML  322



>sp|P28002.1|COMT1_MEDSA RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Medicago sativa]
 pdb|1KYW|A Chain A, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase In Complex With 5- Hydroxyconiferaldehyde
 pdb|1KYW|C Chain C, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase In Complex With 5- Hydroxyconiferaldehyde
 pdb|1KYW|F Chain F, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase In Complex With 5- Hydroxyconiferaldehyde
 pdb|1KYZ|A Chain A, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase Ferulic Acid Complex
 pdb|1KYZ|C Chain C, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase Ferulic Acid Complex
 pdb|1KYZ|E Chain E, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase Ferulic Acid Complex
 gb|AAB46623.1| S-adenosyl-L-methionine: caffeic acid 3-0-methyltransferase [Medicago 
sativa]
Length=365

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 114/188 (61%), Gaps = 2/188 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  K MS  S
Sbjct  126  ALNLMNQDKVLMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHS  184

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
               MK  L+ Y GFEG+  LVDVGG  G  +  I+ K+P+I +GINFDLP V++ AP+ P
Sbjct  185  TITMKKILETYTGFEGLKSLVDVGGGTGAVINTIVSKYPTI-KGINFDLPHVIEDAPSYP  243

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF SIP  DA+FMKW+   W DE C + + +CY AL   GK+   E ILP+ 
Sbjct  244  GVEHVGGDMFVSIPKADAVFMKWICHDWSDEHCLKFLKNCYEALPDNGKVIVAECILPVA  303

Query  543  TDYTHRTR  566
             D +  T+
Sbjct  304  PDSSLATK  311



>gb|ACY06328.1| S-adenosyl-L-methionine: caffeic acid 3-0-methyltransferase [Medicago 
sativa]
Length=365

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 114/188 (61%), Gaps = 2/188 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  K MS  S
Sbjct  126  ALNLMNQDKVLMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHS  184

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
               MK  L+ Y GFEG+  LVDVGG  G  +  I+ K+P+I +GINFDLP V++ AP+ P
Sbjct  185  TITMKKILETYTGFEGLKSLVDVGGGTGAVINTIVSKYPTI-KGINFDLPHVIEDAPSYP  243

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF SIP  DA+FMKW+   W DE C + + +CY AL   GK+   E ILP+ 
Sbjct  244  GVEHVGGDMFVSIPKADAVFMKWICHDWSDEHCLKFLKNCYEALPDNGKVIVAECILPVA  303

Query  543  TDYTHRTR  566
             D +  T+
Sbjct  304  PDSSLATK  311



>ref|XP_006401613.1| hypothetical protein EUTSA_v10013897mg [Eutrema salsugineum]
 gb|ESQ43066.1| hypothetical protein EUTSA_v10013897mg [Eutrema salsugineum]
Length=364

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/198 (44%), Positives = 122/198 (62%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +A++D    PF KA G  A+ Y+GK    N +    MS  S
Sbjct  125  ALCLMNQDKVLMESWYHLKDAILDGGI-PFNKAYGMSAFEYHGKDLRFNTVFNNGMSNHS  183

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
               MK  L+ Y GFEG+T LVDVGG  G  L+MI+ K+P++ +GINFDLP V+++A + P
Sbjct  184  TITMKKILETYKGFEGLTSLVDVGGGIGATLKMILSKYPNL-KGINFDLPHVIEEATSHP  242

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            GI HVGGDMF S+P GDAIFMKW+   W DE C + + +CY AL + GK+   E ILP  
Sbjct  243  GIEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCVKFLKNCYEALPEDGKVILAECILPET  302

Query  543  TDYTHRTRLLLVGDMFVM  596
             D +  T+ ++  D  ++
Sbjct  303  PDSSLSTKQVVHVDCIML  320



>emb|CBI23095.3| unnamed protein product [Vitis vinifera]
Length=236

 Score =   165 bits (417),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/193 (44%), Positives = 119/193 (62%), Gaps = 3/193 (2%)
 Frame = +3

Query  21   HQDAL-MKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMK  197
            +QD + M++W  + +AV+D    PF KA G   + Y+G +P  N +    +SG     MK
Sbjct  2    NQDKVPMQSWYHLKDAVLDGGI-PFNKAYGMTDFEYHGTEPRFNKVFNNGVSGHPTITMK  60

Query  198  AFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHV  377
              L+ Y GFEG+T +VDVGG  G  L MI+ K+P+I +GINFDLP V+  AP+ PG+ HV
Sbjct  61   KILEAYKGFEGLTSIVDVGGGTGATLNMIISKYPTI-KGINFDLPHVIDDAPSYPGVEHV  119

Query  378  GGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDYTH  557
            GGDMF S+P GDAIFMKWM   W D  C + + +CY AL   GK+   E ILP+  D + 
Sbjct  120  GGDMFVSVPKGDAIFMKWMCYEWDDAHCLKFLENCYQALPDNGKVIVAECILPVVPDTSL  179

Query  558  RTRLLLVGDMFVM  596
             T+  +  D+ ++
Sbjct  180  ATKTAVHIDVIML  192



>ref|XP_011043758.1| PREDICTED: caffeic acid 3-O-methyltransferase 1 [Populus euphratica]
Length=365

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 114/185 (62%), Gaps = 2/185 (1%)
 Frame = +3

Query  12   LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  191
            L +    LM++W  + +A++D    PF KA G  A+ Y+G  P  N +  K MS  S   
Sbjct  129  LMNQDKVLMESWYYLKDAILDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTIT  187

Query  192  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  371
            MK  L+ Y GFEG+T LVDVGG  G  +  I+ K+PSI +GINFDLP V++ AP+ PG+ 
Sbjct  188  MKKILETYKGFEGLTSLVDVGGGTGAVVSTIVSKYPSI-KGINFDLPHVIEDAPSYPGVE  246

Query  372  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDY  551
            HVGGDMF S+P  DA+FMKW+   W D  C + + +CY AL + GK+   E ILP+  D 
Sbjct  247  HVGGDMFVSVPKADAVFMKWICHDWSDAHCLKFLKNCYDALPENGKVILVECILPVAPDT  306

Query  552  THRTR  566
            +  T+
Sbjct  307  SLATK  311



>gb|AFK40372.1| unknown [Lotus japonicus]
Length=365

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 115/188 (61%), Gaps = 2/188 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV++    PF KA G  A+ Y+G  P  N +  K MS  S
Sbjct  126  ALNLMNQDKVLMESWYHLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHS  184

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
               MK  L+ Y GFEG+  LVDVGG  G  + MI+ K+P+I +GINFDLP V++ AP+ P
Sbjct  185  TITMKKILETYTGFEGLKSLVDVGGGTGAVINMIVSKYPTI-KGINFDLPHVIEDAPSYP  243

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P  DA+FMKW+   W DE C + + +CY AL   GK+   E ILP+ 
Sbjct  244  GVEHVGGDMFVSVPKADAVFMKWICHDWSDEHCLKFLKNCYEALPDNGKVIVAECILPVA  303

Query  543  TDYTHRTR  566
             D +  T+
Sbjct  304  PDSSLATK  311



>ref|XP_003602396.1| Caffeic acid O-methyltransferase [Medicago truncatula]
 gb|AES72647.1| caffeic acid O-methyltransferase [Medicago truncatula]
Length=365

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 114/188 (61%), Gaps = 2/188 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  K MS  S
Sbjct  126  ALNLMNQDKVLMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHS  184

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
               MK  L+ Y GFEG+  LVDVGG  G  +  I+ K+P+I +GINFDLP V++ AP+ P
Sbjct  185  TITMKKILETYTGFEGLKSLVDVGGGTGAVINTIVSKYPTI-KGINFDLPHVIEDAPSYP  243

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF SIP  DA+FMKW+   W DE C + + +CY AL   GK+   E ILP+ 
Sbjct  244  GVEHVGGDMFVSIPKADAVFMKWICHDWSDEHCLKFLKNCYEALPDNGKVIVAECILPVA  303

Query  543  TDYTHRTR  566
             D +  T+
Sbjct  304  PDSSLATK  311



>dbj|BAJ34520.1| unnamed protein product [Thellungiella halophila]
Length=364

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/198 (44%), Positives = 122/198 (62%), Gaps = 2/198 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +A++D    PF KA G  A+ Y+GK    N +    MS  S
Sbjct  125  ALCLMNQDKVLMESWYHLKDAILDGGI-PFNKAYGMSAFEYHGKDLRFNTVFNNGMSNHS  183

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
               MK  L+ Y GFEG+T LVDVGG  G  L+MI+ K+P++ +GINFDLP V+++A + P
Sbjct  184  TITMKKILETYKGFEGLTSLVDVGGGIGATLKMILSKYPNL-KGINFDLPHVIEEATSHP  242

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            GI HVGGDMF S+P GDAIFMKW+   W DE C + + +CY AL + GK+   E ILP  
Sbjct  243  GIEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCVKFLKNCYEALPEDGKVILAECILPET  302

Query  543  TDYTHRTRLLLVGDMFVM  596
             D +  T+ ++  D  ++
Sbjct  303  PDSSLSTKQVVHVDCIML  320



>gb|AFK39235.1| unknown [Medicago truncatula]
Length=365

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 114/188 (61%), Gaps = 2/188 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  K MS  S
Sbjct  126  ALNLMNQDKVLMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHS  184

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
               MK  L+ Y GFEG+  LVDVGG  G  +  I+ K+P+I +GINFDLP V++ AP+ P
Sbjct  185  TITMKKILETYTGFEGLKSLVDVGGGTGAVINTIVSKYPTI-KGINFDLPHVIEDAPSYP  243

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF SIP  DA+FMKW+   W DE C + + +CY AL   GK+   E ILP+ 
Sbjct  244  GVEHVGGDMFVSIPKADAVFMKWICHDWSDEHCLKFLKNCYEALPDNGKVIVAECILPVA  303

Query  543  TDYTHRTR  566
             D +  T+
Sbjct  304  PDSSLATK  311



>gb|AGS49183.1| O-methyltransferase [Zea mays]
Length=364

 Score =   168 bits (425),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 112/188 (60%), Gaps = 2/188 (1%)
 Frame = +3

Query  3    AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  182
            A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G     N +  + M   S
Sbjct  127  ALALMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDARFNRVFNEGMKNHS  185

Query  183  VPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  362
            V   K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  P
Sbjct  186  VIITKKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFP  244

Query  363  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQ  542
            G+ HVGGDMF S+P GDAI MKW+L  W D  C  ++ +CY AL + GK+   E +LP+ 
Sbjct  245  GVRHVGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVN  304

Query  543  TDYTHRTR  566
            T+ T + +
Sbjct  305  TEATPKAQ  312



>ref|XP_010034911.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like [Eucalyptus 
grandis]
 gb|KCW46118.1| hypothetical protein EUGRSUZ_K00041 [Eucalyptus grandis]
Length=365

 Score =   168 bits (425),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/195 (44%), Positives = 118/195 (61%), Gaps = 2/195 (1%)
 Frame = +3

Query  12   LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  191
            L +H   LM++W  + +AV++     F +A G  A+ Y    P  N +  KAMS VS   
Sbjct  131  LMNHDKVLMESWYHLKDAVLEGGVS-FDRAYGMNAFEYTRTDPRFNKVFNKAMSDVSTIT  189

Query  192  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  371
            MK  L+ Y GF G+  +VD+GG  G  L MI+ K+PSI +GINFDLP V+  AP+ PG+ 
Sbjct  190  MKEVLETYKGFHGLKSVVDIGGGTGAVLNMIVSKYPSI-KGINFDLPHVIANAPSYPGVE  248

Query  372  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALSQGGKMAACEPILPIQTDY  551
            HVGGDMF S+P GDAIFMKW+   W DE C + + +CY AL + GK+   + ILP   D 
Sbjct  249  HVGGDMFVSVPTGDAIFMKWICHDWSDEHCLKFLKNCYNALPEHGKVIVADCILPELPDT  308

Query  552  THRTRLLLVGDMFVM  596
            +  T++    D+ +M
Sbjct  309  SFATKVAFHADLIMM  323



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 774982056510