BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS072C01

Length=634
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004230817.1|  PREDICTED: presequence protease 1, chloropla...    300   4e-91   Solanum lycopersicum
ref|XP_009760273.1|  PREDICTED: presequence protease 1, chloropla...    299   6e-91   Nicotiana sylvestris
ref|XP_009628645.1|  PREDICTED: presequence protease 1, chloropla...    299   7e-91   Nicotiana tomentosiformis
ref|XP_006346464.1|  PREDICTED: presequence protease 1, chloropla...    293   1e-88   Solanum tuberosum [potatoes]
ref|XP_011088279.1|  PREDICTED: presequence protease 1, chloropla...    290   1e-87   Sesamum indicum [beniseed]
ref|XP_010269115.1|  PREDICTED: presequence protease 2, chloropla...    278   3e-83   Nelumbo nucifera [Indian lotus]
gb|AFW73556.1|  hypothetical protein ZEAMMB73_636378                    258   5e-82   
ref|XP_009417618.1|  PREDICTED: presequence protease 1, chloropla...    273   1e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009417619.1|  PREDICTED: presequence protease 1, chloropla...    273   2e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006423050.1|  hypothetical protein CICLE_v10029929mg             263   2e-81   
ref|XP_002518788.1|  zinc metalloprotease, putative                     255   7e-81   
ref|XP_006423047.1|  hypothetical protein CICLE_v10027722mg             271   7e-81   Citrus clementina [clementine]
ref|XP_006423048.1|  hypothetical protein CICLE_v10027722mg             268   1e-80   
ref|XP_004136986.1|  PREDICTED: presequence protease 1, chloropla...    270   2e-80   Cucumis sativus [cucumbers]
ref|XP_004159889.1|  PREDICTED: LOW QUALITY PROTEIN: presequence ...    270   3e-80   
ref|XP_006487082.1|  PREDICTED: LOW QUALITY PROTEIN: presequence ...    269   4e-80   Citrus sinensis [apfelsine]
ref|XP_008454934.1|  PREDICTED: presequence protease 1, chloropla...    268   8e-80   Cucumis melo [Oriental melon]
ref|XP_007042387.1|  Presequence protease 2 isoform 4                   266   1e-79   
ref|XP_010939450.1|  PREDICTED: presequence protease 1, chloropla...    268   1e-79   Elaeis guineensis
ref|XP_010939451.1|  PREDICTED: presequence protease 1, chloropla...    267   2e-79   Elaeis guineensis
ref|XP_010481056.1|  PREDICTED: presequence protease 2, chloropla...    263   2e-79   Camelina sativa [gold-of-pleasure]
ref|XP_007042388.1|  Presequence protease 2 isoform 5                   266   2e-79   
ref|XP_007042385.1|  Presequence protease 2 isoform 2                   266   3e-79   
ref|XP_007042384.1|  Presequence protease 2 isoform 1                   266   5e-79   
ref|XP_004296078.2|  PREDICTED: presequence protease 1, chloropla...    266   5e-79   Fragaria vesca subsp. vesca
ref|XP_007042386.1|  Presequence protease 2 isoform 3                   266   7e-79   
ref|XP_003570577.1|  PREDICTED: presequence protease 1, chloropla...    266   9e-79   Brachypodium distachyon [annual false brome]
ref|XP_010691032.1|  PREDICTED: presequence protease 2, chloropla...    266   9e-79   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002282024.1|  PREDICTED: presequence protease 2, chloropla...    265   1e-78   Vitis vinifera
ref|XP_010500508.1|  PREDICTED: presequence protease 2, chloropla...    265   1e-78   Camelina sativa [gold-of-pleasure]
emb|CBI32433.3|  unnamed protein product                                265   1e-78   Vitis vinifera
ref|XP_008373169.1|  PREDICTED: presequence protease 1, chloropla...    265   2e-78   
ref|XP_009339454.1|  PREDICTED: LOW QUALITY PROTEIN: presequence ...    264   3e-78   Pyrus x bretschneideri [bai li]
gb|KJB77681.1|  hypothetical protein B456_012G150300                    263   3e-78   Gossypium raimondii
ref|XP_010466048.1|  PREDICTED: presequence protease 1, chloropla...    264   3e-78   
ref|XP_008647214.1|  PREDICTED: presequence protease 1, chloropla...    261   4e-78   
ref|XP_008236531.1|  PREDICTED: presequence protease 1, chloropla...    264   4e-78   Prunus mume [ume]
emb|CDO97160.1|  unnamed protein product                                263   6e-78   Coffea canephora [robusta coffee]
ref|XP_011006471.1|  PREDICTED: presequence protease 1, chloropla...    263   8e-78   Populus euphratica
gb|KJB77680.1|  hypothetical protein B456_012G150300                    263   9e-78   Gossypium raimondii
gb|KJB77679.1|  hypothetical protein B456_012G150300                    263   1e-77   Gossypium raimondii
ref|XP_010066034.1|  PREDICTED: presequence protease 2, chloropla...    263   1e-77   
ref|XP_010466047.1|  PREDICTED: presequence protease 1, chloropla...    262   1e-77   
ref|XP_006384425.1|  hypothetical protein POPTR_0004s14960g             262   2e-77   
gb|KHG07948.1|  Presequence protease 2, chloroplastic/mitochondrial     262   2e-77   Gossypium arboreum [tree cotton]
gb|KHG07949.1|  Presequence protease 1, chloroplastic/mitochondrial     261   2e-77   Gossypium arboreum [tree cotton]
ref|XP_010523209.1|  PREDICTED: presequence protease 1, chloropla...    261   2e-77   
gb|AAG13049.1|AC011807_8  Putative zinc metalloprotease                 261   3e-77   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175386.2|  presequence protease 2                                261   4e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004954002.1|  PREDICTED: presequence protease 1, chloropla...    261   4e-77   Setaria italica
ref|XP_002885298.1|  ATPREP1                                            260   6e-77   
gb|KDP42318.1|  hypothetical protein JCGZ_01642                         260   9e-77   Jatropha curcas
ref|XP_010691033.1|  PREDICTED: presequence protease 2, chloropla...    259   1e-76   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010507479.1|  PREDICTED: presequence protease 1, chloropla...    259   1e-76   Camelina sativa [gold-of-pleasure]
ref|XP_002894203.1|  ATPREP2                                            259   1e-76   Arabidopsis lyrata subsp. lyrata
dbj|BAJ89923.1|  predicted protein                                      259   1e-76   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006296881.1|  hypothetical protein CARUB_v10012870mg             259   1e-76   Capsella rubella
ref|XP_010487842.1|  PREDICTED: presequence protease 1, chloropla...    259   1e-76   Camelina sativa [gold-of-pleasure]
dbj|BAJ85497.1|  predicted protein                                      259   2e-76   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_188548.2|  zinc metalloprotease pitrilysin subfamily A           259   2e-76   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001189932.1|  zinc metalloprotease pitrilysin subfamily A        259   2e-76   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB02957.1|  zinc metalloprotease (insulinase family)               259   2e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009135620.1|  PREDICTED: presequence protease 1, chloropla...    259   2e-76   Brassica rapa
ref|XP_006304560.1|  hypothetical protein CARUB_v10011558mg             259   2e-76   
gb|KFK39237.1|  hypothetical protein AALP_AA3G218200                    259   2e-76   Arabis alpina [alpine rockcress]
ref|XP_006829680.1|  hypothetical protein AMTR_s00126p00013900          258   5e-76   Amborella trichopoda
ref|XP_009112103.1|  PREDICTED: presequence protease 1, chloropla...    258   6e-76   Brassica rapa
ref|XP_011000205.1|  PREDICTED: presequence protease 1, chloropla...    258   6e-76   Populus euphratica
gb|EAY87618.1|  hypothetical protein OsI_09029                          258   7e-76   Oryza sativa Indica Group [Indian rice]
emb|CDX82307.1|  BnaA03g35140D                                          257   8e-76   
ref|XP_011000182.1|  PREDICTED: presequence protease 1, chloropla...    257   9e-76   Populus euphratica
ref|XP_006649067.1|  PREDICTED: presequence protease 1, chloropla...    257   1e-75   Oryza brachyantha
ref|XP_006393232.1|  hypothetical protein EUTSA_v10011199mg             257   1e-75   Eutrema salsugineum [saltwater cress]
emb|CDY18572.1|  BnaA01g26230D                                          257   1e-75   Brassica napus [oilseed rape]
ref|XP_006406530.1|  hypothetical protein EUTSA_v10019955mg             256   1e-75   Eutrema salsugineum [saltwater cress]
ref|XP_010546463.1|  PREDICTED: presequence protease 1, chloropla...    256   2e-75   Tarenaya hassleriana [spider flower]
ref|XP_007200813.1|  hypothetical protein PRUPE_ppa025698mg             255   3e-75   
emb|CDY67652.1|  BnaC01g43760D                                          255   5e-75   Brassica napus [oilseed rape]
emb|CDY22983.1|  BnaC03g40860D                                          254   7e-75   Brassica napus [oilseed rape]
gb|EEE57849.1|  hypothetical protein OsJ_08475                          253   1e-74   Oryza sativa Japonica Group [Japonica rice]
gb|KHN30412.1|  Presequence protease 2, chloroplastic/mitochondrial     253   3e-74   Glycine soja [wild soybean]
ref|XP_003517606.1|  PREDICTED: presequence protease 2, chloropla...    253   3e-74   Glycine max [soybeans]
ref|XP_004511282.1|  PREDICTED: presequence protease 1, chloropla...    252   6e-74   Cicer arietinum [garbanzo]
ref|XP_009417620.1|  PREDICTED: presequence protease 1, chloropla...    251   1e-73   
gb|KEH27308.1|  presequence protease                                    251   2e-73   Medicago truncatula
ref|XP_003636020.1|  Presequence protease                               251   2e-73   
ref|XP_002313107.1|  hypothetical protein POPTR_0009s10650g             250   2e-73   
ref|XP_001764982.1|  predicted protein                                  249   8e-73   
ref|XP_009147876.1|  PREDICTED: presequence protease 2, chloropla...    244   2e-71   Brassica rapa
emb|CDY50957.1|  BnaA06g37530D                                          244   2e-71   Brassica napus [oilseed rape]
gb|KFK35994.1|  hypothetical protein AALP_AA4G064300                    244   3e-71   Arabis alpina [alpine rockcress]
emb|CDY28099.1|  BnaC06g02800D                                          244   3e-71   Brassica napus [oilseed rape]
pdb|2FGE|A  Chain A, Crystal Structure Of Presequence Protease Pr...    242   1e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002452870.1|  hypothetical protein SORBIDRAFT_04g033980          242   3e-70   
ref|XP_007157239.1|  hypothetical protein PHAVU_002G054400g             241   3e-70   Phaseolus vulgaris [French bean]
ref|XP_002979622.1|  hypothetical protein SELMODRAFT_419272             237   1e-68   
ref|XP_006423049.1|  hypothetical protein CICLE_v10030315mg             214   9e-64   
ref|XP_007514955.1|  putative peptidase                                 213   4e-60   Bathycoccus prasinos
ref|XP_005651052.1|  hypothetical protein COCSUDRAFT_35102              209   9e-59   Coccomyxa subellipsoidea C-169
ref|WP_043601248.1|  peptidase M16                                      207   5e-58   Desulfovibrio magneticus
dbj|BAH77801.1|  peptidase M16C family protein                          207   6e-58   Desulfovibrio magneticus RS-1
ref|WP_009110736.1|  peptidase M16                                      205   2e-57   Desulfovibrio sp. U5L
ref|XP_005842187.1|  hypothetical protein GUITHDRAFT_83724              205   3e-57   Guillardia theta CCMP2712
ref|WP_019999861.1|  peptidase M16                                      204   4e-57   Desulfovibrionaceae
ref|WP_027361259.1|  peptidase M16                                      204   6e-57   Halodesulfovibrio aestuarii
ref|XP_002501992.1|  predicted protein                                  204   6e-57   Micromonas commoda
ref|WP_005990555.1|  peptidase M16                                      204   6e-57   Desulfovibrio fructosivorans
ref|WP_009182029.1|  peptidase M16                                      204   7e-57   Desulfovibrio sp. FW1012B
gb|KDO42491.1|  hypothetical protein CISIN_1g0037001mg                  190   7e-57   Citrus sinensis [apfelsine]
ref|WP_012805698.1|  peptidase M16                                      203   8e-57   Desulfomicrobium baculatum
ref|XP_005844172.1|  hypothetical protein CHLNCDRAFT_139318             203   1e-56   Chlorella variabilis
ref|WP_006921332.1|  putative Zn-dependent peptidase, insulinase        201   5e-56   
ref|WP_015751993.1|  peptidase M16                                      201   5e-56   Desulfohalobium retbaense
ref|WP_024824358.1|  peptidase M16                                      201   6e-56   Desulfovibrio magneticus
ref|WP_035261705.1|  peptidase M16                                      200   1e-55   Desulfonatronum lacustre
ref|WP_031388389.1|  peptidase M16                                      200   1e-55   Desulfonatronum thiodismutans
ref|WP_029456797.1|  peptidase M16                                      200   2e-55   Desulfovibrio alcoholivorans
ref|XP_002952139.1|  hypothetical protein VOLCADRAFT_81738              200   2e-55   Volvox carteri f. nagariensis
ref|WP_027181841.1|  peptidase M16                                      199   2e-55   Desulfovibrio alaskensis
ref|WP_011368505.1|  peptidase M16                                      199   2e-55   Desulfovibrio alaskensis
ref|WP_028577615.1|  peptidase M16                                      199   2e-55   Desulfomicrobium escambiense
emb|CEG00022.1|  Metalloenzyme, LuxS/M16 peptidase-like                 200   3e-55   Ostreococcus tauri
ref|WP_043637762.1|  peptidase M16                                      199   4e-55   Desulfovibrio sp. TomC
ref|XP_001420892.1|  predicted protein                                  199   4e-55   Ostreococcus lucimarinus CCE9901
ref|XP_003082508.1|  putative metalloprotease (ISS)                     199   6e-55   
gb|KDD73441.1|  hypothetical protein H632_c2174p0                       188   7e-55   Helicosporidium sp. ATCC 50920
gb|EJK74078.1|  hypothetical protein THAOC_04268                        191   8e-55   Thalassiosira oceanica
ref|WP_027177039.1|  peptidase M16                                      198   8e-55   Desulfovibrio aminophilus
ref|XP_005538148.1|  presequence protease                               198   1e-54   Cyanidioschyzon merolae strain 10D
ref|WP_022661974.1|  peptidase M16                                      197   1e-54   Desulfovibrio longus
ref|WP_006425491.1|  peptidase M16                                      197   2e-54   delta proteobacterium NaphS2
gb|EMS56412.1|  Presequence protease 1, chloroplastic/mitochondrial     197   2e-54   Triticum urartu
gb|EMT26044.1|  Presequence protease 1, chloroplastic/mitochondrial     196   2e-54   
ref|WP_035098694.1|  peptidase M16                                      196   3e-54   Devosia sp. LC5
ref|WP_035093689.1|  peptidase M16                                      196   3e-54   Devosia sp. 17-2-E-8
ref|WP_035035576.1|  peptidase M16                                      196   3e-54   Devosia sp. DBB001
ref|WP_041454536.1|  peptidase M16                                      196   3e-54   
ref|WP_018124477.1|  hypothetical protein                               196   4e-54   Desulfovibrio oxyclinae
dbj|BAJ62543.1|  putative M16C family peptidase                         196   4e-54   Anaerolinea thermophila UNI-1
ref|WP_035086012.1|  peptidase M16                                      196   5e-54   Devosia riboflavina
ref|WP_006562562.1|  peptidase M16                                      196   6e-54   Oscillochloris trichoides
ref|XP_005716826.1|  presequence protease                               196   8e-54   Chondrus crispus [carageen]
ref|XP_011396191.1|  Presequence protease 2, chloroplastic/mitoch...    194   2e-53   Auxenochlorella protothecoides
ref|WP_011698518.1|  peptidase M16                                      194   2e-53   Syntrophobacter fumaroxidans
ref|WP_015940539.1|  peptidase M16                                      194   3e-53   Chloroflexus aggregans
gb|EYU37693.1|  hypothetical protein MIMGU_mgv1a000907mg                193   3e-53   Erythranthe guttata [common monkey flower]
ref|WP_012119247.1|  peptidase M16                                      193   4e-53   Roseiflexus castenholzii
ref|XP_008236552.1|  PREDICTED: presequence protease 1, chloropla...    194   6e-53   Prunus mume [ume]
ref|WP_015415436.1|  Presequence protease 1, chloroplastic/mitoch...    193   6e-53   Pseudodesulfovibrio piezophilus
ref|WP_014323044.1|  peptidase M16                                      193   6e-53   Desulfovibrio desulfuricans
ref|XP_007200093.1|  hypothetical protein PRUPE_ppa019970mg             193   7e-53   
ref|WP_012257471.1|  MULTISPECIES: peptidase M16                        192   8e-53   Chloroflexus aurantiacus
ref|WP_031458128.1|  peptidase M16                                      192   9e-53   Chloroflexus sp. MS-G
ref|WP_028458346.1|  peptidase M16                                      192   9e-53   Chloroflexus sp. Y-396-1
ref|WP_011954953.1|  peptidase M16                                      192   1e-52   Roseiflexus sp. RS-1
gb|ADU64271.1|  Peptidase M16C associated domain protein                192   1e-52   Pseudodesulfovibrio aespoeensis Aspo-2
ref|WP_041271892.1|  peptidase M16                                      192   1e-52   
ref|WP_005986746.1|  pre-sequence protease                              192   1e-52   Desulfovibrio africanus
dbj|GAK55491.1|  PreP peptidase                                         192   1e-52   Candidatus Vecturithrix granuli
gb|EPS67763.1|  hypothetical protein M569_07010                         191   2e-52   Genlisea aurea
ref|WP_012612497.1|  peptidase M16                                      191   2e-52   Desulfovibrio vulgaris
ref|WP_014258900.1|  peptidase M16                                      191   2e-52   Desulfovibrio africanus
ref|XP_002290387.1|  hypothetical protein THAPSDRAFT_22863              192   2e-52   Thalassiosira pseudonana CCMP1335
ref|WP_035066446.1|  peptidase M16                                      191   2e-52   Desulfovibrio termitidis
ref|WP_027366525.1|  peptidase M16                                      191   2e-52   Desulfovibrio africanus
ref|WP_035042323.1|  peptidase M16                                      191   3e-52   
gb|EPR39784.1|  Peptidase M16C associated domain protein                191   3e-52   Desulfovibrio sp. X2
ref|WP_029435916.1|  peptidase M16                                      190   4e-52   Bilophila wadsworthia
ref|WP_005028290.1|  peptidase M16                                      190   4e-52   Bilophila wadsworthia
ref|WP_009380390.1|  peptidase M16                                      190   5e-52   Bilophila sp. 4_1_30
ref|WP_012765630.1|  peptidase M16                                      190   7e-52   Desulfovibrio salexigens
ref|WP_028319851.1|  peptidase M16                                      190   7e-52   Desulfatiglans anilini
ref|WP_015335587.1|  Presequence protease 1, chloroplastic/mitoch...    190   7e-52   Desulfovibrio hydrothermalis
dbj|GAK53338.1|  peptidase M16C associated domain protein               189   1e-51   Candidatus Moduliflexus flocculans
ref|WP_010938240.1|  peptidase M16                                      189   1e-51   Desulfovibrio vulgaris
ref|WP_027185458.1|  hypothetical protein                               189   2e-51   Desulfovibrio inopinatus
ref|WP_011792619.1|  peptidase M16                                      189   2e-51   Desulfovibrio vulgaris
ref|WP_006007833.1|  peptidase M16                                      188   2e-51   Desulfovibrio piger
ref|WP_007523808.1|  peptidase M16                                      188   3e-51   Desulfovibrio sp. A2
ref|XP_005761276.1|  peptidase M16                                      188   5e-51   Emiliania huxleyi CCMP1516
ref|WP_027720526.1|  peptidase M16                                      187   5e-51   Desulfovibrio zosterae
ref|XP_005706792.1|  Zn-dependent peptidase                             188   6e-51   Galdieria sulphuraria
ref|WP_033333819.1|  hypothetical protein                               173   8e-51   
ref|WP_012623989.1|  peptidase M16                                      187   8e-51   Desulfovibrio desulfuricans
ref|WP_025577207.1|  peptidase M16                                      187   8e-51   Blautia wexlerae
ref|WP_026649281.1|  peptidase M16                                      187   9e-51   Blautia wexlerae
ref|WP_020993684.1|  MULTISPECIES: hypothetical protein                 187   9e-51   Clostridiales
ref|WP_027178402.1|  peptidase M16                                      187   9e-51   Desulfovibrio bastinii
ref|XP_005782033.1|  peptidase M16                                      187   9e-51   Emiliania huxleyi CCMP1516
ref|WP_043643858.1|  peptidase M16                                      187   9e-51   Desulfovibrio putealis
ref|WP_014431903.1|  peptidase M16                                      187   1e-50   Caldilinea aerophila
ref|XP_002177646.1|  predicted protein                                  186   1e-50   Phaeodactylum tricornutum CCAP 1055/1
ref|WP_021760305.1|  putative peptidase M16C                            186   1e-50   Desulfovibrio gigas
ref|WP_027187627.1|  peptidase M16                                      186   2e-50   Desulfovibrio cuneatus
ref|WP_028573857.1|  peptidase M16                                      186   2e-50   Desulfonatronovibrio hydrogenovorans
ref|WP_019161133.1|  peptidase M16                                      186   2e-50   
ref|WP_035377087.1|  peptidase M16                                      186   2e-50   Fervidicella metallireducens
emb|CCJ33994.1|  Protein hypA                                           178   3e-50   Caloramator australicus RC3
ref|XP_002977652.1|  hypothetical protein SELMODRAFT_152047             185   3e-50   
ref|WP_020887440.1|  Peptidase M16C associated domain protein           185   4e-50   Desulfovibrio alkalitolerans
ref|WP_027369289.1|  peptidase M16                                      185   4e-50   Desulfovermiculus halophilus
ref|WP_009302747.1|  peptidase M16                                      185   4e-50   Desulfovibrio sp. 6_1_46AFAA
ref|WP_008683425.1|  peptidase M16                                      185   4e-50   Desulfovibrio sp. 3_1_syn3
ref|WP_014129848.1|  peptidase M16                                      185   4e-50   Pelagibacterium halotolerans
ref|WP_016483219.1|  pre-sequence protease. Metallo peptidase. ME...    185   4e-50   Chthonomonas calidirosea
ref|WP_029896470.1|  peptidase M16                                      185   5e-50   Desulfovibrio sp. L21-Syr-AB
emb|CCY32009.1|  putative uncharacterized protein                       184   6e-50   Ruminococcus sp. CAG:60
ref|WP_022657642.1|  peptidase M16                                      184   6e-50   Desulfovibrio desulfuricans
ref|WP_028588391.1|  peptidase M16                                      184   1e-49   Desulfocurvus vexinensis
ref|WP_021651012.1|  peptidase M16 inactive domain protein              184   1e-49   Blautia sp. KLE 1732
ref|WP_011526733.1|  peptidase M16                                      184   1e-49   Lawsonia intracellularis
ref|WP_015525808.1|  Predicted Zn-dependent peptidases, insulinas...    183   2e-49   
ref|WP_018702572.1|  hypothetical protein                               183   2e-49   Anaeromusa acidaminophila
ref|WP_027938345.1|  peptidase M16                                      183   2e-49   Anaeroarcus burkinensis
ref|WP_031481722.1|  peptidase M16                                      182   3e-49   Desulfovibrio frigidus
ref|WP_027871447.1|  peptidase M16 [                                    182   3e-49   [Eubacterium] cellulosolvens
ref|WP_032078808.1|  peptidase M16                                      182   3e-49   Clostridium drakei
ref|WP_022655669.1|  peptidase M16                                      182   3e-49   
ref|WP_021720806.1|  peptidase M16 inactive domain protein              182   3e-49   
ref|WP_004603088.1|  peptidase M16 [                                    182   4e-49   [Eubacterium] cellulosolvens
ref|WP_007061507.1|  peptidase M16                                      182   5e-49   Clostridium carboxidivorans
ref|WP_022215422.1|  peptidase M16 inactive domain protein              182   6e-49   
ref|WP_015542595.1|  Predicted Zn-dependent peptidases, insulinas...    181   7e-49   
ref|WP_017895385.1|  hypothetical protein                               181   1e-48   Clostridium tyrobutyricum
ref|WP_017751909.1|  hypothetical protein                               181   1e-48   Clostridium tyrobutyricum
ref|WP_015514322.1|  Predicted Zn-dependent peptidases, insulinas...    180   2e-48   
ref|WP_006568065.1|  peptidase M16                                      180   3e-48   Anaerostipes caccae
ref|WP_009002339.1|  peptidase M16                                      180   3e-48   Clostridium sp. D5
ref|WP_035355373.1|  peptidase M16                                      180   3e-48   
ref|WP_022261301.1|  peptidase                                          179   3e-48   
ref|WP_009290271.1|  peptidase M16                                      179   3e-48   Anaerostipes
ref|WP_016440111.1|  hypothetical protein                               179   3e-48   Coprococcus sp. HPP0048
ref|WP_016439298.1|  hypothetical protein                               179   4e-48   Coprococcus sp. HPP0074
ref|WP_009262834.1|  peptidase M16                                      179   4e-48   Lachnospiraceae bacterium 9_1_43BFAA
ref|WP_008976346.1|  peptidase M16                                      179   5e-48   Lachnospiraceae bacterium 6_1_37FAA
ref|WP_022374165.1|  predicted Zn-dependent peptidases insulinase...    179   5e-48   
ref|WP_008870220.1|  peptidase M16                                      179   6e-48   Desulfonatronospira thiodismutans
ref|WP_016293851.1|  hypothetical protein                               179   6e-48   
ref|WP_009296156.1|  peptidase M16                                      179   6e-48   Clostridium sp. 7_3_54FAA
ref|WP_023921967.1|  hypothetical protein                               179   7e-48   Ruminococcus lactaris
ref|WP_021642841.1|  peptidase M16 inactive domain protein [            179   7e-48   [Clostridium] symbiosum
ref|WP_005612121.1|  peptidase M16                                      179   7e-48   Ruminococcus lactaris
ref|WP_003508127.1|  peptidase M16 [                                    179   7e-48   [Clostridium] symbiosum
ref|WP_009144609.1|  peptidase M16                                      179   8e-48   Phascolarctobacterium succinatutens
gb|AFA48231.1|  peptidase                                               179   8e-48   Acetobacterium woodii DSM 1030
ref|WP_029968780.1|  hypothetical protein                               179   8e-48   
ref|WP_022074565.1|  hypothetical protein                               179   8e-48   
ref|WP_041670908.1|  peptidase M16                                      179   8e-48   Acetobacterium woodii
ref|WP_005424455.1|  peptidase M16 [                                    178   9e-48   
ref|WP_022262531.1|  peptidase M16 family                               178   1e-47   
ref|WP_022389503.1|  peptidase M16 inactive domain protein              178   1e-47   
ref|XP_003057543.1|  predicted protein                                  178   1e-47   Micromonas pusilla CCMP1545
ref|WP_009757457.1|  peptidase M16                                      178   1e-47   Lachnospiraceae bacterium 2_1_46FAA
ref|WP_028988397.1|  peptidase M16                                      178   2e-47   Thermicanus aegyptius
ref|WP_042736266.1|  peptidase M16                                      178   2e-47   Lachnospiraceae bacterium TWA4
ref|WP_027633171.1|  peptidase M16                                      178   2e-47   Clostridium hydrogeniformans
ref|WP_013725059.1|  peptidase M16                                      178   2e-47   Clostridium botulinum
ref|WP_022359738.1|  m16 family Peptidase                               177   2e-47   
ref|WP_028087063.1|  peptidase M16                                      177   2e-47   Dorea longicatena
ref|WP_018598322.1|  peptidase M16                                      177   2e-47   Blautia producta
ref|WP_029468370.1|  peptidase M16                                      177   2e-47   Clostridiales bacterium VE202-06
ref|WP_022092138.1|  predicted Zn-dependent peptidases insulinase...    177   2e-47   
ref|WP_008393275.1|  peptidase M16                                      177   2e-47   Clostridium sp. SS2/1
ref|WP_006555004.1|  hypothetical protein                               177   2e-47   Veillonella seminalis
ref|XP_009037871.1|  hypothetical protein AURANDRAFT_53944              177   2e-47   Aureococcus anophagefferens
ref|WP_003367928.1|  peptidase M16                                      177   2e-47   Clostridium botulinum
ref|WP_009265535.1|  peptidase M16                                      177   2e-47   Lachnospiraceae bacterium 5_1_63FAA
ref|WP_022267732.1|  hypothetical protein                               177   2e-47   
ref|WP_033139292.1|  peptidase M16                                      177   3e-47   Blautia producta
ref|WP_021169379.1|  protein HypA                                       177   3e-47   Sporomusa
ref|WP_039282799.1|  peptidase M16                                      177   3e-47   Clostridium
ref|WP_002602500.1|  peptidase [                                        177   3e-47   Hungatella hathewayi
ref|WP_039277219.1|  peptidase M16                                      177   3e-47   Clostridium botulinum
ref|WP_038352608.1|  peptidase M16                                      177   3e-47   Eubacterium limosum
ref|WP_039255922.1|  peptidase M16                                      177   3e-47   Clostridium novyi
ref|WP_022415087.1|  peptidase M16 inactive domain protein              177   3e-47   
ref|WP_039258210.1|  peptidase M16                                      177   3e-47   Clostridium botulinum
ref|WP_039280280.1|  peptidase M16                                      177   3e-47   Clostridium botulinum
ref|WP_006426364.1|  peptidase M16                                      177   3e-47   Dorea longicatena
ref|WP_040636855.1|  peptidase M16                                      177   3e-47   
ref|WP_013381560.1|  hypothetical protein                               177   4e-47   
gb|ERL25529.1|  peptidase M16 inactive domain protein                   177   4e-47   
ref|WP_035148220.1|  peptidase M16                                      177   4e-47   
ref|WP_034582737.1|  peptidase M16                                      176   4e-47   
ref|WP_010966288.1|  peptidase M16                                      176   4e-47   
ref|WP_022302918.1|  peptidase M16 family                               176   4e-47   
ref|WP_009203647.1|  peptidase M16 inactive domain protein              176   5e-47   
ref|WP_039205951.1|  peptidase M16                                      172   5e-47   
ref|WP_009267857.1|  peptidase M16                                      176   5e-47   
ref|WP_025655146.1|  peptidase M16                                      176   6e-47   
ref|WP_008402837.1|  peptidase M16                                      176   6e-47   
emb|CCZ25963.1|  peptidase M16 inactive domain protein                  176   6e-47   
ref|WP_009243415.1|  MULTISPECIES: peptidase M16                        176   7e-47   
ref|WP_004847047.1|  peptidase M16 [                                    176   7e-47   
ref|WP_034548915.1|  peptidase M16                                      176   8e-47   
ref|WP_005584172.1|  Protein HypA                                       176   8e-47   
ref|WP_004079518.1|  hypothetical protein                               176   9e-47   
ref|WP_022345917.1|  peptidase M16 inactive domain protein              176   1e-46   
ref|WP_008395832.1|  peptidase M16                                      176   1e-46   
ref|WP_021840996.1|  peptidase M16 inactive domain protein              175   1e-46   
ref|WP_022250769.1|  hypothetical protein                               175   1e-46   
ref|WP_024733160.1|  peptidase M16                                      175   1e-46   
ref|WP_026514263.1|  peptidase M16                                      175   1e-46   
ref|WP_005603795.1|  peptidase M16                                      175   1e-46   
ref|WP_021960771.1|  peptidase M16 family                               175   1e-46   
ref|WP_004614449.1|  peptidase M16                                      175   1e-46   
emb|CDC14546.1|  predicted Zn-dependent peptidases insulinase-like      175   2e-46   
ref|WP_026667026.1|  MULTISPECIES: peptidase M16                        175   2e-46   
ref|WP_026654497.1|  peptidase M16                                      175   2e-46   
ref|WP_013978117.1|  peptidase M16                                      175   2e-46   
ref|WP_039260764.1|  peptidase M16                                      175   2e-46   
ref|WP_015529341.1|  Predicted Zn-dependent peptidases, insulinas...    175   2e-46   
ref|WP_022009643.1|  hypothetical protein                               174   2e-46   
ref|WP_022220671.1|  peptidase M16 inactive domain protein              174   2e-46   
ref|WP_007935353.1|  MULTISPECIES: peptidase M16                        174   2e-46   
ref|WP_021106645.1|  peptidase family protein                           174   2e-46   
ref|WP_023437650.1|  zinc-dependent peptidase                           174   2e-46   
ref|WP_021943734.1|  peptidase M16 inactive domain protein              174   2e-46   
ref|WP_015957702.1|  peptidase M16                                      174   2e-46   
ref|WP_012101025.1|  peptidase M16                                      174   2e-46   
ref|WP_012048254.1|  peptidase M16                                      174   2e-46   
dbj|BAQ14943.1|  putative peptidase                                     174   2e-46   
ref|WP_025775831.1|  peptidase M16                                      174   2e-46   
ref|WP_003357443.1|  peptidase M16                                      174   2e-46   
ref|WP_013240340.1|  peptidase M16                                      174   2e-46   
ref|WP_008372070.1|  peptidase M16                                      174   3e-46   
ref|WP_011099072.1|  peptidase M16                                      174   3e-46   
gb|EEC57947.1|  peptidase M16 inactive domain protein [                 174   3e-46   
ref|WP_035110249.1|  peptidase M16                                      174   3e-46   
ref|WP_029543082.1|  peptidase M16                                      174   3e-46   
gb|EDN76339.1|  peptidase M16 inactive domain protein                   174   3e-46   
ref|WP_040893250.1|  peptidase M16 [                                    174   3e-46   
ref|WP_033066419.1|  peptidase M16                                      174   3e-46   
ref|WP_014521888.1|  peptidase M16                                      174   3e-46   
ref|WP_003360374.1|  peptidase M16                                      174   3e-46   
ref|WP_018049849.1|  hypothetical protein                               174   3e-46   
ref|WP_039960074.1|  peptidase M16 [                                    174   3e-46   
ref|WP_022038272.1|  hypothetical protein                               174   3e-46   
ref|WP_009244525.1|  peptidase M16 [                                    174   3e-46   
ref|WP_027624167.1|  peptidase M16                                      174   3e-46   
ref|WP_039217006.1|  peptidase M16                                      174   3e-46   
ref|WP_039232384.1|  peptidase M16                                      174   3e-46   
ref|WP_022360886.1|  hypothetical protein                               174   4e-46   
ref|WP_003375296.1|  peptidase M16                                      174   4e-46   
ref|WP_039229792.1|  peptidase M16                                      174   4e-46   
gb|EGS35643.1|  peptidase M16 inactive domain protein                   174   4e-46   
gb|AJD28281.1|  peptidase M16 inactive domain protein                   174   4e-46   
ref|WP_041347722.1|  peptidase M16                                      174   4e-46   
ref|WP_039237157.1|  peptidase M16                                      174   4e-46   
ref|WP_030036983.1|  peptidase M16                                      174   4e-46   
ref|WP_003483244.1|  MULTISPECIES: peptidase M16                        174   4e-46   
ref|WP_040108719.1|  peptidase M16                                      174   4e-46   
ref|WP_033061370.1|  peptidase M16                                      174   4e-46   
ref|WP_003492319.1|  peptidase M16                                      174   4e-46   
ref|WP_036257306.1|  peptidase M16                                      174   4e-46   
ref|WP_036607124.1|  peptidase M16                                      174   4e-46   
ref|WP_023162326.1|  Peptidase M16C associated domain protein           174   4e-46   
ref|WP_021716196.1|  peptidase M16 inactive domain protein              174   4e-46   
ref|WP_022036330.1|  hypothetical protein                               174   5e-46   
ref|WP_011989018.1|  peptidase M16                                      174   5e-46   
ref|WP_015574413.1|  Predicted Zn-dependent peptidases, insulinas...    174   5e-46   
gb|ERL22297.1|  peptidase M16 inactive domain protein                   174   5e-46   
ref|WP_036599779.1|  peptidase M16                                      174   5e-46   
ref|WP_040653312.1|  peptidase M16                                      173   5e-46   
gb|EFE92811.1|  peptidase M16 inactive domain protein                   174   5e-46   
ref|WP_026522649.1|  peptidase M16                                      173   6e-46   
ref|WP_022770452.1|  peptidase M16                                      173   6e-46   
ref|WP_022514727.1|  zn-dependent peptidase insulinase family pro...    173   6e-46   
ref|WP_022399794.1|  peptidase M16 family                               173   7e-46   
ref|WP_034446831.1|  peptidase M16                                      173   7e-46   
ref|WP_007955448.1|  peptidase M16                                      173   7e-46   
ref|WP_021740137.1|  peptidase M16 inactive domain protein              173   7e-46   
gb|ETP72603.1|  putative Zn-dependent peptidase, insulinase             173   7e-46   
ref|WP_033169024.1|  peptidase M16                                      173   7e-46   
ref|WP_012342935.1|  peptidase M16                                      173   7e-46   
ref|WP_022005098.1|  hypothetical protein                               173   8e-46   
ref|WP_025642732.1|  peptidase M16                                      173   8e-46   
ref|WP_039250259.1|  peptidase M16                                      173   8e-46   
ref|WP_044504232.1|  peptidase M16                                      173   8e-46   
ref|WP_011721750.1|  MULTISPECIES: peptidase M16                        173   9e-46   
ref|WP_039238861.1|  peptidase M16                                      173   9e-46   
ref|WP_034439641.1|  peptidase M16                                      173   9e-46   
ref|WP_035309946.1|  peptidase M16                                      173   9e-46   
ref|WP_022106554.1|  hypothetical protein                               163   1e-45   
ref|WP_016223337.1|  hypothetical protein                               172   1e-45   
ref|WP_044292922.1|  peptidase M16                                      172   1e-45   
ref|WP_027293762.1|  peptidase M16                                      172   1e-45   
ref|WP_036027214.1|  peptidase M16                                      172   1e-45   
ref|WP_035640716.1|  peptidase M16                                      172   1e-45   
ref|WP_021966041.1|  peptidase M16 inactive domain protein              172   1e-45   
gb|EFQ03705.1|  peptidase M16 inactive domain protein                   172   1e-45   
ref|WP_040774437.1|  peptidase M16                                      172   1e-45   
ref|WP_022239112.1|  hypothetical protein                               172   1e-45   
ref|WP_022172571.1|  peptidase M16 family                               172   1e-45   
ref|WP_027405693.1|  peptidase M16                                      172   1e-45   
ref|WP_009248783.1|  peptidase M16 [                                    172   1e-45   
ref|WP_024866717.1|  peptidase M16                                      172   1e-45   
ref|WP_006773397.1|  peptidase M16 [                                    172   1e-45   
ref|WP_006781853.1|  peptidase M16 [                                    172   1e-45   
ref|WP_009246788.1|  peptidase M16                                      172   1e-45   
ref|WP_021952485.1|  peptidase M16 inactive domain protein              172   1e-45   
ref|WP_022031851.1|  peptidase M16 family                               172   1e-45   
ref|WP_005539104.1|  peptidase M16                                      172   2e-45   
ref|WP_031368022.1|  peptidase M16                                      172   2e-45   
ref|WP_004223111.1|  peptidase M16                                      172   2e-45   
ref|WP_009646386.1|  peptidase M16                                      172   2e-45   
gb|EDS07236.1|  peptidase M16 inactive domain protein [ [               172   2e-45   
ref|WP_019879338.1|  hypothetical protein                               172   2e-45   
ref|WP_022243043.1|  zn-dependent peptidase insulinase family pro...    172   2e-45   
ref|WP_038669998.1|  peptidase M16                                      172   2e-45   
ref|WP_026660066.1|  peptidase M16                                      172   2e-45   
ref|WP_006190827.1|  peptidase M16                                      172   2e-45   
ref|WP_012062915.1|  peptidase M16                                      172   2e-45   
ref|WP_027396310.1|  peptidase M16                                      172   2e-45   
ref|WP_027115174.1|  hypothetical protein                               172   2e-45   
ref|WP_022766914.1|  peptidase M16                                      172   2e-45   
ref|WP_031558104.1|  peptidase M16                                      172   2e-45   
ref|WP_029506194.1|  peptidase M16                                      172   2e-45   
ref|WP_027432327.1|  peptidase M16                                      172   2e-45   
ref|WP_008859142.1|  peptidase M16                                      172   2e-45   
ref|WP_027104460.1|  peptidase M16                                      171   2e-45   
ref|WP_027639774.1|  peptidase M16                                      171   3e-45   
ref|WP_022500937.1|  hypothetical protein                               171   3e-45   
ref|WP_026520362.1|  peptidase M16                                      171   3e-45   
ref|WP_009533890.1|  peptidase M16                                      171   3e-45   
ref|WP_024854334.1|  peptidase M16 [                                    171   3e-45   
ref|WP_021285711.1|  hypothetical protein                               171   3e-45   
ref|WP_022367599.1|  peptidase M16 family                               171   3e-45   
ref|WP_009536802.1|  peptidase M16                                      171   4e-45   
ref|WP_021901371.1|  peptidase M16 family                               171   4e-45   
ref|WP_014079416.1|  peptidase M16                                      171   4e-45   
ref|WP_021885887.1|  peptidase M16 inactive domain protein              171   4e-45   
ref|WP_035294970.1|  peptidase M16                                      171   4e-45   
ref|WP_009429971.1|  peptidase M16                                      171   4e-45   
ref|WP_022351639.1|  hypothetical protein                               171   4e-45   
ref|WP_024346955.1|  peptidase M16 [                                    171   4e-45   
ref|WP_028530302.1|  peptidase M16                                      171   5e-45   
ref|WP_006444431.1|  peptidase M16 [                                    171   5e-45   
ref|WP_022461181.1|  peptidase M16 family                               171   5e-45   
ref|WP_040783031.1|  peptidase M16                                      167   5e-45   
ref|WP_022318382.1|  peptidase M16 inactive domain protein              171   5e-45   
ref|WP_033124374.1|  peptidase M16                                      171   6e-45   
gb|EET61285.1|  peptidase M16 inactive domain protein                   166   6e-45   
ref|WP_031583417.1|  hypothetical protein                               170   6e-45   
ref|WP_024291571.1|  MULTISPECIES: peptidase M16                        170   7e-45   
ref|WP_036376441.1|  peptidase M16                                      170   7e-45   
ref|WP_023509403.1|  peptidase M16                                      170   7e-45   
ref|WP_007553874.1|  peptidase M16                                      170   8e-45   
ref|WP_040015579.1|  peptidase M16                                      170   8e-45   
gb|EDR45797.1|  peptidase M16 inactive domain protein                   170   8e-45   
ref|WP_022088011.1|  predicted Zn-dependent peptidases insulinase...    170   8e-45   
ref|WP_007278732.1|  probable zinc metalloprotease                      170   8e-45   
ref|WP_007556480.1|  peptidase M16                                      170   9e-45   
ref|WP_026884785.1|  peptidase M16                                      170   9e-45   
ref|WP_028129011.1|  peptidase M16                                      170   9e-45   
ref|WP_022313374.1|  hypothetical protein                               170   9e-45   
ref|WP_002593286.1|  peptidase [                                        170   9e-45   
ref|WP_022449237.1|  hypothetical protein                               170   1e-44   
ref|WP_006597865.1|  M16 family peptidase                               170   1e-44   
ref|WP_002586228.1|  peptidase [                                        170   1e-44   
ref|WP_003524472.1|  MULTISPECIES: peptidase M16                        170   1e-44   
ref|WP_029451452.1|  peptidase M16                                      170   1e-44   
ref|WP_029200616.1|  peptidase M16                                      170   1e-44   
ref|WP_021893380.1|  hypothetical protein                               170   1e-44   
ref|WP_027113718.1|  peptidase M16                                      170   1e-44   
ref|WP_035134584.1|  peptidase M16                                      170   1e-44   
ref|WP_002571826.1|  peptidase [                                        170   1e-44   
ref|WP_022200298.1|  hypothetical protein                               170   1e-44   
ref|WP_002577940.1|  peptidase [                                        170   1e-44   
ref|WP_002567788.1|  peptidase M16 [                                    170   1e-44   
ref|WP_007867561.1|  peptidase M16 [                                    169   1e-44   
ref|WP_021718536.1|  peptidase M16 inactive domain protein              169   1e-44   
ref|WP_028977449.1|  peptidase M16                                      169   1e-44   
ref|WP_002589733.1|  peptidase [                                        169   1e-44   
ref|WP_028255999.1|  peptidase M16                                      169   1e-44   
ref|WP_039634548.1|  peptidase M16                                      169   2e-44   
ref|WP_026490569.1|  peptidase M16                                      169   2e-44   
ref|WP_005386223.1|  peptidase M16                                      169   2e-44   
ref|WP_016226596.1|  hypothetical protein                               169   2e-44   
ref|WP_031548392.1|  peptidase M16                                      169   2e-44   
ref|WP_020310535.1|  MULTISPECIES: peptidase M16C associated protein    169   2e-44   
ref|WP_022279196.1|  hypothetical protein                               169   2e-44   
ref|WP_026766727.1|  peptidase M16                                      169   2e-44   
ref|WP_022024267.1|  hypothetical protein                               169   2e-44   
ref|WP_026665843.1|  peptidase M16                                      169   2e-44   
ref|XP_011399462.1|  Presequence protease 1, chloroplastic/mitoch...    162   2e-44   
ref|WP_012739588.1|  peptidase M16 [                                    169   2e-44   
ref|WP_014424651.1|  peptidase M16                                      169   2e-44   
ref|WP_004054450.1|  hypothetical protein                               169   2e-44   
ref|WP_022099108.1|  hypothetical protein                               169   2e-44   
gb|ADD61762.1|  putative protein                                        169   2e-44   
ref|WP_021148279.1|  Zn-dependent peptidase, insulinase family          169   2e-44   
ref|WP_016279460.1|  hypothetical protein                               169   2e-44   
ref|WP_005337235.1|  peptidase M16                                      169   2e-44   
ref|WP_029731598.1|  peptidase M16                                      169   2e-44   
ref|WP_022432757.1|  hypothetical protein                               169   2e-44   
ref|WP_026669282.1|  peptidase M16                                      169   2e-44   
ref|WP_026524222.1|  peptidase M16                                      169   2e-44   
ref|WP_026526932.1|  peptidase M16                                      169   2e-44   
ref|WP_027642273.1|  peptidase M16 [                                    169   2e-44   



>ref|XP_004230817.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
[Solanum lycopersicum]
 ref|XP_010315269.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
[Solanum lycopersicum]
Length=1072

 Score =   300 bits (768),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 156/222 (70%), Positives = 178/222 (80%), Gaps = 15/222 (7%)
 Frame = +1

Query  1    EGRVLLRSLSPPN----STLFARSSF---SFSKRPHFFANHLSNPRSTFRNRLLFTSTAA  159
            E  VLLRSLS  +    S +F+RSS    S+S R H    +L   RS  R+ +   S+  
Sbjct  2    ERAVLLRSLSSTSTLAFSRIFSRSSHRFASYSARRHRLLQNLQRRRSLVRSNVRGISS--  59

Query  160  LPSLHLRTRFSPLSVRAVYTFPPELS----GAEDDVARKLGFEKVSEQFVDECKSRAVLY  327
              S++L+ +F PLSVRA+ T  P+ S    GA+D+VA K GFEKVSEQF+DECKS+AVLY
Sbjct  60   --SINLKRQFYPLSVRAIATSSPQSSQEFLGADDEVAEKFGFEKVSEQFIDECKSKAVLY  117

Query  328  KHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELL  507
            KHKKTGAE+MSVSNDDENKVFG+VFRTPPK+STGIPHILEHSVLCGSRKYPLK+PFVELL
Sbjct  118  KHKKTGAEVMSVSNDDENKVFGVVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELL  177

Query  508  KGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            KGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  178  KGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  219



>ref|XP_009760273.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
[Nicotiana sylvestris]
Length=1072

 Score =   299 bits (766),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 156/221 (71%), Positives = 176/221 (80%), Gaps = 13/221 (6%)
 Frame = +1

Query  1    EGRVLLRSLSPPNSTLFARSSFSFSKRPHFFANHLSNP----RSTFRNRLLFTSTAAL--  162
            E  VLLRSLS  ++  F+R    FS+  H  A++ +      ++ +R R L  S   L  
Sbjct  2    EKAVLLRSLSSTSTLAFSRI---FSRSSHRLASYSAKRHRLLQNLYRRRSLIRSNGRLLS  58

Query  163  PSLHLRTRFSPLSVRAVYTFPPELS----GAEDDVARKLGFEKVSEQFVDECKSRAVLYK  330
            PSL L+ +F PLSVRA+ T  P+ S    GA+D+VA K GFEKVSEQF+DECKS+AVLYK
Sbjct  59   PSLDLKRQFYPLSVRAIATSAPQSSQEFLGADDEVAEKYGFEKVSEQFIDECKSKAVLYK  118

Query  331  HKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLK  510
            HKKTGAEIMSVSNDDENKVFGIVFRTPPK+STGIPHILEHSVLCGSRKYPLK+PFVELLK
Sbjct  119  HKKTGAEIMSVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLK  178

Query  511  GSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            GSLNTFLNAFTYPDRTCYPVASTN KDFYNLVDVYLDAVFF
Sbjct  179  GSLNTFLNAFTYPDRTCYPVASTNAKDFYNLVDVYLDAVFF  219



>ref|XP_009628645.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
[Nicotiana tomentosiformis]
Length=1072

 Score =   299 bits (766),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 156/221 (71%), Positives = 176/221 (80%), Gaps = 13/221 (6%)
 Frame = +1

Query  1    EGRVLLRSLSPPNSTLFARSSFSFSKRPHFFANHLSNP----RSTFRNRLLFTSTAAL--  162
            E  VLLRSLS  ++  F+R    FS+  H  A++ +      ++ +R R L  S   L  
Sbjct  2    EKAVLLRSLSSTSTLAFSRI---FSRSSHRLASYSAKRHRLLQNLYRRRSLIRSNGRLLS  58

Query  163  PSLHLRTRFSPLSVRAVYTFPPELS----GAEDDVARKLGFEKVSEQFVDECKSRAVLYK  330
            PSL L+ +F PLSVRA+ T  P+ S    GA+D+VA K GFEKVSEQF+DECKS+AVLYK
Sbjct  59   PSLDLKRQFYPLSVRAIATSVPQSSQEFLGADDEVAEKYGFEKVSEQFIDECKSKAVLYK  118

Query  331  HKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLK  510
            HKKTGAEIMSVSNDDENKVFGIVFRTPPK+STGIPHILEHSVLCGSRKYPLK+PFVELLK
Sbjct  119  HKKTGAEIMSVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLK  178

Query  511  GSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            GSLNTFLNAFTYPDRTCYPVASTN KDFYNLVDVYLDAVFF
Sbjct  179  GSLNTFLNAFTYPDRTCYPVASTNAKDFYNLVDVYLDAVFF  219



>ref|XP_006346464.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
[Solanum tuberosum]
Length=1072

 Score =   293 bits (749),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 168/203 (83%), Gaps = 11/203 (5%)
 Frame = +1

Query  46   LFARSSF---SFSKRPHFFANHLSNPRSTFRNRLLFTSTAALPSLHLRTRFSPLSVRAVY  216
            +F+RSS    S+S R H    +L   RS  R+ +   S+    S++L+ +F PLSVRA+ 
Sbjct  21   IFSRSSHRFASYSARRHRLLQNLHRRRSLVRSNVRGISS----SINLKRQFYPLSVRAIA  76

Query  217  TFPPELS----GAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENK  384
            T  P+ S    GA+D+VA K GFEKVSEQF+DECKS+AVLYKHKKTGAE+MSVSNDDENK
Sbjct  77   TSSPQSSQEFLGADDEVAEKFGFEKVSEQFIDECKSKAVLYKHKKTGAEVMSVSNDDENK  136

Query  385  VFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCY  564
            VFG+VFRTPPK+STGIPHILEHSVLCGSRKYPLK+PFVELLKGSLNTFLNAFTYPDRTCY
Sbjct  137  VFGVVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLNTFLNAFTYPDRTCY  196

Query  565  PVASTNTKDFYNLVDVYLDAVFF  633
            PVASTNTKDFYNLVDVYLDAVFF
Sbjct  197  PVASTNTKDFYNLVDVYLDAVFF  219



>ref|XP_011088279.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
[Sesamum indicum]
Length=1078

 Score =   290 bits (743),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 147/202 (73%), Positives = 165/202 (82%), Gaps = 7/202 (3%)
 Frame = +1

Query  46   LFARSSFSFSKRP--HFFANHLSNPRSTFRNRLLFTSTAALPSLHLRTRFSPLSVRAVYT  219
            LF+RS    ++ P  H    ++ + RS  R  L F S  + PSL L   F  LSVRAV T
Sbjct  25   LFSRSVHRLARLPRRHRLVPNV-HQRSLLRRHLGFISAVSRPSLQLSRHFCSLSVRAVAT  83

Query  220  FP----PELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKV  387
                  PE+ GA+DDVA KLGFEKVS++F++ECKSRAVLYKHKKTGAE+MSVSN+DENKV
Sbjct  84   SSVQSSPEVLGADDDVAEKLGFEKVSDEFIEECKSRAVLYKHKKTGAEVMSVSNEDENKV  143

Query  388  FGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYP  567
            FGIVFRTPPK+STGIPHILEHSVLCGSRKYPLK+PFVELLKGSL+TFLNAFTYPDRTCYP
Sbjct  144  FGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNAFTYPDRTCYP  203

Query  568  VASTNTKDFYNLVDVYLDAVFF  633
            VASTNTKDFYNLVDVYLDAVFF
Sbjct  204  VASTNTKDFYNLVDVYLDAVFF  225



>ref|XP_010269115.1| PREDICTED: presequence protease 2, chloroplastic/mitochondrial 
[Nelumbo nucifera]
Length=1080

 Score =   278 bits (711),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 138/182 (76%), Positives = 156/182 (86%), Gaps = 9/182 (5%)
 Frame = +1

Query  106  SNPRSTFRN--RLLFTSTAALPSLHLRTRFSPLSVRAVYTFP----PELSGAEDDVARKL  267
            +N RS  R+  RL+ +S +   SLHL   FS L+ RA+ T P    P++ G+ D+VA KL
Sbjct  49   ANGRSALRHPCRLISSSPS---SLHLNRCFSSLTPRAIATSPQYASPDIGGSHDEVAEKL  105

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GFEK+SEQ + ECKS+AVLYKHKKTGAE+MSVSNDDENKVFGIVFRTPPK+STGIPHILE
Sbjct  106  GFEKISEQVIQECKSKAVLYKHKKTGAEVMSVSNDDENKVFGIVFRTPPKDSTGIPHILE  165

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSRKYPLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV
Sbjct  166  HSVLCGSRKYPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  225

Query  628  FF  633
            FF
Sbjct  226  FF  227



>gb|AFW73556.1| hypothetical protein ZEAMMB73_636378 [Zea mays]
Length=291

 Score =   258 bits (658),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 135/173 (78%), Positives = 141/173 (82%), Gaps = 13/173 (8%)
 Frame = +1

Query  151  TAALPSLHLRTRFSP---------LSVRAVYTFPPELSGAEDDV---ARKLGFEKVSEQF  294
             AA P LH   R+ P         LS  AV T P  +    DDV   A KLGFEKVSEQ 
Sbjct  60   VAAAP-LHCSGRYWPAAAPQLARRLSASAVSTSPSPVPYDTDDVHEYATKLGFEKVSEQT  118

Query  295  VDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRK  474
            +DECKS AVLYKHKKTGAE+MSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRK
Sbjct  119  IDECKSIAVLYKHKKTGAEVMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRK  178

Query  475  YPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            YPLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  179  YPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  231



>ref|XP_009417618.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=1075

 Score =   273 bits (699),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 148/219 (68%), Positives = 167/219 (76%), Gaps = 14/219 (6%)
 Frame = +1

Query  13   LLRSLSPPNSTLFARSSFSFSKRPHFFANHLSNPR-STFRNRLLFTSTAA------LPSL  171
            LLRSLS  ++T + R  F        F+++L  PR    + R L  S A+       P L
Sbjct  6    LLRSLSC-STTAYRRLLFRPRSASRLFSSNLCRPRPQELQLRALSCSGASRWRPGPAPPL  64

Query  172  HLRTRFSPLSVRAVYTFPPELSGAED-----DVARKLGFEKVSEQFVDECKSRAVLYKHK  336
             LR RFSP S+RA+ T P  +S   D     D+A KLGFE +SEQ ++ECK+ AVLYKHK
Sbjct  65   RLRRRFSP-SIRAISTSPSPVSRGADIDSRNDIAEKLGFEIISEQTINECKATAVLYKHK  123

Query  337  KTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGS  516
            KTGAEIMSVSNDDENKVFGIVFRTPPK+STGIPHILEHSVLCGSRKYPLK+PFVELLKGS
Sbjct  124  KTGAEIMSVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGS  183

Query  517  LNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            L+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  184  LHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  222



>ref|XP_009417619.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=1073

 Score =   273 bits (698),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 147/217 (68%), Positives = 168/217 (77%), Gaps = 12/217 (6%)
 Frame = +1

Query  13   LLRSLSPPNSTLFARSSFSFSKRPHFFANHLSNPR-STFRNRLLFTSTAA------LPSL  171
            LLRSLS  ++T + R  F        F+++L  PR    + R L  S A+       P L
Sbjct  6    LLRSLSC-STTAYRRLLFRPRSASRLFSSNLCRPRPQELQLRALSCSGASRWRPGPAPPL  64

Query  172  HLRTRFSPLSVRAVYTFPPELS---GAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKT  342
             LR RFSP S+RA+ T P  +S    + +D+A KLGFE +SEQ ++ECK+ AVLYKHKKT
Sbjct  65   RLRRRFSP-SIRAISTSPSPVSRDIDSRNDIAEKLGFEIISEQTINECKATAVLYKHKKT  123

Query  343  GAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLN  522
            GAEIMSVSNDDENKVFGIVFRTPPK+STGIPHILEHSVLCGSRKYPLK+PFVELLKGSL+
Sbjct  124  GAEIMSVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLH  183

Query  523  TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  184  TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  220



>ref|XP_006423050.1| hypothetical protein CICLE_v10029929mg [Citrus clementina]
 gb|ESR36290.1| hypothetical protein CICLE_v10029929mg [Citrus clementina]
Length=495

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 158/200 (79%), Gaps = 6/200 (3%)
 Frame = +1

Query  49   FARSSFSFSKRPHF-FANHLSNPRSTFRNRLLFTSTAALPSLHLRTRFSPLSVRAVYT--  219
            F+ SS + ++R H    N+L+  RS  R       + +  SL     FS LS RAV +  
Sbjct  31   FSSSSVAVARRNHHRLINNLTR-RSLLRGDSRLHLSLSSYSLQFNKHFSSLSPRAVASPS  89

Query  220  FPPELSGAE--DDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFG  393
             P    GAE  ++VA KLGFEKVSE+F+ ECKS+AVL+KHKKTGAE+MSVSNDDENKVFG
Sbjct  90   TPSSPEGAEVSNEVAEKLGFEKVSEEFIGECKSKAVLFKHKKTGAEVMSVSNDDENKVFG  149

Query  394  IVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVA  573
            IVFRTPPK+STGIPHILEHSVLCGSRKYPLK+ FVELLKGSLNTFLNAFTYPDRTCYPVA
Sbjct  150  IVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEQFVELLKGSLNTFLNAFTYPDRTCYPVA  209

Query  574  STNTKDFYNLVDVYLDAVFF  633
            STNTKDFYNLVDVYLDAVFF
Sbjct  210  STNTKDFYNLVDVYLDAVFF  229



>ref|XP_002518788.1| zinc metalloprotease, putative [Ricinus communis]
 gb|EEF43713.1| zinc metalloprotease, putative [Ricinus communis]
Length=302

 Score =   255 bits (652),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 146/176 (83%), Gaps = 7/176 (4%)
 Frame = +1

Query  127  RNRLLFTSTAALPSLHLR--TRFSPLSVRAVYTFP----PELSGA-EDDVARKLGFEKVS  285
            RN  LF   A   S   R    FS LS  AV T P    P+++G    +VA KLGF+KVS
Sbjct  53   RNWRLFPVAATSSSSSSRFNKHFSSLSPAAVATHPAPSSPDVAGGVPSEVAEKLGFQKVS  112

Query  286  EQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCG  465
            E+F++ECKS+A L++HKKTGAEIMSVSNDDENKVFGIVFRTPPK+STGIPHILEHSVLCG
Sbjct  113  EEFIEECKSKAELFRHKKTGAEIMSVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCG  172

Query  466  SRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            SRKYPLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  173  SRKYPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  228



>ref|XP_006423047.1| hypothetical protein CICLE_v10027722mg [Citrus clementina]
 gb|ESR36287.1| hypothetical protein CICLE_v10027722mg [Citrus clementina]
Length=1082

 Score =   271 bits (694),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 142/202 (70%), Positives = 164/202 (81%), Gaps = 10/202 (5%)
 Frame = +1

Query  49   FARSSFSFSKRPHF-FANHLSNPRSTFR--NRLLFTSTAALPSLHLRTRFSPLSVRAVYT  219
            F+ SS + ++R H    N+L+  RS  R  +RL F+ ++   SL     FS LS RAV +
Sbjct  31   FSSSSVAVARRNHHRLINNLTR-RSLLRGDSRLRFSLSSY--SLQFNKHFSSLSPRAVAS  87

Query  220  ----FPPELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKV  387
                  PE++   ++VA KLGFEKVSE+F+ ECKS+AVL+KHKKTGAE+MSVSNDDENKV
Sbjct  88   PSTPSSPEVAEVSNEVAEKLGFEKVSEEFIGECKSKAVLFKHKKTGAEVMSVSNDDENKV  147

Query  388  FGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYP  567
            FGIVFRTPPK+STGIPHILEHSVLCGSRKYPLK+PFVELLKGSLNTFLNAFTYPDRTCYP
Sbjct  148  FGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLNTFLNAFTYPDRTCYP  207

Query  568  VASTNTKDFYNLVDVYLDAVFF  633
            VASTNTKDFYNLVDVYLDAVFF
Sbjct  208  VASTNTKDFYNLVDVYLDAVFF  229



>ref|XP_006423048.1| hypothetical protein CICLE_v10027722mg [Citrus clementina]
 gb|ESR36288.1| hypothetical protein CICLE_v10027722mg [Citrus clementina]
Length=815

 Score =   268 bits (685),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 142/202 (70%), Positives = 164/202 (81%), Gaps = 10/202 (5%)
 Frame = +1

Query  49   FARSSFSFSKRPHF-FANHLSNPRSTFR--NRLLFTSTAALPSLHLRTRFSPLSVRAVYT  219
            F+ SS + ++R H    N+L+  RS  R  +RL F+ ++   SL     FS LS RAV +
Sbjct  31   FSSSSVAVARRNHHRLINNLTR-RSLLRGDSRLRFSLSSY--SLQFNKHFSSLSPRAVAS  87

Query  220  ----FPPELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKV  387
                  PE++   ++VA KLGFEKVSE+F+ ECKS+AVL+KHKKTGAE+MSVSNDDENKV
Sbjct  88   PSTPSSPEVAEVSNEVAEKLGFEKVSEEFIGECKSKAVLFKHKKTGAEVMSVSNDDENKV  147

Query  388  FGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYP  567
            FGIVFRTPPK+STGIPHILEHSVLCGSRKYPLK+PFVELLKGSLNTFLNAFTYPDRTCYP
Sbjct  148  FGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLNTFLNAFTYPDRTCYP  207

Query  568  VASTNTKDFYNLVDVYLDAVFF  633
            VASTNTKDFYNLVDVYLDAVFF
Sbjct  208  VASTNTKDFYNLVDVYLDAVFF  229



>ref|XP_004136986.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
[Cucumis sativus]
 gb|KGN43941.1| hypothetical protein Csa_7G073760 [Cucumis sativus]
Length=1084

 Score =   270 bits (690),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 145/216 (67%), Positives = 165/216 (76%), Gaps = 10/216 (5%)
 Frame = +1

Query  7    RVLLRS---LSPPNSTLFARSSFSFSKRPHFFANHLSNPRSTFRNRLLFTSTAALPSLHL  177
            R+  RS   L P  STL  RSSF  S++ H F    S      R   L  + +   S H 
Sbjct  19   RIFFRSAHRLCP--STLPPRSSF-VSRKLHRFNPSFSRRSLLPRQLKLLPAYSQSRSSHF  75

Query  178  RTRFSPLSVRAVYT----FPPELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTG  345
            R +FS L+ RAV +     PPE +   D+VA KLGFEKVSE+F+ ECKS+AVL++HKKTG
Sbjct  76   RKQFSSLAPRAVASPPAHSPPEFAEVSDEVAEKLGFEKVSEEFIGECKSKAVLFRHKKTG  135

Query  346  AEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNT  525
            AE+MSVSNDDENKVFGIVFRTPP +STGIPHILEHSVLCGSRKYP+K+PFVELLKGSL+T
Sbjct  136  AEVMSVSNDDENKVFGIVFRTPPSDSTGIPHILEHSVLCGSRKYPVKEPFVELLKGSLHT  195

Query  526  FLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            FLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  196  FLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  231



>ref|XP_004159889.1| PREDICTED: LOW QUALITY PROTEIN: presequence protease 1, chloroplastic/mitochondrial-like 
[Cucumis sativus]
Length=1084

 Score =   270 bits (690),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 145/216 (67%), Positives = 165/216 (76%), Gaps = 10/216 (5%)
 Frame = +1

Query  7    RVLLRS---LSPPNSTLFARSSFSFSKRPHFFANHLSNPRSTFRNRLLFTSTAALPSLHL  177
            R+  RS   L P  STL  RSSF  S++ H F    S      R   L  + +   S H 
Sbjct  19   RIFFRSAHRLCP--STLPPRSSF-VSRKLHRFNPSFSRRSLLPRQLKLLPAYSQSRSSHF  75

Query  178  RTRFSPLSVRAVYT----FPPELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTG  345
            R +FS L+ RAV +     PPE +   D+VA KLGFEKVSE+F+ ECKS+AVL++HKKTG
Sbjct  76   RKQFSSLAPRAVASPPAHSPPEFAEVSDEVAEKLGFEKVSEEFIGECKSKAVLFRHKKTG  135

Query  346  AEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNT  525
            AE+MSVSNDDENKVFGIVFRTPP +STGIPHILEHSVLCGSRKYP+K+PFVELLKGSL+T
Sbjct  136  AEVMSVSNDDENKVFGIVFRTPPSDSTGIPHILEHSVLCGSRKYPVKEPFVELLKGSLHT  195

Query  526  FLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            FLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  196  FLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  231



>ref|XP_006487082.1| PREDICTED: LOW QUALITY PROTEIN: presequence protease 2, chloroplastic/mitochondrial-like 
[Citrus sinensis]
Length=1082

 Score =   269 bits (688),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 139/200 (70%), Positives = 159/200 (80%), Gaps = 6/200 (3%)
 Frame = +1

Query  49   FARSSFSFSKRPHF-FANHLSNPRSTFRNRLLFTSTAALPSLHLRTRFSPLSVRAVYT--  219
            F+ SS + ++R H    N+L+  RS  R       + +  SL     FS LS RAV +  
Sbjct  31   FSSSSVAVARRNHHRLINNLTR-RSLLRGDSRLHLSLSSYSLQFNKHFSSLSPRAVASPS  89

Query  220  --FPPELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFG  393
                PE++   ++VA KLGFEKVSE+F+ ECKS+AVL+KHKKTGAE+MSVSNDDENKVFG
Sbjct  90   TPSSPEVAEVSNEVAEKLGFEKVSEEFIGECKSKAVLFKHKKTGAEVMSVSNDDENKVFG  149

Query  394  IVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVA  573
            IVFRTPPK+STGIPHILEHSVLCGSRKYPLK+PFVELLKGSLNTFLNAFTYPDRTCYPVA
Sbjct  150  IVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLNTFLNAFTYPDRTCYPVA  209

Query  574  STNTKDFYNLVDVYLDAVFF  633
            STNTKDFYNLVDVYLDAVFF
Sbjct  210  STNTKDFYNLVDVYLDAVFF  229



>ref|XP_008454934.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
[Cucumis melo]
Length=1084

 Score =   268 bits (686),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 147/222 (66%), Positives = 167/222 (75%), Gaps = 22/222 (10%)
 Frame = +1

Query  7    RVLLRS---LSPPNSTLFARSSFSFSKRPHFFANHLSNPRSTFRNRLLFTSTAALP----  165
            R+  RS   L P  STL  RSS S S++ H   +  S      R  LL     +LP    
Sbjct  19   RIFFRSAHRLRP--STLPLRSS-SVSRKLHRLNHSFS------RRSLLPRQLKSLPAYSQ  69

Query  166  --SLHLRTRFSPLSVRAVYT----FPPELSGAEDDVARKLGFEKVSEQFVDECKSRAVLY  327
              S H R +FS L+ RAV +     PPE +   D+VA KLGFEKVSE+F+ ECKS+AVL+
Sbjct  70   SCSFHFRKQFSSLAPRAVASPPAHSPPEFAEVSDEVAEKLGFEKVSEEFIGECKSKAVLF  129

Query  328  KHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELL  507
            +HKKTGAE+MSVSNDDENKVFGIVFRTPP +STGIPHILEHSVLCGSRKYP+K+PFVELL
Sbjct  130  RHKKTGAEVMSVSNDDENKVFGIVFRTPPSDSTGIPHILEHSVLCGSRKYPVKEPFVELL  189

Query  508  KGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            KGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  190  KGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  231



>ref|XP_007042387.1| Presequence protease 2 isoform 4 [Theobroma cacao]
 gb|EOX98218.1| Presequence protease 2 isoform 4 [Theobroma cacao]
Length=849

 Score =   266 bits (679),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 141/152 (93%), Gaps = 3/152 (2%)
 Frame = +1

Query  187  FSPLSVRAVY--TFP-PELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIM  357
            FS LS RAV   T P P+++G ED+VA KLGFEKVSE+F+ ECKS+AVL+KHKKTGAE+M
Sbjct  81   FSSLSPRAVASPTQPSPDIAGVEDEVAEKLGFEKVSEEFIGECKSKAVLFKHKKTGAEVM  140

Query  358  SVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNA  537
            SVSNDDENKVFGIVFRTPPK+STGIPHILEHSVLCGSRKYPLK+PFVELLKGSL+TFLNA
Sbjct  141  SVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNA  200

Query  538  FTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            FTYPDRTCYPVASTN KDFYNLVDVYLDAVFF
Sbjct  201  FTYPDRTCYPVASTNAKDFYNLVDVYLDAVFF  232



>ref|XP_010939450.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
isoform X1 [Elaeis guineensis]
Length=1072

 Score =   268 bits (684),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 149/177 (84%), Gaps = 11/177 (6%)
 Frame = +1

Query  133  RLLFTSTAA------LPSLHLRTRFSPLSVRAVYTFPPELSGAE----DDVARKLGFEKV  282
            RLL  S+A        PS+HLR  FS L+ RAV T P  +S A+     D+A KLGFEK+
Sbjct  44   RLLSCSSALPWRPGPAPSVHLRRAFS-LTTRAVSTTPSPVSRADMDESHDIAEKLGFEKI  102

Query  283  SEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLC  462
            SEQ +DECKS AVLYKHKKTGAE+MS+SNDDENKVFGIVFRTPPK+STGIPHILEHSVLC
Sbjct  103  SEQTIDECKSTAVLYKHKKTGAEVMSLSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLC  162

Query  463  GSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            GSRKYPLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTN KDFYNLVDVYLDAVFF
Sbjct  163  GSRKYPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNAKDFYNLVDVYLDAVFF  219



>ref|XP_010939451.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
isoform X2 [Elaeis guineensis]
Length=1071

 Score =   267 bits (683),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 148/176 (84%), Gaps = 10/176 (6%)
 Frame = +1

Query  133  RLLFTSTAA------LPSLHLRTRFSPLSVRAVYTFPPELSGAED---DVARKLGFEKVS  285
            RLL  S+A        PS+HLR  FS L+ RAV T P  +S   D   D+A KLGFEK+S
Sbjct  44   RLLSCSSALPWRPGPAPSVHLRRAFS-LTTRAVSTTPSPVSRDMDESHDIAEKLGFEKIS  102

Query  286  EQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCG  465
            EQ +DECKS AVLYKHKKTGAE+MS+SNDDENKVFGIVFRTPPK+STGIPHILEHSVLCG
Sbjct  103  EQTIDECKSTAVLYKHKKTGAEVMSLSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCG  162

Query  466  SRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            SRKYPLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTN KDFYNLVDVYLDAVFF
Sbjct  163  SRKYPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNAKDFYNLVDVYLDAVFF  218



>ref|XP_010481056.1| PREDICTED: presequence protease 2, chloroplastic/mitochondrial-like 
[Camelina sativa]
Length=740

 Score =   263 bits (672),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 150/181 (83%), Gaps = 7/181 (4%)
 Frame = +1

Query  103  LSNPRSTFRNRLLFTSTAALPSLHLRT---RFSPLSVRAVYTFP-PELSGAEDDVARKLG  270
            LS P +  R RL  +    L S   R+   +FS LS+RAV T P P   G +D  A KLG
Sbjct  41   LSTPEAAGR-RLFLSRGFKLRSATSRSLSGQFSRLSIRAVATQPAPSYLGQDD--AEKLG  97

Query  271  FEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEH  450
            FEKVSE+F+ ECKS+AVL+KHKKTG E+MSVSNDDENKVFGIVFRTPPK+STGIPHILEH
Sbjct  98   FEKVSEEFISECKSKAVLFKHKKTGCEVMSVSNDDENKVFGIVFRTPPKDSTGIPHILEH  157

Query  451  SVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  630
            SVLCGSRKYPLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF
Sbjct  158  SVLCGSRKYPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  217

Query  631  F  633
            F
Sbjct  218  F  218



>ref|XP_007042388.1| Presequence protease 2 isoform 5 [Theobroma cacao]
 gb|EOX98219.1| Presequence protease 2 isoform 5 [Theobroma cacao]
Length=971

 Score =   266 bits (681),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 141/152 (93%), Gaps = 3/152 (2%)
 Frame = +1

Query  187  FSPLSVRAVY--TFP-PELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIM  357
            FS LS RAV   T P P+++G ED+VA KLGFEKVSE+F+ ECKS+AVL+KHKKTGAE+M
Sbjct  81   FSSLSPRAVASPTQPSPDIAGVEDEVAEKLGFEKVSEEFIGECKSKAVLFKHKKTGAEVM  140

Query  358  SVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNA  537
            SVSNDDENKVFGIVFRTPPK+STGIPHILEHSVLCGSRKYPLK+PFVELLKGSL+TFLNA
Sbjct  141  SVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNA  200

Query  538  FTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            FTYPDRTCYPVASTN KDFYNLVDVYLDAVFF
Sbjct  201  FTYPDRTCYPVASTNAKDFYNLVDVYLDAVFF  232



>ref|XP_007042385.1| Presequence protease 2 isoform 2 [Theobroma cacao]
 gb|EOX98216.1| Presequence protease 2 isoform 2 [Theobroma cacao]
Length=1040

 Score =   266 bits (681),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 141/152 (93%), Gaps = 3/152 (2%)
 Frame = +1

Query  187  FSPLSVRAVY--TFP-PELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIM  357
            FS LS RAV   T P P+++G ED+VA KLGFEKVSE+F+ ECKS+AVL+KHKKTGAE+M
Sbjct  81   FSSLSPRAVASPTQPSPDIAGVEDEVAEKLGFEKVSEEFIGECKSKAVLFKHKKTGAEVM  140

Query  358  SVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNA  537
            SVSNDDENKVFGIVFRTPPK+STGIPHILEHSVLCGSRKYPLK+PFVELLKGSL+TFLNA
Sbjct  141  SVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNA  200

Query  538  FTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            FTYPDRTCYPVASTN KDFYNLVDVYLDAVFF
Sbjct  201  FTYPDRTCYPVASTNAKDFYNLVDVYLDAVFF  232



>ref|XP_007042384.1| Presequence protease 2 isoform 1 [Theobroma cacao]
 gb|EOX98215.1| Presequence protease 2 isoform 1 [Theobroma cacao]
Length=1037

 Score =   266 bits (680),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 141/152 (93%), Gaps = 3/152 (2%)
 Frame = +1

Query  187  FSPLSVRAVY--TFP-PELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIM  357
            FS LS RAV   T P P+++G ED+VA KLGFEKVSE+F+ ECKS+AVL+KHKKTGAE+M
Sbjct  81   FSSLSPRAVASPTQPSPDIAGVEDEVAEKLGFEKVSEEFIGECKSKAVLFKHKKTGAEVM  140

Query  358  SVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNA  537
            SVSNDDENKVFGIVFRTPPK+STGIPHILEHSVLCGSRKYPLK+PFVELLKGSL+TFLNA
Sbjct  141  SVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNA  200

Query  538  FTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            FTYPDRTCYPVASTN KDFYNLVDVYLDAVFF
Sbjct  201  FTYPDRTCYPVASTNAKDFYNLVDVYLDAVFF  232



>ref|XP_004296078.2| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
[Fragaria vesca subsp. vesca]
Length=1105

 Score =   266 bits (681),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 148/180 (82%), Gaps = 9/180 (5%)
 Frame = +1

Query  115  RSTFRNRLL---FTSTAALPSLHLRTRFSPLSVRAVYT----FPPELSGAEDDVARKLGF  273
            R   R  LL   F   AA P  H   RFS LS RAV T     P E SG  D+VA KLGF
Sbjct  75   RQILRPSLLRRTFLLPAASP--HFSRRFSSLSPRAVATPLTPSPSESSGVSDEVAEKLGF  132

Query  274  EKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHS  453
            EKV+E+F+ ECKS+A+L++HKKTGA+++SVSNDDENKVFGIVFRTPP +STGIPHILEHS
Sbjct  133  EKVTEEFIGECKSKALLFRHKKTGAQMISVSNDDENKVFGIVFRTPPNDSTGIPHILEHS  192

Query  454  VLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            VLCGSRKYPLK+PFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  193  VLCGSRKYPLKEPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  252



>ref|XP_007042386.1| Presequence protease 2 isoform 3 [Theobroma cacao]
 gb|EOX98217.1| Presequence protease 2 isoform 3 [Theobroma cacao]
Length=1041

 Score =   266 bits (679),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 141/152 (93%), Gaps = 3/152 (2%)
 Frame = +1

Query  187  FSPLSVRAVY--TFP-PELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIM  357
            FS LS RAV   T P P+++G ED+VA KLGFEKVSE+F+ ECKS+AVL+KHKKTGAE+M
Sbjct  81   FSSLSPRAVASPTQPSPDIAGVEDEVAEKLGFEKVSEEFIGECKSKAVLFKHKKTGAEVM  140

Query  358  SVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNA  537
            SVSNDDENKVFGIVFRTPPK+STGIPHILEHSVLCGSRKYPLK+PFVELLKGSL+TFLNA
Sbjct  141  SVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNA  200

Query  538  FTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            FTYPDRTCYPVASTN KDFYNLVDVYLDAVFF
Sbjct  201  FTYPDRTCYPVASTNAKDFYNLVDVYLDAVFF  232



>ref|XP_003570577.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
[Brachypodium distachyon]
Length=1083

 Score =   266 bits (679),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 146/181 (81%), Gaps = 16/181 (9%)
 Frame = +1

Query  127  RNRLLFTSTAALPSLHLRTRFSP---------LSVRAVYTFPPELSGAEDDV---ARKLG  270
            R+RLL    AA   LH   R+ P         LSV AV T P  +    DDV   A KLG
Sbjct  54   RSRLL----AAAAPLHCAGRYWPPYAPGLARRLSVPAVSTSPSPVPHDTDDVHEYAAKLG  109

Query  271  FEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEH  450
            FEKVSEQ +DECKS AVLYKHKKTGAE+MSV+NDDENKVFGIVFRTPPKNSTGIPHILEH
Sbjct  110  FEKVSEQVIDECKSTAVLYKHKKTGAEVMSVANDDENKVFGIVFRTPPKNSTGIPHILEH  169

Query  451  SVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  630
            SVLCGSRKYPLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF
Sbjct  170  SVLCGSRKYPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  229

Query  631  F  633
            F
Sbjct  230  F  230



>ref|XP_010691032.1| PREDICTED: presequence protease 2, chloroplastic/mitochondrial-like 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=1076

 Score =   266 bits (679),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 141/212 (67%), Positives = 163/212 (77%), Gaps = 10/212 (5%)
 Frame = +1

Query  7    RVLLRSLSPPNSTLFARSSFSFSKRPHF--FANH-LSNPRSTFRNRLLFTSTAALPSLHL  177
            R+L RS+     +L  R +F   + P+F     H +  P ST     L  S + LP  + 
Sbjct  20   RLLPRSIRSRRFSLLHRQNF---RNPNFSLLRQHSILRPISTLS---LPLSNSPLP-FNG  72

Query  178  RTRFSPLSVRAVYTFPPELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIM  357
            R  FS +S +A+ +   E+   + DVA KLGFEKVSEQF+DECKS+AVLYKHKKTGA++M
Sbjct  73   RRSFSSISPQAISSSASEVGKHDSDVAEKLGFEKVSEQFIDECKSKAVLYKHKKTGAQVM  132

Query  358  SVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNA  537
            SVSNDDENKVFGIV RTPP +STGIPHILEHSVLCGSRKYPLK+PFVELLKGSL+TFLNA
Sbjct  133  SVSNDDENKVFGIVLRTPPNDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNA  192

Query  538  FTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            FTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  193  FTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  224



>ref|XP_002282024.1| PREDICTED: presequence protease 2, chloroplastic/mitochondrial-like 
[Vitis vinifera]
Length=1080

 Score =   265 bits (678),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 139/153 (91%), Gaps = 4/153 (3%)
 Frame = +1

Query  187  FSPLSVRAVYTFPPELS----GAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEI  354
            FS LS +A+ T P + S    G++DD+A K GF+KVSEQF+ ECKS+AVLYKHKKTGAE+
Sbjct  75   FSSLSPKAIATSPEQASSDAVGSQDDLAEKYGFDKVSEQFIQECKSKAVLYKHKKTGAEV  134

Query  355  MSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLN  534
            MSVSNDDENKVFGIVFRTPPK+STGIPHILEHSVLCGSRKYPLK+PFVELLKGSL+TFLN
Sbjct  135  MSVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLN  194

Query  535  AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            AFTYPDRTCYPVASTNTKDFYNLVDVYLDAV F
Sbjct  195  AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVLF  227



>ref|XP_010500508.1| PREDICTED: presequence protease 2, chloroplastic/mitochondrial 
[Camelina sativa]
Length=1071

 Score =   265 bits (677),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 150/181 (83%), Gaps = 7/181 (4%)
 Frame = +1

Query  103  LSNPRSTFRNRLLFTSTAALPSLHLRT---RFSPLSVRAVYTFP-PELSGAEDDVARKLG  270
            LS P +  R RLL +    L S   R+   +FS LS+RAV T P P   G   D A KLG
Sbjct  41   LSTPEAAGR-RLLLSRGFKLRSAASRSLSGQFSRLSIRAVATQPAPSYHGQ--DEAEKLG  97

Query  271  FEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEH  450
            FEKVSE+F+ ECKS+AVL+KHKKTG E+MSVSNDDENKVFGIVFRTPPK+STGIPHILEH
Sbjct  98   FEKVSEEFISECKSKAVLFKHKKTGCEVMSVSNDDENKVFGIVFRTPPKDSTGIPHILEH  157

Query  451  SVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  630
            SVLCGSRKYPLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF
Sbjct  158  SVLCGSRKYPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  217

Query  631  F  633
            F
Sbjct  218  F  218



>emb|CBI32433.3| unnamed protein product [Vitis vinifera]
Length=1098

 Score =   265 bits (677),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 139/153 (91%), Gaps = 4/153 (3%)
 Frame = +1

Query  187  FSPLSVRAVYTFPPELS----GAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEI  354
            FS LS +A+ T P + S    G++DD+A K GF+KVSEQF+ ECKS+AVLYKHKKTGAE+
Sbjct  75   FSSLSPKAIATSPEQASSDAVGSQDDLAEKYGFDKVSEQFIQECKSKAVLYKHKKTGAEV  134

Query  355  MSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLN  534
            MSVSNDDENKVFGIVFRTPPK+STGIPHILEHSVLCGSRKYPLK+PFVELLKGSL+TFLN
Sbjct  135  MSVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLN  194

Query  535  AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            AFTYPDRTCYPVASTNTKDFYNLVDVYLDAV F
Sbjct  195  AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVLF  227



>ref|XP_008373169.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
[Malus domestica]
Length=1082

 Score =   265 bits (676),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 150/181 (83%), Gaps = 9/181 (5%)
 Frame = +1

Query  109  NPRSTFRNRLLFTSTAALPSL--HLRTRFSPLSVRAVYT----FPPELSGAEDDVARKLG  270
            NPR   R  LL  ++  LPS   ++   FS LS  AV T     P E SG +D+V  KLG
Sbjct  52   NPR---RRSLLHRASRLLPSSAPNVARSFSSLSPXAVATPFTQSPSEFSGVQDEVVEKLG  108

Query  271  FEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEH  450
            FEKVSE+F+ ECKS+A+L++HKKTGA+++SVSNDDENKVFGIVFRTPP +STGIPHILEH
Sbjct  109  FEKVSEEFIGECKSKALLFRHKKTGAQVISVSNDDENKVFGIVFRTPPNDSTGIPHILEH  168

Query  451  SVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  630
            SVLCGSRKYPLK+PFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF
Sbjct  169  SVLCGSRKYPLKEPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  228

Query  631  F  633
            F
Sbjct  229  F  229



>ref|XP_009339454.1| PREDICTED: LOW QUALITY PROTEIN: presequence protease 1, chloroplastic/mitochondrial-like 
[Pyrus x bretschneideri]
Length=1092

 Score =   264 bits (675),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 147/175 (84%), Gaps = 6/175 (3%)
 Frame = +1

Query  127  RNRLLFTSTAALPSL--HLRTRFSPLSVRAVY----TFPPELSGAEDDVARKLGFEKVSE  288
            R  LL  ++  LPS   ++   FS LS RAV       P E SG +DDV  KLGFEKVSE
Sbjct  65   RRSLLRPASRLLPSSAPNVARSFSSLSARAVAIPFTQSPSEYSGVQDDVVEKLGFEKVSE  124

Query  289  QFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGS  468
            +F+ ECKS+A+L++HKKTGA+++SVSNDDENKVFGIVFRTPP +STGIPHILEHSVLCGS
Sbjct  125  EFIGECKSKALLFRHKKTGAQVISVSNDDENKVFGIVFRTPPNDSTGIPHILEHSVLCGS  184

Query  469  RKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            RKYPLK+PFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  185  RKYPLKEPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  239



>gb|KJB77681.1| hypothetical protein B456_012G150300 [Gossypium raimondii]
Length=906

 Score =   263 bits (672),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 140/153 (92%), Gaps = 4/153 (3%)
 Frame = +1

Query  187  FSPLSVRAVYTFPPE----LSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEI  354
            FS LS RAV + P +    ++G  D+VA KLGFEKVSE+F+ ECKS+AVL+KHKKTGAE+
Sbjct  84   FSSLSPRAVASPPTQPSSDIAGVGDEVAEKLGFEKVSEEFIGECKSKAVLFKHKKTGAEV  143

Query  355  MSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLN  534
            MSVSNDDENKVFGIVFRTPPK+STGIPHILEHSVLCGSRKYPLK+PFVELLKGSL+TFLN
Sbjct  144  MSVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLN  203

Query  535  AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            AFTYPDRTCYPVASTN+KDFYNLVDVYLDAVFF
Sbjct  204  AFTYPDRTCYPVASTNSKDFYNLVDVYLDAVFF  236



>ref|XP_010466048.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
isoform X2 [Camelina sativa]
Length=1078

 Score =   264 bits (675),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 143/161 (89%), Gaps = 4/161 (2%)
 Frame = +1

Query  160  LPSLHLRT---RFSPLSVRAVYTFPPELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYK  330
            +PS  LR+   +FS LSVRAV T P  L    D+ A KLGFEKVSE+F+ ECKS+A+L+K
Sbjct  66   IPSTALRSVSGQFSRLSVRAVATQPAPLYPGRDE-AEKLGFEKVSEEFISECKSKAILFK  124

Query  331  HKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLK  510
            HKKTG E+MSVSN+DENKVFG+VFRTPPKNSTGIPHILEHSVLCGSRKYPLK+PFVELLK
Sbjct  125  HKKTGCEVMSVSNEDENKVFGVVFRTPPKNSTGIPHILEHSVLCGSRKYPLKEPFVELLK  184

Query  511  GSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            GSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  185  GSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  225



>ref|XP_008647214.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial 
[Zea mays]
Length=813

 Score =   261 bits (667),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 135/173 (78%), Positives = 141/173 (82%), Gaps = 13/173 (8%)
 Frame = +1

Query  151  TAALPSLHLRTRFSP---------LSVRAVYTFPPELSGAEDDV---ARKLGFEKVSEQF  294
             AA P LH   R+ P         LS  AV T P  +    DDV   A KLGFEKVSEQ 
Sbjct  60   VAAAP-LHCSGRYWPAAAPQLARRLSASAVSTSPSPVPYDTDDVHEYATKLGFEKVSEQT  118

Query  295  VDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRK  474
            +DECKS AVLYKHKKTGAE+MSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRK
Sbjct  119  IDECKSIAVLYKHKKTGAEVMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRK  178

Query  475  YPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            YPLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  179  YPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  231



>ref|XP_008236531.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
[Prunus mume]
Length=1086

 Score =   264 bits (674),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 139/156 (89%), Gaps = 4/156 (3%)
 Frame = +1

Query  178  RTRFSPLSVRAVYT----FPPELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTG  345
            R  FS L+ RA+ T     P E SG ED+V  KLGFEKVSE+F+ ECKS+A+L++HKKTG
Sbjct  79   RRSFSSLAPRAIATPFTQSPSEFSGVEDEVVEKLGFEKVSEEFIGECKSKALLFRHKKTG  138

Query  346  AEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNT  525
            A+++SVSNDDENKVFGIVFRTPP +STGIPHILEHSVLCGSRKYPLK+PFVELLKGSLNT
Sbjct  139  AQVISVSNDDENKVFGIVFRTPPNDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLNT  198

Query  526  FLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            FLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  199  FLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  234



>emb|CDO97160.1| unnamed protein product [Coffea canephora]
Length=1055

 Score =   263 bits (672),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 120/135 (89%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = +1

Query  229  ELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRT  408
            ++ GA+DDVA KLGF+KVSEQF++ECKSRA+LYKH+KTGAEIMS+SNDDENK FGIVFRT
Sbjct  68   KMLGADDDVADKLGFDKVSEQFIEECKSRAILYKHRKTGAEIMSISNDDENKCFGIVFRT  127

Query  409  PPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTK  588
            PPK+STGIPHILEHSVLCGSRKYPLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTNTK
Sbjct  128  PPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNTK  187

Query  589  DFYNLVDVYLDAVFF  633
            DFYNLVDVYLDAVFF
Sbjct  188  DFYNLVDVYLDAVFF  202



>ref|XP_011006471.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial 
[Populus euphratica]
Length=1082

 Score =   263 bits (672),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 125/153 (82%), Positives = 139/153 (91%), Gaps = 1/153 (1%)
 Frame = +1

Query  178  RTRFSPLSVRAVYT-FPPELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEI  354
            +  FS LS  A+ T + P++S   D+VA K GFEKVSE+F+ ECKS+AVL+KHKKTGAE+
Sbjct  77   KHHFSTLSPHAISTQYSPDVSNVSDEVAEKYGFEKVSEEFIGECKSKAVLFKHKKTGAEV  136

Query  355  MSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLN  534
            MSVSNDDENKVFGIVFRTPPK+STGIPHILEHSVLCGSRKYPLK+PFVELLKGSL+TFLN
Sbjct  137  MSVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLN  196

Query  535  AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  197  AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  229



>gb|KJB77680.1| hypothetical protein B456_012G150300 [Gossypium raimondii]
Length=1078

 Score =   263 bits (671),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 157/204 (77%), Gaps = 23/204 (11%)
 Frame = +1

Query  34   PNSTLFARSSFSFSKRPHFFANHLSNPRSTFRNRLLFTSTAALPSLHLRTRFSPLSVRAV  213
            PN +L  R+S+    R    ++H S+ R    N+                 FS LS RAV
Sbjct  52   PNRSLLRRNSWRSLPRA---SSHSSSLRFGLNNK----------------HFSSLSPRAV  92

Query  214  YTFPPE----LSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDEN  381
             + P +    ++G  D+VA KLGFEKVSE+F+ ECKS+AVL+KHKKTGAE+MSVSNDDEN
Sbjct  93   ASPPTQPSSDIAGVGDEVAEKLGFEKVSEEFIGECKSKAVLFKHKKTGAEVMSVSNDDEN  152

Query  382  KVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTC  561
            KVFGIVFRTPPK+STGIPHILEHSVLCGSRKYPLK+PFVELLKGSL+TFLNAFTYPDRTC
Sbjct  153  KVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNAFTYPDRTC  212

Query  562  YPVASTNTKDFYNLVDVYLDAVFF  633
            YPVASTN+KDFYNLVDVYLDAVFF
Sbjct  213  YPVASTNSKDFYNLVDVYLDAVFF  236



>gb|KJB77679.1| hypothetical protein B456_012G150300 [Gossypium raimondii]
Length=1089

 Score =   263 bits (671),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 157/204 (77%), Gaps = 23/204 (11%)
 Frame = +1

Query  34   PNSTLFARSSFSFSKRPHFFANHLSNPRSTFRNRLLFTSTAALPSLHLRTRFSPLSVRAV  213
            PN +L  R+S+    R    ++H S+ R    N+                 FS LS RAV
Sbjct  52   PNRSLLRRNSWRSLPRA---SSHSSSLRFGLNNK----------------HFSSLSPRAV  92

Query  214  YTFPPE----LSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDEN  381
             + P +    ++G  D+VA KLGFEKVSE+F+ ECKS+AVL+KHKKTGAE+MSVSNDDEN
Sbjct  93   ASPPTQPSSDIAGVGDEVAEKLGFEKVSEEFIGECKSKAVLFKHKKTGAEVMSVSNDDEN  152

Query  382  KVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTC  561
            KVFGIVFRTPPK+STGIPHILEHSVLCGSRKYPLK+PFVELLKGSL+TFLNAFTYPDRTC
Sbjct  153  KVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNAFTYPDRTC  212

Query  562  YPVASTNTKDFYNLVDVYLDAVFF  633
            YPVASTN+KDFYNLVDVYLDAVFF
Sbjct  213  YPVASTNSKDFYNLVDVYLDAVFF  236



>ref|XP_010066034.1| PREDICTED: presequence protease 2, chloroplastic/mitochondrial-like 
[Eucalyptus grandis]
 gb|KCW63801.1| hypothetical protein EUGRSUZ_G01465 [Eucalyptus grandis]
Length=1090

 Score =   263 bits (671),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 136/152 (89%), Gaps = 4/152 (3%)
 Frame = +1

Query  190  SPLSVRAVYTFP----PELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIM  357
            S L+ RA+ T P    PE+ G +D VA K GFEKVSE+F+ ECKSRA L++HKKTGAE+M
Sbjct  86   SSLAPRAIATPPTQPSPEVFGVQDGVAEKYGFEKVSEEFIKECKSRATLFRHKKTGAEVM  145

Query  358  SVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNA  537
            SVSNDDENKVFGIVFRTPP NSTGIPHILEHSVLCGSRKYPLK+PFVELLKGSLNTFLNA
Sbjct  146  SVSNDDENKVFGIVFRTPPNNSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLNTFLNA  205

Query  538  FTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            FTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  206  FTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  237



>ref|XP_010466047.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
isoform X1 [Camelina sativa]
Length=1080

 Score =   262 bits (670),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 142/162 (88%), Gaps = 4/162 (2%)
 Frame = +1

Query  160  LPSLHLRT---RFSPLSVRAVYTFP-PELSGAEDDVARKLGFEKVSEQFVDECKSRAVLY  327
            +PS  LR+   +FS LSVRAV T P P       D A KLGFEKVSE+F+ ECKS+A+L+
Sbjct  66   IPSTALRSVSGQFSRLSVRAVATQPAPLYPDIGRDEAEKLGFEKVSEEFISECKSKAILF  125

Query  328  KHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELL  507
            KHKKTG E+MSVSN+DENKVFG+VFRTPPKNSTGIPHILEHSVLCGSRKYPLK+PFVELL
Sbjct  126  KHKKTGCEVMSVSNEDENKVFGVVFRTPPKNSTGIPHILEHSVLCGSRKYPLKEPFVELL  185

Query  508  KGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            KGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  186  KGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  227



>ref|XP_006384425.1| hypothetical protein POPTR_0004s14960g [Populus trichocarpa]
 gb|ERP62222.1| hypothetical protein POPTR_0004s14960g [Populus trichocarpa]
Length=1091

 Score =   262 bits (670),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/153 (82%), Positives = 139/153 (91%), Gaps = 1/153 (1%)
 Frame = +1

Query  178  RTRFSPLSVRAVYT-FPPELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEI  354
            +  FS LS  A+ T + P++S   D+VA K GFEKVSE+F+ ECKS+AVL+KHKKTGAE+
Sbjct  82   KHHFSTLSPHAISTQYSPDVSNVSDEVAAKYGFEKVSEEFIGECKSKAVLFKHKKTGAEV  141

Query  355  MSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLN  534
            MSVSNDDENKVFGIVFRTPPK+STGIPHILEHSVLCGSRKYPLK+PFVELLKGSL+TFLN
Sbjct  142  MSVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLN  201

Query  535  AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  202  AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  234



>gb|KHG07948.1| Presequence protease 2, chloroplastic/mitochondrial [Gossypium 
arboreum]
Length=1074

 Score =   262 bits (669),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 156/204 (76%), Gaps = 23/204 (11%)
 Frame = +1

Query  34   PNSTLFARSSFSFSKRPHFFANHLSNPRSTFRNRLLFTSTAALPSLHLRTRFSPLSVRAV  213
            PN +L  R+S+    R    ++H S+ R    N+                 FS LS RAV
Sbjct  52   PNRSLLHRNSWRSLARA---SSHSSSLRFGLNNK----------------HFSSLSPRAV  92

Query  214  YTFPPE----LSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDEN  381
             + P +    ++G  D+VA K GFEKVSE+F+ ECKS+AVL+KHKKTGAE+MSVSNDDEN
Sbjct  93   ASPPTQPSSDIAGVGDEVAEKFGFEKVSEEFIGECKSKAVLFKHKKTGAEVMSVSNDDEN  152

Query  382  KVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTC  561
            KVFGIVFRTPPK+STGIPHILEHSVLCGSRKYPLK+PFVELLKGSL+TFLNAFTYPDRTC
Sbjct  153  KVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNAFTYPDRTC  212

Query  562  YPVASTNTKDFYNLVDVYLDAVFF  633
            YPVASTN+KDFYNLVDVYLDAVFF
Sbjct  213  YPVASTNSKDFYNLVDVYLDAVFF  236



>gb|KHG07949.1| Presequence protease 1, chloroplastic/mitochondrial [Gossypium 
arboreum]
Length=1025

 Score =   261 bits (668),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 156/204 (76%), Gaps = 23/204 (11%)
 Frame = +1

Query  34   PNSTLFARSSFSFSKRPHFFANHLSNPRSTFRNRLLFTSTAALPSLHLRTRFSPLSVRAV  213
            PN +L  R+S+    R    ++H S+ R    N+                 FS LS RAV
Sbjct  52   PNRSLLHRNSWRSLARA---SSHSSSLRFGLNNK----------------HFSSLSPRAV  92

Query  214  YTFPPE----LSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDEN  381
             + P +    ++G  D+VA K GFEKVSE+F+ ECKS+AVL+KHKKTGAE+MSVSNDDEN
Sbjct  93   ASPPTQPSSDIAGVGDEVAEKFGFEKVSEEFIGECKSKAVLFKHKKTGAEVMSVSNDDEN  152

Query  382  KVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTC  561
            KVFGIVFRTPPK+STGIPHILEHSVLCGSRKYPLK+PFVELLKGSL+TFLNAFTYPDRTC
Sbjct  153  KVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNAFTYPDRTC  212

Query  562  YPVASTNTKDFYNLVDVYLDAVFF  633
            YPVASTN+KDFYNLVDVYLDAVFF
Sbjct  213  YPVASTNSKDFYNLVDVYLDAVFF  236



>ref|XP_010523209.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial 
[Tarenaya hassleriana]
 ref|XP_010523210.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial 
[Tarenaya hassleriana]
Length=1082

 Score =   261 bits (668),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 137/154 (89%), Gaps = 1/154 (1%)
 Frame = +1

Query  175  LRTRFSPLSVRAVYTFP-PELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAE  351
            L  +FS LSVRAV T P P       D A +LGFEKVSE+F+ ECKS+AVL+KHKKTG E
Sbjct  76   LNGQFSRLSVRAVATQPAPSYPDVGQDEAERLGFEKVSEEFISECKSKAVLFKHKKTGCE  135

Query  352  IMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFL  531
            +MSVSNDDENKVFGIVFRTPPK+STGIPHILEHSVLCGSRKYPLK+PFVELLKGSL+TFL
Sbjct  136  VMSVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFL  195

Query  532  NAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            NAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  196  NAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  229



>gb|AAG13049.1|AC011807_8 Putative zinc metalloprotease [Arabidopsis thaliana]
Length=1077

 Score =   261 bits (667),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 159/210 (76%), Gaps = 6/210 (3%)
 Frame = +1

Query  7    RVLLRS-LSPPNSTLFARSSFSFSKRPHFFANHLSNPRSTFRNRLLFTSTAALPSLHLRT  183
            R L RS LSP +ST    +S    +R    +   +  R  F  R L   +AA  S  L  
Sbjct  22   RQLPRSYLSPSSSTTVVGASGRNIRR---LSTLEAAGRRLFLRRGLKLLSAA--SRGLNG  76

Query  184  RFSPLSVRAVYTFPPELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSV  363
            +FS LS+RAV T     S    D A KLGFEKVSE+F+ ECKS+AVL+KHKKTG E+MSV
Sbjct  77   QFSRLSIRAVATQSAPSSYPGQDEAEKLGFEKVSEEFISECKSKAVLFKHKKTGCEVMSV  136

Query  364  SNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFT  543
            SNDDENKVFGIVFRTPPK+STGIPHILEHSVLCGSRKYP+K+PFVELLKGSL+TFLNAFT
Sbjct  137  SNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPMKEPFVELLKGSLHTFLNAFT  196

Query  544  YPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            YPDRTCYPVASTN KDFYNLVDVYLDAVFF
Sbjct  197  YPDRTCYPVASTNKKDFYNLVDVYLDAVFF  226



>ref|NP_175386.2| presequence protease 2 [Arabidopsis thaliana]
 ref|NP_850961.1| presequence protease 2 [Arabidopsis thaliana]
 ref|NP_850962.1| presequence protease 2 [Arabidopsis thaliana]
 sp|Q8VY06.1|PREP2_ARATH RecName: Full=Presequence protease 2, chloroplastic/mitochondrial; 
Short=AtPreP2; Short=PreP 2; AltName: Full=Zinc metalloprotease 
2; Short=AtZnMP2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL67002.1| putative hydrogenase protein [Arabidopsis thaliana]
 gb|AAO42370.1| putative hydrogenase [Arabidopsis thaliana]
 gb|AEE32451.1| presequence protease 2 [Arabidopsis thaliana]
 gb|AEE32452.1| presequence protease 2 [Arabidopsis thaliana]
 gb|AEE32453.1| presequence protease 2 [Arabidopsis thaliana]
Length=1080

 Score =   261 bits (667),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 159/210 (76%), Gaps = 6/210 (3%)
 Frame = +1

Query  7    RVLLRS-LSPPNSTLFARSSFSFSKRPHFFANHLSNPRSTFRNRLLFTSTAALPSLHLRT  183
            R L RS LSP +ST    +S    +R    +   +  R  F  R L   +AA  S  L  
Sbjct  22   RQLPRSYLSPSSSTTVVGASGRNIRR---LSTLEAAGRRLFLRRGLKLLSAA--SRGLNG  76

Query  184  RFSPLSVRAVYTFPPELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSV  363
            +FS LS+RAV T     S    D A KLGFEKVSE+F+ ECKS+AVL+KHKKTG E+MSV
Sbjct  77   QFSRLSIRAVATQSAPSSYPGQDEAEKLGFEKVSEEFISECKSKAVLFKHKKTGCEVMSV  136

Query  364  SNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFT  543
            SNDDENKVFGIVFRTPPK+STGIPHILEHSVLCGSRKYP+K+PFVELLKGSL+TFLNAFT
Sbjct  137  SNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPMKEPFVELLKGSLHTFLNAFT  196

Query  544  YPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            YPDRTCYPVASTN KDFYNLVDVYLDAVFF
Sbjct  197  YPDRTCYPVASTNKKDFYNLVDVYLDAVFF  226



>ref|XP_004954002.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
[Setaria italica]
Length=1084

 Score =   261 bits (666),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 140/172 (81%), Gaps = 12/172 (7%)
 Frame = +1

Query  154  AALPSLHLRTRFSP---------LSVRAVYTFPPELSGAEDDV---ARKLGFEKVSEQFV  297
            AA   LH   R+ P         LS  AV T P  +    DDV   A KLGFEKVSEQ +
Sbjct  60   AAAAPLHCSGRYWPAATPRLARRLSAPAVSTSPSPVPYDTDDVHEYAAKLGFEKVSEQII  119

Query  298  DECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKY  477
            DECKS AVLYKHKKTGAE+MSV+NDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGS+KY
Sbjct  120  DECKSTAVLYKHKKTGAEVMSVANDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSKKY  179

Query  478  PLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            PLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  180  PLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  231



>ref|XP_002885298.1| ATPREP1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61557.1| ATPREP1 [Arabidopsis lyrata subsp. lyrata]
Length=1081

 Score =   260 bits (665),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 142/162 (88%), Gaps = 4/162 (2%)
 Frame = +1

Query  160  LPSLHLRT---RFSPLSVRAVYTFP-PELSGAEDDVARKLGFEKVSEQFVDECKSRAVLY  327
            +PS  +R+   +FS LSVRAV T P P       D A KLGFEKVSE+F+ ECKS+A+L+
Sbjct  66   IPSAAVRSVNGQFSRLSVRAVATQPAPLYPDVGQDEAEKLGFEKVSEEFISECKSKAILF  125

Query  328  KHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELL  507
            KHKKTG E+MSVSN+DENKVFG+VFRTPPK+STGIPHILEHSVLCGSRKYPLK+PFVELL
Sbjct  126  KHKKTGCEVMSVSNEDENKVFGVVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELL  185

Query  508  KGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            KGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  186  KGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  227



>gb|KDP42318.1| hypothetical protein JCGZ_01642 [Jatropha curcas]
Length=1088

 Score =   260 bits (664),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 125/153 (82%), Positives = 137/153 (90%), Gaps = 4/153 (3%)
 Frame = +1

Query  187  FSPLSVRAVYTFP----PELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEI  354
            FS LS  A+ T P    P +    ++VA KLGFEKVSE+F+ ECKS+AVL+KHKKTGAE+
Sbjct  83   FSSLSTAAIGTHPAQSSPYVGSVPNEVAEKLGFEKVSEEFIGECKSKAVLFKHKKTGAEV  142

Query  355  MSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLN  534
            MSVSNDDENKVFGIVFRTPPK+STGIPHILEHSVLCGSRKYPLK+PFVELLKGSL+TFLN
Sbjct  143  MSVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLN  202

Query  535  AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  203  AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  235



>ref|XP_010691033.1| PREDICTED: presequence protease 2, chloroplastic/mitochondrial-like 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=1075

 Score =   259 bits (663),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 140/212 (66%), Positives = 162/212 (76%), Gaps = 11/212 (5%)
 Frame = +1

Query  7    RVLLRSLSPPNSTLFARSSFSFSKRPHF--FANH-LSNPRSTFRNRLLFTSTAALPSLHL  177
            R+L RS+     +L  R +F   + P+F     H +  P ST     L  S + LP  + 
Sbjct  20   RLLPRSIRSRRFSLLHRQNF---RNPNFSLLRQHSILRPISTLS---LPLSNSPLP-FNG  72

Query  178  RTRFSPLSVRAVYTFPPELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIM  357
            R  FS +S +A+ +    +   + DVA KLGFEKVSEQF+DECKS+AVLYKHKKTGA++M
Sbjct  73   RRSFSSISPQAISS-SASVGKHDSDVAEKLGFEKVSEQFIDECKSKAVLYKHKKTGAQVM  131

Query  358  SVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNA  537
            SVSNDDENKVFGIV RTPP +STGIPHILEHSVLCGSRKYPLK+PFVELLKGSL+TFLNA
Sbjct  132  SVSNDDENKVFGIVLRTPPNDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNA  191

Query  538  FTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            FTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  192  FTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  223



>ref|XP_010507479.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial 
[Camelina sativa]
Length=1080

 Score =   259 bits (663),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 141/162 (87%), Gaps = 4/162 (2%)
 Frame = +1

Query  160  LPSLHLRT---RFSPLSVRAVYTFP-PELSGAEDDVARKLGFEKVSEQFVDECKSRAVLY  327
            +PS  +R+   +FS LSVRAV T P P       D A KLGFEKVSE+F+ ECKS+A+L+
Sbjct  66   IPSTAVRSVSGQFSRLSVRAVATQPAPLYPDVGRDEAEKLGFEKVSEEFISECKSKAILF  125

Query  328  KHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELL  507
            KHKKTG E+MSV N+DENKVFG+VFRTPPKNSTGIPHILEHSVLCGSRKYPLK+PFVELL
Sbjct  126  KHKKTGCEVMSVCNEDENKVFGVVFRTPPKNSTGIPHILEHSVLCGSRKYPLKEPFVELL  185

Query  508  KGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            KGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  186  KGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  227



>ref|XP_002894203.1| ATPREP2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70462.1| ATPREP2 [Arabidopsis lyrata subsp. lyrata]
Length=1076

 Score =   259 bits (663),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = +1

Query  166  SLHLRTRFSPLSVRAVYTFPPELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTG  345
            S  L  +FS LS+RAV T     S    D A KLGFEKVSE+F+ ECKS+AVL++HKKTG
Sbjct  68   SRGLNGQFSRLSIRAVATQSAPSSIPGQDEAEKLGFEKVSEEFISECKSKAVLFRHKKTG  127

Query  346  AEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNT  525
             E+MSVSNDDENKVFGIVFRTPPK+STGIPHILEHSVLCGSRKYPLK+PFVELLKGSL+T
Sbjct  128  CEVMSVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHT  187

Query  526  FLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            FLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  188  FLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  223



>dbj|BAJ89923.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=957

 Score =   259 bits (661),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/149 (85%), Positives = 133/149 (89%), Gaps = 3/149 (2%)
 Frame = +1

Query  196  LSVRAVYTFPPELSGAEDDV---ARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVS  366
            LSV AV T P  +    DDV   A  LGFEKVSEQ +DECKS AVLYKHKKTGAE+MSV+
Sbjct  80   LSVPAVSTSPSPVPSDTDDVHEYAATLGFEKVSEQVIDECKSAAVLYKHKKTGAEVMSVA  139

Query  367  NDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTY  546
            NDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLK+PFVELLKGSL+TFLNAFTY
Sbjct  140  NDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNAFTY  199

Query  547  PDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            PDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  200  PDRTCYPVASTNTKDFYNLVDVYLDAVFF  228



>ref|XP_006296881.1| hypothetical protein CARUB_v10012870mg [Capsella rubella]
 gb|EOA29779.1| hypothetical protein CARUB_v10012870mg [Capsella rubella]
Length=1080

 Score =   259 bits (663),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 142/162 (88%), Gaps = 4/162 (2%)
 Frame = +1

Query  160  LPSLHLRT---RFSPLSVRAVYTFP-PELSGAEDDVARKLGFEKVSEQFVDECKSRAVLY  327
            +PS  +R+   +FS LSVRAV T P P       D A KLGFEKVSE+F+ ECKS+A+L+
Sbjct  66   VPSTAVRSVNGQFSRLSVRAVATQPAPLYPDVGRDEAEKLGFEKVSEEFISECKSKAILF  125

Query  328  KHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELL  507
            KHKKTG E+MSVSN+DENKVFG+VFRTPPK+STGIPHILEHSVLCGSRKYPLK+PFVELL
Sbjct  126  KHKKTGCEVMSVSNEDENKVFGVVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELL  185

Query  508  KGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            KGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  186  KGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  227



>ref|XP_010487842.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
[Camelina sativa]
Length=1080

 Score =   259 bits (663),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 141/162 (87%), Gaps = 4/162 (2%)
 Frame = +1

Query  160  LPSLHLRT---RFSPLSVRAVYTFP-PELSGAEDDVARKLGFEKVSEQFVDECKSRAVLY  327
            +PS  +R+   +FS LSVRAV T P P       D A KLGFEKVSE+F+ ECKS+A+L+
Sbjct  66   IPSTAVRSVSGQFSRLSVRAVATQPAPLYPDVGRDEAEKLGFEKVSEEFISECKSKAILF  125

Query  328  KHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELL  507
            KHKKTG E+MSV N+DENKVFG+VFRTPPKNSTGIPHILEHSVLCGSRKYPLK+PFVELL
Sbjct  126  KHKKTGCEVMSVCNEDENKVFGVVFRTPPKNSTGIPHILEHSVLCGSRKYPLKEPFVELL  185

Query  508  KGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            KGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  186  KGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  227



>dbj|BAJ85497.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87833.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1081

 Score =   259 bits (662),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/149 (85%), Positives = 133/149 (89%), Gaps = 3/149 (2%)
 Frame = +1

Query  196  LSVRAVYTFPPELSGAEDDV---ARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVS  366
            LSV AV T P  +    DDV   A  LGFEKVSEQ +DECKS AVLYKHKKTGAE+MSV+
Sbjct  80   LSVPAVSTSPSPVPSDTDDVHEYAATLGFEKVSEQVIDECKSAAVLYKHKKTGAEVMSVA  139

Query  367  NDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTY  546
            NDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLK+PFVELLKGSL+TFLNAFTY
Sbjct  140  NDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNAFTY  199

Query  547  PDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            PDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  200  PDRTCYPVASTNTKDFYNLVDVYLDAVFF  228



>ref|NP_188548.2| zinc metalloprotease pitrilysin subfamily A [Arabidopsis thaliana]
 sp|Q9LJL3.2|PREP1_ARATH RecName: Full=Presequence protease 1, chloroplastic/mitochondrial; 
Short=AtPreP1; Short=PreP 1; AltName: Full=Zinc metalloprotease 
1; Short=AtZnMP1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL90904.1| AT3g19170/MVI11_8 [Arabidopsis thaliana]
 gb|AAM13872.1| putative metalloprotease [Arabidopsis thaliana]
 gb|AAN86205.1| putative metalloprotease [Arabidopsis thaliana]
 gb|AAP21170.1| At3g19170/MVI11_8 [Arabidopsis thaliana]
 gb|AEE76201.1| zinc metalloprotease pitrilysin subfamily A [Arabidopsis thaliana]
Length=1080

 Score =   259 bits (662),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 142/162 (88%), Gaps = 4/162 (2%)
 Frame = +1

Query  160  LPSLHLRT---RFSPLSVRAVYTFP-PELSGAEDDVARKLGFEKVSEQFVDECKSRAVLY  327
            +PS  +R+   +FS LSVRAV T P P       D A KLGFEKVSE+F+ ECKS+A+L+
Sbjct  66   IPSAAVRSVNGQFSRLSVRAVATQPAPLYPDVGQDEAEKLGFEKVSEEFISECKSKAILF  125

Query  328  KHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELL  507
            KHKKTG E+MSVSN+DENKVFG+VFRTPPK+STGIPHILEHSVLCGSRKYP+K+PFVELL
Sbjct  126  KHKKTGCEVMSVSNEDENKVFGVVFRTPPKDSTGIPHILEHSVLCGSRKYPVKEPFVELL  185

Query  508  KGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            KGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  186  KGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  227



>ref|NP_001189932.1| zinc metalloprotease pitrilysin subfamily A [Arabidopsis thaliana]
 gb|AEE76202.1| zinc metalloprotease pitrilysin subfamily A [Arabidopsis thaliana]
Length=1069

 Score =   259 bits (662),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 142/162 (88%), Gaps = 4/162 (2%)
 Frame = +1

Query  160  LPSLHLRT---RFSPLSVRAVYTFP-PELSGAEDDVARKLGFEKVSEQFVDECKSRAVLY  327
            +PS  +R+   +FS LSVRAV T P P       D A KLGFEKVSE+F+ ECKS+A+L+
Sbjct  66   IPSAAVRSVNGQFSRLSVRAVATQPAPLYPDVGQDEAEKLGFEKVSEEFISECKSKAILF  125

Query  328  KHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELL  507
            KHKKTG E+MSVSN+DENKVFG+VFRTPPK+STGIPHILEHSVLCGSRKYP+K+PFVELL
Sbjct  126  KHKKTGCEVMSVSNEDENKVFGVVFRTPPKDSTGIPHILEHSVLCGSRKYPVKEPFVELL  185

Query  508  KGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            KGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  186  KGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  227



>dbj|BAB02957.1| zinc metalloprotease (insulinase family) [Arabidopsis thaliana]
Length=1052

 Score =   259 bits (661),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 142/162 (88%), Gaps = 4/162 (2%)
 Frame = +1

Query  160  LPSLHLRT---RFSPLSVRAVYTFP-PELSGAEDDVARKLGFEKVSEQFVDECKSRAVLY  327
            +PS  +R+   +FS LSVRAV T P P       D A KLGFEKVSE+F+ ECKS+A+L+
Sbjct  38   IPSAAVRSVNGQFSRLSVRAVATQPAPLYPDVGQDEAEKLGFEKVSEEFISECKSKAILF  97

Query  328  KHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELL  507
            KHKKTG E+MSVSN+DENKVFG+VFRTPPK+STGIPHILEHSVLCGSRKYP+K+PFVELL
Sbjct  98   KHKKTGCEVMSVSNEDENKVFGVVFRTPPKDSTGIPHILEHSVLCGSRKYPVKEPFVELL  157

Query  508  KGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            KGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  158  KGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  199



>ref|XP_009135620.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial 
[Brassica rapa]
Length=1077

 Score =   259 bits (661),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 147/181 (81%), Gaps = 5/181 (3%)
 Frame = +1

Query  103  LSNPRSTFRNRLLFTSTAALPSLHLRT---RFSPLSVRAVYTFP-PELSGAEDDVARKLG  270
            +++P ST R R+       +PS  +R    + S LSVRAV T P P       D A KLG
Sbjct  45   VASPSSTGR-RVFLRRGLRVPSTAVRGVNRQLSRLSVRAVATQPAPSYPDVGQDEAEKLG  103

Query  271  FEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEH  450
            FEKVSE+F+ ECKS+A L+KHKKTG E+MSVSN+DENKVFGIV RTPPK+STGIPHILEH
Sbjct  104  FEKVSEEFISECKSKATLFKHKKTGCEVMSVSNEDENKVFGIVLRTPPKDSTGIPHILEH  163

Query  451  SVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  630
            SVLCGSRKYPLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF
Sbjct  164  SVLCGSRKYPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  223

Query  631  F  633
            F
Sbjct  224  F  224



>ref|XP_006304560.1| hypothetical protein CARUB_v10011558mg [Capsella rubella]
 gb|EOA37458.1| hypothetical protein CARUB_v10011558mg [Capsella rubella]
Length=1082

 Score =   259 bits (661),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 147/182 (81%), Gaps = 9/182 (5%)
 Frame = +1

Query  103  LSNPRSTFRNRLLFTSTA----ALPSLHLRTRFSPLSVRAVYTFP-PELSGAEDDVARKL  267
            LS P +    R LFT       +  S  L  +FS  S+RAV T P P   G   D A KL
Sbjct  45   LSTPEAA--GRRLFTRRGFNLRSAASRSLNGQFSRFSIRAVATQPAPSYPGQ--DEAEKL  100

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GFEKVSE+F+ ECKS+AVL+KHKKTG E++SVSNDDENKVFGIVFRTPPK+STGIPHILE
Sbjct  101  GFEKVSEEFISECKSKAVLFKHKKTGCEVISVSNDDENKVFGIVFRTPPKDSTGIPHILE  160

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSRKYPLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV
Sbjct  161  HSVLCGSRKYPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  220

Query  628  FF  633
            FF
Sbjct  221  FF  222



>gb|KFK39237.1| hypothetical protein AALP_AA3G218200 [Arabis alpina]
Length=1077

 Score =   259 bits (661),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 136/151 (90%), Gaps = 1/151 (1%)
 Frame = +1

Query  184  RFSPLSVRAVYTFPPE-LSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMS  360
            +FS LSVRAV T P +       D A KLGFEKVSE+F+ ECKS+A+L+KHKKTG E+MS
Sbjct  74   QFSSLSVRAVATQPAQSYPDVGQDEAEKLGFEKVSEEFISECKSKAILFKHKKTGCEVMS  133

Query  361  VSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAF  540
            V+N+DENKVFGIVFRTPPK+STGIPHILEHSVLCGSRKYPLK+PFVELLKGSL+TFLNAF
Sbjct  134  VANEDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNAF  193

Query  541  TYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            TYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  194  TYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  224



>ref|XP_006829680.1| hypothetical protein AMTR_s00126p00013900 [Amborella trichopoda]
 gb|ERM97096.1| hypothetical protein AMTR_s00126p00013900 [Amborella trichopoda]
Length=1075

 Score =   258 bits (658),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 141/221 (64%), Positives = 166/221 (75%), Gaps = 16/221 (7%)
 Frame = +1

Query  10   VLLRSLSPPNS-----TLFARSSFSFSKRPHFFANHLSNPRS-----TFRNRLLFTSTAA  159
            VLLRSLS   +     +L  RSS+  +  P      L +PR+        +R+ + ST+ 
Sbjct  5    VLLRSLSCSTACMRFLSLKPRSSWKTASTP-LTQQLLISPRNRGLPLACGSRMRWVSTSR  63

Query  160  LPSLHLRTRFSPLSVRAVYTFPPELSGAED---DVARKLGFEKVSEQFVDECKSRAVLYK  330
                H R  FS +S +A+ T   + S   D   D+A +LGFEKVSEQ ++ECKS+A+LYK
Sbjct  64   YAFQHKRG-FS-VSPQAIATPSKQASSGIDGSHDIAHELGFEKVSEQLIEECKSKAILYK  121

Query  331  HKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLK  510
            HKKTGAE++SV NDDENKVFGIVFRTPPK+STGIPHILEHSVLCGSRKYPLK+PFVELLK
Sbjct  122  HKKTGAEVISVVNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLK  181

Query  511  GSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            GSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  182  GSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  222



>ref|XP_009112103.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial 
[Brassica rapa]
Length=1075

 Score =   258 bits (658),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 138/162 (85%), Gaps = 1/162 (1%)
 Frame = +1

Query  151  TAALPSLHLRTRFSPLSVRAVYTFP-PELSGAEDDVARKLGFEKVSEQFVDECKSRAVLY  327
            ++A     +  +FS LSVRAV T P P       D A KLGFEKVSE+F+ ECKS+A L+
Sbjct  61   SSAAAGRGVNGQFSRLSVRAVATQPAPSYPDVSQDEAEKLGFEKVSEEFISECKSKATLF  120

Query  328  KHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELL  507
            KHKKTG E+MSVSN+DENKVFGIV RTPPK+STGIPHILEHSVLCGSRKYP+K+PFVELL
Sbjct  121  KHKKTGCEVMSVSNEDENKVFGIVLRTPPKDSTGIPHILEHSVLCGSRKYPVKEPFVELL  180

Query  508  KGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            KGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  181  KGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  222



>ref|XP_011000205.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial 
isoform X2 [Populus euphratica]
Length=1070

 Score =   258 bits (658),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 138/154 (90%), Gaps = 1/154 (1%)
 Frame = +1

Query  175  LRTRFSPLSVRAVYT-FPPELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAE  351
            ++  FS  S + + T   P++S   D+VA K GFEKVSE+F+ ECKSRAVL+KHKKTGAE
Sbjct  64   IKHHFSSSSPQTIATQCSPDVSTLTDEVAAKYGFEKVSEEFIRECKSRAVLFKHKKTGAE  123

Query  352  IMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFL  531
            +MSVSNDDENKVFGIVFRTPPK+STGIPHILEHSVLCGSRKYPLK+PFVELLKGSL+TFL
Sbjct  124  VMSVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFL  183

Query  532  NAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            NAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  184  NAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  217



>gb|EAY87618.1| hypothetical protein OsI_09029 [Oryza sativa Indica Group]
Length=1078

 Score =   258 bits (658),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 127/149 (85%), Positives = 132/149 (89%), Gaps = 3/149 (2%)
 Frame = +1

Query  196  LSVRAVYTFPPELSGAEDDV---ARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVS  366
            LS  AV T P  +    DDV   A KLGFEKVSEQ +DECKS AVLYKHKKTGAE+MSVS
Sbjct  77   LSAPAVSTSPSPVPSDTDDVHEYAAKLGFEKVSEQSIDECKSTAVLYKHKKTGAEVMSVS  136

Query  367  NDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTY  546
            NDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLK+PFVELLKGSL+TFLNAFTY
Sbjct  137  NDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNAFTY  196

Query  547  PDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            PDRTCYPVASTN KDFYNLVDVYLDAVFF
Sbjct  197  PDRTCYPVASTNAKDFYNLVDVYLDAVFF  225



>emb|CDX82307.1| BnaA03g35140D [Brassica napus]
Length=1074

 Score =   257 bits (657),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 146/181 (81%), Gaps = 5/181 (3%)
 Frame = +1

Query  103  LSNPRSTFRNRLLFTSTAALPSLHLRT---RFSPLSVRAVYTFP-PELSGAEDDVARKLG  270
            +++P ST R R+       +PS   R    + S LSVRAV T P P       D A KLG
Sbjct  45   VASPASTGR-RVFLRRGLRVPSTAGRGVNRQLSRLSVRAVATQPAPSYPDVGQDEAEKLG  103

Query  271  FEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEH  450
            FEKVSE+F+ ECKS+A L+KHKKTG E+MSVSN+DENKVFGIV RTPPK+STGIPHILEH
Sbjct  104  FEKVSEEFISECKSKATLFKHKKTGCEVMSVSNEDENKVFGIVLRTPPKDSTGIPHILEH  163

Query  451  SVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  630
            SVLCGSRKYPLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF
Sbjct  164  SVLCGSRKYPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  223

Query  631  F  633
            F
Sbjct  224  F  224



>ref|XP_011000182.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial 
isoform X1 [Populus euphratica]
 ref|XP_011000191.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial 
isoform X1 [Populus euphratica]
 ref|XP_011000200.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial 
isoform X1 [Populus euphratica]
Length=1087

 Score =   257 bits (657),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 138/154 (90%), Gaps = 1/154 (1%)
 Frame = +1

Query  175  LRTRFSPLSVRAVYT-FPPELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAE  351
            ++  FS  S + + T   P++S   D+VA K GFEKVSE+F+ ECKSRAVL+KHKKTGAE
Sbjct  81   IKHHFSSSSPQTIATQCSPDVSTLTDEVAAKYGFEKVSEEFIRECKSRAVLFKHKKTGAE  140

Query  352  IMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFL  531
            +MSVSNDDENKVFGIVFRTPPK+STGIPHILEHSVLCGSRKYPLK+PFVELLKGSL+TFL
Sbjct  141  VMSVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFL  200

Query  532  NAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            NAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  201  NAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  234



>ref|XP_006649067.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
[Oryza brachyantha]
Length=1095

 Score =   257 bits (656),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 127/149 (85%), Positives = 132/149 (89%), Gaps = 3/149 (2%)
 Frame = +1

Query  196  LSVRAVYTFPPELSGAEDDV---ARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVS  366
            LS  AV T P  +    DDV   A KLGFEKVSEQ +DECKS AVLYKHKKTG E+MSVS
Sbjct  94   LSAPAVSTSPSPVPQDTDDVHEYAAKLGFEKVSEQSIDECKSTAVLYKHKKTGTEVMSVS  153

Query  367  NDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTY  546
            NDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLK+PFVELLKGSL+TFLNAFTY
Sbjct  154  NDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNAFTY  213

Query  547  PDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            PDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  214  PDRTCYPVASTNTKDFYNLVDVYLDAVFF  242



>ref|XP_006393232.1| hypothetical protein EUTSA_v10011199mg [Eutrema salsugineum]
 gb|ESQ30518.1| hypothetical protein EUTSA_v10011199mg [Eutrema salsugineum]
Length=1076

 Score =   257 bits (656),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 144/174 (83%), Gaps = 3/174 (2%)
 Frame = +1

Query  115  RSTFRNRLLFTSTAALPSLHLRTRFSPLSVRAVYTFP-PELSGAEDDVARKLGFEKVSEQ  291
            R  F  R L   +AA  SL+   +FS LS+RA  T P P  +    D A KLGFEK  E+
Sbjct  52   RQLFLRRGLRFPSAASGSLN--GQFSRLSLRAFATQPAPSYTELGQDEAEKLGFEKAREE  109

Query  292  FVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSR  471
            F+ ECKS+AVL++HKKTG E+MSVSNDDENKVFG+VFRTPPK+STGIPHILEHSVLCGSR
Sbjct  110  FISECKSKAVLFRHKKTGCEVMSVSNDDENKVFGVVFRTPPKDSTGIPHILEHSVLCGSR  169

Query  472  KYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            KYPLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  170  KYPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  223



>emb|CDY18572.1| BnaA01g26230D [Brassica napus]
Length=1140

 Score =   257 bits (656),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 138/162 (85%), Gaps = 1/162 (1%)
 Frame = +1

Query  151  TAALPSLHLRTRFSPLSVRAVYTFP-PELSGAEDDVARKLGFEKVSEQFVDECKSRAVLY  327
            ++A     +  +FS LSVRAV T P P       D A KLGFEKVSE+F+ ECKS+A L+
Sbjct  61   SSAAAGRGVNGQFSRLSVRAVATQPAPSYPDVSQDEAEKLGFEKVSEEFISECKSKATLF  120

Query  328  KHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELL  507
            KHKKTG E+MSVSN+DENKVFGIV RTPPK+STGIPHILEHSVLCGSRKYP+K+PFVELL
Sbjct  121  KHKKTGCEVMSVSNEDENKVFGIVLRTPPKDSTGIPHILEHSVLCGSRKYPVKEPFVELL  180

Query  508  KGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            KGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  181  KGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  222



>ref|XP_006406530.1| hypothetical protein EUTSA_v10019955mg [Eutrema salsugineum]
 gb|ESQ47983.1| hypothetical protein EUTSA_v10019955mg [Eutrema salsugineum]
Length=1080

 Score =   256 bits (655),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 134/151 (89%), Gaps = 1/151 (1%)
 Frame = +1

Query  184  RFSPLSVRAVYTFP-PELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMS  360
            + S LSVRAV T P P       D A KLGFEKVSE+F+ ECKS+A+L+KHKKTG E+MS
Sbjct  77   QLSRLSVRAVATQPAPSYPDVGQDEAEKLGFEKVSEEFISECKSKAILFKHKKTGCEVMS  136

Query  361  VSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAF  540
            VSN+DENKVFGIV RTPPK+STGIPHILEHSVLCGSRKYPLK+PFVELLKGSL+TFLNAF
Sbjct  137  VSNEDENKVFGIVLRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNAF  196

Query  541  TYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            TYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  197  TYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  227



>ref|XP_010546463.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
[Tarenaya hassleriana]
Length=1077

 Score =   256 bits (654),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 139/224 (62%), Positives = 157/224 (70%), Gaps = 17/224 (8%)
 Frame = +1

Query  13   LLRSLSPPNSTLFARSSFSFSKRP-HFFANHLSNPRSTFRNRLLFTSTAA----------  159
            +LR+LS P         F FS+R  HF  ++ +   ++  N   F S  A          
Sbjct  1    MLRTLSSPPYLGLTSPFFRFSRRHRHFPRSYSAAAGASGCNLRWFQSPVAGGRRLFLRRV  60

Query  160  -----LPSLHLRTRFSPLSVRAVYTFP-PELSGAEDDVARKLGFEKVSEQFVDECKSRAV  321
                   +  L  +F   SVRAV T P P       D A +LGFEKVSE+F+ ECKS  V
Sbjct  61   LRLSPAAARGLGGQFYGFSVRAVATQPAPSYPDVGQDEAERLGFEKVSEEFISECKSNVV  120

Query  322  LYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVE  501
            L+KHKKTG E+MSVSNDDENKVFGIVFRTPPK+STGIPHILEHSVLCGSRKYPLK+PFVE
Sbjct  121  LFKHKKTGCEVMSVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVE  180

Query  502  LLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            LLKGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  181  LLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  224



>ref|XP_007200813.1| hypothetical protein PRUPE_ppa025698mg, partial [Prunus persica]
 gb|EMJ02012.1| hypothetical protein PRUPE_ppa025698mg, partial [Prunus persica]
Length=986

 Score =   255 bits (651),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +1

Query  235  SGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPP  414
            SG ED+V  KLGFEKVSE+F+ ECKS+A+L++HKKTGA+++SVSNDDENKVFGIVFRTPP
Sbjct  2    SGVEDEVVEKLGFEKVSEEFIGECKSKALLFRHKKTGAQVISVSNDDENKVFGIVFRTPP  61

Query  415  KNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDF  594
             +STGIPHILEHSVLCGSRKYPLK+PFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDF
Sbjct  62   NDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDF  121

Query  595  YNLVDVYLDAVFF  633
            YNLVDVYLDAVFF
Sbjct  122  YNLVDVYLDAVFF  134



>emb|CDY67652.1| BnaC01g43760D [Brassica napus]
Length=1139

 Score =   255 bits (652),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 139/173 (80%), Gaps = 2/173 (1%)
 Frame = +1

Query  115  RSTFRNRLLFTSTAALPSLHLRTRFSPLSVRAVYTFPPELSGAEDDVARKLGFEKVSEQF  294
            R   R  L  +S A      +  +FS  SVRAV T  P       D A KLGFEKVSE+F
Sbjct  51   RVFLRRGLRVSSAATAGGGGVNGQFSRFSVRAVAT--PSYPDVGQDEAEKLGFEKVSEEF  108

Query  295  VDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRK  474
            + ECKS+A L+KHKKTG E+MSVSN+DENKVFGIV RTPPK+STGIPHILEHSVLCGSRK
Sbjct  109  ISECKSKATLFKHKKTGCEVMSVSNEDENKVFGIVLRTPPKDSTGIPHILEHSVLCGSRK  168

Query  475  YPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            YP+K+PFVELLKGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  169  YPVKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  221



>emb|CDY22983.1| BnaC03g40860D [Brassica napus]
Length=1074

 Score =   254 bits (650),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 142/174 (82%), Gaps = 3/174 (2%)
 Frame = +1

Query  115  RSTFRNRLLFTSTAALPSLHLRTRFSPLSVRAVYTFP-PELSGAEDDVARKLGFEKVSEQ  291
            R  F  R L   +AA+  ++   + S L VRAV T P P       D A KLGFEKVSE+
Sbjct  53   RRVFLRRGLRVPSAAVRRVN--RQLSRLYVRAVATQPAPSYPDVGQDEAEKLGFEKVSEE  110

Query  292  FVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSR  471
            F+ ECKS+A L+KHKKTG E+MSVSN+DENKVFGIV RTPPK+STGIPHILEHSVLCGSR
Sbjct  111  FISECKSKATLFKHKKTGCEVMSVSNEDENKVFGIVLRTPPKDSTGIPHILEHSVLCGSR  170

Query  472  KYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            KYPLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  171  KYPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  224



>gb|EEE57849.1| hypothetical protein OsJ_08475 [Oryza sativa Japonica Group]
Length=1000

 Score =   253 bits (647),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 125/132 (95%), Gaps = 3/132 (2%)
 Frame = +1

Query  247  DDV---ARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPK  417
            DDV   A KLGFEKVSEQ +DECKS AVLYKHKKTGAE+MSVSNDDENKVFGIVFRTPPK
Sbjct  16   DDVHEYAAKLGFEKVSEQSIDECKSTAVLYKHKKTGAEVMSVSNDDENKVFGIVFRTPPK  75

Query  418  NSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFY  597
            NSTGIPHILEHSVLCGSRKYPLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTN KDFY
Sbjct  76   NSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNAKDFY  135

Query  598  NLVDVYLDAVFF  633
            NLVDVYLDAVFF
Sbjct  136  NLVDVYLDAVFF  147



>gb|KHN30412.1| Presequence protease 2, chloroplastic/mitochondrial [Glycine 
soja]
Length=1094

 Score =   253 bits (646),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 137/154 (89%), Gaps = 2/154 (1%)
 Frame = +1

Query  178  RTRFSPLSVRAVYTFPPELSGAE--DDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAE  351
            R  FS L+ RAV +  P    AE  D+VA KLGFEKVSE+F+ ECKS+AVL++H KTGA+
Sbjct  72   RKHFSSLAPRAVLSPSPSSGFAEVNDEVALKLGFEKVSEEFIPECKSKAVLFRHIKTGAQ  131

Query  352  IMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFL  531
            +MSVSNDD+NKVFGIVFRTPPK+STGIPHILEHSVLCGSRKYPLK+PFVELLKGSL+TFL
Sbjct  132  VMSVSNDDDNKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFL  191

Query  532  NAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            NAFTYPDRTCYPVASTN KDFYNLVDVYLDAVFF
Sbjct  192  NAFTYPDRTCYPVASTNAKDFYNLVDVYLDAVFF  225



>ref|XP_003517606.1| PREDICTED: presequence protease 2, chloroplastic/mitochondrial 
[Glycine max]
Length=1078

 Score =   253 bits (645),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 137/154 (89%), Gaps = 2/154 (1%)
 Frame = +1

Query  178  RTRFSPLSVRAVYTFPPELSGAE--DDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAE  351
            R  FS L+ RAV +  P    AE  D+VA KLGFEKVSE+F+ ECKS+AVL++H KTGA+
Sbjct  72   RKHFSSLAPRAVLSPSPSSGFAEVNDEVALKLGFEKVSEEFIPECKSKAVLFRHIKTGAQ  131

Query  352  IMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFL  531
            +MSVSNDD+NKVFGIVFRTPPK+STGIPHILEHSVLCGSRKYPLK+PFVELLKGSL+TFL
Sbjct  132  VMSVSNDDDNKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFL  191

Query  532  NAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            NAFTYPDRTCYPVASTN KDFYNLVDVYLDAVFF
Sbjct  192  NAFTYPDRTCYPVASTNAKDFYNLVDVYLDAVFF  225



>ref|XP_004511282.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
[Cicer arietinum]
Length=1080

 Score =   252 bits (643),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 138/156 (88%), Gaps = 6/156 (4%)
 Frame = +1

Query  178  RTRFSPLSVRAVYTFPPELSGA----EDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTG  345
            R  FS  + RA     P++SG     +D+VAR+LGFEKVSE+F+ ECKS+AVL++H KTG
Sbjct  74   RNHFS--TSRASLVSSPDISGGGEVVKDEVARELGFEKVSEEFITECKSKAVLFRHLKTG  131

Query  346  AEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNT  525
            A++MSVSN+DENKVFGIVFRTPP +STGIPHILEHSVLCGSRKYPLK+PFVELLKGSL+T
Sbjct  132  AQVMSVSNNDENKVFGIVFRTPPNDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHT  191

Query  526  FLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            FLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  192  FLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  227



>ref|XP_009417620.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=997

 Score =   251 bits (640),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = +1

Query  247  DDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNST  426
            +D+A KLGFE +SEQ ++ECK+ AVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPK+ST
Sbjct  16   NDIAEKLGFEIISEQTINECKATAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKDST  75

Query  427  GIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLV  606
            GIPHILEHSVLCGSRKYPLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLV
Sbjct  76   GIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLV  135

Query  607  DVYLDAVFF  633
            DVYLDAVFF
Sbjct  136  DVYLDAVFF  144



>gb|KEH27308.1| presequence protease [Medicago truncatula]
Length=1077

 Score =   251 bits (640),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 137/160 (86%), Gaps = 4/160 (3%)
 Frame = +1

Query  163  PSLHLRTRFSPLSVRAVYTFPPELSGAE---DDVARKLGFEKVSEQFVDECKSRAVLYKH  333
            P  + R R +  S RA     P++ G E   D+VAR+LGFEKVSE+F+ ECKS AVL+KH
Sbjct  66   PLFYFRNR-NHFSTRASLVSSPDIGGGEVVKDEVARELGFEKVSEEFIPECKSIAVLFKH  124

Query  334  KKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKG  513
             KTGA+++SVSN DENKVFGIVFRTPP +STGIPHILEHSVLCGSRKYPLK+PFVELLKG
Sbjct  125  VKTGAQVISVSNKDENKVFGIVFRTPPNDSTGIPHILEHSVLCGSRKYPLKEPFVELLKG  184

Query  514  SLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            SL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  185  SLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  224



>ref|XP_003636020.1| Presequence protease [Medicago truncatula]
Length=1124

 Score =   251 bits (640),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 137/160 (86%), Gaps = 4/160 (3%)
 Frame = +1

Query  163  PSLHLRTRFSPLSVRAVYTFPPELSGAE---DDVARKLGFEKVSEQFVDECKSRAVLYKH  333
            P  + R R +  S RA     P++ G E   D+VAR+LGFEKVSE+F+ ECKS AVL+KH
Sbjct  66   PLFYFRNR-NHFSTRASLVSSPDIGGGEVVKDEVARELGFEKVSEEFIPECKSIAVLFKH  124

Query  334  KKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKG  513
             KTGA+++SVSN DENKVFGIVFRTPP +STGIPHILEHSVLCGSRKYPLK+PFVELLKG
Sbjct  125  VKTGAQVISVSNKDENKVFGIVFRTPPNDSTGIPHILEHSVLCGSRKYPLKEPFVELLKG  184

Query  514  SLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            SL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  185  SLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  224



>ref|XP_002313107.1| hypothetical protein POPTR_0009s10650g [Populus trichocarpa]
 gb|EEE87062.1| hypothetical protein POPTR_0009s10650g [Populus trichocarpa]
Length=1006

 Score =   250 bits (638),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/127 (92%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +1

Query  253  VARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGI  432
            VA K GFEKVSE F+ ECKSRAVL KHKKTGAE+MSVSNDDENKVFGIVFRTPPK+STGI
Sbjct  30   VAAKYGFEKVSEDFIGECKSRAVLLKHKKTGAEVMSVSNDDENKVFGIVFRTPPKDSTGI  89

Query  433  PHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDV  612
            PHILEHSVLCGSRKYPLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDV
Sbjct  90   PHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDV  149

Query  613  YLDAVFF  633
            YLDAVFF
Sbjct  150  YLDAVFF  156



>ref|XP_001764982.1| predicted protein [Physcomitrella patens]
 gb|EDQ70198.1| predicted protein [Physcomitrella patens]
Length=1060

 Score =   249 bits (635),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = +1

Query  163  PSLHLRTRFSPLSVRAVYTFPPELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKT  342
            PS+ +R   S LS  AV    P  +GA+ ++ ++LGFE+V EQFVDE KS A LY+HKKT
Sbjct  53   PSMTVRRELS-LSPVAVVAPSPAKTGADSELVKELGFEEVQEQFVDEYKSTATLYRHKKT  111

Query  343  GAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLN  522
            GAEIMSV NDDENKVFGIVFRTPP +STGIPHILEHSVLCGSRKYPLK+PFVELLKGSL 
Sbjct  112  GAEIMSVVNDDENKVFGIVFRTPPTDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLQ  171

Query  523  TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            TFLNAFTYPDRTCYPVASTN +DFYNLVDVYLDAVF+
Sbjct  172  TFLNAFTYPDRTCYPVASTNLQDFYNLVDVYLDAVFY  208



>ref|XP_009147876.1| PREDICTED: presequence protease 2, chloroplastic/mitochondrial 
[Brassica rapa]
Length=1067

 Score =   244 bits (624),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 134/160 (84%), Gaps = 7/160 (4%)
 Frame = +1

Query  157  ALPSLHLRTRFS-PLSVRAVYTFPPELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKH  333
            A  S  L  +FS  +S +   ++P +      D A KLGFEK  E+F+ ECKS+AVL++H
Sbjct  61   AAASGCLSGQFSLAVSTQTATSYPGQ------DEAEKLGFEKSREEFISECKSKAVLFRH  114

Query  334  KKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKG  513
            KKTG E+MSVSNDDENKVFG+VFRTPPK+STGIPHILEHSVLCGSRKYPLK+PFVELLKG
Sbjct  115  KKTGCEVMSVSNDDENKVFGVVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKG  174

Query  514  SLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            SL TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  175  SLYTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  214



>emb|CDY50957.1| BnaA06g37530D [Brassica napus]
Length=1072

 Score =   244 bits (624),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 134/160 (84%), Gaps = 7/160 (4%)
 Frame = +1

Query  157  ALPSLHLRTRFS-PLSVRAVYTFPPELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKH  333
            A  S  L  +FS  +S +   ++P +      D A KLGFEK  E+F+ ECKS+AVL++H
Sbjct  61   AAASGCLSGQFSRAVSTQTATSYPGQ------DEAEKLGFEKSREEFISECKSKAVLFRH  114

Query  334  KKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKG  513
            KKTG E+MSVSNDDENKVFG+VFRTPPK+STGIPHILEHSVLCGSRKYPLK+PFVELLKG
Sbjct  115  KKTGCEVMSVSNDDENKVFGVVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKG  174

Query  514  SLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            SL TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  175  SLYTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  214



>gb|KFK35994.1| hypothetical protein AALP_AA4G064300 [Arabis alpina]
Length=1065

 Score =   244 bits (624),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +1

Query  250  DVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTG  429
            D A K GFEKV E+F+ ECKS+A+L+KHKKTG E+MSVSNDDENKVFG+VFRTPPK+STG
Sbjct  85   DEAGKHGFEKVREEFISECKSKAILFKHKKTGCEVMSVSNDDENKVFGVVFRTPPKDSTG  144

Query  430  IPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVD  609
            IPHILEHSVLCGSRKYPLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVD
Sbjct  145  IPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVD  204

Query  610  VYLDAVFF  633
            VYLDAVFF
Sbjct  205  VYLDAVFF  212



>emb|CDY28099.1| BnaC06g02800D [Brassica napus]
Length=1064

 Score =   244 bits (624),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/128 (87%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = +1

Query  250  DVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTG  429
            D A KLGFEK  E+F+ ECKS+AVL++HKKTG E+MSVSNDDENKVFG+VFRTPPK+STG
Sbjct  87   DEAEKLGFEKAREEFISECKSKAVLFRHKKTGCEVMSVSNDDENKVFGVVFRTPPKDSTG  146

Query  430  IPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVD  609
            IPHILEHS+LCGSRKYPLK+PFVELLKGSL TFLNAFTYPDRTCYPVASTNTKDFYNLVD
Sbjct  147  IPHILEHSILCGSRKYPLKEPFVELLKGSLYTFLNAFTYPDRTCYPVASTNTKDFYNLVD  206

Query  610  VYLDAVFF  633
            VYLDAVFF
Sbjct  207  VYLDAVFF  214



>pdb|2FGE|A Chain A, Crystal Structure Of Presequence Protease Prep From 
Arabidopsis Thaliana
 pdb|2FGE|B Chain B, Crystal Structure Of Presequence Protease Prep From 
Arabidopsis Thaliana
Length=995

 Score =   242 bits (618),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/128 (86%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +1

Query  250  DVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTG  429
            D A KLGFEKVSE+F+ ECKS+A+L+KHKKTG E+ SVSN+DENKVFG+VFRTPPK+STG
Sbjct  15   DEAEKLGFEKVSEEFISECKSKAILFKHKKTGCEVXSVSNEDENKVFGVVFRTPPKDSTG  74

Query  430  IPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVD  609
            IPHIL+HSVLCGSRKYP+K+PFVELLKGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVD
Sbjct  75   IPHILQHSVLCGSRKYPVKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVD  134

Query  610  VYLDAVFF  633
            VYLDAVFF
Sbjct  135  VYLDAVFF  142



>ref|XP_002452870.1| hypothetical protein SORBIDRAFT_04g033980 [Sorghum bicolor]
 gb|EES05846.1| hypothetical protein SORBIDRAFT_04g033980 [Sorghum bicolor]
Length=1125

 Score =   242 bits (617),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/119 (94%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  277  KVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSV  456
            +VSEQ +DECKS AVLYKHKKTGAE+MSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSV
Sbjct  140  QVSEQTIDECKSTAVLYKHKKTGAEVMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSV  199

Query  457  LCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            LCGSRKYPLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  200  LCGSRKYPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  258



>ref|XP_007157239.1| hypothetical protein PHAVU_002G054400g [Phaseolus vulgaris]
 gb|ESW29233.1| hypothetical protein PHAVU_002G054400g [Phaseolus vulgaris]
Length=1078

 Score =   241 bits (616),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 128/194 (66%), Positives = 148/194 (76%), Gaps = 24/194 (12%)
 Frame = +1

Query  106  SNPRSTF---RNRLLFTSTAALPSLHLRT---RFSPLSVRAVY------------TFPPE  231
            S P S+F   R+  L  ++++ P  H RT   RF   S RAV              FP  
Sbjct  38   SRPSSSFLRRRSPRLLPASSSPP--HFRTSSNRFCSFSPRAVLSPSPSSSPSPPPAFPQ-  94

Query  232  LSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTP  411
                ED+VA + GF+ VSE+F+ ECKS+AVL++H KTGA++MSVSNDDENKVFGIVFRTP
Sbjct  95   ---VEDEVALQFGFQIVSEEFIPECKSKAVLFRHIKTGAQVMSVSNDDENKVFGIVFRTP  151

Query  412  PKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKD  591
            P +STGIPHILEHSVLCGSRKYPLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTN+KD
Sbjct  152  PNDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNSKD  211

Query  592  FYNLVDVYLDAVFF  633
            FYNLVDVYLDAVFF
Sbjct  212  FYNLVDVYLDAVFF  225



>ref|XP_002979622.1| hypothetical protein SELMODRAFT_419272 [Selaginella moellendorffii]
 gb|EFJ19511.1| hypothetical protein SELMODRAFT_419272 [Selaginella moellendorffii]
Length=1040

 Score =   237 bits (604),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  238  GAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPK  417
            GA  DV ++LGFE+V E+F+ E KS AVLY+HKKTGAE+MSV N+DENKVFGIVFRTPPK
Sbjct  72   GANPDVVKELGFEEVREEFISEYKSTAVLYRHKKTGAEVMSVVNEDENKVFGIVFRTPPK  131

Query  418  NSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFY  597
            +S GIPHILEHSVLCGSRKYPLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTN KDFY
Sbjct  132  DSKGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNLKDFY  191

Query  598  NLVDVYLDAVF  630
            NLVDVYLDAVF
Sbjct  192  NLVDVYLDAVF  202



>ref|XP_006423049.1| hypothetical protein CICLE_v10030315mg [Citrus clementina]
 gb|ESR36289.1| hypothetical protein CICLE_v10030315mg [Citrus clementina]
Length=416

 Score =   214 bits (546),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 145/221 (66%), Gaps = 30/221 (14%)
 Frame = +1

Query  1    EGRVLLRSLSPPNSTLFARSSFSFS------KRPHFFANHLSNPRSTFRNRLLFTSTAAL  162
            E   LLRSLS    +   R+ FS S      +  H   N+L+  RS  R       + + 
Sbjct  2    ERAALLRSLSYSTFSFVPRAKFSSSSVAVARRNHHRLINNLTR-RSLLRGDSRLHLSLSS  60

Query  163  PSLHLRTRFSPLSVRAVYT--FPPELSGAE--DDVARKLGFEKVSEQFVDECKSRAVLYK  330
             SL     FS LS RAV +   P    GAE  ++VA KLGFEKVSE+F+ ECKS+AVL+K
Sbjct  61   YSLQFNKHFSSLSPRAVASPSTPSSPEGAEVSNEVAEKLGFEKVSEEFIGECKSKAVLFK  120

Query  331  HKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLK  510
            HKKTGAE+MSVSNDDENKVFGIVFRTPPK                   YPLK+ FVELLK
Sbjct  121  HKKTGAEVMSVSNDDENKVFGIVFRTPPK-------------------YPLKEQFVELLK  161

Query  511  GSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            GSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  162  GSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  202



>ref|XP_007514955.1| putative peptidase [Bathycoccus prasinos]
 emb|CCO15195.1| putative peptidase [Bathycoccus prasinos]
Length=1060

 Score =   213 bits (543),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF+ V E+FV E  ++  L+KHKKTGAE+MS+SNDDENK FG+ FRTPP NSTGIPHILE
Sbjct  87   GFDLVKEEFVPEYNAKGFLFKHKKTGAEVMSLSNDDENKSFGVTFRTPPANSTGIPHILE  146

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSRKYP+K+PFVEL+KGSLNTFLNA TYPDRTCYPVAS N  DFYNLVDVYLDAV
Sbjct  147  HSVLCGSRKYPIKEPFVELIKGSLNTFLNAMTYPDRTCYPVASCNLADFYNLVDVYLDAV  206

Query  628  F  630
            F
Sbjct  207  F  207



>ref|XP_005651052.1| hypothetical protein COCSUDRAFT_35102 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26508.1| hypothetical protein COCSUDRAFT_35102 [Coccomyxa subellipsoidea 
C-169]
Length=998

 Score =   209 bits (532),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 112/135 (83%), Gaps = 3/135 (2%)
 Frame = +1

Query  238  GAEDDVARK---LGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRT  408
            GA   VA++    GFE V E FV E  S+ ++Y+HKKTGAE+MS+ N DENK FG VFRT
Sbjct  12   GALSQVAQRPELHGFELVREHFVSEYDSQVLMYRHKKTGAEVMSLINKDENKTFGAVFRT  71

Query  409  PPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTK  588
            P  NS GIPHILEHSVLCGS+KYP+K+PFVEL+KGSLNTFLNAFTYPDRTCYPVASTN +
Sbjct  72   PVDNSKGIPHILEHSVLCGSKKYPIKEPFVELMKGSLNTFLNAFTYPDRTCYPVASTNLQ  131

Query  589  DFYNLVDVYLDAVFF  633
            DFYNLVDVYLDAV +
Sbjct  132  DFYNLVDVYLDAVLY  146



>ref|WP_043601248.1| peptidase M16 [Desulfovibrio magneticus]
Length=970

 Score =   207 bits (526),  Expect = 5e-58, Method: Composition-based stats.
 Identities = 92/127 (72%), Positives = 113/127 (89%), Gaps = 0/127 (0%)
 Frame = +1

Query  253  VARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGI  432
            +++K GF  + ++ V+E  +RA+LY+H +TGAE++S+ +DDENKVFG  FRTPP  STG+
Sbjct  1    MSKKYGFSVLRDEIVEEYAARAILYRHDRTGAELLSLISDDENKVFGAAFRTPPACSTGV  60

Query  433  PHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDV  612
            PHILEHSVLCGS+KYP+K+PFVELLKGSLNTFLNAFTYPD+TCYPVASTN +DFYNLVDV
Sbjct  61   PHILEHSVLCGSQKYPVKEPFVELLKGSLNTFLNAFTYPDKTCYPVASTNLRDFYNLVDV  120

Query  613  YLDAVFF  633
            YLDAVFF
Sbjct  121  YLDAVFF  127



>dbj|BAH77801.1| peptidase M16C family protein [Desulfovibrio magneticus RS-1]
Length=990

 Score =   207 bits (526),  Expect = 6e-58, Method: Composition-based stats.
 Identities = 92/127 (72%), Positives = 113/127 (89%), Gaps = 0/127 (0%)
 Frame = +1

Query  253  VARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGI  432
            +++K GF  + ++ V+E  +RA+LY+H +TGAE++S+ +DDENKVFG  FRTPP  STG+
Sbjct  21   MSKKYGFSVLRDEIVEEYAARAILYRHDRTGAELLSLISDDENKVFGAAFRTPPACSTGV  80

Query  433  PHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDV  612
            PHILEHSVLCGS+KYP+K+PFVELLKGSLNTFLNAFTYPD+TCYPVASTN +DFYNLVDV
Sbjct  81   PHILEHSVLCGSQKYPVKEPFVELLKGSLNTFLNAFTYPDKTCYPVASTNLRDFYNLVDV  140

Query  613  YLDAVFF  633
            YLDAVFF
Sbjct  141  YLDAVFF  147



>ref|WP_009110736.1| peptidase M16 [Desulfovibrio sp. U5L]
 gb|EIG55675.1| putative Zn-dependent peptidase, insulinase [Desulfovibrio sp. 
U5L]
Length=968

 Score =   205 bits (521),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 92/127 (72%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = +1

Query  253  VARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGI  432
            ++R  GF  ++++ + E  +RAV Y+H +TGAE++S+S DD NKVFG+ FRTPP NSTG+
Sbjct  1    MSRSHGFTVLTDETLTEYAARAVRYRHDRTGAEVLSLSLDDANKVFGVAFRTPPANSTGV  60

Query  433  PHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDV  612
            PHILEHSVLCGSRKYP+K+PFVELLKGSL TFLNAFTYPD+TCYPVASTN +DFYNLVDV
Sbjct  61   PHILEHSVLCGSRKYPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASTNLRDFYNLVDV  120

Query  613  YLDAVFF  633
            YLDAVFF
Sbjct  121  YLDAVFF  127



>ref|XP_005842187.1| hypothetical protein GUITHDRAFT_83724 [Guillardia theta CCMP2712]
 gb|EKX55207.1| hypothetical protein GUITHDRAFT_83724 [Guillardia theta CCMP2712]
Length=1049

 Score =   205 bits (522),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 127/178 (71%), Gaps = 13/178 (7%)
 Frame = +1

Query  115  RSTFRNRLLFTSTAALPSLHLR--TRFSPLS-VRAVYTFPPELSGAEDDVARKLGFEK--  279
            R +   R+   ++  LP    R   R +P S VR V T       +  DV     F+K  
Sbjct  21   RGSAGARMSKVASFKLPQASFRRPGRLAPFSNVRMVAT-------SSVDVKSSAIFQKYD  73

Query  280  -VSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSV  456
             V E  +DE  ++ VL+KHKKTGAE+MSVS  DENKVFGI FRTPP +STG+PHILEHSV
Sbjct  74   IVKEDHIDEYGAKVVLFKHKKTGAEVMSVSVPDENKVFGITFRTPPNDSTGVPHILEHSV  133

Query  457  LCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  630
            LCGSR+YP+K+PFVELLKGS+NTFLNAFTYPDRTCYPVAS N KDFYNL++VYLDAV 
Sbjct  134  LCGSRRYPVKEPFVELLKGSMNTFLNAFTYPDRTCYPVASQNLKDFYNLINVYLDAVL  191



>ref|WP_019999861.1| peptidase M16 [Desulfovibrio desulfuricans]
Length=970

 Score =   204 bits (519),  Expect = 4e-57, Method: Composition-based stats.
 Identities = 89/127 (70%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = +1

Query  253  VARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGI  432
            +  + GFE V EQ V+E  + A L+KH+KTGA+++S++N DENKVFG+ FRTPP +STG+
Sbjct  1    MTEQFGFELVDEQRVEELATTARLWKHRKTGAQVLSMNNADENKVFGVSFRTPPSDSTGV  60

Query  433  PHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDV  612
             HILEHSVLCGS K+P+K+PFVELLKGSL TFLNAFTYPD+TCYPVASTN +DFYNL+DV
Sbjct  61   AHILEHSVLCGSEKFPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASTNLQDFYNLIDV  120

Query  613  YLDAVFF  633
            YLDA FF
Sbjct  121  YLDAAFF  127



>ref|WP_027361259.1| peptidase M16 [Desulfovibrio acrylicus]
Length=970

 Score =   204 bits (518),  Expect = 6e-57, Method: Composition-based stats.
 Identities = 89/127 (70%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = +1

Query  253  VARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGI  432
            +  + GFE V EQ V+E  + A L+KH+KTGA+++S++N DENKVFG+ FRTPP +STG+
Sbjct  1    MTEQFGFELVDEQRVEELATTARLWKHRKTGAQVLSMNNADENKVFGVSFRTPPSDSTGV  60

Query  433  PHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDV  612
             HILEHSVLCGS K+P+K+PFVELLKGSL TFLNAFTYPD+TCYPVASTN +DFYNL+DV
Sbjct  61   AHILEHSVLCGSEKFPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASTNLQDFYNLIDV  120

Query  613  YLDAVFF  633
            YLDA FF
Sbjct  121  YLDAAFF  127



>ref|XP_002501992.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63250.1| predicted protein [Micromonas sp. RCC299]
Length=1042

 Score =   204 bits (520),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GFE V E +V E  S+   ++H KTGAE+MS+SNDDENK FG+  RTPP NSTGIPHILE
Sbjct  69   GFELVREDYVAEYDSKVFFFRHAKTGAEVMSLSNDDENKCFGVTLRTPPANSTGIPHILE  128

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSRKYP+K+PFVEL+KGSLNTFLNA TYPDRTCYPVAS N +DF NLVDVYLDAV
Sbjct  129  HSVLCGSRKYPIKEPFVELIKGSLNTFLNAMTYPDRTCYPVASCNLQDFRNLVDVYLDAV  188

Query  628  F  630
            F
Sbjct  189  F  189



>ref|WP_005990555.1| peptidase M16 [Desulfovibrio fructosivorans]
 gb|EFL52739.1| Peptidase M16C associated domain protein [Desulfovibrio fructosivorans 
JJ]
Length=968

 Score =   204 bits (518),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF  + ++ +DE  +RAVL +H +TGA+++S+S DD NKVFGI FRTPP NSTG+PHILE
Sbjct  6    GFTVLRDETLDEYAARAVLARHDRTGAQVLSLSLDDANKVFGISFRTPPANSTGVPHILE  65

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSRKYP+K+PFVELLKGSL TFLNAFTYPD+TCYPVASTN +DFYNL+DVYLDAV
Sbjct  66   HSVLCGSRKYPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASTNLRDFYNLIDVYLDAV  125

Query  628  FF  633
            F+
Sbjct  126  FY  127



>ref|WP_009182029.1| peptidase M16 [Desulfovibrio sp. FW1012B]
 gb|EHJ48664.1| Peptidase M16C associated domain protein [Desulfovibrio sp. FW1012B]
Length=968

 Score =   204 bits (518),  Expect = 7e-57, Method: Composition-based stats.
 Identities = 92/127 (72%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = +1

Query  253  VARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGI  432
            ++R  GF  ++++ + E  +RAV Y+H +TGAE++S+S DD NKVFG+ FRTPP NSTG+
Sbjct  1    MSRSHGFTVLADETLTEYAARAVRYRHDRTGAEVLSLSLDDANKVFGVAFRTPPANSTGV  60

Query  433  PHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDV  612
            PHILEHSVLCGSRKYP+K+PFVELLKGSL TFLNAFTYPD+TCYPVASTN  DFYNLVDV
Sbjct  61   PHILEHSVLCGSRKYPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASTNLPDFYNLVDV  120

Query  613  YLDAVFF  633
            YLDAVFF
Sbjct  121  YLDAVFF  127



>gb|KDO42491.1| hypothetical protein CISIN_1g0037001mg, partial [Citrus sinensis]
 gb|KDO42492.1| hypothetical protein CISIN_1g0037001mg, partial [Citrus sinensis]
 gb|KDO42493.1| hypothetical protein CISIN_1g0037001mg, partial [Citrus sinensis]
 gb|KDO42494.1| hypothetical protein CISIN_1g0037001mg, partial [Citrus sinensis]
 gb|KDO42495.1| hypothetical protein CISIN_1g0037001mg, partial [Citrus sinensis]
Length=204

 Score =   190 bits (483),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 90/93 (97%), Positives = 92/93 (99%), Gaps = 0/93 (0%)
 Frame = +1

Query  355  MSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLN  534
            MSVSNDDENKVFGIVFRTPPK+STGIPHILEHSVLCGSRKYPLK+PFVELLKGSLNTFLN
Sbjct  1    MSVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLNTFLN  60

Query  535  AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            AFTYPDRTCYPVASTNTKDFYNLVDVY DAVFF
Sbjct  61   AFTYPDRTCYPVASTNTKDFYNLVDVYFDAVFF  93



>ref|WP_012805698.1| peptidase M16 [Desulfomicrobium baculatum]
 gb|ACU88615.1| Peptidase M16C associated domain protein [Desulfomicrobium baculatum 
DSM 4028]
Length=969

 Score =   203 bits (517),  Expect = 8e-57, Method: Composition-based stats.
 Identities = 92/122 (75%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF +VS  +V E  SRA ++ H +TGA I+SV NDDENKVFGI FRTPP +STG+ HILE
Sbjct  4    GFTRVSTTYVQEISSRADIFVHDRTGARILSVVNDDENKVFGISFRTPPSDSTGVAHILE  63

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSRKYP+K+PFV+LLKGSL TFLNA TYPD+TCYPVAS N KDFYNLVDVYLDAV
Sbjct  64   HSVLCGSRKYPVKEPFVDLLKGSLQTFLNAMTYPDKTCYPVASQNLKDFYNLVDVYLDAV  123

Query  628  FF  633
            FF
Sbjct  124  FF  125



>ref|XP_005844172.1| hypothetical protein CHLNCDRAFT_139318 [Chlorella variabilis]
 gb|EFN52070.1| hypothetical protein CHLNCDRAFT_139318 [Chlorella variabilis]
Length=980

 Score =   203 bits (516),  Expect = 1e-56, Method: Composition-based stats.
 Identities = 93/127 (73%), Positives = 108/127 (85%), Gaps = 1/127 (1%)
 Frame = +1

Query  253  VARKL-GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTG  429
            V +KL GF  V +Q+V E  S+ ++Y+H KTGA++MSV N DENK FG+ FRTP  NS G
Sbjct  8    VPQKLHGFSLVEQQYVTEYASQVLMYRHDKTGAQLMSVINSDENKTFGVTFRTPVANSRG  67

Query  430  IPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVD  609
            +PHILEHSVLCGSRKYP+K+PFVEL+KGSLNTFLNAFTYPDRTCYPVAS N +DFYNLVD
Sbjct  68   VPHILEHSVLCGSRKYPIKEPFVELMKGSLNTFLNAFTYPDRTCYPVASINLQDFYNLVD  127

Query  610  VYLDAVF  630
            VYLDAVF
Sbjct  128  VYLDAVF  134



>ref|WP_006921332.1| putative Zn-dependent peptidase, insulinase [Desulfovibrio magneticus]
 gb|EKO38312.1| putative Zn-dependent peptidase, insulinase [Desulfovibrio magneticus 
str. Maddingley MBC34]
Length=970

 Score =   201 bits (512),  Expect = 5e-56, Method: Composition-based stats.
 Identities = 90/127 (71%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = +1

Query  253  VARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGI  432
            +++  GF  + ++ ++E  +RAVLY+H +TGA+++S+ +DDENKVFG  FRTPP  STG+
Sbjct  1    MSKHHGFSVLRDEILEEYAARAVLYRHDRTGAQLLSLISDDENKVFGAAFRTPPACSTGV  60

Query  433  PHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDV  612
            PHILEHSVLCGS+KYP+K+PFVELLKGSLNTFLNAFTYPD+TCYPVASTN +DFYNLVDV
Sbjct  61   PHILEHSVLCGSQKYPVKEPFVELLKGSLNTFLNAFTYPDKTCYPVASTNLRDFYNLVDV  120

Query  613  YLDAVFF  633
            YLDAVFF
Sbjct  121  YLDAVFF  127



>ref|WP_015751993.1| peptidase M16 [Desulfohalobium retbaense]
 gb|ACV68849.1| Peptidase M16C associated domain protein [Desulfohalobium retbaense 
DSM 5692]
Length=968

 Score =   201 bits (511),  Expect = 5e-56, Method: Composition-based stats.
 Identities = 88/121 (73%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF  + + +VDE +S+  +Y+H +TGAE++SV N D NKVFGI FRTPPK+STG+ HILE
Sbjct  6    GFTCLRDTYVDEIRSQCRVYRHDQTGAEVLSVENQDTNKVFGISFRTPPKDSTGVAHILE  65

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSRKYPLK+PFVELLKGSL TFLNA T+PD+TCYPVAS NT+DFYNL+DVYLDAV
Sbjct  66   HSVLCGSRKYPLKEPFVELLKGSLQTFLNAMTFPDKTCYPVASQNTQDFYNLIDVYLDAV  125

Query  628  F  630
            F
Sbjct  126  F  126



>ref|WP_024824358.1| peptidase M16 [Desulfovibrio magneticus]
Length=970

 Score =   201 bits (511),  Expect = 6e-56, Method: Composition-based stats.
 Identities = 90/127 (71%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = +1

Query  253  VARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGI  432
            ++R  GF  + ++ +DE  +RA+LY+H +TGA+++S+  DD NKVFG  FRTPP+ STG+
Sbjct  1    MSRMHGFSVLRDETLDEYAARAILYRHDRTGAQLLSLVLDDTNKVFGAAFRTPPECSTGV  60

Query  433  PHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDV  612
            PHILEHSVLCGSRKYP+K+PFVELLKGSLNTFLNAFTYPD+TCYPVASTN +DFYNLVDV
Sbjct  61   PHILEHSVLCGSRKYPVKEPFVELLKGSLNTFLNAFTYPDKTCYPVASTNLRDFYNLVDV  120

Query  613  YLDAVFF  633
            YLDAVF+
Sbjct  121  YLDAVFY  127



>ref|WP_035261705.1| peptidase M16 [Desulfonatronum lacustre]
Length=979

 Score =   200 bits (509),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 89/120 (74%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  271  FEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEH  450
            F  + E F+ E +SRA LY+H +TGA ++S+ N+DENKVFGI FRTPP +STG+ HILEH
Sbjct  5    FTLLKETFITELQSRAFLYRHDRTGARLLSLVNNDENKVFGISFRTPPADSTGVAHILEH  64

Query  451  SVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  630
            SVLCGSRKYP+K+PFVELLKGSL TFLNAFTYPD+TCYPVAS N+KDFYNL+DVYLDAVF
Sbjct  65   SVLCGSRKYPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASQNSKDFYNLIDVYLDAVF  124



>ref|WP_031388389.1| peptidase M16 [Desulfonatronum thiodismutans]
Length=979

 Score =   200 bits (509),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 90/120 (75%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = +1

Query  271  FEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEH  450
            F  + E F+ E +SRA LY+H  TGA ++S+ NDDENKVFGI FRTPP +STG+ HILEH
Sbjct  5    FTLLKETFITELQSRAFLYRHDHTGARLLSLVNDDENKVFGISFRTPPADSTGVAHILEH  64

Query  451  SVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  630
            SVLCGSRKYP+K+PFVELLKGSL TFLNAFTYPD+TCYPVAS N KDFYNL+DVYLDAVF
Sbjct  65   SVLCGSRKYPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASQNIKDFYNLIDVYLDAVF  124



>ref|WP_029456797.1| peptidase M16 [Desulfovibrio alcoholivorans]
Length=968

 Score =   200 bits (508),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 90/124 (73%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +1

Query  262  KLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHI  441
            K GF  + ++ + E  +RAVL +H +TGA+++S+S DD NKVFG+ FRTPP NSTG+PHI
Sbjct  4    KYGFTVLCDEDLAEYAARAVLCRHDRTGAQVLSLSLDDANKVFGVSFRTPPANSTGVPHI  63

Query  442  LEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLD  621
            LEHSVLCGSRKYP+K+PFVELLKGSL TFLNAFTYPD+TCYPVASTN +DFYNLVDVYLD
Sbjct  64   LEHSVLCGSRKYPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASTNLRDFYNLVDVYLD  123

Query  622  AVFF  633
            AVF+
Sbjct  124  AVFY  127



>ref|XP_002952139.1| hypothetical protein VOLCADRAFT_81738 [Volvox carteri f. nagariensis]
 gb|EFJ46930.1| hypothetical protein VOLCADRAFT_81738 [Volvox carteri f. nagariensis]
Length=1034

 Score =   200 bits (509),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +1

Query  253  VARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGI  432
            V +  GF    +Q+V E  S  +LYKH KTGAE++SV N D NK FG+V RTP  +STGI
Sbjct  51   VEKAHGFTLQRQQYVKEYGSHVLLYKHDKTGAELISVLNSDLNKTFGVVLRTPVDDSTGI  110

Query  433  PHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDV  612
            PHILEHSVLCGSRKYP+K+PFVEL+K SLNTFLNAFTYPDRTCYPVASTNT+DFYNLVDV
Sbjct  111  PHILEHSVLCGSRKYPIKEPFVELMKSSLNTFLNAFTYPDRTCYPVASTNTQDFYNLVDV  170

Query  613  YLDAVF  630
            YLDAVF
Sbjct  171  YLDAVF  176



>ref|WP_027181841.1| peptidase M16 [Desulfovibrio alaskensis]
Length=965

 Score =   199 bits (507),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 91/124 (73%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +1

Query  262  KLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHI  441
            K GF  V E+ + E  SRA L++H  TGA ++S+SNDDENKVFG+ FRTPP +STG+ HI
Sbjct  3    KHGFTLVEEREIKELSSRARLWRHDATGAALLSMSNDDENKVFGVSFRTPPHDSTGVAHI  62

Query  442  LEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLD  621
            LEHSVLCGS KYP+K+PFVELLKGSL TFLNAFTYPD+TCYPVASTN  DFYNLVDVYLD
Sbjct  63   LEHSVLCGSEKYPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASTNLADFYNLVDVYLD  122

Query  622  AVFF  633
            A FF
Sbjct  123  AAFF  126



>ref|WP_011368505.1| peptidase M16 [Desulfovibrio alaskensis]
 gb|ABB39473.2| metalloprotease, iron regulated [Desulfovibrio alaskensis G20]
Length=965

 Score =   199 bits (507),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 91/124 (73%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +1

Query  262  KLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHI  441
            K GF  V E+ + E  SRA L++H  TGA ++S+SNDDENKVFG+ FRTPP +STG+ HI
Sbjct  3    KHGFTLVEEREIKELSSRARLWRHDATGAALLSMSNDDENKVFGVSFRTPPHDSTGVAHI  62

Query  442  LEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLD  621
            LEHSVLCGS KYP+K+PFVELLKGSL TFLNAFTYPD+TCYPVASTN  DFYNLVDVYLD
Sbjct  63   LEHSVLCGSEKYPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASTNLADFYNLVDVYLD  122

Query  622  AVFF  633
            A FF
Sbjct  123  AAFF  126



>ref|WP_028577615.1| peptidase M16 [Desulfomicrobium escambiense]
Length=969

 Score =   199 bits (507),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 92/122 (75%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF  VS   V E  S+A LY H +TGA I+SV NDDENKVFGI FRTPP +STG+ HILE
Sbjct  4    GFTLVSSTHVPEIASQADLYVHDRTGARILSVRNDDENKVFGITFRTPPADSTGVAHILE  63

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSRKYP+K+PFV+LLKGSL TFLNA TYPD+TCYPVAS N KDFYNL DVYLDAV
Sbjct  64   HSVLCGSRKYPVKEPFVDLLKGSLQTFLNAMTYPDKTCYPVASQNLKDFYNLTDVYLDAV  123

Query  628  FF  633
            FF
Sbjct  124  FF  125



>emb|CEG00022.1| Metalloenzyme, LuxS/M16 peptidase-like [Ostreococcus tauri]
Length=1055

 Score =   200 bits (508),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GFE V E ++ E  ++A L++H KTGAE+MS+SN+DENK FG+ FRTPP NSTGIPHILE
Sbjct  85   GFELVREDYISEYDAKAFLFRHAKTGAEVMSLSNEDENKTFGVTFRTPPSNSTGIPHILE  144

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSRKYP+K+PFVEL+KGSLNTFLNA T+PD+T YPVAS N +DF NL DVYLDAV
Sbjct  145  HSVLCGSRKYPIKEPFVELIKGSLNTFLNAMTWPDKTAYPVASCNLQDFRNLTDVYLDAV  204

Query  628  F  630
            F
Sbjct  205  F  205



>ref|WP_043637762.1| peptidase M16 [Desulfovibrio sp. TomC]
 gb|KHK01438.1| peptidase, M16 family [Desulfovibrio sp. TomC]
Length=970

 Score =   199 bits (505),  Expect = 4e-55, Method: Composition-based stats.
 Identities = 90/127 (71%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = +1

Query  253  VARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGI  432
            ++R  GF  + ++ +DE  +RA++ +H +TGAE++S+  DD NKVFG  FRTPP  STG+
Sbjct  1    MSRTHGFSVLRDESLDEYAARAMVLRHDRTGAELLSLVLDDANKVFGAAFRTPPDCSTGV  60

Query  433  PHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDV  612
            PHILEHSVLCGSRKYP+K+PFVELLKGSLNTFLNAFTYPD+TCYPVASTN +DFYNLVDV
Sbjct  61   PHILEHSVLCGSRKYPVKEPFVELLKGSLNTFLNAFTYPDKTCYPVASTNVRDFYNLVDV  120

Query  613  YLDAVFF  633
            YLDAVFF
Sbjct  121  YLDAVFF  127



>ref|XP_001420892.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99185.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=979

 Score =   199 bits (505),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF  V E ++ E  ++A L+KH+KTGAE+MS+SN+DENK FG+ FRTPP NSTGIPHILE
Sbjct  9    GFRLVREDYIAEYDAKAFLFKHEKTGAEVMSLSNEDENKTFGVTFRTPPSNSTGIPHILE  68

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSRKYP+K+PFVEL+KGSLNTFLNA T+PD+T YPVAS N +DF NL DVYLDAV
Sbjct  69   HSVLCGSRKYPIKEPFVELIKGSLNTFLNAMTWPDKTAYPVASCNLQDFRNLTDVYLDAV  128

Query  628  F  630
            F
Sbjct  129  F  129



>ref|XP_003082508.1| putative metalloprotease (ISS), partial [Ostreococcus tauri]
Length=1085

 Score =   199 bits (506),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GFE V E ++ E  ++A L++H KTGAE+MS+SN+DENK FG+ FRTPP NSTGIPHILE
Sbjct  9    GFELVREDYISEYDAKAFLFRHAKTGAEVMSLSNEDENKTFGVTFRTPPSNSTGIPHILE  68

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSRKYP+K+PFVEL+KGSLNTFLNA T+PD+T YPVAS N +DF NL DVYLDAV
Sbjct  69   HSVLCGSRKYPIKEPFVELIKGSLNTFLNAMTWPDKTAYPVASCNLQDFRNLTDVYLDAV  128

Query  628  F  630
            F
Sbjct  129  F  129



>gb|KDD73441.1| hypothetical protein H632_c2174p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=287

 Score =   188 bits (477),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = +1

Query  256  ARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIP  435
            A   GFE V  ++V E  S   LY+H  +GAE+MSV N DENK FG+ F TP  +S G P
Sbjct  15   ASSHGFELVRSEYVSESSSHVALYRHLASGAELMSVRNADENKTFGVTFCTPVHDSKGTP  74

Query  436  HILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVY  615
            HILEHSVLCGS +YP K+PFVEL+KGSLNTFLNAFTYPDRTCYPVASTN +D+YNLVDVY
Sbjct  75   HILEHSVLCGSDRYPCKEPFVELMKGSLNTFLNAFTYPDRTCYPVASTNLRDYYNLVDVY  134

Query  616  LDAVF  630
            LDAVF
Sbjct  135  LDAVF  139



>gb|EJK74078.1| hypothetical protein THAOC_04268 [Thalassiosira oceanica]
Length=404

 Score =   191 bits (485),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = +1

Query  271  FEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEH  450
            +E V    + E  + A+LYKHKKTGAE++S+S DD+NK FGI FRTPP +STG+PHILEH
Sbjct  225  YEVVQTDHITEFGANAILYKHKKTGAELLSLSTDDDNKCFGITFRTPPTDSTGVPHILEH  284

Query  451  SVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  630
            SVLCGSRKY  K PFV+LL+GSL TFLNAFTYPDRTCY VAS NTKDFYNL++VY DAVF
Sbjct  285  SVLCGSRKYTTKDPFVQLLQGSLQTFLNAFTYPDRTCYVVASQNTKDFYNLINVYADAVF  344



>ref|WP_027177039.1| peptidase M16 [Desulfovibrio aminophilus]
Length=967

 Score =   198 bits (503),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF K+ EQ + E ++RA +Y+H KTG  ++S+ N+DENKVFGI FRTPP++STG+ HILE
Sbjct  6    GFRKIREQDIPEIRTRAQVYEHVKTGGRLLSLLNEDENKVFGISFRTPPRDSTGVAHILE  65

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSRKYP+++PFVELLKGSL TFLNA T+PD+TCYPVASTN +DFYNL+DVYLDAV
Sbjct  66   HSVLCGSRKYPVREPFVELLKGSLQTFLNALTFPDKTCYPVASTNVQDFYNLIDVYLDAV  125

Query  628  F  630
            F
Sbjct  126  F  126



>ref|XP_005538148.1| presequence protease [Cyanidioschyzon merolae strain 10D]
 dbj|BAM82112.1| presequence protease [Cyanidioschyzon merolae strain 10D]
Length=1067

 Score =   198 bits (504),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 121/172 (70%), Gaps = 7/172 (4%)
 Frame = +1

Query  139  LFTSTAALPSLHLRTRFSPLSVRAVYTFP-PELSGAEDDVARK------LGFEKVSEQFV  297
            +F S+     +  + RF+   +RA    P P  +     V R+       GF  V  +FV
Sbjct  29   VFRSSRCKVGVQRQVRFTVPGLRATAVMPTPTQAPVRVQVPRRELGEKAFGFTLVRSEFV  88

Query  298  DECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKY  477
             E +S   +YKH + G E++SV NDDENK FG+ FRTPP +STG+PHILEHSVLCGSRKY
Sbjct  89   PEIQSYVRVYKHDRYGTELISVVNDDENKTFGVAFRTPPSDSTGVPHILEHSVLCGSRKY  148

Query  478  PLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            P+K+PFVELLK S+NTFLNA T+PD+TCYPVASTN +DFYNLVDVYLDAVFF
Sbjct  149  PVKEPFVELLKTSMNTFLNAMTFPDKTCYPVASTNLRDFYNLVDVYLDAVFF  200



>ref|WP_022661974.1| peptidase M16 [Desulfovibrio longus]
Length=964

 Score =   197 bits (502),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = +1

Query  253  VARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGI  432
            +A+K GF  V+++ + E  SRA+LY+H +TG  ++SV N DENKVFGI FRT P +STG+
Sbjct  1    MAKKHGFTLVADREIPEMSSRALLYEHDRTGGRVLSVVNSDENKVFGISFRTTPADSTGL  60

Query  433  PHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDV  612
            PHILEHSVLCGSRKYP+++PFVELLKGSL TFLNA T+PD+TCYPVAS N +DFYNLVDV
Sbjct  61   PHILEHSVLCGSRKYPVREPFVELLKGSLQTFLNALTFPDKTCYPVASANLQDFYNLVDV  120

Query  613  YLDAVFF  633
            YLDAVFF
Sbjct  121  YLDAVFF  127



>ref|WP_006425491.1| peptidase M16 [delta proteobacterium NaphS2]
 gb|EFK05737.1| peptidase M16 inactive domain protein [delta proteobacterium 
NaphS2]
Length=977

 Score =   197 bits (500),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 88/122 (72%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
             FE + +Q + E K+ A LY+H+KTGA+I+S+  DDENKVFGI FRTPP +STG+ HILE
Sbjct  6    AFELIKKQEIAELKTEARLYRHRKTGAQILSMITDDENKVFGITFRTPPFDSTGVAHILE  65

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGS+KYP+K+PFVELLKGSL TFLNAFTYPD+TCYPVAS N +DFYNL+DVYLDAV
Sbjct  66   HSVLCGSKKYPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASQNLQDFYNLMDVYLDAV  125

Query  628  FF  633
            F+
Sbjct  126  FY  127



>gb|EMS56412.1| Presequence protease 1, chloroplastic/mitochondrial [Triticum 
urartu]
Length=974

 Score =   197 bits (500),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 90/93 (97%), Positives = 93/93 (100%), Gaps = 0/93 (0%)
 Frame = +1

Query  355  MSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLN  534
            MSV+NDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLK+PFVELLKGSL+TFLN
Sbjct  1    MSVANDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLN  60

Query  535  AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  61   AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  93



>gb|EMT26044.1| Presequence protease 1, chloroplastic/mitochondrial [Aegilops 
tauschii]
Length=961

 Score =   196 bits (499),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 90/93 (97%), Positives = 93/93 (100%), Gaps = 0/93 (0%)
 Frame = +1

Query  355  MSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLN  534
            MSV+NDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLK+PFVELLKGSL+TFLN
Sbjct  1    MSVANDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLN  60

Query  535  AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  61   AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  93



>ref|WP_035098694.1| peptidase M16 [Devosia sp. LC5]
 gb|KFC69781.1| Peptidase M16C associated domain protein [Devosia sp. LC5]
Length=968

 Score =   196 bits (499),  Expect = 3e-54, Method: Composition-based stats.
 Identities = 87/122 (71%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
             FE + ++ + E  S+  L++HKKTGAE++S+ NDDENKVFG+ F+TPP++STGI HILE
Sbjct  5    AFELIRDEHIAEVNSQVQLFRHKKTGAEVLSLVNDDENKVFGVTFKTPPQDSTGIAHILE  64

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSRKYP+KKPFVELLKGS++TFLNA T+PD+T YPVAS N KDFYNLVDVYLDAV
Sbjct  65   HSVLCGSRKYPVKKPFVELLKGSMHTFLNAMTFPDKTAYPVASQNLKDFYNLVDVYLDAV  124

Query  628  FF  633
            FF
Sbjct  125  FF  126



>ref|WP_035093689.1| peptidase M16 [Devosia sp. 17-2-E-8]
 gb|KFL26101.1| peptidase M16 [Devosia sp. 17-2-E-8]
Length=970

 Score =   196 bits (499),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = +1

Query  271  FEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEH  450
            FE + EQ + E  S A LY+HKKTGAE++S+ NDDENKVFG+  +TPP +STG+ HILEH
Sbjct  7    FELLQEQTIPEVNSLARLYRHKKTGAEVLSLVNDDENKVFGVTLKTPPSDSTGVAHILEH  66

Query  451  SVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  630
            SVLCGSRKYP+KKPFVE+LKGSL+TFLNA TYPD+T YPVAS N +DFYNLVDVYLDAVF
Sbjct  67   SVLCGSRKYPVKKPFVEMLKGSLHTFLNAMTYPDKTTYPVASQNLRDFYNLVDVYLDAVF  126



>ref|WP_035035576.1| peptidase M16 [Devosia sp. DBB001]
 emb|CDP52867.1| Peptidase M16C associated domain protein [Devosia sp. DBB001]
Length=970

 Score =   196 bits (499),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = +1

Query  271  FEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEH  450
            FE + EQ + E  S A LY+HKKTGAE++S+ NDDENKVFG+  +TPP +STG+ HILEH
Sbjct  7    FELLQEQTIPEVNSLARLYRHKKTGAEVLSLVNDDENKVFGVTLKTPPSDSTGVAHILEH  66

Query  451  SVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  630
            SVLCGSRKYP+KKPFVE+LKGSL+TFLNA TYPD+T YPVAS N +DFYNLVDVYLDAVF
Sbjct  67   SVLCGSRKYPVKKPFVEMLKGSLHTFLNAMTYPDKTTYPVASQNLRDFYNLVDVYLDAVF  126



>ref|WP_041454536.1| peptidase M16 [Anaerolinea thermophila]
Length=970

 Score =   196 bits (499),  Expect = 3e-54, Method: Composition-based stats.
 Identities = 88/121 (73%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GFE + ++ + E  SRA LY+H +TGAE++S+ NDDENKVFGI FRT P + TG+PHI+E
Sbjct  7    GFELLRDERIPEINSRARLYRHIRTGAELLSLENDDENKVFGITFRTLPMDDTGLPHIME  66

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSRKYP+K+PFVEL+KGSLNTFLNA TYPD+TCYPVAS N +DFYNLVDVYLDAV
Sbjct  67   HSVLCGSRKYPVKEPFVELMKGSLNTFLNAMTYPDKTCYPVASQNLQDFYNLVDVYLDAV  126

Query  628  F  630
            F
Sbjct  127  F  127



>ref|WP_018124477.1| hypothetical protein [Desulfovibrio oxyclinae]
Length=970

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF+KV E  + E  S A +++H+KTG  ++S+ NDDENKVFG+ FRTPPK+STG+ HILE
Sbjct  4    GFDKVREMEIKELGSVAQIWRHRKTGGRVLSMINDDENKVFGLSFRTPPKDSTGVAHILE  63

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSRKYP+K+PFVELLKGSL TFLNA T+PD+TCYPVAS N  DFYNLVDVYLDA 
Sbjct  64   HSVLCGSRKYPVKEPFVELLKGSLQTFLNALTFPDKTCYPVASANHADFYNLVDVYLDAA  123

Query  628  FF  633
            FF
Sbjct  124  FF  125



>dbj|BAJ62543.1| putative M16C family peptidase [Anaerolinea thermophila UNI-1]
Length=1007

 Score =   196 bits (499),  Expect = 4e-54, Method: Composition-based stats.
 Identities = 88/121 (73%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GFE + ++ + E  SRA LY+H +TGAE++S+ NDDENKVFGI FRT P + TG+PHI+E
Sbjct  44   GFELLRDERIPEINSRARLYRHIRTGAELLSLENDDENKVFGITFRTLPMDDTGLPHIME  103

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSRKYP+K+PFVEL+KGSLNTFLNA TYPD+TCYPVAS N +DFYNLVDVYLDAV
Sbjct  104  HSVLCGSRKYPVKEPFVELMKGSLNTFLNAMTYPDKTCYPVASQNLQDFYNLVDVYLDAV  163

Query  628  F  630
            F
Sbjct  164  F  164



>ref|WP_035086012.1| peptidase M16 [Devosia riboflavina]
 gb|KFL29675.1| peptidase M16 [Devosia riboflavina]
Length=969

 Score =   196 bits (497),  Expect = 5e-54, Method: Composition-based stats.
 Identities = 88/122 (72%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
             FE V ++ + E  S+A L++HKKTGAE++S+ NDDENKVFG+  +TPP +STGI HILE
Sbjct  6    AFELVRDESIAEINSQAQLFRHKKTGAEVLSLINDDENKVFGVTLKTPPDDSTGIAHILE  65

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSRKYP+KKPFVELLKGS++TFLNA T+PD+T YPVAS N KDFYNLVDVYLDAV
Sbjct  66   HSVLCGSRKYPVKKPFVELLKGSMHTFLNAMTFPDKTAYPVASANLKDFYNLVDVYLDAV  125

Query  628  FF  633
            FF
Sbjct  126  FF  127



>ref|WP_006562562.1| peptidase M16 [Oscillochloris trichoides]
 gb|EFO80139.1| peptidase M16C associated domain-containing protein [Oscillochloris 
trichoides DG-6]
Length=970

 Score =   196 bits (497),  Expect = 6e-54, Method: Composition-based stats.
 Identities = 87/122 (71%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF  + ++ + E  ++A +Y+H KTGAE++++SNDDENK FG+ FRTPP++STGI HILE
Sbjct  6    GFTLIRDEAIPELNTQARIYRHIKTGAELLALSNDDENKCFGVTFRTPPEDSTGIAHILE  65

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSRKYP+K+PFVELLK SL TFLNAFTY D+TCYPVASTN +DFYNLVDVYLDAV
Sbjct  66   HSVLCGSRKYPVKEPFVELLKSSLKTFLNAFTYADKTCYPVASTNLQDFYNLVDVYLDAV  125

Query  628  FF  633
            FF
Sbjct  126  FF  127



>ref|XP_005716826.1| presequence protease [Chondrus crispus]
 emb|CDF37007.1| presequence protease [Chondrus crispus]
Length=996

 Score =   196 bits (497),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF    E++V E  S   L+ H++TG E+MSVSNDDENK FG+V RTPP +STG+PHILE
Sbjct  21   GFALRREEYVKEIGSVTRLWVHQRTGTELMSVSNDDENKTFGVVLRTPPNDSTGVPHILE  80

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGS KYP+K+PFVEL+K SLNTFLNAFTYPD+TCYPVAS N +DFYNLVDVY+DAV
Sbjct  81   HSVLCGSEKYPVKEPFVELIKCSLNTFLNAFTYPDKTCYPVASCNERDFYNLVDVYMDAV  140

Query  628  F  630
            F
Sbjct  141  F  141



>ref|XP_011396191.1| Presequence protease 2, chloroplastic/mitochondrial [Auxenochlorella 
protothecoides]
 gb|KFM23321.1| Presequence protease 2, chloroplastic/mitochondrial [Auxenochlorella 
protothecoides]
Length=957

 Score =   194 bits (493),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF  V +Q++ E  S A+LY+HKKTGA++MSV N DENK FG  FRTP  +S G PHILE
Sbjct  43   GFTLVEQQYLAEYDSTALLYRHKKTGAQLMSVINKDENKTFGATFRTPVDDSKGTPHILE  102

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGS KYP+K+PFVEL+KGSLNTFLNAFTYPDRTCYPVAS N +DFYNLVDVYLD+V
Sbjct  103  HSVLCGSDKYPIKEPFVELMKGSLNTFLNAFTYPDRTCYPVASANLRDFYNLVDVYLDSV  162

Query  628  F  630
             
Sbjct  163  L  163



>ref|WP_011698518.1| peptidase M16 [Syntrophobacter fumaroxidans]
 gb|ABK17348.1| PreP peptidase. Metallo peptidase. MEROPS family M16C [Syntrophobacter 
fumaroxidans MPOB]
Length=976

 Score =   194 bits (493),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GFE + +Q+V E  +   + +H  TGA+++S+ NDDENKVFGI FRTPP++STG+ HILE
Sbjct  6    GFELLKQQYVPEISTEIKVLRHVGTGAQVLSLINDDENKVFGISFRTPPEDSTGVAHILE  65

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSRK+P+K+PFVELLKGSL TFLNAFTYPD+TCYPVAS N KDFYNL+DVYLDAV
Sbjct  66   HSVLCGSRKFPVKEPFVELLKGSLKTFLNAFTYPDKTCYPVASQNDKDFYNLIDVYLDAV  125

Query  628  F  630
            F
Sbjct  126  F  126



>ref|WP_015940539.1| peptidase M16 [Chloroflexus aggregans]
 gb|ACL24680.1| Peptidase M16C associated domain protein [Chloroflexus aggregans 
DSM 9485]
Length=969

 Score =   194 bits (492),  Expect = 3e-53, Method: Composition-based stats.
 Identities = 88/122 (72%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GFE + ++F+ E  +RA LY+H KTGAE++S+ NDDENK FGI FRTPP++STGI HILE
Sbjct  6    GFELLRDEFIPELNTRARLYRHIKTGAELLSLENDDENKCFGITFRTPPRDSTGIAHILE  65

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSRKYP+K PF  L+KGS++TFLNA TYPD+T YPVASTN KDFYNL+DVYLDAV
Sbjct  66   HSVLCGSRKYPVKDPFFTLVKGSVHTFLNAMTYPDKTTYPVASTNLKDFYNLIDVYLDAV  125

Query  628  FF  633
            FF
Sbjct  126  FF  127



>gb|EYU37693.1| hypothetical protein MIMGU_mgv1a000907mg [Erythranthe guttata]
Length=946

 Score =   193 bits (491),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/93 (96%), Positives = 92/93 (99%), Gaps = 0/93 (0%)
 Frame = +1

Query  355  MSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLN  534
            MSVSNDDENKVFGIV RTPPK+STGIPHILEHSVLCGSRKYPLK+PFVELLKGSL+TFLN
Sbjct  1    MSVSNDDENKVFGIVLRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLN  60

Query  535  AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  61   AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  93



>ref|WP_012119247.1| peptidase M16 [Roseiflexus castenholzii]
 gb|ABU56817.1| Peptidase M16C associated domain protein [Roseiflexus castenholzii 
DSM 13941]
Length=968

 Score =   193 bits (491),  Expect = 4e-53, Method: Composition-based stats.
 Identities = 92/121 (76%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GFE + EQ + E  S A  Y+H  TGAE++S+ NDDENKVFGI FRTPP +STG+ HILE
Sbjct  6    GFELLREQQIAELNSLARWYRHVATGAELLSLINDDENKVFGITFRTPPPDSTGVAHILE  65

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGS KYPLKKPFVELLKGSL TFLNA TY D+T YPVASTNTKDFYNLVDVYLDAV
Sbjct  66   HSVLCGSEKYPLKKPFVELLKGSLKTFLNAMTYSDKTVYPVASTNTKDFYNLVDVYLDAV  125

Query  628  F  630
            F
Sbjct  126  F  126



>ref|XP_008236552.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
[Prunus mume]
Length=1079

 Score =   194 bits (492),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 126/176 (72%), Gaps = 6/176 (3%)
 Frame = +1

Query  118  STFRNRLLFTSTAALPSLHLRTRFSPLSVRAV----YTFPPELSGAEDDVARKLGFEKVS  285
            S  R+ ++   +++ P  H+ T F  LS RAV     T P E    +D+V  KLGFEKV+
Sbjct  49   SLLRSHIILLPSSSHP--HVTTHFRCLSSRAVPASSDTPPSECPEVKDEVLDKLGFEKVT  106

Query  286  EQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCG  465
            E+F+ ECKS+A+L++HKKTGA+++S+SNDDE KVF I+FR P K+STGI  IL+ SV CG
Sbjct  107  EEFIGECKSKALLFRHKKTGAQVISMSNDDEQKVFSIIFRNPLKDSTGISQILQRSVYCG  166

Query  466  SRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            SRKYP+K PF E++ G+L  F   F Y DRTCY V S +TKDFYNLVD+ LDAVFF
Sbjct  167  SRKYPVKNPFEEVIGGTLGNFSEKFIYSDRTCYVVTSAHTKDFYNLVDMNLDAVFF  222



>ref|WP_015415436.1| Presequence protease 1, chloroplastic/mitochondrial [Desulfovibrio 
piezophilus]
 emb|CCH49392.1| Presequence protease 1, chloroplastic/mitochondrial [Desulfovibrio 
piezophilus C1TLV30]
Length=969

 Score =   193 bits (490),  Expect = 6e-53, Method: Composition-based stats.
 Identities = 87/121 (72%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF K+ E  + E  S A +Y+H KTGA ++SV NDDENKVFGI FRTPP++STG+ HILE
Sbjct  4    GFTKIQEMEITEMGSLAHVYRHDKTGARVLSVINDDENKVFGISFRTPPEDSTGVAHILE  63

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGS KYP+K+PFVELLKGSL TFLNA T+PD+TCYPVAS N +DFYNL+DVYLDAV
Sbjct  64   HSVLCGSDKYPIKEPFVELLKGSLQTFLNALTFPDKTCYPVASANVQDFYNLIDVYLDAV  123

Query  628  F  630
            F
Sbjct  124  F  124



>ref|WP_014323044.1| peptidase M16 [Desulfovibrio desulfuricans]
 gb|EGB15618.1| Peptidase M16C associated domain protein [Desulfovibrio desulfuricans 
ND132]
Length=969

 Score =   193 bits (490),  Expect = 6e-53, Method: Composition-based stats.
 Identities = 86/123 (70%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  265  LGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHIL  444
             GF K+ E  + E  + AV+Y+H KTGA ++S+ NDDENKVFGI FRTPP++STG+ HIL
Sbjct  3    FGFTKIREMEIAELATTAVVYRHDKTGARLLSMINDDENKVFGISFRTPPEDSTGVAHIL  62

Query  445  EHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDA  624
            EHSVLCGS KYP+K+PFVELLKGSL TFLNA T+PD+TCYPVAS N +DFYNL+DVYLDA
Sbjct  63   EHSVLCGSDKYPVKEPFVELLKGSLQTFLNALTFPDKTCYPVASANVQDFYNLIDVYLDA  122

Query  625  VFF  633
            VF+
Sbjct  123  VFY  125



>ref|XP_007200093.1| hypothetical protein PRUPE_ppa019970mg, partial [Prunus persica]
 gb|EMJ01292.1| hypothetical protein PRUPE_ppa019970mg, partial [Prunus persica]
Length=1095

 Score =   193 bits (491),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 118/158 (75%), Gaps = 4/158 (3%)
 Frame = +1

Query  172  HLRTRFSPLSVRAV----YTFPPELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKK  339
            HL T F  LS RAV     T P E S  +D+V  KLGFEKV+E+++ ECKS+A+L++HKK
Sbjct  65   HLTTHFRCLSSRAVPASSDTPPSECSEVKDEVLDKLGFEKVTEEYIGECKSKALLFRHKK  124

Query  340  TGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSL  519
            TGA+++S+SNDDE KVF I+FR P  +STGI  IL+ SV CGSRKYP+K PF E++ G+L
Sbjct  125  TGAQVISMSNDDEEKVFSIIFRNPLMDSTGISQILQRSVYCGSRKYPVKNPFEEVIGGTL  184

Query  520  NTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
              F   F Y DRTCY V ST+TKDFYNLVD+ LDAVFF
Sbjct  185  GNFSEKFIYSDRTCYVVTSTHTKDFYNLVDMNLDAVFF  222



>ref|WP_012257471.1| MULTISPECIES: peptidase M16 [Chloroflexus]
 ref|YP_001635206.1| peptidase M16C associated domain-containing protein [Chloroflexus 
aurantiacus J-10-fl]
 gb|ABY34817.1| Peptidase M16C associated domain protein [Chloroflexus aurantiacus 
J-10-fl]
 gb|ACM53146.1| Peptidase M16C associated domain protein [Chloroflexus sp. Y-400-fl]
Length=969

 Score =   192 bits (489),  Expect = 8e-53, Method: Composition-based stats.
 Identities = 88/122 (72%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GFE + ++F+ E  +RA LY+H KTGAE++S+ NDDENK FGI FRTPP++STGI HILE
Sbjct  6    GFELLRDEFIPELNTRARLYRHIKTGAELLSLENDDENKCFGITFRTPPRDSTGIAHILE  65

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSRKYP+K PF  L+KGS++TFLNA T+PD+T YPVASTN KDFYNLVDVYLDAV
Sbjct  66   HSVLCGSRKYPVKDPFFTLVKGSVHTFLNAITFPDKTAYPVASTNLKDFYNLVDVYLDAV  125

Query  628  FF  633
            FF
Sbjct  126  FF  127



>ref|WP_031458128.1| peptidase M16 [Chloroflexus sp. MS-G]
Length=969

 Score =   192 bits (488),  Expect = 9e-53, Method: Composition-based stats.
 Identities = 87/122 (71%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GFE + ++F+ E  +RA LY+H KTGAE++S+ NDDENK FGI FRTPP++STG+ HILE
Sbjct  6    GFELLRDEFIPELNTRARLYRHIKTGAEVLSLENDDENKCFGITFRTPPRDSTGVAHILE  65

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSRKYP+K PF  L+KGS++TFLNA T+PD+T YPVASTN KDFYNLVDVYLDAV
Sbjct  66   HSVLCGSRKYPVKDPFFTLVKGSVHTFLNAITFPDKTSYPVASTNLKDFYNLVDVYLDAV  125

Query  628  FF  633
            FF
Sbjct  126  FF  127



>ref|WP_028458346.1| peptidase M16 [Chloroflexus sp. Y-396-1]
Length=969

 Score =   192 bits (488),  Expect = 9e-53, Method: Composition-based stats.
 Identities = 87/122 (71%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GFE + ++F+ E  +RA LY+H KTGAE++S+ NDDENK FGI FRTPP++STG+ HILE
Sbjct  6    GFELLRDEFIPELNTRARLYRHIKTGAEVLSLENDDENKCFGITFRTPPRDSTGVAHILE  65

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSRKYP+K PF  L+KGS++TFLNA T+PD+T YPVASTN KDFYNLVDVYLDAV
Sbjct  66   HSVLCGSRKYPVKDPFFTLVKGSVHTFLNAITFPDKTSYPVASTNLKDFYNLVDVYLDAV  125

Query  628  FF  633
            FF
Sbjct  126  FF  127



>ref|WP_011954953.1| peptidase M16 [Roseiflexus sp. RS-1]
 gb|ABQ88594.1| Peptidase M16C associated domain protein [Roseiflexus sp. RS-1]
Length=968

 Score =   192 bits (487),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 90/121 (74%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GFE + EQ + E  + A LY+H  TGAE++S+ NDDENKVFGI FRTPP +STG+ HILE
Sbjct  6    GFELLREQQISELNTLARLYRHVATGAELLSLINDDENKVFGITFRTPPPDSTGVAHILE  65

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGS KYPLKKPFVELLKGSL TFLNA T+ D+T YPVASTNTKDFYNL+DVYLDAV
Sbjct  66   HSVLCGSEKYPLKKPFVELLKGSLKTFLNAITFSDKTVYPVASTNTKDFYNLIDVYLDAV  125

Query  628  F  630
            F
Sbjct  126  F  126



>gb|ADU64271.1| Peptidase M16C associated domain protein [Desulfovibrio aespoeensis 
Aspo-2]
Length=969

 Score =   192 bits (487),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 86/122 (70%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF K+ E  + E  + A LY+H KTGA ++S+ NDDENKVFGI FRTPP++STG+ HILE
Sbjct  4    GFTKIRELEIAEMAAFAHLYRHDKTGARVLSIVNDDENKVFGISFRTPPEDSTGVAHILE  63

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGS KYP+++PFVELLKGSL TFLNA T+PD+TCYPVAS N  DFYNLVDVYLDAV
Sbjct  64   HSVLCGSEKYPVREPFVELLKGSLQTFLNALTFPDKTCYPVASANVSDFYNLVDVYLDAV  123

Query  628  FF  633
            F+
Sbjct  124  FY  125



>ref|WP_041271892.1| peptidase M16 [Desulfovibrio aespoeensis]
Length=970

 Score =   192 bits (487),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 86/122 (70%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF K+ E  + E  + A LY+H KTGA ++S+ NDDENKVFGI FRTPP++STG+ HILE
Sbjct  5    GFTKIRELEIAEMAAFAHLYRHDKTGARVLSIVNDDENKVFGISFRTPPEDSTGVAHILE  64

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGS KYP+++PFVELLKGSL TFLNA T+PD+TCYPVAS N  DFYNLVDVYLDAV
Sbjct  65   HSVLCGSEKYPVREPFVELLKGSLQTFLNALTFPDKTCYPVASANVSDFYNLVDVYLDAV  124

Query  628  FF  633
            F+
Sbjct  125  FY  126



>ref|WP_005986746.1| pre-sequence protease [Desulfovibrio africanus]
 gb|EMG37176.1| pre-sequence protease [Desulfovibrio africanus PCS]
Length=968

 Score =   192 bits (487),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 91/121 (75%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF    E  V E  S   LY+H+KTGA +MSV   DENKVFGI FRTPPK+STG+ HILE
Sbjct  8    GFRLEREAEVAEISSTVRLYRHEKTGARLMSVIAPDENKVFGISFRTPPKDSTGVAHILE  67

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGS KYP+K+PFVELLKGSL TFLNAFTYPD+TCYPVASTN +DFYNLVDVYLDAV
Sbjct  68   HSVLCGSDKYPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASTNVRDFYNLVDVYLDAV  127

Query  628  F  630
            F
Sbjct  128  F  128



>dbj|GAK55491.1| PreP peptidase [bacterium UASB270]
Length=972

 Score =   192 bits (487),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 86/122 (70%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF+ V+E+ + E ++ A L+ H KTGAE+ S+ NDDENKVFGI FRTPP +STG+PHI+E
Sbjct  6    GFKLVAERDILEIQTHARLFCHVKTGAELFSLENDDENKVFGITFRTPPTDSTGLPHIME  65

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSRKYP+K+PFVEL+KGSLNTFLNA T+PD+T YPVAS N KD YNL+DVYLDAV
Sbjct  66   HSVLCGSRKYPVKEPFVELMKGSLNTFLNAMTFPDKTSYPVASQNVKDLYNLIDVYLDAV  125

Query  628  FF  633
            F+
Sbjct  126  FY  127



>gb|EPS67763.1| hypothetical protein M569_07010, partial [Genlisea aurea]
Length=947

 Score =   191 bits (486),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/93 (94%), Positives = 93/93 (100%), Gaps = 0/93 (0%)
 Frame = +1

Query  355  MSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLN  534
            MS+SNDDENKVFG+VFRTPPK+STGIPHILEHSVLCGSRKYPLK+PFVELLKGSL+TFLN
Sbjct  1    MSLSNDDENKVFGVVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLN  60

Query  535  AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF+
Sbjct  61   AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFY  93



>ref|WP_012612497.1| peptidase M16 [Desulfovibrio vulgaris]
 gb|ACL08314.1| Peptidase M16C associated domain protein [Desulfovibrio vulgaris 
str. 'Miyazaki F']
Length=968

 Score =   191 bits (486),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 87/122 (71%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF+ V E+ V E  SR  L++H  TGA+++S  N DENKVFG+ FRTPP +STG+ HILE
Sbjct  5    GFDLVFERTVHELNSRIRLWRHDATGAQLLSCCNADENKVFGVTFRTPPSDSTGVAHILE  64

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGS KYP+K+PFVELLKGSL TFLNAFTYPD+TCYPVAS N +DF NLVDVYLDAV
Sbjct  65   HSVLCGSEKYPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASANLQDFRNLVDVYLDAV  124

Query  628  FF  633
            FF
Sbjct  125  FF  126



>ref|WP_014258900.1| peptidase M16 [Desulfovibrio africanus]
 gb|EGJ49064.1| Peptidase M16C associated domain protein [Desulfovibrio africanus 
str. Walvis Bay]
Length=968

 Score =   191 bits (486),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 91/121 (75%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF    E  V E  S   LY+H+KTGA +MSV   DENKVFGI FRTPPK+STG+ HILE
Sbjct  8    GFRLEREAEVAEISSTVRLYRHEKTGARLMSVIAPDENKVFGISFRTPPKDSTGVAHILE  67

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGS KYP+K+PFVELLKGSL TFLNAFTYPD+TCYPVASTN +DFYNLVDVYLDAV
Sbjct  68   HSVLCGSDKYPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASTNVRDFYNLVDVYLDAV  127

Query  628  F  630
            F
Sbjct  128  F  128



>ref|XP_002290387.1| hypothetical protein THAPSDRAFT_22863 [Thalassiosira pseudonana 
CCMP1335]
 gb|EED92139.1| hypothetical protein THAPSDRAFT_22863 [Thalassiosira pseudonana 
CCMP1335]
Length=1186

 Score =   192 bits (488),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GFE +S   V+E  +   LY+HKK+GAE++SV+ DD+NK FGI FRTPP +STG+PHILE
Sbjct  177  GFEVISTDVVNEFGAYCTLYRHKKSGAELLSVATDDDNKCFGITFRTPPSDSTGVPHILE  236

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSRKY  K PFV+LL+GSL TFLNAFTYPDRTCY VAS NTKDFYNL++VY DAV
Sbjct  237  HSVLCGSRKYKTKDPFVQLLQGSLQTFLNAFTYPDRTCYVVASQNTKDFYNLINVYSDAV  296

Query  628  F  630
            F
Sbjct  297  F  297



>ref|WP_035066446.1| peptidase M16 [Desulfovibrio termitidis]
Length=971

 Score =   191 bits (486),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 87/122 (71%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF+ V E+ V E  SR  L++H  TGA+++S  N DENKVFG+ FRTPP +STG+ HILE
Sbjct  5    GFDLVFERTVHELNSRIRLWRHGATGAQLLSCCNADENKVFGVTFRTPPSDSTGVAHILE  64

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGS KYP+K+PFVELLKGSL TFLNAFTYPD+TCYPVAS N +DF NLVDVYLDAV
Sbjct  65   HSVLCGSEKYPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASANLQDFRNLVDVYLDAV  124

Query  628  FF  633
            FF
Sbjct  125  FF  126



>ref|WP_027366525.1| peptidase M16 [Desulfovibrio africanus]
Length=968

 Score =   191 bits (485),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 91/121 (75%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF    E  V E  S   LY+H KTGA +MSV   DENKVFGI FRTPPK+STG+ HILE
Sbjct  8    GFRLEREAEVAEISSTVRLYRHDKTGARLMSVIAPDENKVFGISFRTPPKDSTGVAHILE  67

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGS KYP+K+PFVELLKGSL TFLNAFTYPD+TCYPVASTN +DFYNLVDVYLDAV
Sbjct  68   HSVLCGSDKYPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASTNVRDFYNLVDVYLDAV  127

Query  628  F  630
            F
Sbjct  128  F  128



>ref|WP_035042323.1| peptidase M16 [Desulfovibrio sp. X2]
Length=967

 Score =   191 bits (484),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 88/122 (72%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF  + E+ V E +S A +Y+H  TGA ++SV   DENKVFGI FRTPP++STG+ HILE
Sbjct  5    GFTLLREENVPEIQSTARIYRHDATGARLLSVIAPDENKVFGIAFRTPPRDSTGVAHILE  64

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSRKYP+K+PFVELLKGSL TFLNAFTYPD+TCYPVAS N +DFYNLVDVYLDAV
Sbjct  65   HSVLCGSRKYPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASANLQDFYNLVDVYLDAV  124

Query  628  FF  633
            F+
Sbjct  125  FY  126



>gb|EPR39784.1| Peptidase M16C associated domain protein [Desulfovibrio sp. X2]
Length=966

 Score =   191 bits (484),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 88/122 (72%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF  + E+ V E +S A +Y+H  TGA ++SV   DENKVFGI FRTPP++STG+ HILE
Sbjct  4    GFTLLREENVPEIQSTARIYRHDATGARLLSVIAPDENKVFGIAFRTPPRDSTGVAHILE  63

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSRKYP+K+PFVELLKGSL TFLNAFTYPD+TCYPVAS N +DFYNLVDVYLDAV
Sbjct  64   HSVLCGSRKYPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASANLQDFYNLVDVYLDAV  123

Query  628  FF  633
            F+
Sbjct  124  FY  125



>ref|WP_029435916.1| peptidase M16 [Bilophila wadsworthia]
Length=965

 Score =   190 bits (483),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 85/122 (70%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF  V E+ + E      L++H  TGAE++S+ N+DENK FG  FRTPPK+STG+ HILE
Sbjct  5    GFSLVREERLSEVSGTVKLWRHDATGAELLSIVNNDENKCFGATFRTPPKDSTGVAHILE  64

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGS KYP+K+PFVELLKGSL TFLNAFT+PD+TCYPVAS N +DFYNLVDVYLDAV
Sbjct  65   HSVLCGSEKYPVKEPFVELLKGSLQTFLNAFTFPDKTCYPVASANLQDFYNLVDVYLDAV  124

Query  628  FF  633
            FF
Sbjct  125  FF  126



>ref|WP_005028290.1| peptidase M16 [Bilophila wadsworthia]
 gb|EFV43748.1| hypothetical protein HMPREF0179_02440 [Bilophila wadsworthia 
3_1_6]
Length=965

 Score =   190 bits (483),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 85/122 (70%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF  V E+ + E      L++H  TGAE++S+ N+DENK FG  FRTPPK+STG+ HILE
Sbjct  5    GFSLVREERLSEVSGTVKLWRHDATGAELLSIVNNDENKCFGATFRTPPKDSTGVAHILE  64

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGS KYP+K+PFVELLKGSL TFLNAFT+PD+TCYPVAS N +DFYNLVDVYLDAV
Sbjct  65   HSVLCGSEKYPVKEPFVELLKGSLQTFLNAFTFPDKTCYPVASANLQDFYNLVDVYLDAV  124

Query  628  FF  633
            FF
Sbjct  125  FF  126



>ref|WP_009380390.1| peptidase M16 [Bilophila sp. 4_1_30]
 gb|EGW45410.1| hypothetical protein HMPREF0178_01889 [Bilophila sp. 4_1_30]
Length=965

 Score =   190 bits (483),  Expect = 5e-52, Method: Composition-based stats.
 Identities = 85/122 (70%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF  V E+ + E      L++H  TGAE++S+ N+DENK FG  FRTPPK+STG+ HILE
Sbjct  5    GFSLVREERLSEVSGTVKLWRHDATGAELLSIVNNDENKCFGATFRTPPKDSTGVAHILE  64

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGS KYP+K+PFVELLKGSL TFLNAFT+PD+TCYPVAS N +DFYNLVDVYLDAV
Sbjct  65   HSVLCGSEKYPVKEPFVELLKGSLQTFLNAFTFPDKTCYPVASANLQDFYNLVDVYLDAV  124

Query  628  FF  633
            FF
Sbjct  125  FF  126



>ref|WP_012765630.1| peptidase M16 [Desulfovibrio salexigens]
 gb|ACS78104.1| Peptidase M16C associated domain protein [Desulfovibrio salexigens 
DSM 2638]
Length=961

 Score =   190 bits (482),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF+++S ++++E    AV+Y+H+KTG  ++SV N+DENK FGI FRTPP+NSTG+PHILE
Sbjct  6    GFKEISREYLNELNGEAVIYEHEKTGGRVLSVINNDENKTFGISFRTPPENSTGLPHILE  65

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGS+KYP+K+PFVELLK SL TFLNA TYPD+T YPVAS N +DF NLV VYLDAV
Sbjct  66   HSVLCGSKKYPVKEPFVELLKCSLQTFLNAMTYPDKTVYPVASPNEQDFRNLVGVYLDAV  125

Query  628  FF  633
            FF
Sbjct  126  FF  127



>ref|WP_028319851.1| peptidase M16 [Desulfatiglans anilini]
Length=972

 Score =   190 bits (482),  Expect = 7e-52, Method: Composition-based stats.
 Identities = 86/121 (71%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GFE + E+ + E K+   +Y+H +TGA+++ + N+DENKVFGI FRTPP +STG+PHILE
Sbjct  6    GFELIHERDIHEIKTHGRMYEHTRTGAKLLYLLNEDENKVFGITFRTPPADSTGLPHILE  65

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSRKYPLK+PFVELLKGSL TFLNAFTYPDRTCYPVAS N +DF NL+DVYLDAV
Sbjct  66   HSVLCGSRKYPLKEPFVELLKGSLQTFLNAFTYPDRTCYPVASQNRQDFLNLIDVYLDAV  125

Query  628  F  630
             
Sbjct  126  L  126



>ref|WP_015335587.1| Presequence protease 1, chloroplastic/mitochondrial [Desulfovibrio 
hydrothermalis]
 ref|YP_007325083.1| Presequence protease 1, chloroplastic/mitochondrial [Desulfovibrio 
hydrothermalis AM13 = DSM 14728]
 ref|YP_008683882.1| Presequence protease 1, chloroplastic/mitochondrial [Desulfovibrio 
hydrothermalis]
 emb|CCO22982.1| Presequence protease 1, chloroplastic/mitochondrial [Desulfovibrio 
hydrothermalis AM13 = DSM 14728]
 emb|CCN98975.1| Presequence protease 1, chloroplastic/mitochondrial [Desulfovibrio 
hydrothermalis]
Length=961

 Score =   190 bits (482),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF+++S +++ E    AV+Y+H+KTG  ++SV N+DENK FGI FRTPP+NSTG+PHILE
Sbjct  6    GFKEISREYLTELNGEAVIYEHEKTGGRVLSVINNDENKTFGISFRTPPENSTGLPHILE  65

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSRKYP+K+PFVELLK SL TFLNA TYPD+T YPVAS N +DF NLV VYLDAV
Sbjct  66   HSVLCGSRKYPVKEPFVELLKCSLQTFLNAMTYPDKTVYPVASPNEQDFRNLVGVYLDAV  125

Query  628  FF  633
            FF
Sbjct  126  FF  127



>dbj|GAK53338.1| peptidase M16C associated domain protein [bacterium UASB14]
Length=972

 Score =   189 bits (481),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 82/122 (67%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF  + +Q + E  +RA L++H K+GAE++SV N DENK FGI FRTPP +STG+ HI+E
Sbjct  6    GFTLIKDQTIPELNARAKLFRHDKSGAELLSVENSDENKAFGISFRTPPADSTGVAHIME  65

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSRKYP+K+PFVEL+KGSLNTFLNA T+PD+T YPVAS N KD Y+L+DVYLDAV
Sbjct  66   HSVLCGSRKYPVKEPFVELMKGSLNTFLNAMTFPDKTSYPVASQNVKDLYHLIDVYLDAV  125

Query  628  FF  633
            F+
Sbjct  126  FY  127



>ref|WP_010938240.1| peptidase M16 [Desulfovibrio vulgaris]
 ref|YP_010162.1| M16 family peptidase [Desulfovibrio vulgaris str. Hildenborough]
 gb|AAS95421.1| peptidase, M16 family [Desulfovibrio vulgaris str. Hildenborough]
 gb|ADP86034.1| Peptidase M16C associated domain protein [Desulfovibrio vulgaris 
RCH1]
Length=964

 Score =   189 bits (480),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 85/122 (70%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GFE + E  ++E  SR   ++H  TGA+++S  N DENKVFG+ FRTPP +STG+ HILE
Sbjct  5    GFELIDETNLEELSSRVRRWRHVVTGAQLLSFCNADENKVFGVSFRTPPGDSTGVAHILE  64

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGS +YP+K+PFVELLKGSL TFLNAFTYPD+TCYPVASTN +DF NLVDVYLDAV
Sbjct  65   HSVLCGSERYPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASTNLQDFRNLVDVYLDAV  124

Query  628  FF  633
            FF
Sbjct  125  FF  126



>ref|WP_027185458.1| hypothetical protein [Desulfovibrio inopinatus]
Length=965

 Score =   189 bits (479),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 84/122 (69%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            G+E + ++ + E  + A+  +H  TGAEI+S+   DENKVFG+ F+TPP +STG+ HILE
Sbjct  6    GYEVIRQEHIAEYAADALYCRHIVTGAEILSIQCADENKVFGVSFKTPPSDSTGVAHILE  65

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSRKYP+K+PFVELLKGSLNTFLNAFTYPD+TCYPVAS N +DFYNL+DVYLDAV
Sbjct  66   HSVLCGSRKYPVKEPFVELLKGSLNTFLNAFTYPDKTCYPVASANEEDFYNLIDVYLDAV  125

Query  628  FF  633
            FF
Sbjct  126  FF  127



>ref|WP_011792619.1| peptidase M16 [Desulfovibrio vulgaris]
 gb|ABM29060.1| pre-sequence protease, Metallo peptidase, MEROPS family M16C 
[Desulfovibrio vulgaris DP4]
Length=964

 Score =   189 bits (479),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 85/122 (70%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GFE + E  ++E  SR   ++H  TGA+++S  N DENKVFG+ FRTPP +STG+ HILE
Sbjct  5    GFELIDETNLEELSSRVRRWRHVVTGAQLLSFCNADENKVFGVSFRTPPGDSTGVAHILE  64

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGS +YP+K+PFVELLKGSL TFLNAFTYPD+TCYPVASTN +DF NLVDVYLDAV
Sbjct  65   HSVLCGSERYPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASTNLQDFRNLVDVYLDAV  124

Query  628  FF  633
            FF
Sbjct  125  FF  126



>ref|WP_006007833.1| peptidase M16 [Desulfovibrio piger]
 gb|EEB32816.1| peptidase M16 inactive domain protein [Desulfovibrio piger ATCC 
29098]
Length=971

 Score =   188 bits (478),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 85/121 (70%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GFE V+E+ + E    A L+KH  TGA+++SVSN DENK FG+ FRTPP +STG+ HILE
Sbjct  5    GFELVTERRLHEVGGTARLWKHSVTGAQLLSVSNADENKCFGVSFRTPPTDSTGVAHILE  64

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGS KYP+K+PFVELLKGSL TFLNAFT+PD+TCYPVAS N +DFYNL+DVY+DAV
Sbjct  65   HSVLCGSDKYPVKEPFVELLKGSLQTFLNAFTFPDKTCYPVASANLQDFYNLIDVYIDAV  124

Query  628  F  630
            F
Sbjct  125  F  125



>ref|WP_007523808.1| peptidase M16 [Desulfovibrio sp. A2]
 gb|EGY26196.1| presequence protease 1 [Desulfovibrio sp. A2]
Length=968

 Score =   188 bits (477),  Expect = 3e-51, Method: Composition-based stats.
 Identities = 86/122 (70%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF+ V E+ V E  SR  L++H  T A+++S  N DENKVFG+ FRTPP +STG+ HILE
Sbjct  5    GFDLVFERTVHELNSRIRLWRHGATSAQLLSCCNADENKVFGVTFRTPPADSTGVAHILE  64

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGS KYP+K+PFVELLKGSL TFLNAFTYPD+TCYPVAS N +DF NLVDVYLDAV
Sbjct  65   HSVLCGSEKYPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASANLQDFRNLVDVYLDAV  124

Query  628  FF  633
            FF
Sbjct  125  FF  126



>ref|XP_005761276.1| peptidase M16 [Emiliania huxleyi CCMP1516]
 gb|EOD08847.1| peptidase M16 [Emiliania huxleyi CCMP1516]
Length=1043

 Score =   188 bits (477),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 98/121 (81%), Gaps = 0/121 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
             FE V  + VDE   +   Y+H+++GAE++S   DDENKVFGI FRTP ++STG+PHILE
Sbjct  68   AFELVRVEMVDEYTIKVATYRHRQSGAEVISAQADDENKVFGIAFRTPVEDSTGVPHILE  127

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGS KY  K+PF ELLKGSL TFLNAFTYPDRTCYPVAS NTKDFYNLV+VYLDAV
Sbjct  128  HSVLCGSAKYTSKEPFTELLKGSLQTFLNAFTYPDRTCYPVASCNTKDFYNLVNVYLDAV  187

Query  628  F  630
             
Sbjct  188  L  188



>ref|WP_027720526.1| peptidase M16 [Desulfovibrio zosterae]
Length=961

 Score =   187 bits (476),  Expect = 5e-51, Method: Composition-based stats.
 Identities = 85/122 (70%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF ++S +++ E    AV+YKH KTG  ++S+ N+DENK FGI FRTPP+NSTG+PHILE
Sbjct  6    GFIEISREYLTELNGEAVIYKHAKTGGRLLSIINNDENKTFGISFRTPPENSTGLPHILE  65

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSRKYP+K+PFVELLK SL TFLNA TYPD+T YPVAS N +DF NLV VYLDAV
Sbjct  66   HSVLCGSRKYPVKEPFVELLKCSLQTFLNAMTYPDKTVYPVASPNEQDFRNLVGVYLDAV  125

Query  628  FF  633
            FF
Sbjct  126  FF  127



>ref|XP_005706792.1| Zn-dependent peptidase [Galdieria sulphuraria]
 gb|EME30272.1| Zn-dependent peptidase [Galdieria sulphuraria]
Length=1090

 Score =   188 bits (477),  Expect = 6e-51, Method: Composition-based stats.
 Identities = 85/121 (70%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +1

Query  271  FEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEH  450
            F+ V E+++ +  S    Y H  TGA++MSV N +ENK FG+VFRTPP NS G PHILEH
Sbjct  111  FQLVQEEYIPDIDSIIRKYVHTHTGAQLMSVLNKEENKTFGVVFRTPPSNSRGTPHILEH  170

Query  451  SVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  630
            SVLCGSRKYP+K+PFVEL+K SLNTFLNAFT+PD+TCYPVAS N KDFYNLVDVYLDAVF
Sbjct  171  SVLCGSRKYPVKEPFVELMKSSLNTFLNAFTFPDKTCYPVASCNLKDFYNLVDVYLDAVF  230

Query  631  F  633
            +
Sbjct  231  Y  231



>ref|WP_033333819.1| hypothetical protein, partial [Nitrospina sp. AB-629-B06]
Length=162

 Score =   173 bits (439),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = +1

Query  271  FEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEH  450
            F+ +  + + E  S A+L+ H KTGAE++ + NDD+NKVF   F+TPP N  G+ HILEH
Sbjct  12   FQLLQRESISELNSLALLFTHLKTGAEVLVIENDDDNKVFSATFKTPPSNDRGVAHILEH  71

Query  451  SVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  630
            SVLCGSRKYP+K+PF+ELLKGSL TFLNA T+PD+T YPVAS N KDF+NL+DVYLDAVF
Sbjct  72   SVLCGSRKYPVKEPFLELLKGSLQTFLNAMTFPDKTMYPVASRNKKDFFNLMDVYLDAVF  131

Query  631  F  633
            +
Sbjct  132  Y  132



>ref|WP_012623989.1| peptidase M16 [Desulfovibrio desulfuricans]
 gb|ACL48259.1| Peptidase M16C associated domain protein [Desulfovibrio desulfuricans 
subsp. desulfuricans str. ATCC 27774]
Length=970

 Score =   187 bits (474),  Expect = 8e-51, Method: Composition-based stats.
 Identities = 82/121 (68%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF  ++EQ + E    A L++H+ TGA+++S+SN DENK FG+ FRTPP +STG+ HILE
Sbjct  5    GFTLITEQQLREVDGTARLWRHEATGAQMLSISNTDENKCFGVSFRTPPTDSTGVAHILE  64

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGS KYP+K+PFVELLKGSL TFLNAFT+PD+TCYPVAS N +DFYNL+DVY+DAV
Sbjct  65   HSVLCGSDKYPVKEPFVELLKGSLQTFLNAFTFPDKTCYPVASCNLRDFYNLIDVYIDAV  124

Query  628  F  630
            F
Sbjct  125  F  125



>ref|WP_025577207.1| peptidase M16 [Blautia wexlerae]
Length=974

 Score =   187 bits (474),  Expect = 8e-51, Method: Composition-based stats.
 Identities = 84/122 (69%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
             +E V+E+ + +  S   L +HKKTGA +M + NDDENKVF I FRTPPK+STG+ HILE
Sbjct  8    AYEVVTEENLTDIHSTGWLLRHKKTGARVMLIENDDENKVFNIAFRTPPKDSTGVAHILE  67

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSR++PLK PFVEL+KGSLNTFLNA TYPD+TCYPVAS N KDF NL+ VYLDAV
Sbjct  68   HSVLCGSREFPLKDPFVELVKGSLNTFLNAMTYPDKTCYPVASCNDKDFQNLMHVYLDAV  127

Query  628  FF  633
            F+
Sbjct  128  FY  129



>ref|WP_026649281.1| peptidase M16 [Blautia wexlerae]
Length=974

 Score =   187 bits (474),  Expect = 9e-51, Method: Composition-based stats.
 Identities = 84/122 (69%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
             +E V+E+ + +  S   L +HKKTGA +M + NDDENKVF I FRTPPK+STG+ HILE
Sbjct  8    AYEVVTEENLTDIHSTGWLLRHKKTGARVMLIENDDENKVFNIAFRTPPKDSTGVAHILE  67

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSR++PLK PFVEL+KGSLNTFLNA TYPD+TCYPVAS N KDF NL+ VYLDAV
Sbjct  68   HSVLCGSREFPLKDPFVELVKGSLNTFLNAMTYPDKTCYPVASCNDKDFQNLMHVYLDAV  127

Query  628  FF  633
            F+
Sbjct  128  FY  129



>ref|WP_020993684.1| MULTISPECIES: hypothetical protein [Ruminococcus]
 emb|CDD77514.1| putative uncharacterized protein [Ruminococcus sp. CAG:9]
 gb|EES75839.2| hypothetical protein RSAG_03026 [Ruminococcus sp. 5_1_39BFAA]
Length=974

 Score =   187 bits (474),  Expect = 9e-51, Method: Composition-based stats.
 Identities = 84/122 (69%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
             +E V+E+ + +  S   L +HKKTGA +M + NDDENKVF I FRTPPK+STG+ HILE
Sbjct  8    AYEVVTEENLTDIHSTGWLLRHKKTGARVMLIENDDENKVFNIAFRTPPKDSTGVAHILE  67

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSR++PLK PFVEL+KGSLNTFLNA TYPD+TCYPVAS N KDF NL+ VYLDAV
Sbjct  68   HSVLCGSREFPLKDPFVELVKGSLNTFLNAMTYPDKTCYPVASCNDKDFQNLMHVYLDAV  127

Query  628  FF  633
            F+
Sbjct  128  FY  129



>ref|WP_027178402.1| peptidase M16 [Desulfovibrio bastinii]
Length=960

 Score =   187 bits (474),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF++VS + + E    AV+Y+H KTG  ++S+ N DENK FGI FRTPP+NSTG+ HILE
Sbjct  6    GFKEVSREKLAEVGGDAVVYEHIKTGGRVLSIINADENKTFGISFRTPPENSTGLAHILE  65

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSRKYP+K+PFVELLKGSL TFLNA T+PD+T YPVAS N +DFYNLVDVYLDAV
Sbjct  66   HSVLCGSRKYPVKEPFVELLKGSLQTFLNAMTFPDKTVYPVASPNVQDFYNLVDVYLDAV  125

Query  628  F  630
            F
Sbjct  126  F  126



>ref|XP_005782033.1| peptidase M16 [Emiliania huxleyi CCMP1516]
 gb|EOD29604.1| peptidase M16 [Emiliania huxleyi CCMP1516]
Length=1096

 Score =   187 bits (476),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 98/121 (81%), Gaps = 0/121 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
             FE V  + VDE   +   Y+H+++GAE++S   DDENKVFGI FRTP ++STG+PHILE
Sbjct  68   AFELVRVEMVDEYTIKVATYRHRQSGAEVISAQADDENKVFGIAFRTPVEDSTGVPHILE  127

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGS KY  K+PF ELLKGSL TFLNAFTYPDRTCYPVAS NTKDFYNLV+VYLDAV
Sbjct  128  HSVLCGSAKYTSKEPFTELLKGSLQTFLNAFTYPDRTCYPVASCNTKDFYNLVNVYLDAV  187

Query  628  F  630
             
Sbjct  188  L  188



>ref|WP_043643858.1| peptidase M16 [Desulfovibrio putealis]
Length=969

 Score =   187 bits (474),  Expect = 9e-51, Method: Composition-based stats.
 Identities = 84/127 (66%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +1

Query  253  VARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGI  432
            ++ K GF  + E  ++E   +A LY+H++TGAE++S+ + D+NKVFG   RTPP +STG+
Sbjct  1    MSAKHGFSLIHEGPIEEYAIQARLYRHERTGAELLSIISPDDNKVFGAALRTPPTDSTGL  60

Query  433  PHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDV  612
            PHILEHSVLCGSR+YP+K+PFVELLK SL TFLNAFTYPD+TCYPVAS N  DFYNLVDV
Sbjct  61   PHILEHSVLCGSRRYPVKEPFVELLKSSLQTFLNAFTYPDKTCYPVASANLADFYNLVDV  120

Query  613  YLDAVFF  633
            YLDAVF+
Sbjct  121  YLDAVFY  127



>ref|WP_014431903.1| peptidase M16 [Caldilinea aerophila]
 dbj|BAL98662.1| peptidase M16 family protein [Caldilinea aerophila DSM 14535 
= NBRC 104270]
Length=973

 Score =   187 bits (474),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 85/121 (70%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GFE + ++ + E K+RA LY+H KTGA+++S+ NDDENKVFG+ FRT P++STG+ HILE
Sbjct  8    GFELIRDEIIAELKTRARLYRHVKTGAQLLSLENDDENKVFGVSFRTLPEDSTGVAHILE  67

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            H+VL GSRKYPLK+PFV+L+KGSL+TFLNAFT PD+T YPVASTN KDFYNLV+VYLDAV
Sbjct  68   HAVLGGSRKYPLKEPFVQLIKGSLHTFLNAFTSPDKTTYPVASTNLKDFYNLVEVYLDAV  127

Query  628  F  630
            F
Sbjct  128  F  128



>ref|XP_002177646.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC50460.1| predicted protein, partial [Phaeodactylum tricornutum CCAP 1055/1]
Length=986

 Score =   186 bits (473),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 84/120 (70%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = +1

Query  271  FEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEH  450
            ++ V +  VDE  +   LY+HKK+GAE++SV+ DD+NKVFGI FRTPP++STG+PHILEH
Sbjct  1    YDVVEKDVVDEYGAYCTLYRHKKSGAELLSVAVDDDNKVFGITFRTPPEDSTGVPHILEH  60

Query  451  SVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  630
            SVLCGSRKY  K PFV+LL+GSL TFLNAFTYPDRTCY VAS NTKDFYNL++VY DAV+
Sbjct  61   SVLCGSRKYKTKDPFVQLLQGSLQTFLNAFTYPDRTCYVVASQNTKDFYNLINVYADAVY  120



>ref|WP_021760305.1| putative peptidase M16C [Desulfovibrio gigas]
 gb|AGW13456.1| putative peptidase M16C [Desulfovibrio gigas DSM 1382 = ATCC 
19364]
Length=987

 Score =   186 bits (473),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 84/122 (69%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF    E  + E  +   L++H+KTGA  +S+ N D+NKVF + FRTPPK+STG+ HILE
Sbjct  9    GFVLEREATLQEYHTVVHLWRHQKTGARYLSLCNKDDNKVFAVTFRTPPKDSTGVAHILE  68

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSRKYP+K+PFVEL+KGSL TFLNAFTYPD+TCYPVAST+ KDFYNL+DVYLDAV
Sbjct  69   HSVLCGSRKYPVKEPFVELMKGSLQTFLNAFTYPDKTCYPVASTHAKDFYNLMDVYLDAV  128

Query  628  FF  633
            FF
Sbjct  129  FF  130



>ref|WP_027187627.1| peptidase M16 [Desulfovibrio cuneatus]
Length=964

 Score =   186 bits (472),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 85/122 (70%), Positives = 99/122 (81%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF  V E  + E  S A L++H+KT A ++S +N DENKVFG+ FRTPP +STG+ HILE
Sbjct  6    GFSLVEETHIAELDSTARLWRHEKTQAVLLSFTNTDENKVFGVSFRTPPPDSTGVAHILE  65

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGS KYP+K+PFVELLKGSL TFLNAFTYPD+TCYPVAS N +DF NL DVYLDAV
Sbjct  66   HSVLCGSEKYPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASCNLRDFRNLTDVYLDAV  125

Query  628  FF  633
            FF
Sbjct  126  FF  127



>ref|WP_028573857.1| peptidase M16 [Desulfonatronovibrio hydrogenovorans]
Length=971

 Score =   186 bits (471),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 83/118 (70%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +1

Query  280  VSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVL  459
            + E+ + E  SRA L++HKKTGA ++S++N DENKVF I FRTPPK++TG+PHILEHSVL
Sbjct  10   IEERDISEINSRARLFEHKKTGARVLSLTNQDENKVFSINFRTPPKDNTGVPHILEHSVL  69

Query  460  CGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            CGSRKY +K+PFVELLK SL TFLNA T+PD+TCYPVAS N +DFYNL+DVYLD+VFF
Sbjct  70   CGSRKYKVKEPFVELLKSSLQTFLNAVTFPDKTCYPVASQNLQDFYNLMDVYLDSVFF  127



>ref|WP_019161133.1| peptidase M16 [Ruminococcus sp. JC304]
Length=974

 Score =   186 bits (471),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 83/122 (68%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
             +E + E+ + +  SR  L +HKKTGA +M + NDDENKVF I FRTPPK+STG+ HILE
Sbjct  8    AYEVIMEENLTDIHSRGWLLRHKKTGARVMLIENDDENKVFNIAFRTPPKDSTGVAHILE  67

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSR++PLK PFVEL+KGSLNTFLNA TYPD+TCYPVAS N +DF NL+ VYLDAV
Sbjct  68   HSVLCGSREFPLKDPFVELVKGSLNTFLNAMTYPDKTCYPVASCNDQDFQNLMHVYLDAV  127

Query  628  FF  633
            F+
Sbjct  128  FY  129



>ref|WP_035377087.1| peptidase M16 [Fervidicella metallireducens]
 gb|EYE89773.1| peptidase M16 [Fervidicella metallireducens AeB]
Length=975

 Score =   186 bits (471),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 84/122 (69%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF  + E+ + E  S A L+ H+K+GA ++ +SNDD+NKVF I FRTPP+NSTG+PHILE
Sbjct  11   GFRLLEEKDLKEINSTARLFSHEKSGARLLYISNDDDNKVFSISFRTPPENSTGLPHILE  70

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSRK+P+K+PFVEL+KGSLNTFLNA TYPD+T YPVAS N+KDF NL+DVYLDAV
Sbjct  71   HSVLCGSRKFPVKEPFVELVKGSLNTFLNAMTYPDKTMYPVASKNSKDFINLMDVYLDAV  130

Query  628  FF  633
            F+
Sbjct  131  FY  132



>emb|CCJ33994.1| Protein hypA [Caloramator australicus RC3]
Length=362

 Score =   178 bits (452),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF  +  + + E  S+A +++H+K+GA ++ + NDD+NKVF I FRTPP +STG+PHI+E
Sbjct  9    GFRLLEIRDIKEINSKAYIFEHEKSGARLLKIHNDDDNKVFSISFRTPPSDSTGVPHIIE  68

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSRK+P+K+PFVEL+KGSL TFLNA TYPD+T YPVAS N KDF+NL+DVYLDAV
Sbjct  69   HSVLCGSRKFPVKEPFVELIKGSLQTFLNAMTYPDKTMYPVASKNEKDFFNLMDVYLDAV  128

Query  628  FF  633
            F+
Sbjct  129  FY  130



>ref|XP_002977652.1| hypothetical protein SELMODRAFT_152047 [Selaginella moellendorffii]
 gb|EFJ20990.1| hypothetical protein SELMODRAFT_152047 [Selaginella moellendorffii]
Length=959

 Score =   185 bits (470),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/92 (92%), Positives = 89/92 (97%), Gaps = 0/92 (0%)
 Frame = +1

Query  355  MSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKKPFVELLKGSLNTFLN  534
            MSV N+DENKVFGIVFRTPPK+S GIPHILEHSVLCGSRKYPLK+PFVELLKGSL+TFLN
Sbjct  1    MSVVNEDENKVFGIVFRTPPKDSKGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLN  60

Query  535  AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  630
            AFTYPDRTCYPVASTN KDFYNLVDVYLDAVF
Sbjct  61   AFTYPDRTCYPVASTNLKDFYNLVDVYLDAVF  92



>ref|WP_020887440.1| Peptidase M16C associated domain protein [Desulfovibrio alkalitolerans]
 gb|EPR32391.1| Peptidase M16C associated domain protein [Desulfovibrio alkalitolerans 
DSM 16529]
Length=964

 Score =   185 bits (470),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 83/121 (69%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF  + E+ + E +++A++Y+H  TGA ++SV+  DENKVFGI FRTPP++STG+ HILE
Sbjct  4    GFTLLREEDIPEIQAKALIYRHDATGARLLSVAAPDENKVFGIAFRTPPRDSTGVAHILE  63

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGS KYP+K+PFVELLKGSL TFLNAFTYPD+TCYPVASTN +D  NL+DVYLDAV
Sbjct  64   HSVLCGSEKYPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASTNGQDLTNLIDVYLDAV  123

Query  628  F  630
            F
Sbjct  124  F  124



>ref|WP_027369289.1| peptidase M16 [Desulfovermiculus halophilus]
Length=970

 Score =   185 bits (469),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 82/125 (66%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = +1

Query  259  RKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPH  438
            + +GFE V +  + E +  A LY++ + GAE+++V NDDENKV GI FRTPPK+STG+ H
Sbjct  2    KDIGFELVWQARIPEIQGLARLYRYSRNGAEVLAVENDDENKVAGIAFRTPPKDSTGVAH  61

Query  439  ILEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYL  618
            ILEHSVLCGSRKYP+K+PFVELLKGS+ TFLNA T+PD+TCYPVAS N++D  NL+DVYL
Sbjct  62   ILEHSVLCGSRKYPVKEPFVELLKGSVQTFLNAMTFPDKTCYPVASQNSQDLQNLLDVYL  121

Query  619  DAVFF  633
            DA FF
Sbjct  122  DAAFF  126



>ref|WP_009302747.1| peptidase M16 [Desulfovibrio sp. 6_1_46AFAA]
 gb|EGW51202.1| hypothetical protein HMPREF1022_01681 [Desulfovibrio sp. 6_1_46AFAA]
Length=970

 Score =   185 bits (469),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 83/123 (67%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +1

Query  262  KLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHI  441
            K GF  ++E+ + E    A L++HK TGA+++SV N DENK FG+ FRTPP +STG+ HI
Sbjct  3    KHGFTLLTERDMAEVGGTARLWQHKITGAQLLSVVNADENKCFGVSFRTPPTDSTGVAHI  62

Query  442  LEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLD  621
            LEHSVLCGS KYP+K+PFVELLKGSL TFLNAFT+PD+TCYPVAS N +DFYNL+DVY+D
Sbjct  63   LEHSVLCGSDKYPVKEPFVELLKGSLQTFLNAFTFPDKTCYPVASANLRDFYNLIDVYID  122

Query  622  AVF  630
            AVF
Sbjct  123  AVF  125



>ref|WP_008683425.1| peptidase M16 [Desulfovibrio sp. 3_1_syn3]
 gb|EFL87313.1| hypothetical protein HMPREF0326_01089 [Desulfovibrio sp. 3_1_syn3]
Length=970

 Score =   185 bits (469),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 83/123 (67%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +1

Query  262  KLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHI  441
            K GF  ++E+ + E    A L++HK TGA+++SV N DENK FG+ FRTPP +STG+ HI
Sbjct  3    KHGFTLLTERDMAEVGGTARLWQHKITGAQLLSVVNADENKCFGVSFRTPPTDSTGVAHI  62

Query  442  LEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLD  621
            LEHSVLCGS KYP+K+PFVELLKGSL TFLNAFT+PD+TCYPVAS N +DFYNL+DVY+D
Sbjct  63   LEHSVLCGSDKYPVKEPFVELLKGSLQTFLNAFTFPDKTCYPVASANLRDFYNLIDVYID  122

Query  622  AVF  630
            AVF
Sbjct  123  AVF  125



>ref|WP_014129848.1| peptidase M16 [Pelagibacterium halotolerans]
 gb|AEQ50699.1| peptidase M16C associated domain protein [Pelagibacterium halotolerans 
B2]
Length=967

 Score =   185 bits (469),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
             FE ++E+ + E  + A  Y+H KTGAE++S+ NDDENKVFGI F TPP++STG+PHILE
Sbjct  6    AFELIAEEKISEVNALARHYRHNKTGAEVLSLINDDENKVFGISFATPPEDSTGLPHILE  65

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGS K+P+KKPFVE+LKGSL+TFLNA T+PD+T YPVAS N  DFYNL  VY+DAV
Sbjct  66   HSVLCGSEKFPVKKPFVEMLKGSLHTFLNAMTFPDKTVYPVASQNLADFYNLTQVYMDAV  125

Query  628  FF  633
            FF
Sbjct  126  FF  127



>ref|WP_016483219.1| pre-sequence protease. Metallo peptidase. MEROPS family M16C 
[Chthonomonas calidirosea]
 ref|YP_008089798.1| pre-sequence protease. Metallo peptidase. MEROPS family M16C 
[Chthonomonas calidirosea T49]
 emb|CCW35694.1| pre-sequence protease. Metallo peptidase. MEROPS family M16C 
[Chthonomonas calidirosea T49]
Length=971

 Score =   185 bits (469),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 86/121 (71%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GFE + EQ + E  S A LY+H+KTGA  +S+ NDDENK FGI FRTP  +STG+ HILE
Sbjct  6    GFELIREQNIPEINSLARLYRHEKTGALFLSLINDDENKSFGINFRTPVSDSTGVAHILE  65

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSRKYP+K+PF+EL K SLNTFLNAFTYPD+TCYPVAS N +DFYNL+DVYLD V
Sbjct  66   HSVLCGSRKYPVKEPFIELAKSSLNTFLNAFTYPDKTCYPVASQNLQDFYNLIDVYLDTV  125

Query  628  F  630
            F
Sbjct  126  F  126



>ref|WP_029896470.1| peptidase M16 [Desulfovibrio sp. L21-Syr-AB]
Length=973

 Score =   185 bits (469),  Expect = 5e-50, Method: Composition-based stats.
 Identities = 83/121 (69%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF  + E+ + E ++ A LY+H KTGA ++S++NDDENKVFG  FRTPP++STG+ HILE
Sbjct  5    GFSLLREEEISEYQTVARLYRHDKTGARVLSLANDDENKVFGAAFRTPPRDSTGVAHILE  64

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVL GSRKYP+K+PFVELLKGSL TFLNAFT+PD+TCYPV+S N +DF NLVDVYLDA 
Sbjct  65   HSVLNGSRKYPVKEPFVELLKGSLKTFLNAFTFPDKTCYPVSSCNLQDFRNLVDVYLDAA  124

Query  628  F  630
            F
Sbjct  125  F  125



>emb|CCY32009.1| putative uncharacterized protein [Ruminococcus sp. CAG:60]
Length=974

 Score =   184 bits (468),  Expect = 6e-50, Method: Composition-based stats.
 Identities = 81/122 (66%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
             +E V+++ + +  S   + +HKKTGA ++ + NDDENKVF I FRTPP NSTG+PHILE
Sbjct  8    AYEIVTQENLTDIHSTGYMLRHKKTGARLILIENDDENKVFSIAFRTPPANSTGVPHILE  67

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSR++PLK PFVEL+KGSLNTFLNA TYPD+TCYPVAS N +DF NL+ VYLDAV
Sbjct  68   HSVLCGSREFPLKDPFVELVKGSLNTFLNAMTYPDKTCYPVASCNDQDFQNLMHVYLDAV  127

Query  628  FF  633
            F+
Sbjct  128  FY  129



>ref|WP_022657642.1| peptidase M16 [Desulfovibrio desulfuricans]
Length=970

 Score =   184 bits (468),  Expect = 6e-50, Method: Composition-based stats.
 Identities = 80/123 (65%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +1

Query  262  KLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHI  441
            K GF  ++EQ + E    A L++H+ TGA+++S++N DENK FG+ FRTPP +STG+ HI
Sbjct  3    KHGFTLLTEQHLHEVDGTARLWRHEATGAQLLSINNSDENKCFGVNFRTPPADSTGVAHI  62

Query  442  LEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLD  621
            LEHSVLCGS KYP+K+PFVEL+KGSL TFLNAFT+PD+TCYP+AS N +DFYNL+DVY+D
Sbjct  63   LEHSVLCGSDKYPVKEPFVELMKGSLQTFLNAFTFPDKTCYPIASCNLRDFYNLIDVYID  122

Query  622  AVF  630
            AVF
Sbjct  123  AVF  125



>ref|WP_028588391.1| peptidase M16 [Desulfocurvus vexinensis]
Length=964

 Score =   184 bits (466),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 85/121 (70%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF  + EQ + E    A LY H +TGA+++SV+  DENKVFG+  RTPP +STG+ HILE
Sbjct  6    GFSLLREQEIAEAGCTARLYCHDRTGAQLVSVACPDENKVFGVTLRTPPADSTGVAHILE  65

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSR+YP+K+PFVELLKGSL+TFLNAFTYPD+TCYPVASTN  DF NLVDVYLDAV
Sbjct  66   HSVLCGSRRYPVKEPFVELLKGSLHTFLNAFTYPDKTCYPVASTNLADFRNLVDVYLDAV  125

Query  628  F  630
            F
Sbjct  126  F  126



>ref|WP_021651012.1| peptidase M16 inactive domain protein [Blautia sp. KLE 1732]
 gb|ERI97649.1| peptidase M16 inactive domain protein [Blautia sp. KLE 1732]
Length=973

 Score =   184 bits (466),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 82/122 (67%), Positives = 99/122 (81%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
             +E + E+ + +  S+  L +HKKTGA +M + N DENKVF I FRTPPKNSTG+ HILE
Sbjct  8    AYEVLKEEELQDIHSKGWLLRHKKTGARVMLIENSDENKVFNIAFRTPPKNSTGVAHILE  67

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSR++PLK PFVEL+KGSLNTFLNA TYPD+TCYPVAS N +DF NL+ VYLDAV
Sbjct  68   HSVLCGSREFPLKDPFVELVKGSLNTFLNAMTYPDKTCYPVASCNDRDFQNLMHVYLDAV  127

Query  628  FF  633
            F+
Sbjct  128  FY  129



>ref|WP_011526733.1| peptidase M16 [Lawsonia intracellularis]
 emb|CAJ54704.1| predicted Zn-dependent peptidases, insulinase-like [Lawsonia 
intracellularis PHE/MN1-00]
 gb|AGC50071.1| M16 family peptidase [Lawsonia intracellularis N343]
Length=963

 Score =   184 bits (466),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 80/118 (68%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = +1

Query  280  VSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVL  459
            + E  + E    A  ++H  T AEI+S+SN+DENK FG+ FRTPP +STG+ HILEHSVL
Sbjct  8    IREVKIPEVSGIAKYWRHNGTNAEILSISNNDENKCFGVTFRTPPHDSTGVAHILEHSVL  67

Query  460  CGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            CGS+KYP+K+PFVELLKGSL TFLNAFT+PD+TCYP+AS N +DFYNL+DVYLDAVFF
Sbjct  68   CGSKKYPIKEPFVELLKGSLQTFLNAFTFPDKTCYPIASANLQDFYNLIDVYLDAVFF  125



>ref|WP_015525808.1| Predicted Zn-dependent peptidases, insulinase-like [Ruminococcus 
sp. SR1/5]
 ref|YP_007783604.1| Predicted Zn-dependent peptidases, insulinase-like [Ruminococcus 
sp. SR1/5]
 emb|CBL19941.1| Predicted Zn-dependent peptidases, insulinase-like [Ruminococcus 
sp. SR1/5]
Length=973

 Score =   183 bits (465),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 81/122 (66%), Positives = 99/122 (81%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
             +E + E+ + +  S+  L +HKKTGA +M + N DENKVF I FRTPPKNSTG+ HILE
Sbjct  8    AYEVLKEEELQDIHSKGWLLRHKKTGARVMLIENSDENKVFNIAFRTPPKNSTGVAHILE  67

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSR++PLK PFVEL+KGSLNTFLNA TYPD+TCYP+AS N +DF NL+ VYLDAV
Sbjct  68   HSVLCGSREFPLKDPFVELVKGSLNTFLNAMTYPDKTCYPIASCNDRDFQNLMHVYLDAV  127

Query  628  FF  633
            F+
Sbjct  128  FY  129



>ref|WP_018702572.1| hypothetical protein [Anaeromusa acidaminophila]
Length=970

 Score =   183 bits (464),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 82/124 (66%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = +1

Query  262  KLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHI  441
            K GF  ++ Q V E  S+A  Y+H+++GA ++ + NDD+NKVF I F+TPP + TG+PHI
Sbjct  4    KSGFRLIATQTVAELASKAYTYEHEQSGARLVYLENDDDNKVFSITFKTPPADHTGVPHI  63

Query  442  LEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLD  621
            LEHSVLCGSRK+PLK+PFVEL+KGSLNTFLNA T+PD+T YPVAS N KDF NL+DVYLD
Sbjct  64   LEHSVLCGSRKFPLKEPFVELIKGSLNTFLNAMTFPDKTMYPVASQNDKDFRNLMDVYLD  123

Query  622  AVFF  633
            AVFF
Sbjct  124  AVFF  127



>ref|WP_027938345.1| peptidase M16 [Anaeroarcus burkinensis]
Length=970

 Score =   183 bits (464),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 82/124 (66%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = +1

Query  262  KLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHI  441
            K GF  ++ Q V E  S+A  Y+H+++GA ++ + NDD+NKVF I F+TPP + TG+PHI
Sbjct  4    KSGFRLIATQTVAELASKAYTYEHEQSGARLVYLENDDDNKVFSITFKTPPADHTGVPHI  63

Query  442  LEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLD  621
            LEHSVLCGSRK+PLK+PFVEL+KGSLNTFLNA T+PD+T YPVAS N KDF NL+DVYLD
Sbjct  64   LEHSVLCGSRKFPLKEPFVELIKGSLNTFLNAMTFPDKTMYPVASQNDKDFRNLMDVYLD  123

Query  622  AVFF  633
            AVFF
Sbjct  124  AVFF  127



>ref|WP_031481722.1| peptidase M16 [Desulfovibrio frigidus]
Length=961

 Score =   182 bits (463),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF ++S + + E     V+Y+H+KTG  ++SV N DENK FGI FRTPP +STG+PHILE
Sbjct  6    GFNEISRETLTELNGEVVIYEHEKTGGRVLSVINGDENKTFGISFRTPPADSTGLPHILE  65

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSRKYP+K+PFVELLK SL TFLNA TYPD+T YPVAS N +DF NLV VYLDAV
Sbjct  66   HSVLCGSRKYPVKEPFVELLKCSLQTFLNAMTYPDKTVYPVASPNEQDFRNLVGVYLDAV  125

Query  628  FF  633
            FF
Sbjct  126  FF  127



>ref|WP_027871447.1| peptidase M16 [[Eubacterium] cellulosolvens]
Length=977

 Score =   182 bits (463),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 78/121 (64%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = +1

Query  271  FEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEH  450
            +E +S++F+++  +R +L +H+K+GA +  ++NDD NKVF I FRTPPKNSTG+ HI+EH
Sbjct  10   YEVISDEFIEDVHARGMLLRHRKSGARVALLANDDNNKVFNIAFRTPPKNSTGVAHIIEH  69

Query  451  SVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  630
            +VLCGSRK+PLK PFVEL+KGSLNTFLNA TYPD+T +PVAS N +DF NL+DVYLDAVF
Sbjct  70   TVLCGSRKFPLKDPFVELVKGSLNTFLNAMTYPDKTMFPVASCNDQDFQNLMDVYLDAVF  129

Query  631  F  633
            +
Sbjct  130  Y  130



>ref|WP_032078808.1| peptidase M16 [Clostridium drakei]
Length=975

 Score =   182 bits (463),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 80/122 (66%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF+ V ++ ++E  S  +L++H+K+GA +  + N+D+NKVF I FRTPPK+STG+PHILE
Sbjct  11   GFKLVEKKDINEINSTGILFEHEKSGARLFYLKNEDDNKVFSISFRTPPKDSTGVPHILE  70

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSRK+PLK+PFVEL+KGS+NTFLNAFT+PD+T YPVAS N KDF NL++VYLDAV
Sbjct  71   HSVLCGSRKFPLKEPFVELIKGSMNTFLNAFTFPDKTMYPVASRNNKDFLNLMNVYLDAV  130

Query  628  FF  633
            F+
Sbjct  131  FY  132



>ref|WP_022655669.1| peptidase M16 [Desulfovibrio sp. Dsv1]
Length=971

 Score =   182 bits (463),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 82/123 (67%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +1

Query  262  KLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHI  441
            K GF  ++E+ + E    A L++H+ TGA+++SV+N DENK FG+ FRTPP +STG+ HI
Sbjct  3    KHGFILLTERDMAEVGGTARLWRHRVTGAQLLSVTNADENKCFGVSFRTPPTDSTGVAHI  62

Query  442  LEHSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLD  621
            LEHSVLCGS KYP+K+PFVELLKGSL TFLNAFT+PD+TCYPVAS N +DFYNLV VY+D
Sbjct  63   LEHSVLCGSEKYPVKEPFVELLKGSLQTFLNAFTFPDKTCYPVASANLRDFYNLVSVYID  122

Query  622  AVF  630
            AVF
Sbjct  123  AVF  125



>ref|WP_021720806.1| peptidase M16 inactive domain protein [Phascolarctobacterium 
succinatutens]
 emb|CDD10024.1| peptidase M16 inactive domain protein [Phascolarctobacterium 
succinatutens CAG:287]
Length=973

 Score =   182 bits (463),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 81/122 (66%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF+ +  QFVDE  S+A + +H K+GA ++ ++NDD+NKVF I FRTPP + TG+ HILE
Sbjct  11   GFKVLQAQFVDEISSQAYIMEHIKSGARLLCLANDDDNKVFSISFRTPPADDTGVAHILE  70

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HS LCGSRKYPLK+PFV+L+KGSLNTFLNA T+PD+T YPVAS N KDF+NL+DVYLDAV
Sbjct  71   HSSLCGSRKYPLKEPFVDLVKGSLNTFLNAMTFPDKTMYPVASRNDKDFHNLMDVYLDAV  130

Query  628  FF  633
            F+
Sbjct  131  FY  132



>ref|WP_004603088.1| peptidase M16 [[Eubacterium] cellulosolvens]
 gb|EIM56951.1| putative Zn-dependent peptidase, insulinase [ [[Eubacterium] 
cellulosolvens 6]
Length=977

 Score =   182 bits (462),  Expect = 4e-49, Method: Composition-based stats.
 Identities = 78/121 (64%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = +1

Query  271  FEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEH  450
            ++ +S++F+++  +R VL +H+K+GA +  ++NDD NKVF I FRTPPKNSTG+ HI+EH
Sbjct  10   YDVISDEFIEDVHARGVLLRHRKSGARVALLANDDNNKVFNIAFRTPPKNSTGVAHIIEH  69

Query  451  SVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  630
            +VLCGSRK+PLK PFVEL+KGSLNTFLNA TYPD+T +PVAS N +DF NL+DVYLDAVF
Sbjct  70   TVLCGSRKFPLKDPFVELVKGSLNTFLNAMTYPDKTMFPVASCNDQDFQNLMDVYLDAVF  129

Query  631  F  633
            +
Sbjct  130  Y  130



>ref|WP_007061507.1| peptidase M16 [Clostridium carboxidivorans]
 gb|EET86900.1| Peptidase M16C associated domain protein [Clostridium carboxidivorans 
P7]
 gb|EFG90000.1| peptidase M16C associated [Clostridium carboxidivorans P7]
Length=975

 Score =   182 bits (462),  Expect = 5e-49, Method: Composition-based stats.
 Identities = 80/122 (66%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF+ V ++ ++E  S  +L++H+K+GA +  + N+D+NKVF I FRTPPK+STG+PHILE
Sbjct  11   GFKLVEKKDINEINSTGILFEHEKSGARLFYLKNEDDNKVFSISFRTPPKDSTGVPHILE  70

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSRK+PLK+PFVEL+KGS+NTFLNAFT+PD+T YPVAS N KDF NL++VYLDAV
Sbjct  71   HSVLCGSRKFPLKEPFVELIKGSMNTFLNAFTFPDKTMYPVASRNNKDFLNLMNVYLDAV  130

Query  628  FF  633
            F+
Sbjct  131  FY  132



>ref|WP_022215422.1| peptidase M16 inactive domain protein [Blautia sp. CAG:237]
 emb|CDB77493.1| peptidase M16 inactive domain protein [Blautia sp. CAG:237]
Length=974

 Score =   182 bits (461),  Expect = 6e-49, Method: Composition-based stats.
 Identities = 81/122 (66%), Positives = 99/122 (81%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
             +E + ++ + + +S   L +H KTGA +M + NDDENKVF I FRTPPKNSTG+ HILE
Sbjct  8    AYEVIQKKKLTDIRSTGYLLRHIKTGARVMLIENDDENKVFNIAFRTPPKNSTGVAHILE  67

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSR++PLK PFVEL+KGSLNTFLNA TYPD+TCYPVAS N +DF NL+ VYLDAV
Sbjct  68   HSVLCGSREFPLKDPFVELVKGSLNTFLNAMTYPDKTCYPVASCNDQDFQNLMHVYLDAV  127

Query  628  FF  633
            F+
Sbjct  128  FY  129



>ref|WP_015542595.1| Predicted Zn-dependent peptidases, insulinase-like [[Ruminococcus] 
obeum]
 ref|YP_007805802.1| Predicted Zn-dependent peptidases, insulinase-like [Ruminococcus 
obeum A2-162]
 emb|CBL23820.1| Predicted Zn-dependent peptidases, insulinase-like [Ruminococcus 
obeum A2-162]
Length=974

 Score =   181 bits (460),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = +1

Query  280  VSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVL  459
            V ++ +++ +S   L++H KTGA +M++ NDDENKVF I FRTPPKNSTG+ HILEHSVL
Sbjct  12   VKKEKLNDIRSTGYLFRHIKTGARVMAIENDDENKVFNIAFRTPPKNSTGVAHILEHSVL  71

Query  460  CGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            CGS+ +PLK PFVEL+KGSLNTFLNA TYPD+TCYPVAS N +DF NL+ VYLDAVF+
Sbjct  72   CGSKDFPLKDPFVELVKGSLNTFLNAMTYPDKTCYPVASCNDQDFQNLMHVYLDAVFY  129



>ref|WP_017895385.1| hypothetical protein [Clostridium tyrobutyricum]
 emb|CDL91770.1| Protein hypA [Clostridium tyrobutyricum DIVETGP]
Length=973

 Score =   181 bits (459),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 82/122 (67%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF+ V ++ ++E  S  ++++HKK+GA +  + NDD+NKVF I FRTPP+NS GIPHILE
Sbjct  9    GFKFVEKKNINELNSIGMIFQHKKSGARLFFLKNDDDNKVFAISFRTPPENSEGIPHILE  68

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSRK+P+K+PFVEL+KGSLNTFLNAFT+PD+T YPVAS N KDF NL+DVYLDAV
Sbjct  69   HSVLCGSRKFPVKEPFVELIKGSLNTFLNAFTFPDKTMYPVASMNDKDFTNLIDVYLDAV  128

Query  628  FF  633
            F+
Sbjct  129  FY  130



>ref|WP_017751909.1| hypothetical protein [Clostridium tyrobutyricum]
Length=973

 Score =   181 bits (459),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 82/122 (67%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF+ V ++ ++E  S  ++++HKK+GA +  + NDD+NKVF I FRTPP+NS GIPHILE
Sbjct  9    GFKFVEKKNINELNSIGMIFQHKKSGARLFFLKNDDDNKVFAISFRTPPENSEGIPHILE  68

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSRK+P+K+PFVEL+KGSLNTFLNAFT+PD+T YPVAS N KDF NL+DVYLDAV
Sbjct  69   HSVLCGSRKFPVKEPFVELIKGSLNTFLNAFTFPDKTMYPVASMNDKDFTNLIDVYLDAV  128

Query  628  FF  633
            F+
Sbjct  129  FY  130



>ref|WP_015514322.1| Predicted Zn-dependent peptidases, insulinase-like [Coprococcus 
catus]
 ref|YP_007770163.1| Predicted Zn-dependent peptidases, insulinase-like [Coprococcus 
catus GD/7]
 emb|CBK80754.1| Predicted Zn-dependent peptidases, insulinase-like [Coprococcus 
catus GD/7]
Length=979

 Score =   180 bits (457),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 81/121 (67%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
             +E VS +++DE KS+A L +H+KTGA I  ++NDDENK F I FRTPPK+STG+ HI+E
Sbjct  11   AYEIVSLEYIDEIKSQAALLRHRKTGARIAVLANDDENKTFNIGFRTPPKDSTGVAHIME  70

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGS K+P K PFVEL KGSLNTFLNA TYPD+T YP+AS N  DF NL+ VYLDAV
Sbjct  71   HSVLCGSEKFPAKDPFVELAKGSLNTFLNAMTYPDKTVYPIASCNDADFQNLMHVYLDAV  130

Query  628  F  630
            F
Sbjct  131  F  131



>ref|WP_006568065.1| peptidase M16 [Anaerostipes caccae]
 gb|EDR96737.1| peptidase M16 inactive domain protein [Anaerostipes caccae DSM 
14662]
Length=966

 Score =   180 bits (456),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 80/121 (66%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +1

Query  271  FEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEH  450
            +E V E+ + E      +Y+HKKTGA ++ VSN+D+NKVF I F+TPPK+ TG+PHI+EH
Sbjct  5    YELVKEEQIKELNGTGYVYRHKKTGARVVVVSNEDDNKVFQIGFKTPPKDDTGVPHIMEH  64

Query  451  SVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  630
            SVLCGSR++PLK PFVEL+KGSLNTFLNA TYPD+T YPVAS N KDF+NL+ VYLDAVF
Sbjct  65   SVLCGSREFPLKDPFVELVKGSLNTFLNAMTYPDKTVYPVASCNDKDFFNLMHVYLDAVF  124

Query  631  F  633
            +
Sbjct  125  Y  125



>ref|WP_009002339.1| peptidase M16 [Clostridium sp. D5]
 gb|EGB94707.1| peptidase, M16 family [Clostridium sp. D5]
Length=975

 Score =   180 bits (456),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 79/122 (65%), Positives = 99/122 (81%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
             +E V E+ + + KS+  L +HKK+GA ++ + NDDENKVF I FRTPP +STG+PHI+E
Sbjct  8    AYEPVLEEDLSDLKSKGCLLRHKKSGARVLLMENDDENKVFSIGFRTPPSDSTGVPHIME  67

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSR +P+K PFVEL+KGSLNTFLNA TYPD+T YPVAS N KDF NL+ VY+DAV
Sbjct  68   HSVLCGSRDFPVKDPFVELVKGSLNTFLNAMTYPDKTVYPVASCNDKDFQNLMHVYMDAV  127

Query  628  FF  633
            F+
Sbjct  128  FY  129



>ref|WP_035355373.1| peptidase M16 [Acetobacterium dehalogenans]
Length=973

 Score =   180 bits (456),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 83/122 (68%), Positives = 99/122 (81%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF    E+FVDE    A  + H+KTGA ++ +S DD+NKVF I FRTP  +STG+PHILE
Sbjct  10   GFILNKEEFVDEIDGFARTFVHEKTGARLLYISADDDNKVFSISFRTPSTDSTGVPHILE  69

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGS+KYP+K+PFVEL KGSLNTFLNA TYPD+T YP+ASTN KDF NL+DVYLDAV
Sbjct  70   HSVLCGSKKYPVKEPFVELAKGSLNTFLNAMTYPDKTMYPIASTNAKDFMNLMDVYLDAV  129

Query  628  FF  633
            F+
Sbjct  130  FY  131



>ref|WP_022261301.1| peptidase [Anaerostipes sp. CAG:276]
 emb|CDC34340.1| peptidase [Anaerostipes sp. CAG:276]
Length=965

 Score =   179 bits (455),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 80/121 (66%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +1

Query  271  FEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEH  450
            +E V E+ + E      +Y+HKKTGA ++ VSN+D+NKVF I F+TPPK+ TG+PHI+EH
Sbjct  4    YELVKEEQIKELNGTGYVYRHKKTGARVVVVSNEDDNKVFQIGFKTPPKDDTGVPHIMEH  63

Query  451  SVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  630
            SVLCGSR++PLK PFVEL+KGSLNTFLNA TYPD+T YPVAS N KDF+NL+ VYLDAVF
Sbjct  64   SVLCGSREFPLKDPFVELVKGSLNTFLNAMTYPDKTVYPVASCNDKDFFNLMHVYLDAVF  123

Query  631  F  633
            +
Sbjct  124  Y  124



>ref|WP_009290271.1| peptidase M16 [Anaerostipes sp. 3_2_56FAA]
 gb|EFV22064.1| peptidase [Anaerostipes sp. 3_2_56FAA]
Length=966

 Score =   179 bits (455),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 80/121 (66%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +1

Query  271  FEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEH  450
            +E V E+ + E      +Y+HKKTGA ++ VSN+D+NKVF I F+TPPK+ TG+PHI+EH
Sbjct  5    YELVKEEQIKELNGTGYVYRHKKTGARVVVVSNEDDNKVFQIGFKTPPKDDTGVPHIMEH  64

Query  451  SVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  630
            SVLCGSR++PLK PFVEL+KGSLNTFLNA TYPD+T YPVAS N KDF+NL+ VYLDAVF
Sbjct  65   SVLCGSREFPLKDPFVELVKGSLNTFLNAMTYPDKTVYPVASCNDKDFFNLMHVYLDAVF  124

Query  631  F  633
            +
Sbjct  125  Y  125



>ref|WP_016440111.1| hypothetical protein [Coprococcus sp. HPP0048]
 gb|EPD65839.1| hypothetical protein HMPREF1216_00251 [Coprococcus sp. HPP0048]
Length=974

 Score =   179 bits (455),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 80/122 (66%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
             +E V +Q V + +S   L++HKKTGA ++ + NDDENKVF I FRTPP++STG+PHILE
Sbjct  8    AYELVRKQDVSDLQSVGYLFRHKKTGARVLLLENDDENKVFTIGFRTPPEDSTGLPHILE  67

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGS+K+P K PFVEL+KGSLNTFLNA TYPD+T YP+AS N KDF NL+ VY+DAV
Sbjct  68   HSVLCGSKKFPAKDPFVELVKGSLNTFLNAMTYPDKTLYPIASCNDKDFQNLMHVYMDAV  127

Query  628  FF  633
            F+
Sbjct  128  FY  129



>ref|WP_016439298.1| hypothetical protein [Coprococcus sp. HPP0074]
 gb|EPD58559.1| hypothetical protein HMPREF1215_01578 [Coprococcus sp. HPP0074]
Length=974

 Score =   179 bits (455),  Expect = 4e-48, Method: Composition-based stats.
 Identities = 80/122 (66%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
             +E V +Q V + +S   L++HKKTGA ++ + NDDENKVF I FRTPP++STG+PHILE
Sbjct  8    AYELVRKQDVSDLQSVGYLFRHKKTGARVLLLENDDENKVFTIGFRTPPEDSTGLPHILE  67

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGS+K+P K PFVEL+KGSLNTFLNA TYPD+T YP+AS N KDF NL+ VY+DAV
Sbjct  68   HSVLCGSKKFPAKDPFVELVKGSLNTFLNAMTYPDKTLYPIASCNDKDFQNLMHVYMDAV  127

Query  628  FF  633
            F+
Sbjct  128  FY  129



>ref|WP_009262834.1| peptidase M16 [Lachnospiraceae bacterium 9_1_43BFAA]
 gb|EGG86451.1| hypothetical protein HMPREF0987_01409 [Lachnospiraceae bacterium 
9_1_43BFAA]
Length=974

 Score =   179 bits (454),  Expect = 4e-48, Method: Composition-based stats.
 Identities = 80/122 (66%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
             +E V +Q V + +S   L++HKKTGA ++ + NDDENKVF I FRTPP++STG+PHILE
Sbjct  8    AYELVRKQDVSDLQSVGYLFRHKKTGARVLLLENDDENKVFTIGFRTPPEDSTGLPHILE  67

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGS+K+P K PFVEL+KGSLNTFLNA TYPD+T YP+AS N KDF NL+ VY+DAV
Sbjct  68   HSVLCGSKKFPAKDPFVELVKGSLNTFLNAMTYPDKTLYPIASCNDKDFQNLMHVYMDAV  127

Query  628  FF  633
            F+
Sbjct  128  FY  129



>ref|WP_008976346.1| peptidase M16 [Lachnospiraceae bacterium 6_1_37FAA]
 gb|EGC74703.1| hypothetical protein HMPREF0490_01583 [Lachnospiraceae bacterium 
6_1_37FAA]
Length=974

 Score =   179 bits (454),  Expect = 5e-48, Method: Composition-based stats.
 Identities = 80/122 (66%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
             +E V +Q V + +S   L++HKKTGA ++ + NDDENKVF I FRTPP++STG+PHILE
Sbjct  8    AYELVRKQDVSDLQSVGYLFRHKKTGARVLLLENDDENKVFTIGFRTPPEDSTGLPHILE  67

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGS+K+P K PFVEL+KGSLNTFLNA TYPD+T YP+AS N KDF NL+ VY+DAV
Sbjct  68   HSVLCGSKKFPAKDPFVELVKGSLNTFLNAMTYPDKTLYPIASCNDKDFQNLMHVYMDAV  127

Query  628  FF  633
            F+
Sbjct  128  FY  129



>ref|WP_022374165.1| predicted Zn-dependent peptidases insulinase-like [Firmicutes 
bacterium CAG:270]
 emb|CDD69858.1| predicted Zn-dependent peptidases insulinase-like [Firmicutes 
bacterium CAG:270]
Length=966

 Score =   179 bits (454),  Expect = 5e-48, Method: Composition-based stats.
 Identities = 79/118 (67%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = +1

Query  280  VSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVL  459
            + ++ ++E      L KH KTGA ++ VSN+D+NKVF I FRTPPK+ TG+PHILEHSVL
Sbjct  8    IKQESIEELNGTGYLLKHNKTGARVVVVSNEDDNKVFQIGFRTPPKDDTGVPHILEHSVL  67

Query  460  CGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            CGSR++P+K PFVEL+KGSLNTFLNA TYPD+T YPVAS N KDF+NLV VYLDAVF+
Sbjct  68   CGSREFPMKDPFVELVKGSLNTFLNAMTYPDKTVYPVASQNDKDFFNLVHVYLDAVFY  125



>ref|WP_008870220.1| peptidase M16 [Desulfonatronospira thiodismutans]
 gb|EFI34906.1| Peptidase M16C associated domain protein [Desulfonatronospira 
thiodismutans ASO3-1]
Length=971

 Score =   179 bits (454),  Expect = 6e-48, Method: Composition-based stats.
 Identities = 80/121 (66%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = +1

Query  271  FEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEH  450
            F  V E+ + E  S A L++H+KTGA ++S++N DENKVFGI FRTPP+++TG+ HILEH
Sbjct  7    FRLVEERHIPEINSLARLFEHQKTGARVLSMTNQDENKVFGITFRTPPRDNTGVAHILEH  66

Query  451  SVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  630
            SVLCGSR+Y +K+PFVELLK S+ TFLNA T+PD+TCYPVAS N +D YNL+DVYLDAVF
Sbjct  67   SVLCGSRRYRVKEPFVELLKSSVQTFLNAITFPDKTCYPVASQNRQDLYNLMDVYLDAVF  126

Query  631  F  633
            F
Sbjct  127  F  127



>ref|WP_016293851.1| hypothetical protein [Lachnospiraceae bacterium M18-1]
 gb|EOS40989.1| hypothetical protein C808_00153 [Lachnospiraceae bacterium M18-1]
Length=990

 Score =   179 bits (454),  Expect = 6e-48, Method: Composition-based stats.
 Identities = 78/121 (64%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = +1

Query  271  FEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEH  450
            +EKV ++ + + KS+  L +HKK+GA ++ +SN+DENKVF I FRTPP +STG+PHI+EH
Sbjct  23   YEKVLKEDLTDLKSKGYLLRHKKSGARVLMLSNEDENKVFAIGFRTPPSDSTGVPHIMEH  82

Query  451  SVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  630
            SVLCGS+ +P+K PFVEL+KGSLNTFLNA TYPD+T YPVAS N KDF NL+ VY+DAVF
Sbjct  83   SVLCGSKDFPVKDPFVELVKGSLNTFLNAMTYPDKTVYPVASCNDKDFQNLMHVYMDAVF  142

Query  631  F  633
            +
Sbjct  143  Y  143



>ref|WP_009296156.1| peptidase M16 [Clostridium sp. 7_3_54FAA]
 gb|EHF07264.1| hypothetical protein HMPREF1020_00787 [Clostridium sp. 7_3_54FAA]
Length=974

 Score =   179 bits (453),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
             ++ +SE++V E  S  ++ +HKKTGA I  +SN+DENKVF I FRTPP +STG+PHILE
Sbjct  10   AYQVISEKYVKELNSEGIILEHKKTGARIFLLSNEDENKVFTIGFRTPPSDSTGVPHILE  69

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGS K+P+K PFVEL+KGSLNTFLNA TYPD+T YPVAS N KDF NL++VY+DAV
Sbjct  70   HSVLCGSEKFPVKDPFVELVKGSLNTFLNAMTYPDKTVYPVASCNDKDFQNLMNVYMDAV  129

Query  628  F  630
             
Sbjct  130  L  130



>ref|WP_023921967.1| hypothetical protein [Ruminococcus lactaris]
 gb|ETD22402.1| hypothetical protein HMPREF1202_01482 [Ruminococcus lactaris 
CC59_002D]
Length=974

 Score =   179 bits (453),  Expect = 7e-48, Method: Composition-based stats.
 Identities = 78/122 (64%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
             +E + ++ + + KS+  L KHKK+GA ++ + NDDENKVF I FRTPP +STG+PHI+E
Sbjct  8    AYEVLQQEDLSDLKSKGTLLKHKKSGARVLLMENDDENKVFTIGFRTPPSDSTGVPHIME  67

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSR++P+K PFVEL+KGSLNTFLNA TYPD+T YPVAS N KDF NL+ VY+DAV
Sbjct  68   HSVLCGSREFPVKDPFVELVKGSLNTFLNAMTYPDKTVYPVASCNDKDFQNLMHVYMDAV  127

Query  628  FF  633
            F+
Sbjct  128  FY  129



>ref|WP_021642841.1| peptidase M16 inactive domain protein [[Clostridium] symbiosum]
 gb|ERI77326.1| peptidase M16 inactive domain protein [ [[Clostridium] symbiosum 
ATCC 14940]
Length=974

 Score =   179 bits (453),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
             ++ +SE++V E  S  ++ +HKKTGA I  +SN+DENKVF I FRTPP +STG+PHILE
Sbjct  10   AYQVISEKYVKELNSEGIILEHKKTGARIFLLSNEDENKVFTIGFRTPPSDSTGVPHILE  69

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGS K+P+K PFVEL+KGSLNTFLNA TYPD+T YPVAS N KDF NL++VY+DAV
Sbjct  70   HSVLCGSEKFPVKDPFVELVKGSLNTFLNAMTYPDKTVYPVASCNDKDFQNLMNVYMDAV  129

Query  628  F  630
             
Sbjct  130  L  130



>ref|WP_005612121.1| peptidase M16 [Ruminococcus lactaris]
 gb|EDY32168.1| peptidase M16 inactive domain protein [Ruminococcus lactaris 
ATCC 29176]
Length=974

 Score =   179 bits (453),  Expect = 7e-48, Method: Composition-based stats.
 Identities = 78/122 (64%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
             +E + ++ + + KS+  L KHKK+GA ++ + NDDENKVF I FRTPP +STG+PHI+E
Sbjct  8    AYEVLQQEDLSDLKSKGTLLKHKKSGARVLLMENDDENKVFTIGFRTPPSDSTGVPHIME  67

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSR++P+K PFVEL+KGSLNTFLNA TYPD+T YPVAS N KDF NL+ VY+DAV
Sbjct  68   HSVLCGSREFPVKDPFVELVKGSLNTFLNAMTYPDKTVYPVASCNDKDFQNLMHVYMDAV  127

Query  628  FF  633
            F+
Sbjct  128  FY  129



>ref|WP_003508127.1| peptidase M16 [[Clostridium] symbiosum]
 gb|EGB19019.1| peptidase M16 inactive domain protein [ [[Clostridium] symbiosum 
WAL-14673]
Length=974

 Score =   179 bits (453),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
             ++ +SE++V E  S  ++ +HKKTGA I  +SN+DENKVF I FRTPP +STG+PHILE
Sbjct  10   AYQVISEKYVKELNSEGIILEHKKTGARIFLLSNEDENKVFTIGFRTPPSDSTGVPHILE  69

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGS K+P+K PFVEL+KGSLNTFLNA TYPD+T YPVAS N KDF NL++VY+DAV
Sbjct  70   HSVLCGSEKFPVKDPFVELVKGSLNTFLNAMTYPDKTVYPVASCNDKDFQNLMNVYMDAV  129

Query  628  F  630
             
Sbjct  130  L  130



>ref|WP_009144609.1| peptidase M16 [Phascolarctobacterium succinatutens]
 gb|EFY05774.1| peptidase M16 inactive domain protein [Phascolarctobacterium 
succinatutens YIT 12067]
Length=973

 Score =   179 bits (453),  Expect = 8e-48, Method: Composition-based stats.
 Identities = 80/122 (66%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF+ +  QFVDE  S+A + +H K+GA ++ ++NDD+NKVF I FRTPP + TG+ HILE
Sbjct  11   GFKVLQAQFVDEISSQAYIMEHIKSGARLLYLANDDDNKVFSISFRTPPADDTGVAHILE  70

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HS LCGSRKYPLK+PFV+L+KGSLNTFLNA T+ D+T YPVAS N KDF+NL+DVYLDAV
Sbjct  71   HSSLCGSRKYPLKEPFVDLVKGSLNTFLNAMTFSDKTMYPVASRNDKDFHNLMDVYLDAV  130

Query  628  FF  633
            F+
Sbjct  131  FY  132



>gb|AFA48231.1| peptidase [Acetobacterium woodii DSM 1030]
Length=970

 Score =   179 bits (453),  Expect = 8e-48, Method: Composition-based stats.
 Identities = 82/122 (67%), Positives = 99/122 (81%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF    E+FVDE    A  + H+KTGA+ + +S +D+NKVF I FRTP  +STG+PHILE
Sbjct  7    GFILKKEEFVDEIDGYARTFVHQKTGAQCLYISAEDDNKVFSISFRTPSTDSTGVPHILE  66

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGS+KYP+K+PFVEL KGSLNTFLNA TYPD+T YP+ASTN KDF NL+DVYLDAV
Sbjct  67   HSVLCGSKKYPVKEPFVELAKGSLNTFLNAMTYPDKTMYPIASTNAKDFMNLMDVYLDAV  126

Query  628  FF  633
            F+
Sbjct  127  FY  128



>ref|WP_029968780.1| hypothetical protein [Desulfonauticus sp. A7A]
Length=959

 Score =   179 bits (453),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 94/110 (85%), Gaps = 2/110 (2%)
 Frame = +1

Query  304  CKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPL  483
            CK    L  H+KT A I+S+  DD NKVFGI F+TPPK++TG+PHILEHSVLCGS+KYP+
Sbjct  17   CKINYFL--HQKTKARILSIQIDDPNKVFGISFKTPPKDNTGLPHILEHSVLCGSKKYPV  74

Query  484  KKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  633
            K+PFVELLK SL TFLNA TYPD+TCYPVASTN +DFYNLVDVYLDAVFF
Sbjct  75   KEPFVELLKSSLQTFLNAMTYPDKTCYPVASTNLRDFYNLVDVYLDAVFF  124



>ref|WP_022074565.1| hypothetical protein [Firmicutes bacterium CAG:212]
 emb|CDA14806.1| putative uncharacterized protein [Firmicutes bacterium CAG:212]
Length=978

 Score =   179 bits (453),  Expect = 8e-48, Method: Composition-based stats.
 Identities = 78/122 (64%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
             +E + E  + + KS+  L KHKK+GA ++ + NDDENKVF I FRTPP +STG+PHI+E
Sbjct  8    AYELIQEADLSDIKSKGYLLKHKKSGARVLLMENDDENKVFTIGFRTPPSDSTGVPHIME  67

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGS+ +P+K PFVEL+KGSLNTFLNA TYPD+T YPVAS N KDF NL+ VY+DAV
Sbjct  68   HSVLCGSKNFPVKDPFVELVKGSLNTFLNAMTYPDKTVYPVASCNDKDFQNLMHVYMDAV  127

Query  628  FF  633
            F+
Sbjct  128  FY  129



>ref|WP_041670908.1| peptidase M16 [Acetobacterium woodii]
Length=973

 Score =   179 bits (453),  Expect = 8e-48, Method: Composition-based stats.
 Identities = 82/122 (67%), Positives = 99/122 (81%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
            GF    E+FVDE    A  + H+KTGA+ + +S +D+NKVF I FRTP  +STG+PHILE
Sbjct  10   GFILKKEEFVDEIDGYARTFVHQKTGAQCLYISAEDDNKVFSISFRTPSTDSTGVPHILE  69

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGS+KYP+K+PFVEL KGSLNTFLNA TYPD+T YP+ASTN KDF NL+DVYLDAV
Sbjct  70   HSVLCGSKKYPVKEPFVELAKGSLNTFLNAMTYPDKTMYPIASTNAKDFMNLMDVYLDAV  129

Query  628  FF  633
            F+
Sbjct  130  FY  131



>ref|WP_005424455.1| peptidase M16 [[Ruminococcus] obeum]
 gb|EDM88215.1| peptidase M16 inactive domain protein [Ruminococcus obeum ATCC 
29174]
Length=983

 Score =   178 bits (452),  Expect = 9e-48, Method: Composition-based stats.
 Identities = 81/122 (66%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = +1

Query  268  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILE  447
             ++ V ++ + + +S   L +H KTGA IM + NDD+NKVF I FRTPPKNSTG+ HILE
Sbjct  17   AYKLVRKENLSDIRSTGYLLRHIKTGARIMVIENDDDNKVFNIAFRTPPKNSTGVAHILE  76

Query  448  HSVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  627
            HSVLCGSR +PLK PFVEL+KGSLNTFLNA TYPD+TCYPVAS N +DF NL+ VYLDAV
Sbjct  77   HSVLCGSRDFPLKDPFVELVKGSLNTFLNAMTYPDKTCYPVASCNEQDFQNLMHVYLDAV  136

Query  628  FF  633
            F+
Sbjct  137  FY  138



>ref|WP_022262531.1| peptidase M16 family [Butyrivibrio sp. CAG:318]
 emb|CDC37775.1| peptidase M16 family [Butyrivibrio sp. CAG:318]
Length=977

 Score =   178 bits (452),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 78/120 (65%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = +1

Query  271  FEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKNSTGIPHILEH  450
            +E + E+ ++E KS   L++H+K+GA ++ ++NDDENKVF I FRTPP +STG+PHILEH
Sbjct  15   YELIQEERIEELKSDGYLFRHRKSGARVLILANDDENKVFSIGFRTPPPDSTGVPHILEH  74

Query  451  SVLCGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  630
            SVLCGS KYP+K PF+EL+KGSLNTFLNA TYPD+T YPVAS N  D+ NL+DVY+DAVF
Sbjct  75   SVLCGSAKYPVKDPFIELVKGSLNTFLNAMTYPDKTVYPVASCNDVDYRNLMDVYMDAVF  134



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 920235338500