BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS072A11

Length=542
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009761607.1|  PREDICTED: heat shock 70 kDa protein 15-like       259   1e-83   Nicotiana sylvestris
ref|XP_011072334.1|  PREDICTED: heat shock 70 kDa protein 15-like       259   7e-78   Sesamum indicum [beniseed]
gb|KJB35057.1|  hypothetical protein B456_006G098500                    255   7e-78   Gossypium raimondii
ref|XP_007024113.1|  Heat shock protein 91 isoform 2                    253   2e-77   
gb|KJB35056.1|  hypothetical protein B456_006G098500                    257   9e-77   Gossypium raimondii
gb|KHG16198.1|  Heat shock 70 kDa 15 -like protein                      256   9e-77   Gossypium arboreum [tree cotton]
gb|KHG16619.1|  Heat shock 70 kDa 15 -like protein                      256   1e-76   Gossypium arboreum [tree cotton]
ref|XP_007024112.1|  Heat shock protein 91 isoform 1                    255   4e-76   
ref|XP_002528199.1|  Heat shock 70 kDa protein, putative                254   6e-76   Ricinus communis
ref|XP_010539495.1|  PREDICTED: heat shock 70 kDa protein 15-like       254   1e-75   Tarenaya hassleriana [spider flower]
gb|KJB70511.1|  hypothetical protein B456_011G076800                    251   2e-75   Gossypium raimondii
ref|XP_009624163.1|  PREDICTED: heat shock 70 kDa protein 15-like       253   3e-75   Nicotiana tomentosiformis
gb|KDP37205.1|  hypothetical protein JCGZ_06261                         252   3e-75   Jatropha curcas
gb|KJB70509.1|  hypothetical protein B456_011G076800                    252   6e-75   Gossypium raimondii
ref|XP_011080863.1|  PREDICTED: heat shock 70 kDa protein 14-like       251   7e-75   Sesamum indicum [beniseed]
ref|XP_010521527.1|  PREDICTED: heat shock 70 kDa protein 15            251   9e-75   Tarenaya hassleriana [spider flower]
ref|XP_010538015.1|  PREDICTED: heat shock 70 kDa protein 14            250   1e-74   Tarenaya hassleriana [spider flower]
ref|XP_003546366.1|  PREDICTED: heat shock 70 kDa protein 14-like       250   2e-74   Glycine max [soybeans]
ref|XP_006389708.1|  hypothetical protein EUTSA_v100181451mg            245   2e-74   
gb|KDO51190.1|  hypothetical protein CISIN_1g003056mg                   248   4e-74   Citrus sinensis [apfelsine]
ref|XP_004252333.1|  PREDICTED: heat shock 70 kDa protein 15-like       249   4e-74   Solanum lycopersicum
gb|ACF83633.1|  unknown                                                 236   7e-74   Zea mays [maize]
ref|XP_010691292.1|  PREDICTED: heat shock 70 kDa protein 15-like       249   7e-74   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO51188.1|  hypothetical protein CISIN_1g003056mg                   248   7e-74   Citrus sinensis [apfelsine]
ref|XP_010925328.1|  PREDICTED: heat shock 70 kDa protein 14-like       249   8e-74   Elaeis guineensis
ref|XP_010915054.1|  PREDICTED: heat shock 70 kDa protein 14-like       248   8e-74   Elaeis guineensis
ref|XP_009610837.1|  PREDICTED: heat shock 70 kDa protein 14-like...    248   9e-74   Nicotiana tomentosiformis
gb|KDO51189.1|  hypothetical protein CISIN_1g003056mg                   248   1e-73   Citrus sinensis [apfelsine]
ref|XP_006427039.1|  hypothetical protein CICLE_v10024883mg             248   1e-73   Citrus clementina [clementine]
ref|XP_006465548.1|  PREDICTED: heat shock 70 kDa protein 14-like       248   1e-73   Citrus sinensis [apfelsine]
ref|XP_002279789.2|  PREDICTED: heat shock 70 kDa protein 14-like       247   2e-73   Vitis vinifera
ref|XP_009610834.1|  PREDICTED: heat shock 70 kDa protein 15-like...    247   3e-73   Nicotiana tomentosiformis
ref|XP_004252334.1|  PREDICTED: heat shock 70 kDa protein 15-like       247   3e-73   Solanum lycopersicum
ref|XP_010249783.1|  PREDICTED: heat shock 70 kDa protein 15-like       246   5e-73   Nelumbo nucifera [Indian lotus]
ref|XP_008354138.1|  PREDICTED: heat shock 70 kDa protein 15-like       241   6e-73   
ref|XP_009801414.1|  PREDICTED: heat shock 70 kDa protein 15-like       246   6e-73   Nicotiana sylvestris
ref|XP_008793460.1|  PREDICTED: heat shock 70 kDa protein 14-like       246   7e-73   Phoenix dactylifera
gb|KHN32604.1|  Heat shock 70 kDa protein 14                            246   7e-73   Glycine soja [wild soybean]
gb|EPS63387.1|  hypothetical protein M569_11394                         236   7e-73   Genlisea aurea
ref|XP_007150665.1|  hypothetical protein PHAVU_005G171400g             246   7e-73   Phaseolus vulgaris [French bean]
ref|XP_003543647.1|  PREDICTED: heat shock 70 kDa protein 14-like       246   8e-73   Glycine max [soybeans]
ref|XP_006346576.1|  PREDICTED: heat shock 70 kDa protein 15-like       246   8e-73   Solanum tuberosum [potatoes]
gb|EPS59607.1|  hypothetical protein M569_15197                         239   1e-72   Genlisea aurea
ref|XP_006346577.1|  PREDICTED: heat shock 70 kDa protein 15-like...    245   1e-72   Solanum tuberosum [potatoes]
ref|XP_002304187.1|  heat shock protein 70                              245   1e-72   Populus trichocarpa [western balsam poplar]
gb|EYU21549.1|  hypothetical protein MIMGU_mgv1a001311mg                245   1e-72   Erythranthe guttata [common monkey flower]
ref|XP_009587742.1|  PREDICTED: heat shock 70 kDa protein 15-like       245   1e-72   Nicotiana tomentosiformis
ref|XP_010254149.1|  PREDICTED: heat shock 70 kDa protein 15-like       245   2e-72   Nelumbo nucifera [Indian lotus]
ref|XP_006300740.1|  hypothetical protein CARUB_v10019803mg             245   2e-72   Capsella rubella
emb|CDO98063.1|  unnamed protein product                                245   2e-72   Coffea canephora [robusta coffee]
ref|XP_009388669.1|  PREDICTED: heat shock 70 kDa protein 14-like       244   2e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010033884.1|  PREDICTED: heat shock 70 kDa protein 14-like       245   2e-72   Eucalyptus grandis [rose gum]
emb|CCM07272.1|  Putative 97 kDa heat shock protein                     244   3e-72   Musa balbisiana [starchy banana]
gb|AAG52244.1|AC011717_12  putative heat-shock protein; 41956-44878     243   4e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010098045.1|  Heat shock 70 kDa protein 15                       244   4e-72   Morus notabilis
emb|CDY43337.1|  BnaC04g25190D                                          244   4e-72   Brassica napus [oilseed rape]
ref|NP_850984.4|  Heat shock protein 70                                 243   5e-72   
ref|XP_009408938.1|  PREDICTED: heat shock 70 kDa protein 15-like       244   5e-72   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAL38353.1|  putative heat-shock protein                             243   5e-72   Arabidopsis thaliana [mouse-ear cress]
ref|NP_178110.6|  Heat shock protein 70                                 243   7e-72   
ref|XP_010473008.1|  PREDICTED: heat shock 70 kDa protein 15-like       243   8e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010430044.1|  PREDICTED: heat shock 70 kDa protein 15            243   8e-72   
ref|XP_007217050.1|  hypothetical protein PRUPE_ppa001317mg             243   8e-72   Prunus persica
ref|XP_006392781.1|  hypothetical protein EUTSA_v10011242mg             243   8e-72   Eutrema salsugineum [saltwater cress]
ref|XP_010033879.1|  PREDICTED: heat shock 70 kDa protein 14-like       243   9e-72   Eucalyptus grandis [rose gum]
ref|XP_011000832.1|  PREDICTED: heat shock 70 kDa protein 14-like...    242   9e-72   Populus euphratica
ref|XP_010473009.1|  PREDICTED: heat shock 70 kDa protein 15-like       243   9e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010417777.1|  PREDICTED: heat shock 70 kDa protein 15-like...    243   9e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010417776.1|  PREDICTED: heat shock 70 kDa protein 15-like...    243   1e-71   Camelina sativa [gold-of-pleasure]
emb|CDX76065.1|  BnaA04g03290D                                          243   1e-71   
ref|XP_008228510.1|  PREDICTED: heat shock 70 kDa protein 15-like       243   1e-71   Prunus mume [ume]
ref|NP_001031305.1|  heat shock protein 91                              242   1e-71   Arabidopsis thaliana [mouse-ear cress]
gb|EYU24689.1|  hypothetical protein MIMGU_mgv1a001324mg                238   1e-71   Erythranthe guttata [common monkey flower]
ref|NP_178111.1|  heat shock protein 91                                 242   2e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010430043.1|  PREDICTED: heat shock 70 kDa protein 15-like       242   2e-71   Camelina sativa [gold-of-pleasure]
ref|XP_008786326.1|  PREDICTED: heat shock 70 kDa protein 15-like       242   2e-71   Phoenix dactylifera
ref|XP_011000830.1|  PREDICTED: heat shock 70 kDa protein 15-like...    242   2e-71   Populus euphratica
ref|XP_009147592.1|  PREDICTED: heat shock 70 kDa protein 14            241   2e-71   Brassica rapa
ref|XP_004506856.1|  PREDICTED: heat shock 70 kDa protein 15-like       242   3e-71   Cicer arietinum [garbanzo]
emb|CDY45119.1|  BnaC06g06400D                                          243   3e-71   Brassica napus [oilseed rape]
ref|XP_004506857.1|  PREDICTED: heat shock 70 kDa protein 15-like       241   3e-71   Cicer arietinum [garbanzo]
gb|AFW81561.1|  hypothetical protein ZEAMMB73_352123                    236   3e-71   
emb|CDY24089.1|  BnaA06g00870D                                          241   3e-71   Brassica napus [oilseed rape]
ref|XP_009139126.1|  PREDICTED: heat shock 70 kDa protein 15            241   4e-71   Brassica rapa
ref|XP_006287070.1|  hypothetical protein CARUB_v10000229mg             241   4e-71   Capsella rubella
ref|XP_002887853.1|  hypothetical protein ARALYDRAFT_896005             241   5e-71   Arabidopsis lyrata subsp. lyrata
emb|CAA94389.1|  heat-shock protein                                     241   6e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002439385.1|  hypothetical protein SORBIDRAFT_09g005580          241   7e-71   Sorghum bicolor [broomcorn]
ref|XP_009389931.1|  PREDICTED: heat shock 70 kDa protein 14-like       240   8e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011013254.1|  PREDICTED: heat shock 70 kDa protein 15-like       240   1e-70   Populus euphratica
ref|XP_003529646.1|  PREDICTED: heat shock 70 kDa protein 15-like...    239   2e-70   
gb|EYU24688.1|  hypothetical protein MIMGU_mgv1a001324mg                239   2e-70   Erythranthe guttata [common monkey flower]
ref|XP_003531683.1|  PREDICTED: heat shock 70 kDa protein 14-like...    238   4e-70   Glycine max [soybeans]
gb|KHN47807.1|  Heat shock 70 kDa protein 14                            238   4e-70   Glycine soja [wild soybean]
ref|XP_006585595.1|  PREDICTED: heat shock 70 kDa protein 14-like...    238   4e-70   Glycine max [soybeans]
ref|XP_010925584.1|  PREDICTED: heat shock 70 kDa protein 14-like       238   4e-70   Elaeis guineensis
ref|XP_003597778.1|  97 kDa heat shock protein                          238   5e-70   Medicago truncatula
ref|NP_001151579.1|  heat shock 70 kDa protein 4                        238   6e-70   Zea mays [maize]
gb|ACG43420.1|  heat shock 70 kDa protein 4                             238   8e-70   Zea mays [maize]
ref|XP_006643833.1|  PREDICTED: heat shock 70 kDa protein 14-like       238   8e-70   Oryza brachyantha
ref|XP_004960855.1|  PREDICTED: heat shock 70 kDa protein 15-like...    238   9e-70   Setaria italica
ref|XP_008655087.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    238   9e-70   Zea mays [maize]
ref|XP_008654914.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    237   9e-70   
ref|NP_001147805.1|  heat shock 70 kDa protein 4                        237   9e-70   Zea mays [maize]
ref|XP_008775317.1|  PREDICTED: heat shock 70 kDa protein 14-like       237   1e-69   Phoenix dactylifera
ref|XP_007135698.1|  hypothetical protein PHAVU_010G150800g             237   1e-69   Phaseolus vulgaris [French bean]
ref|XP_006842242.1|  hypothetical protein AMTR_s00078p00190750          237   1e-69   Amborella trichopoda
ref|XP_009358191.1|  PREDICTED: heat shock 70 kDa protein 15-like       236   2e-69   Pyrus x bretschneideri [bai li]
ref|XP_009358190.1|  PREDICTED: heat shock 70 kDa protein 15-like       236   2e-69   Pyrus x bretschneideri [bai li]
ref|XP_002440718.1|  hypothetical protein SORBIDRAFT_09g005570          236   2e-69   Sorghum bicolor [broomcorn]
ref|XP_004960853.1|  PREDICTED: heat shock 70 kDa protein 14-like...    236   3e-69   Setaria italica
gb|EMS61926.1|  Heat shock 70 kDa protein 4L                            236   3e-69   Triticum urartu
ref|XP_009399777.1|  PREDICTED: heat shock 70 kDa protein 14-like       236   3e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010231645.1|  PREDICTED: heat shock 70 kDa protein 14-like       236   3e-69   
ref|XP_004960852.1|  PREDICTED: heat shock 70 kDa protein 14-like...    236   4e-69   
gb|EMT09857.1|  Heat shock 70 kDa protein 4L                            236   5e-69   
ref|XP_008647466.1|  PREDICTED: uncharacterized protein LOC100217...    235   6e-69   
gb|EAY72790.1|  hypothetical protein OsI_00654                          235   6e-69   Oryza sativa Indica Group [Indian rice]
ref|XP_008362708.1|  PREDICTED: heat shock 70 kDa protein 15-like       235   7e-69   
ref|NP_001042210.1|  Os01g0180800                                       235   7e-69   
ref|XP_008371663.1|  PREDICTED: heat shock 70 kDa protein 15-like       235   8e-69   
ref|XP_010231644.1|  PREDICTED: heat shock 70 kDa protein 15-like       235   8e-69   Brachypodium distachyon [annual false brome]
ref|XP_002299641.1|  heat shock protein 70                              235   9e-69   Populus trichocarpa [western balsam poplar]
ref|XP_008649434.1|  PREDICTED: heat shock 70 kDa protein 14-like       234   1e-68   Zea mays [maize]
ref|XP_004302913.1|  PREDICTED: heat shock 70 kDa protein 15-like       233   2e-68   Fragaria vesca subsp. vesca
ref|XP_008462146.1|  PREDICTED: heat shock 70 kDa protein 15-like       233   3e-68   Cucumis melo [Oriental melon]
gb|EMT31029.1|  Heat shock 70 kDa protein 4L                            233   3e-68   
gb|AFW77408.1|  hypothetical protein ZEAMMB73_835876                    235   3e-68   
ref|XP_004141777.1|  PREDICTED: heat shock 70 kDa protein 15-like       233   6e-68   Cucumis sativus [cucumbers]
gb|KEH28782.1|  heat shock 70 kDa protein                               233   6e-68   Medicago truncatula
gb|EMS52665.1|  Heat shock 70 kDa protein 4L                            234   2e-67   Triticum urartu
gb|EAY96776.1|  hypothetical protein OsI_18700                          231   3e-67   Oryza sativa Indica Group [Indian rice]
dbj|BAJ90753.1|  predicted protein                                      231   3e-67   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001054812.1|  Os05g0181000                                       231   3e-67   
gb|AFG63451.1|  hypothetical protein UMN_2640_01                        213   4e-67   Pinus taeda
ref|XP_008354139.1|  PREDICTED: heat shock 70 kDa protein 15-like       229   1e-66   
ref|XP_001764380.1|  predicted protein                                  227   5e-66   
ref|XP_001755636.1|  predicted protein                                  226   1e-65   
ref|XP_006654112.1|  PREDICTED: heat shock 70 kDa protein 15-like       223   1e-64   Oryza brachyantha
ref|XP_001760080.1|  predicted protein                                  222   3e-64   
ref|XP_002986462.1|  hypothetical protein SELMODRAFT_124091             215   7e-62   
ref|XP_002978946.1|  hypothetical protein SELMODRAFT_109750             213   4e-61   
ref|XP_008363587.1|  PREDICTED: heat shock 70 kDa protein 16-like       199   6e-59   
ref|XP_002317001.1|  hypothetical protein POPTR_0011s14240g             205   3e-58   Populus trichocarpa [western balsam poplar]
ref|XP_008353314.1|  PREDICTED: heat shock 70 kDa protein 16-like       198   4e-58   
ref|XP_008226915.1|  PREDICTED: heat shock 70 kDa protein 16            204   7e-58   Prunus mume [ume]
ref|XP_007213641.1|  hypothetical protein PRUPE_ppa001697mg             204   7e-58   Prunus persica
ref|XP_008366399.1|  PREDICTED: heat shock 70 kDa protein 16-like       203   1e-57   
ref|XP_008345050.1|  PREDICTED: heat shock 70 kDa protein 16-like       197   1e-57   
ref|XP_011030786.1|  PREDICTED: heat shock 70 kDa protein 16-like...    203   1e-57   Populus euphratica
ref|XP_011030785.1|  PREDICTED: heat shock 70 kDa protein 16-like...    203   1e-57   Populus euphratica
ref|XP_008355346.1|  PREDICTED: heat shock 70 kDa protein 16-like       197   1e-56   
gb|KCW67010.1|  hypothetical protein EUGRSUZ_F00767                     199   3e-56   Eucalyptus grandis [rose gum]
ref|XP_009352450.1|  PREDICTED: heat shock 70 kDa protein 16-like       199   3e-56   Pyrus x bretschneideri [bai li]
ref|XP_009372708.1|  PREDICTED: heat shock 70 kDa protein 16-like...    199   4e-56   Pyrus x bretschneideri [bai li]
gb|AII99893.1|  heat shock protein                                      199   5e-56   Cicer arietinum [garbanzo]
ref|XP_009372707.1|  PREDICTED: heat shock 70 kDa protein 16-like...    199   5e-56   Pyrus x bretschneideri [bai li]
ref|XP_010060358.1|  PREDICTED: heat shock 70 kDa protein 16            199   5e-56   Eucalyptus grandis [rose gum]
ref|XP_009352433.1|  PREDICTED: heat shock 70 kDa protein 16-like       199   5e-56   Pyrus x bretschneideri [bai li]
ref|XP_010092150.1|  Heat shock 70 kDa protein 16                       198   7e-56   
ref|XP_003600064.1|  Heat shock 70 kDa protein 4L                       198   9e-56   Medicago truncatula
gb|KDP39123.1|  hypothetical protein JCGZ_00880                         198   1e-55   Jatropha curcas
ref|XP_004500055.1|  PREDICTED: heat shock 70 kDa protein 16-like       197   1e-55   Cicer arietinum [garbanzo]
gb|EYU27799.1|  hypothetical protein MIMGU_mgv1a001740mg                197   1e-55   Erythranthe guttata [common monkey flower]
ref|XP_009760615.1|  PREDICTED: heat shock 70 kDa protein 16            197   2e-55   Nicotiana sylvestris
gb|EYU27798.1|  hypothetical protein MIMGU_mgv1a001740mg                197   2e-55   Erythranthe guttata [common monkey flower]
ref|XP_004151979.1|  PREDICTED: heat shock 70 kDa protein 16-like       196   3e-55   Cucumis sativus [cucumbers]
ref|XP_004167874.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock 7...    196   3e-55   
gb|AET00484.2|  heat shock 70 kDa protein                               196   6e-55   Medicago truncatula
ref|XP_003617525.1|  97 kDa heat shock protein                          196   7e-55   
ref|XP_009614255.1|  PREDICTED: heat shock 70 kDa protein 16            195   7e-55   Nicotiana tomentosiformis
ref|XP_007020850.1|  Heat shock protein 70 family protein               194   1e-54   
ref|XP_002522946.1|  Heat-shock protein 105 kDa, putative               194   1e-54   
ref|XP_008465078.1|  PREDICTED: heat shock 70 kDa protein 16            194   3e-54   Cucumis melo [Oriental melon]
ref|XP_002278262.1|  PREDICTED: heat shock 70 kDa protein 16            192   8e-54   Vitis vinifera
ref|XP_006858197.1|  hypothetical protein AMTR_s00062p00170870          190   1e-53   
ref|XP_010278704.1|  PREDICTED: heat shock 70 kDa protein 16            192   1e-53   Nelumbo nucifera [Indian lotus]
ref|XP_011096072.1|  PREDICTED: heat shock 70 kDa protein 16            191   2e-53   Sesamum indicum [beniseed]
ref|XP_010931798.1|  PREDICTED: heat shock 70 kDa protein 16            191   2e-53   Elaeis guineensis
ref|XP_004232717.1|  PREDICTED: heat shock 70 kDa protein 16            191   3e-53   Solanum lycopersicum
ref|XP_007020851.1|  Heat shock protein 70 family protein               190   5e-53   
gb|AII99889.1|  heat shock protein                                      190   6e-53   Cicer arietinum [garbanzo]
ref|XP_004491392.1|  PREDICTED: heat shock 70 kDa protein 16-like       190   7e-53   Cicer arietinum [garbanzo]
ref|XP_010665569.1|  PREDICTED: heat shock 70 kDa protein 16            189   1e-52   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006348107.1|  PREDICTED: heat shock 70 kDa protein 16-like...    188   3e-52   Solanum tuberosum [potatoes]
gb|KJB69295.1|  hypothetical protein B456_011G014900                    187   4e-52   Gossypium raimondii
ref|XP_003553093.1|  PREDICTED: heat shock 70 kDa protein 16-like       187   5e-52   Glycine max [soybeans]
gb|KHN45217.1|  Heat shock 70 kDa protein 16                            187   5e-52   Glycine soja [wild soybean]
ref|XP_008365284.1|  PREDICTED: heat shock 70 kDa protein 16            186   8e-52   
ref|XP_008806739.1|  PREDICTED: heat shock 70 kDa protein 16 isof...    186   1e-51   Phoenix dactylifera
ref|XP_008806738.1|  PREDICTED: heat shock 70 kDa protein 16 isof...    186   1e-51   Phoenix dactylifera
ref|XP_007146461.1|  hypothetical protein PHAVU_006G042400g             186   2e-51   Phaseolus vulgaris [French bean]
ref|XP_006306833.1|  hypothetical protein CARUB_v10008380mg             185   2e-51   
ref|XP_006306834.1|  hypothetical protein CARUB_v10008380mg             185   3e-51   Capsella rubella
ref|XP_004294376.1|  PREDICTED: heat shock 70 kDa protein 16            185   4e-51   Fragaria vesca subsp. vesca
emb|CDP04389.1|  unnamed protein product                                185   4e-51   Coffea canephora [robusta coffee]
ref|XP_002305580.2|  hypothetical protein POPTR_0004s01640g             184   5e-51   
ref|XP_011037663.1|  PREDICTED: heat shock 70 kDa protein 16            184   5e-51   Populus euphratica
ref|XP_006595737.1|  PREDICTED: heat shock 70 kDa protein 16-like...    184   8e-51   Glycine max [soybeans]
ref|XP_006595736.1|  PREDICTED: heat shock 70 kDa protein 16-like...    184   9e-51   Glycine max [soybeans]
emb|CBI36157.3|  unnamed protein product                                184   1e-50   Vitis vinifera
ref|XP_006475182.1|  PREDICTED: heat shock 70 kDa protein 16-like...    182   3e-50   
ref|XP_006452327.1|  hypothetical protein CICLE_v10007538mg             182   4e-50   Citrus clementina [clementine]
gb|KJB22069.1|  hypothetical protein B456_004G027900                    182   4e-50   Gossypium raimondii
gb|KJB22068.1|  hypothetical protein B456_004G027900                    181   9e-50   Gossypium raimondii
gb|KHG25442.1|  Heat shock 70 kDa 16 -like protein                      181   1e-49   Gossypium arboreum [tree cotton]
gb|KHM99573.1|  Heat shock 70 kDa protein 16                            181   1e-49   Glycine soja [wild soybean]
ref|XP_003532123.1|  PREDICTED: heat shock 70 kDa protein 16-like       181   1e-49   Glycine max [soybeans]
gb|KDO75458.1|  hypothetical protein CISIN_1g004211mg                   180   2e-49   Citrus sinensis [apfelsine]
ref|XP_010493114.1|  PREDICTED: heat shock 70 kDa protein 16-like       180   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_002889885.1|  hypothetical protein ARALYDRAFT_888478             180   2e-49   
ref|XP_006468028.1|  PREDICTED: heat shock 70 kDa protein 16-like       180   2e-49   Citrus sinensis [apfelsine]
ref|NP_172631.2|  heat shock protein 70 (Hsp 70) family protein         180   2e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010476099.1|  PREDICTED: heat shock 70 kDa protein 16            180   3e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010458573.1|  PREDICTED: heat shock 70 kDa protein 16-like       179   3e-49   Camelina sativa [gold-of-pleasure]
ref|XP_007142282.1|  hypothetical protein PHAVU_008G267400g             179   6e-49   Phaseolus vulgaris [French bean]
gb|EPS74057.1|  hypothetical protein M569_00693                         177   1e-48   Genlisea aurea
ref|XP_006417329.1|  hypothetical protein EUTSA_v10006883mg             177   2e-48   Eutrema salsugineum [saltwater cress]
ref|XP_009148495.1|  PREDICTED: heat shock 70 kDa protein 16            175   9e-48   Brassica rapa
emb|CDX97975.1|  BnaA06g07260D                                          175   1e-47   
emb|CDY49794.1|  BnaCnng18070D                                          175   2e-47   Brassica napus [oilseed rape]
ref|XP_010533816.1|  PREDICTED: heat shock 70 kDa protein 16            166   1e-44   Tarenaya hassleriana [spider flower]
ref|XP_009420545.1|  PREDICTED: heat shock 70 kDa protein 16            166   2e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001695858.1|  heat shock protein 70E                             166   3e-44   Chlamydomonas reinhardtii
ref|XP_002949519.1|  heat shock protein Hsp70E                          162   8e-43   Volvox carteri f. nagariensis
ref|XP_003082170.1|  heat shock protein 91-Arabidopsis thaliana (...    159   9e-42   
ref|XP_005642775.1|  heat shock protein 70E                             159   1e-41   Coccomyxa subellipsoidea C-169
emb|CEF99759.1|  Heat shock protein 70 family                           159   1e-41   Ostreococcus tauri
ref|XP_002973871.1|  hypothetical protein SELMODRAFT_267697             156   8e-41   
ref|XP_002969191.1|  hypothetical protein SELMODRAFT_440676             156   8e-41   
ref|XP_006449032.1|  hypothetical protein CICLE_v10014383mg             152   2e-39   
ref|XP_006449031.1|  hypothetical protein CICLE_v10014383mg             152   3e-39   
ref|XP_002505210.1|  heat shock protein 70                              152   3e-39   Micromonas commoda
ref|XP_003060408.1|  heat shock protein 70                              144   3e-36   Micromonas pusilla CCMP1545
gb|KDD72574.1|  heat shock protein Hsp70                                131   9e-35   Helicosporidium sp. ATCC 50920
ref|XP_011304595.1|  PREDICTED: 97 kDa heat shock protein isoform X2    139   1e-34   Fopius arisanus
ref|XP_011304586.1|  PREDICTED: 97 kDa heat shock protein isoform X1    139   2e-34   Fopius arisanus
ref|XP_003485911.1|  PREDICTED: heat shock 70 kDa protein 4L-like       139   2e-34   Bombus impatiens
ref|XP_001641799.1|  predicted protein                                  138   4e-34   Nematostella vectensis
ref|XP_003702344.1|  PREDICTED: 97 kDa heat shock protein-like          137   6e-34   Megachile rotundata
ref|XP_006615729.1|  PREDICTED: 97 kDa heat shock protein-like is...    137   7e-34   Apis dorsata [rock honeybee]
ref|XP_006561225.1|  PREDICTED: 97 kDa heat shock protein isoform X2    137   8e-34   Apis mellifera [bee]
ref|XP_006615728.1|  PREDICTED: 97 kDa heat shock protein-like is...    137   8e-34   Apis dorsata [rock honeybee]
ref|XP_623199.2|  PREDICTED: 97 kDa heat shock protein isoformX1        137   8e-34   Apis mellifera [bee]
ref|XP_003691374.1|  PREDICTED: heat shock 70 kDa protein 4L-like       137   8e-34   Apis florea [dwarf honeybee]
ref|XP_003394081.1|  PREDICTED: heat shock 70 kDa protein 4L-like       137   9e-34   Bombus terrestris [large earth bumblebee]
ref|XP_005846866.1|  hypothetical protein CHLNCDRAFT_35731              137   1e-33   Chlorella variabilis
sp|Q06068.2|HSP97_STRPU  RecName: Full=97 kDa heat shock protein;...    136   2e-33   Strongylocentrotus purpuratus [purple urchin]
ref|NP_999695.1|  97 kDa heat shock protein                             136   2e-33   Strongylocentrotus purpuratus [purple urchin]
sp|Q94738.1|HSP97_STRFN  RecName: Full=97 kDa heat shock protein;...    135   3e-33   Mesocentrotus franciscanus
ref|XP_011399703.1|  97 kDa heat shock protein                          134   3e-33   Auxenochlorella protothecoides
ref|XP_011256245.1|  PREDICTED: heat shock 70 kDa protein 4L isof...    133   2e-32   Camponotus floridanus
ref|XP_011256244.1|  PREDICTED: heat shock 70 kDa protein 4L isof...    133   2e-32   Camponotus floridanus
ref|XP_011162513.1|  PREDICTED: 97 kDa heat shock protein isoform X2    133   3e-32   Solenopsis invicta [imported red fire ant]
ref|XP_011162512.1|  PREDICTED: 97 kDa heat shock protein isoform X1    133   3e-32   Solenopsis invicta [imported red fire ant]
gb|KJE91467.1|  hsp97-like protein                                      132   4e-32   Capsaspora owczarzaki ATCC 30864
ref|XP_011052836.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    132   4e-32   Acromyrmex echinatior
ref|XP_011052837.1|  PREDICTED: 97 kDa heat shock protein isoform X2    132   4e-32   Acromyrmex echinatior
ref|XP_004349347.1|  hsp97-like protein                                 131   1e-31   Capsaspora owczarzaki ATCC 30864
ref|XP_008557093.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    131   1e-31   Microplitis demolitor
gb|EHJ64651.1|  hypothetical protein KGM_00738                          130   1e-31   
ref|XP_011154271.1|  PREDICTED: heat shock 70 kDa protein 4L            130   2e-31   Harpegnathos saltator
ref|XP_002585532.1|  hypothetical protein BRAFLDRAFT_111895             126   3e-31   Branchiostoma floridae
ref|XP_008557094.1|  PREDICTED: 97 kDa heat shock protein isoform X2    129   4e-31   
ref|XP_008191928.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    129   5e-31   Tribolium castaneum [rust-red flour beetle]
ref|XP_004927888.1|  PREDICTED: 97 kDa heat shock protein-like          129   5e-31   Bombyx mori [silk moth]
ref|XP_008191929.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    129   6e-31   Tribolium castaneum [rust-red flour beetle]
ref|XP_011497941.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    128   1e-30   Ceratosolen solmsi marchali
ref|XP_002431004.1|  Heat-shock protein 105 kDa, putative               128   1e-30   Pediculus humanus corporis [human body lice]
ref|XP_011497950.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    128   1e-30   Ceratosolen solmsi marchali
gb|EHK40353.1|  hypothetical protein TRIATDRAFT_128447                  127   2e-30   Trichoderma atroviride IMI 206040
ref|XP_005819695.1|  hypothetical protein GUITHDRAFT_166641             128   2e-30   Guillardia theta CCMP2712
gb|AEB26316.1|  heat shock protein 105                                  127   2e-30   Helicoverpa armigera [American bollworm]
dbj|BAA97566.1|  hsp70                                                  126   2e-30   Blastocystis hominis
ref|XP_002585896.1|  hypothetical protein BRAFLDRAFT_256670             126   5e-30   Branchiostoma floridae
ref|XP_011339673.1|  PREDICTED: 97 kDa heat shock protein isoform X2    125   1e-29   
ref|XP_011339672.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    125   1e-29   Ooceraea biroi
ref|XP_003687776.1|  hypothetical protein TPHA_0K02090                  124   1e-29   Tetrapisispora phaffii CBS 4417
ref|XP_006003281.1|  PREDICTED: heat shock 70 kDa protein 4             124   2e-29   
gb|KIK59701.1|  hypothetical protein GYMLUDRAFT_201113                  123   2e-29   
gb|ENN79035.1|  hypothetical protein YQE_04502                          124   3e-29   
gb|ERL85506.1|  hypothetical protein D910_02925                         124   3e-29   
gb|KFM56735.1|  heat shock protein                                      124   4e-29   
ref|XP_007389090.1|  heat shock protein 70                              122   7e-29   
ref|XP_011424694.1|  PREDICTED: heat shock 70 kDa protein 4-like        121   1e-28   
emb|CDO64077.1|  heat shock protein 70, putative                        122   1e-28   
gb|ELT92200.1|  hypothetical protein CAPTEDRAFT_221226                  122   1e-28   
gb|EKC30577.1|  hypothetical protein CGI_10017255                       121   1e-28   
ref|XP_005177158.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    122   2e-28   
ref|XP_005177155.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    122   2e-28   
gb|KIR24989.1|  hsp72-like protein                                      115   2e-28   
gb|KHN76490.1|  Uncharacterized protein C30C11.4                        120   3e-28   
gb|KDQ18475.1|  hypothetical protein BOTBODRAFT_154372                  120   3e-28   
emb|CDO70718.1|  hypothetical protein BN946_scf184798.g33               120   3e-28   
gb|ERZ96294.1|  hypothetical protein GLOINDRAFT_12777                   120   4e-28   
gb|KDQ33571.1|  hypothetical protein PLEOSDRAFT_1052407                 120   4e-28   
gb|EPT05848.1|  hypothetical protein FOMPIDRAFT_1021055                 120   4e-28   
ref|XP_007003338.1|  hypothetical protein TREMEDRAFT_43142              120   4e-28   
gb|KIK06501.1|  hypothetical protein K443DRAFT_674159                   120   4e-28   
ref|XP_004255736.1|  heat shock protein, putative                       112   5e-28   
ref|XP_004338433.1|  HSP91 (Heat shock protein 91), putative            120   6e-28   
ref|XP_001878586.1|  predicted protein                                  119   7e-28   
ref|XP_008036836.1|  heat shock protein                                 119   7e-28   
dbj|BAM44861.1|  heat shock protein                                     116   7e-28   
ref|XP_806460.1|  heat shock 70 kDa protein                             114   8e-28   
gb|KDR19282.1|  Heat shock 70 kDa protein 4L                            120   8e-28   
gb|ETW18876.1|  hsp70-like protein                                      119   8e-28   
gb|KII89044.1|  hypothetical protein PLICRDRAFT_109952                  119   9e-28   
gb|KDQ59435.1|  hypothetical protein JAAARDRAFT_32998                   119   9e-28   
gb|AEX60710.1|  Hsp70-x                                                 119   9e-28   
ref|XP_008598905.1|  heat shock protein 70-2                            119   9e-28   
ref|XP_009542365.1|  hypothetical protein HETIRDRAFT_310898             119   9e-28   
gb|KJA20216.1|  hypothetical protein HYPSUDRAFT_43335                   119   1e-27   
ref|XP_004320561.1|  PREDICTED: heat shock 70 kDa protein 4-like        113   1e-27   
emb|CCO26137.1|  Heat shock protein SSB                                 119   1e-27   
gb|EMD38594.1|  hypothetical protein CERSUDRAFT_105182                  119   1e-27   
gb|ETW31578.1|  hsp70-like protein                                      119   1e-27   
ref|XP_007847651.1|  heat shock protein sks2                            119   1e-27   
emb|CAA81135.1|  heat shock protein                                     119   1e-27   
emb|CDH59379.1|  heat shock protein                                     119   1e-27   
gb|AGM32458.1|  cytoplasmic heat shock protein 70                       115   1e-27   
ref|XP_007301367.1|  heat shock protein 70                              118   1e-27   
gb|ABD85255.1|  heat shock protein 70                                   112   1e-27   
emb|CDJ62090.1|  Heat shock protein, related                            119   1e-27   
gb|EKF27699.1|  heat shock 70 kDa protein, putative                     115   2e-27   
ref|XP_008202915.1|  PREDICTED: heat shock 70 kDa protein 4L isof...    119   2e-27   
gb|EJU05725.1|  heat shock protein 70                                   118   2e-27   
ref|XP_008202916.1|  PREDICTED: heat shock 70 kDa protein 4L isof...    119   2e-27   
ref|XP_007270891.1|  chaperone protein BipA                             119   2e-27   
ref|XP_007863613.1|  heat shock protein 70                              118   2e-27   
gb|KIM49447.1|  hypothetical protein M413DRAFT_438630                   118   2e-27   
ref|NP_498868.1|  Protein C30C11.4                                      119   2e-27   
ref|XP_003104191.1|  hypothetical protein CRE_00953                     119   2e-27   
gb|KFY50117.1|  hypothetical protein V496_09590                         118   2e-27   
gb|KIL68610.1|  hypothetical protein M378DRAFT_158432                   118   2e-27   
emb|CDF44000.1|  hypothetical protein BofuT4P114000012001               118   2e-27   
gb|AAA35095.1|  70kDal heat shock protein                               115   2e-27   
ref|XP_811549.1|  heat shock 70 kDa protein                             114   3e-27   
ref|XP_007402330.1|  hypothetical protein PHACADRAFT_265825             117   3e-27   
emb|CDJ44218.1|  hypothetical protein ETH_00000210                      118   3e-27   
gb|KDP41952.1|  hypothetical protein JCGZ_26970                         117   3e-27   
ref|XP_010678753.1|  PREDICTED: heat shock 70 kDa protein 18-like       117   3e-27   
ref|XP_011190144.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    118   3e-27   
gb|AET50612.1|  hypothetical protein                                    118   3e-27   
gb|KIJ69340.1|  hypothetical protein HYDPIDRAFT_36410                   117   4e-27   
emb|CDS10615.1|  hypothetical protein LRAMOSA11101                      118   4e-27   
ref|XP_002911943.1|  heat shock protein                                 117   4e-27   
emb|CCM02852.1|  predicted protein                                      117   4e-27   
gb|KIJ17459.1|  hypothetical protein PAXINDRAFT_73182                   117   4e-27   
ref|XP_011190138.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    118   4e-27   
gb|KGB79179.1|  glucose-regulated protein                               113   4e-27   
gb|AAC26629.1|  heat shock protein 70                                   117   4e-27   
emb|CBK24438.2|  unnamed protein product                                117   4e-27   
ref|XP_006458814.1|  heat shock HSP70 protein                           117   4e-27   
gb|KIK31153.1|  hypothetical protein PISMIDRAFT_134034                  117   5e-27   
ref|XP_003035960.1|  hypothetical protein SCHCODRAFT_65817              117   5e-27   
gb|KIK97082.1|  hypothetical protein PAXRUDRAFT_137049                  117   5e-27   
gb|AAC72001.1|  heat shock protein 70                                   117   5e-27   
ref|XP_568651.1|  heat shock protein                                    117   5e-27   
gb|AAC84134.1|  heat shock protein                                      110   5e-27   
ref|XP_002365977.1|  heat shock protein 70, putative                    117   5e-27   
emb|CBK24647.2|  unnamed protein product                                117   5e-27   
gb|KIO13411.1|  hypothetical protein M404DRAFT_992969                   117   5e-27   
ref|XP_805703.1|  heat shock 70 kDa protein                             115   5e-27   
ref|XP_008882675.1|  heat shock protein HSP70                           117   5e-27   
gb|EKF38332.1|  heat shock 70 kDa protein, putative                     115   5e-27   
gb|AAO66452.5|  heat shock protein 70                                   117   5e-27   
emb|CDS05536.1|  hypothetical protein LRAMOSA08064                      117   5e-27   
dbj|BAB20284.1|  hsp70                                                  117   5e-27   
ref|XP_002174397.1|  heat shock protein                                 117   5e-27   
ref|XP_002173111.1|  heat shock protein                                 117   5e-27   
emb|CCD15027.1|  unnamed protein product                                117   5e-27   
ref|XP_003883640.1|  Heat shock protein 70, related                     117   5e-27   
gb|KFB38249.1|  AGAP010331-PA-like protein                              117   5e-27   
gb|KDR81815.1|  hypothetical protein GALMADRAFT_240042                  117   6e-27   
gb|ACC93947.1|  heat-shock protein 70                                   117   6e-27   
ref|XP_008869434.1|  hypothetical protein H310_06229                    117   6e-27   
emb|CCL98188.1|  predicted protein                                      117   6e-27   
ref|XP_008483643.1|  PREDICTED: heat shock protein 70 A1-like           110   6e-27   
ref|XP_007321970.1|  hypothetical protein SERLADRAFT_475629             117   6e-27   
ref|XP_006220075.1|  PREDICTED: heat shock 70 kDa protein A-like        111   6e-27   
gb|KIM65321.1|  hypothetical protein SCLCIDRAFT_541821                  117   6e-27   
gb|ADN44262.1|  heat shock protein 70                                   117   6e-27   
ref|XP_005537819.1|  heat shock protein Hsp70, cytosolic                117   7e-27   
gb|ADZ45037.1|  heat shock protein 70                                   117   7e-27   
gb|KDP41951.1|  hypothetical protein JCGZ_26969                         117   7e-27   
ref|XP_010937656.1|  PREDICTED: probable mediator of RNA polymera...    117   7e-27   
gb|AAB34280.1|  70 kda heat shock protein                               112   7e-27   
gb|KIY66276.1|  heat shock protein 70                                   116   7e-27   
ref|XP_002781830.1|  heat shock protein 70, putative                    110   7e-27   
ref|XP_008469279.1|  PREDICTED: heat shock protein 105 kDa-like         115   8e-27   
gb|AAR17057.1|  HSP70                                                   110   8e-27   
ref|XP_006670013.1|  heat shock 70 kDa protein                          117   8e-27   
ref|XP_010929169.1|  PREDICTED: heat shock 70 kDa protein-like          117   8e-27   
ref|XP_568652.1|  heat shock protein                                    117   8e-27   
gb|EPB87687.1|  heat shock 70kDa protein 4                              117   8e-27   
gb|KIR50397.1|  hsp75-like protein                                      116   8e-27   
gb|KDR08212.1|  Heat shock 70 kDa protein cognate 2                     116   8e-27   
ref|XP_002840352.1|  hypothetical protein                               116   8e-27   
ref|NP_595438.1|  heat shock protein, ribosome associated molecul...    116   9e-27   
emb|CEG71289.1|  Putative Heat shock 70kDa protein 4                    117   9e-27   
dbj|BAA20093.1|  Heat-Shock Protein                                     116   9e-27   
gb|KFY30850.1|  hypothetical protein V493_01619                         116   9e-27   
ref|XP_006493389.1|  PREDICTED: heat shock 70 kDa protein-like          116   9e-27   
gb|EMD49224.1|  heat shock protein hsp70A2, putative                    110   9e-27   
dbj|BAC35620.1|  unnamed protein product                                112   1e-26   
dbj|BAA12279.1|  heat shock cognate                                     116   1e-26   
gb|EUC67144.1|  heat shock protein SSB1                                 116   1e-26   
ref|XP_002642168.1|  Hypothetical protein CBG18133                      117   1e-26   
gb|EWM22964.1|  heat shock protein 70                                   117   1e-26   
gb|KDO55354.1|  hypothetical protein CISIN_1g043296mg                   116   1e-26   
gb|EJT52733.1|  heat shock protein                                      116   1e-26   
sp|P05456.1|HSP70_TRYCR  RecName: Full=Heat shock 70 kDa protein        116   1e-26   
gb|EET00398.1|  Cytosolic HSP70                                         116   1e-26   
ref|XP_001914478.1|  heat shock protein70, hsp70A2                      109   1e-26   
ref|XP_011082530.1|  PREDICTED: heat shock 70 kDa protein-like          116   1e-26   
gb|KIY51034.1|  heat shock protein 70                                   116   1e-26   
ref|XP_006826662.1|  hypothetical protein AMTR_s00137p00032560          116   1e-26   
gb|AAT92549.1|  hsp70                                                   116   1e-26   
gb|ESU40913.1|  Heat shock protein 70                                   116   1e-26   
dbj|GAN04884.1|  heat shock protein                                     116   1e-26   
emb|CDH09973.1|  Heat shock protein SSA2                                116   1e-26   
ref|XP_001295355.1|  cytoplasmic heat shock protein 70                  113   1e-26   
gb|AFJ20626.1|  heat shock protein 70                                   116   1e-26   
gb|KHN76389.1|  Heat shock 70 kDa protein A                             114   1e-26   
ref|XP_001707970.1|  Cytosolic HSP70                                    116   1e-26   
gb|EFO65449.1|  Cytosolic HSP70                                         116   1e-26   
ref|XP_005242837.1|  PREDICTED: heat shock 70 kDa protein 4             117   1e-26   
ref|XP_003870868.1|  Hsp70 hsp70 chaperone                              111   1e-26   
gb|EPY34179.1|  heat shock 70 kDa protein                               110   1e-26   
gb|KIR48216.1|  hsp72-like protein                                      115   1e-26   
ref|NP_009396.2|  Hsp70 family ATPase SSA1                              115   1e-26   
gb|AAS68531.1|  HSP70                                                   109   1e-26   
gb|ETL96982.1|  hsp70-like protein                                      109   1e-26   
ref|XP_011199483.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    116   2e-26   
gb|AAC04952.1|  Ssa1p: Heat shock protein of HSP70 family               115   2e-26   
ref|XP_004180736.1|  hypothetical protein TBLA_0E01600                  115   2e-26   
ref|XP_007203774.1|  hypothetical protein PRUPE_ppa002595mg             115   2e-26   
ref|XP_011199479.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    116   2e-26   
ref|XP_005833237.1|  heat shock protein 70                              115   2e-26   
gb|EMD42644.1|  heatshock protein hsp70, putative                       115   2e-26   
ref|XP_005833236.1|  heat shock protein 70                              115   2e-26   
gb|EPX74268.1|  heat shock protein                                      115   2e-26   
ref|XP_002119191.1|  PREDICTED: heat shock 70 kDa protein 4L            116   2e-26   
ref|XP_004519096.1|  PREDICTED: heat shock 70 kDa protein 4-like ...    116   2e-26   
ref|XP_006427662.1|  hypothetical protein CICLE_v10025114mg             115   2e-26   
emb|CDY32364.1|  BnaC01g36830D                                          112   2e-26   
gb|ETM50132.1|  hsp70-like protein                                      109   2e-26   
ref|XP_003292454.1|  hypothetical protein DICPUDRAFT_57975              116   2e-26   
emb|CCD18698.1|  heat shock protein 70, putative, (fragment)            110   2e-26   
gb|EGA59895.1|  Ssa1p                                                   115   2e-26   
gb|KGK37668.1|  hypothetical protein JL09_g3211                         115   2e-26   
ref|XP_007338632.1|  heat shock protein 70                              115   2e-26   
gb|EGT52111.1|  hypothetical protein CAEBREN_09625                      116   2e-26   
gb|AEF30000.1|  heat shock protein 70                                   115   2e-26   
ref|XP_004350535.1|  Hsc70 protein                                      115   2e-26   
gb|AJO96221.1|  Ssa1p                                                   115   2e-26   
gb|AJO93829.1|  Ssa1p                                                   115   2e-26   
ref|XP_004519098.1|  PREDICTED: heat shock 70 kDa protein 4-like ...    116   2e-26   
ref|XP_001314691.1|  cytoplasmic heat shock protein 70                  115   2e-26   
gb|AHY74361.1|  Ssa1p                                                   115   2e-26   
gb|AAZ05448.1|  Hsp70                                                   109   2e-26   
ref|XP_001324527.1|  cytoplasmic heat shock protein 70                  115   2e-26   
gb|EGA63465.1|  Ssa1p                                                   115   2e-26   
gb|EDN59758.1|  stress-seventy subfamily A protein                      115   2e-26   
gb|KIP01720.1|  hypothetical protein PHLGIDRAFT_131141                  115   2e-26   
emb|CAY77648.1|  Ssa1p                                                  115   2e-26   
gb|AJO93117.1|  Ssa1p                                                   115   2e-26   
gb|ELK03095.1|  Heat shock 70 kDa protein 4                             111   2e-26   
gb|AJO98092.1|  Ssa1p                                                   115   2e-26   
gb|AJO97872.1|  Ssa1p                                                   115   2e-26   
gb|AJO96370.1|  Ssa1p                                                   115   2e-26   
gb|AJO92970.1|  Ssa1p                                                   115   2e-26   
gb|ETL43818.1|  hsp70-like protein                                      109   2e-26   
emb|CDO72906.1|  hypothetical protein BN946_scf185002.g91               115   2e-26   
ref|XP_005838018.1|  heat shock protein 70                              115   2e-26   
ref|XP_001592724.1|  heat shock protein SSB                             115   2e-26   
ref|XP_503148.1|  YALI0D22352p                                          115   3e-26   
ref|XP_009345467.1|  PREDICTED: heat shock cognate 70 kDa protein...    113   3e-26   
emb|CEI91389.1|  Putative Heat shock 70kDa protein 4                    115   3e-26   
gb|AJO96439.1|  Ssa1p                                                   115   3e-26   
ref|XP_005837933.1|  hypothetical protein GUITHDRAFT_103535             115   3e-26   
gb|KIM80823.1|  hypothetical protein PILCRDRAFT_822101                  115   3e-26   
gb|AAZ05449.1|  Hsp70                                                   109   3e-26   
gb|AAA30205.1|  heat shock protein HSP70                                115   3e-26   
gb|AJO92527.1|  Ssa1p                                                   115   3e-26   
ref|XP_003658595.1|  hypothetical protein MYCTH_75824                   115   3e-26   
ref|XP_817737.1|  heat shock protein 70 (HSP70)                         115   3e-26   
gb|AJO92307.1|  Ssa1p                                                   115   3e-26   
ref|XP_007264114.1|  heat shock protein 70                              115   3e-26   
gb|AJO92605.1|  Ssa1p                                                   115   3e-26   
gb|EKF38327.1|  glucose-regulated protein 78, putative                  115   3e-26   
ref|XP_007764255.1|  heat shock protein 70                              115   3e-26   
gb|AJO97289.1|  Ssa1p                                                   115   3e-26   
gb|EPY49391.1|  heat shock protein                                      115   3e-26   
gb|AJO92385.1|  Ssa1p                                                   115   3e-26   
ref|XP_009380663.1|  PREDICTED: heat shock cognate 70 kDa protein...    115   3e-26   
gb|AFO84299.1|  heat shock protein 70                                   115   3e-26   
ref|XP_003657383.1|  hypothetical protein THITE_2156506                 115   3e-26   
gb|AJO92897.1|  Ssa1p                                                   115   3e-26   



>ref|XP_009761607.1| PREDICTED: heat shock 70 kDa protein 15-like, partial [Nicotiana 
sylvestris]
Length=263

 Score =   259 bits (663),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/172 (76%), Positives = 145/172 (84%), Gaps = 8/172 (5%)
 Frame = +1

Query  16   EERVLEYTCALLLARSFRHFLL--CLLPVFRSVGL*LLLATKMSVVGFDVGNESCVVAVA  189
            + R LE+    +L   F+ F++  CL    R V L   +  KMSVVGFD GNES VVAVA
Sbjct  47   QSRTLEHRFQKILFYVFKEFVITDCLT---RGVAL---MPAKMSVVGFDFGNESGVVAVA  100

Query  190  RQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNPKNTISQVKRLIGRQFSDP  369
            RQRGIDVVLNDESKRETPA+VCFGEKQRFLGTAGAA+SMMNPKNTISQ+KRLIGRQFSDP
Sbjct  101  RQRGIDVVLNDESKRETPAIVCFGEKQRFLGTAGAASSMMNPKNTISQIKRLIGRQFSDP  160

Query  370  ELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGMVVSNLKSIAE  525
            ELQRDLK+ PFSVTEGPDG+PLIHARYLGEMRTFTPTQVLGMV S+LK+IAE
Sbjct  161  ELQRDLKALPFSVTEGPDGYPLIHARYLGEMRTFTPTQVLGMVFSDLKTIAE  212



>ref|XP_011072334.1| PREDICTED: heat shock 70 kDa protein 15-like [Sesamum indicum]
 ref|XP_011072335.1| PREDICTED: heat shock 70 kDa protein 15-like [Sesamum indicum]
Length=845

 Score =   259 bits (663),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPA+VCFG+KQRFLGTAGAATSMMNP
Sbjct  1    MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFLGTAGAATSMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNTISQ+KRLIGRQFSDPELQRDLKS PF VTEGPDG+PLIHARYLGE RTFTPTQ+LGM
Sbjct  61   KNTISQIKRLIGRQFSDPELQRDLKSLPFLVTEGPDGYPLIHARYLGETRTFTPTQILGM  120

Query  496  VVSNLKSIAE  525
            V+SNLKSIAE
Sbjct  121  VLSNLKSIAE  130



>gb|KJB35057.1| hypothetical protein B456_006G098500 [Gossypium raimondii]
Length=628

 Score =   255 bits (652),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGRQFSDPELQRD+KS PF+VTEGPDG+PLIHARYLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFNVTEGPDGYPLIHARYLGEMRTFTPTQVLGM  120

Query  496  VVSNLKSIAE  525
            V SNLKSIAE
Sbjct  121  VFSNLKSIAE  130



>ref|XP_007024113.1| Heat shock protein 91 isoform 2 [Theobroma cacao]
 gb|EOY26735.1| Heat shock protein 91 isoform 2 [Theobroma cacao]
Length=575

 Score =   253 bits (646),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGRQFSDPELQRDLKS PFSVTEGPDG+PLIHARYLGEM+TFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKSLPFSVTEGPDGYPLIHARYLGEMKTFTPTQVLGM  120

Query  496  VVSNLKSIAE  525
            V+S+LKSIAE
Sbjct  121  VLSDLKSIAE  130



>gb|KJB35056.1| hypothetical protein B456_006G098500 [Gossypium raimondii]
 gb|KJB35058.1| hypothetical protein B456_006G098500 [Gossypium raimondii]
Length=856

 Score =   257 bits (656),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGRQFSDPELQRD+KS PF+VTEGPDG+PLIHARYLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFNVTEGPDGYPLIHARYLGEMRTFTPTQVLGM  120

Query  496  VVSNLKSIAE  525
            V SNLKSIAE
Sbjct  121  VFSNLKSIAE  130



>gb|KHG16198.1| Heat shock 70 kDa 15 -like protein [Gossypium arboreum]
Length=856

 Score =   256 bits (655),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGRQFSDPELQRD+KS PF+VTEGPDG+PLIHARYLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFNVTEGPDGYPLIHARYLGEMRTFTPTQVLGM  120

Query  496  VVSNLKSIAE  525
            V SNLKSIAE
Sbjct  121  VFSNLKSIAE  130



>gb|KHG16619.1| Heat shock 70 kDa 15 -like protein [Gossypium arboreum]
Length=855

 Score =   256 bits (654),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKSLPFNVTEGPDGYPLIHARYLGEMRTFTPTQVLGM  120

Query  496  VVSNLKSIAE  525
            V+SNLKSIAE
Sbjct  121  VLSNLKSIAE  130



>ref|XP_007024112.1| Heat shock protein 91 isoform 1 [Theobroma cacao]
 gb|EOY26734.1| Heat shock protein 91 isoform 1 [Theobroma cacao]
Length=860

 Score =   255 bits (651),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGRQFSDPELQRDLKS PFSVTEGPDG+PLIHARYLGEM+TFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKSLPFSVTEGPDGYPLIHARYLGEMKTFTPTQVLGM  120

Query  496  VVSNLKSIAE  525
            V+S+LKSIAE
Sbjct  121  VLSDLKSIAE  130



>ref|XP_002528199.1| Heat shock 70 kDa protein, putative [Ricinus communis]
 gb|EEF34206.1| Heat shock 70 kDa protein, putative [Ricinus communis]
Length=849

 Score =   254 bits (649),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRL+GRQFSDPELQ+DLKS PF+VTEGPDGFPLIHARYLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLVGRQFSDPELQKDLKSLPFAVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  120

Query  496  VVSNLKSIAE  525
            V+S+LK IAE
Sbjct  121  VLSDLKGIAE  130



>ref|XP_010539495.1| PREDICTED: heat shock 70 kDa protein 15-like [Tarenaya hassleriana]
Length=866

 Score =   254 bits (648),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +1

Query  124  LATKMSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATS  303
            +  KMSVVGFD GNE+C+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++
Sbjct  17   IKAKMSVVGFDFGNENCIVAVARQRGIDVVLNDESKRETPAVVCFGDKQRFIGTAGAAST  76

Query  304  MMNPKNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQ  483
            MMNPK+++SQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGEMRTFTPTQ
Sbjct  77   MMNPKSSVSQIKRLIGRQFSDPELQRDLKSLPFTVTEGPDGYPLIHARYLGEMRTFTPTQ  136

Query  484  VLGMVVSNLKSIAE  525
            V+GMV+SNLKSIAE
Sbjct  137  VMGMVLSNLKSIAE  150



>gb|KJB70511.1| hypothetical protein B456_011G076800 [Gossypium raimondii]
Length=749

 Score =   251 bits (642),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGEMR+FTPTQ+LGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKSLPFNVTEGPDGYPLIHARYLGEMRSFTPTQILGM  120

Query  496  VVSNLKSIAE  525
            V+ NLKSIAE
Sbjct  121  VLLNLKSIAE  130



>ref|XP_009624163.1| PREDICTED: heat shock 70 kDa protein 15-like [Nicotiana tomentosiformis]
Length=854

 Score =   253 bits (645),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/130 (92%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFLGTAGAASSMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNTISQ+KRLIGRQFSDPELQRDLK+ PFSVTEGPDG+PLIHARYLGEMRTFTPTQVLGM
Sbjct  61   KNTISQIKRLIGRQFSDPELQRDLKALPFSVTEGPDGYPLIHARYLGEMRTFTPTQVLGM  120

Query  496  VVSNLKSIAE  525
            V S+LK+IAE
Sbjct  121  VFSDLKTIAE  130



>gb|KDP37205.1| hypothetical protein JCGZ_06261 [Jatropha curcas]
Length=847

 Score =   252 bits (644),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGRQFSDPELQ+DLKS PF+V+EGPDGFPLIHARYLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQKDLKSLPFAVSEGPDGFPLIHARYLGEMRTFTPTQVLGM  120

Query  496  VVSNLKSIAE  525
            V+SNLK IAE
Sbjct  121  VLSNLKGIAE  130



>gb|KJB70509.1| hypothetical protein B456_011G076800 [Gossypium raimondii]
 gb|KJB70510.1| hypothetical protein B456_011G076800 [Gossypium raimondii]
Length=855

 Score =   252 bits (643),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGEMR+FTPTQ+LGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKSLPFNVTEGPDGYPLIHARYLGEMRSFTPTQILGM  120

Query  496  VVSNLKSIAE  525
            V+ NLKSIAE
Sbjct  121  VLLNLKSIAE  130



>ref|XP_011080863.1| PREDICTED: heat shock 70 kDa protein 14-like [Sesamum indicum]
Length=856

 Score =   251 bits (642),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 119/130 (92%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNESCVVAVARQRGIDVVLNDESKRETPALVCFG+KQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESCVVAVARQRGIDVVLNDESKRETPALVCFGDKQRFLGTAGAASSMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNTISQ+KRLIGRQFSDPELQRDLKS PF VTEGPDG+PLIHARYLGE RTFTPTQVLGM
Sbjct  61   KNTISQIKRLIGRQFSDPELQRDLKSLPFLVTEGPDGYPLIHARYLGENRTFTPTQVLGM  120

Query  496  VVSNLKSIAE  525
            V S+LK IAE
Sbjct  121  VFSDLKIIAE  130



>ref|XP_010521527.1| PREDICTED: heat shock 70 kDa protein 15 [Tarenaya hassleriana]
Length=832

 Score =   251 bits (641),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNE+C+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCIVAVARQRGIDVVLNDESKRETPAVVCFGDKQRFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGRQFSDPELQRD+KS P++VTEGPDG+PLIHAR+LGEMRTFTPTQV+GM
Sbjct  61   KNSISQMKRLIGRQFSDPELQRDIKSLPYTVTEGPDGYPLIHARFLGEMRTFTPTQVMGM  120

Query  496  VVSNLKSIAET  528
            V+SNLKSIAET
Sbjct  121  VLSNLKSIAET  131



>ref|XP_010538015.1| PREDICTED: heat shock 70 kDa protein 14 [Tarenaya hassleriana]
 ref|XP_010538016.1| PREDICTED: heat shock 70 kDa protein 14 [Tarenaya hassleriana]
Length=829

 Score =   250 bits (639),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNE+C+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCIVAVARQRGIDVVLNDESKRETPAVVCFGDKQRFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+++SQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGEMRTFTPTQV+GM
Sbjct  61   KSSVSQIKRLIGRQFSDPELQRDLKSLPFTVTEGPDGYPLIHARYLGEMRTFTPTQVMGM  120

Query  496  VVSNLKSIAE  525
            V+SNLKSIAE
Sbjct  121  VLSNLKSIAE  130



>ref|XP_003546366.1| PREDICTED: heat shock 70 kDa protein 14-like [Glycine max]
 gb|KHM98765.1| Heat shock 70 kDa protein 14 [Glycine soja]
Length=863

 Score =   250 bits (639),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRFLGTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFLGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGRQFSDPELQRDLK+FPF VTEGPDG+PLIHARYLGE RTFTPTQV GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKTFPFVVTEGPDGYPLIHARYLGEARTFTPTQVFGM  120

Query  496  VVSNLKSIAE  525
            ++SNLK IAE
Sbjct  121  MLSNLKEIAE  130



>ref|XP_006389708.1| hypothetical protein EUTSA_v100181451mg, partial [Eutrema salsugineum]
 gb|ESQ26994.1| hypothetical protein EUTSA_v100181451mg, partial [Eutrema salsugineum]
Length=569

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA++CFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIICFGEKQRFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRL+GRQFSDPELQRD+KS PFSVTEGPDG+P+IHARYLGEMR FTPTQV+GM
Sbjct  61   KNSISQIKRLVGRQFSDPELQRDIKSLPFSVTEGPDGYPMIHARYLGEMRAFTPTQVMGM  120

Query  496  VVSNLKSIAE  525
            ++SNLK IAE
Sbjct  121  MLSNLKGIAE  130



>gb|KDO51190.1| hypothetical protein CISIN_1g003056mg [Citrus sinensis]
Length=726

 Score =   248 bits (632),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETP++VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPSIVCFGDKQRFIGTAGAASSTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGE R FTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKSLPFAVTEGPDGYPLIHARYLGETRVFTPTQVLGM  120

Query  496  VVSNLKSIAET  528
            ++SNLK+IAE+
Sbjct  121  LLSNLKAIAES  131



>ref|XP_004252333.1| PREDICTED: heat shock 70 kDa protein 15-like [Solanum lycopersicum]
Length=846

 Score =   249 bits (636),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFLGTAGAASSMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNTISQ+KRLIGRQFSDPELQRDLK+ PF VTEGPDG+PLIHARYLGEMRTFTPTQV+GM
Sbjct  61   KNTISQIKRLIGRQFSDPELQRDLKALPFLVTEGPDGYPLIHARYLGEMRTFTPTQVVGM  120

Query  496  VVSNLKSIAE  525
            V S+LK+IAE
Sbjct  121  VFSDLKTIAE  130



>gb|ACF83633.1| unknown [Zea mays]
Length=293

 Score =   236 bits (601),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRL+GR+FSDPELQRDL SFPF VTEGPDGFPL+H RYLGE RTFT TQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQRDLASFPFRVTEGPDGFPLVHVRYLGEERTFTSTQLLAM  120

Query  496  VVSNLKSIAE  525
            V+SNLK IAE
Sbjct  121  VLSNLKGIAE  130



>ref|XP_010691292.1| PREDICTED: heat shock 70 kDa protein 15-like [Beta vulgaris subsp. 
vulgaris]
Length=850

 Score =   249 bits (635),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRF+GTAGAA+++MNP
Sbjct  1    MSVVGFDFGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFIGTAGAASALMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNTISQ+KRLIGRQ+SDPELQRDLKS PF+V EGPDGFPLIHARYLGE R FTPTQVLGM
Sbjct  61   KNTISQIKRLIGRQYSDPELQRDLKSLPFTVAEGPDGFPLIHARYLGETRAFTPTQVLGM  120

Query  496  VVSNLKSIA  522
            + SNLKSIA
Sbjct  121  LFSNLKSIA  129



>gb|KDO51188.1| hypothetical protein CISIN_1g003056mg [Citrus sinensis]
Length=833

 Score =   248 bits (634),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETP++VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPSIVCFGDKQRFIGTAGAASSTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGE R FTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKSLPFAVTEGPDGYPLIHARYLGETRVFTPTQVLGM  120

Query  496  VVSNLKSIAET  528
            ++SNLK+IAE+
Sbjct  121  LLSNLKAIAES  131



>ref|XP_010925328.1| PREDICTED: heat shock 70 kDa protein 14-like [Elaeis guineensis]
Length=851

 Score =   249 bits (635),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+SMMNP
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRL+GR+FSDPELQRDL+S PF VTEG DGFPLIHARYLGE RTFTPTQVL M
Sbjct  61   KNSISQIKRLVGRKFSDPELQRDLQSLPFLVTEGADGFPLIHARYLGEQRTFTPTQVLAM  120

Query  496  VVSNLKSIAE  525
            V+SNLKSIAE
Sbjct  121  VLSNLKSIAE  130



>ref|XP_010915054.1| PREDICTED: heat shock 70 kDa protein 14-like [Elaeis guineensis]
Length=853

 Score =   248 bits (634),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+SMMNP
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFVGTAGAASSMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN++SQ+KRL+GR+FSDPELQRDL+S PF VTEGPDGFPLIHARYLGE RTFTPTQVL M
Sbjct  61   KNSVSQIKRLLGRKFSDPELQRDLQSLPFLVTEGPDGFPLIHARYLGEQRTFTPTQVLAM  120

Query  496  VVSNLKSIAE  525
            V+S+LKSIAE
Sbjct  121  VLSDLKSIAE  130



>ref|XP_009610837.1| PREDICTED: heat shock 70 kDa protein 14-like isoform X2 [Nicotiana 
tomentosiformis]
Length=780

 Score =   248 bits (632),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFLGTAGAASSMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNTISQ+KRLIGR+FSDPELQRD+K+ PFSVTEGPDG+PLIHA YLGEMRTFTPTQVLGM
Sbjct  61   KNTISQIKRLIGRKFSDPELQRDIKALPFSVTEGPDGYPLIHALYLGEMRTFTPTQVLGM  120

Query  496  VVSNLKSIAE  525
            V S+LK+IAE
Sbjct  121  VFSDLKTIAE  130



>gb|KDO51189.1| hypothetical protein CISIN_1g003056mg [Citrus sinensis]
Length=852

 Score =   248 bits (634),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETP++VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPSIVCFGDKQRFIGTAGAASSTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGE R FTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKSLPFAVTEGPDGYPLIHARYLGETRVFTPTQVLGM  120

Query  496  VVSNLKSIAET  528
            ++SNLK+IAE+
Sbjct  121  LLSNLKAIAES  131



>ref|XP_006427039.1| hypothetical protein CICLE_v10024883mg [Citrus clementina]
 gb|ESR40279.1| hypothetical protein CICLE_v10024883mg [Citrus clementina]
Length=852

 Score =   248 bits (634),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETP++VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPSIVCFGDKQRFIGTAGAASSTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGE R FTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKSLPFAVTEGPDGYPLIHARYLGETRVFTPTQVLGM  120

Query  496  VVSNLKSIAET  528
            ++SNLK+IAE+
Sbjct  121  LLSNLKAIAES  131



>ref|XP_006465548.1| PREDICTED: heat shock 70 kDa protein 14-like [Citrus sinensis]
Length=852

 Score =   248 bits (633),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETP++VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPSIVCFGDKQRFIGTAGAASSTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGE R FTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKSLPFAVTEGPDGYPLIHARYLGETRVFTPTQVLGM  120

Query  496  VVSNLKSIAET  528
            ++SNLK+IAE+
Sbjct  121  LLSNLKAIAES  131



>ref|XP_002279789.2| PREDICTED: heat shock 70 kDa protein 14-like [Vitis vinifera]
 ref|XP_010654673.1| PREDICTED: heat shock 70 kDa protein 14-like [Vitis vinifera]
 ref|XP_010654674.1| PREDICTED: heat shock 70 kDa protein 14-like [Vitis vinifera]
Length=848

 Score =   247 bits (631),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGRQFSDPELQ+DLKS PF+VTEGPDG+PLIHARYLGE+RTFTPTQVLGM
Sbjct  61   KNSISQMKRLIGRQFSDPELQQDLKSLPFTVTEGPDGYPLIHARYLGEVRTFTPTQVLGM  120

Query  496  VVSNLKSIAE  525
            + SNLK IAE
Sbjct  121  MFSNLKGIAE  130



>ref|XP_009610834.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009610835.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009610836.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Nicotiana 
tomentosiformis]
Length=856

 Score =   247 bits (631),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFLGTAGAASSMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNTISQ+KRLIGR+FSDPELQRD+K+ PFSVTEGPDG+PLIHA YLGEMRTFTPTQVLGM
Sbjct  61   KNTISQIKRLIGRKFSDPELQRDIKALPFSVTEGPDGYPLIHALYLGEMRTFTPTQVLGM  120

Query  496  VVSNLKSIAE  525
            V S+LK+IAE
Sbjct  121  VFSDLKTIAE  130



>ref|XP_004252334.1| PREDICTED: heat shock 70 kDa protein 15-like [Solanum lycopersicum]
 ref|XP_010314276.1| PREDICTED: heat shock 70 kDa protein 15-like [Solanum lycopersicum]
Length=852

 Score =   247 bits (630),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFLGTAGAASSMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNTISQ+KRLIGRQFSDPELQRD+K+ PF VTEGPDG+PLIHARYLGE+RTFTPTQ+LGM
Sbjct  61   KNTISQIKRLIGRQFSDPELQRDIKTLPFLVTEGPDGYPLIHARYLGEVRTFTPTQILGM  120

Query  496  VVSNLKSIAE  525
            V S+LK+IAE
Sbjct  121  VFSDLKTIAE  130



>ref|XP_010249783.1| PREDICTED: heat shock 70 kDa protein 15-like [Nelumbo nucifera]
 ref|XP_010249784.1| PREDICTED: heat shock 70 kDa protein 15-like [Nelumbo nucifera]
Length=850

 Score =   246 bits (629),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAVVCFGEKQRFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGRQFSDPELQ+DLK+ PF+VTEGPDG+PLIHARYLGE R FTPTQ+LGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQQDLKALPFTVTEGPDGYPLIHARYLGESRVFTPTQLLGM  120

Query  496  VVSNLKSIAE  525
            V+S+LKSIAE
Sbjct  121  VLSDLKSIAE  130



>ref|XP_008354138.1| PREDICTED: heat shock 70 kDa protein 15-like [Malus domestica]
Length=558

 Score =   241 bits (615),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPALVCFGEKQRF+GTAGAA+++MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPALVCFGEKQRFIGTAGAASALMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNTISQ+KRLIG+QFSDP LQRD+KS PF+V+EGPDG+PLIHARYLGE +TFTPTQVLGM
Sbjct  61   KNTISQIKRLIGKQFSDPVLQRDIKSLPFAVSEGPDGYPLIHARYLGEAKTFTPTQVLGM  120

Query  496  VVSNLKSIAE  525
            + S+LK IAE
Sbjct  121  LFSDLKIIAE  130



>ref|XP_009801414.1| PREDICTED: heat shock 70 kDa protein 15-like [Nicotiana sylvestris]
Length=846

 Score =   246 bits (628),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFLGTAGAASSMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNTISQ+KRLIGR+F DPELQRDLK+ PFSVTEGPDG+PLIHARYLGEMR+FTPTQVLGM
Sbjct  61   KNTISQIKRLIGRKFLDPELQRDLKALPFSVTEGPDGYPLIHARYLGEMRSFTPTQVLGM  120

Query  496  VVSNLKSIAE  525
            V S+LK IAE
Sbjct  121  VFSDLKIIAE  130



>ref|XP_008793460.1| PREDICTED: heat shock 70 kDa protein 14-like [Phoenix dactylifera]
Length=854

 Score =   246 bits (628),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGNESC+VAVARQRGIDVVLN+ESKRETPA+VCFGEKQRF+GTAGAA+S+MNP
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGEKQRFVGTAGAASSLMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN++SQ+KRL+GR+FSDPELQRDL+S PF VTEGPDGFPLIHARYLGE R FTPTQVL M
Sbjct  61   KNSVSQIKRLLGRKFSDPELQRDLQSLPFLVTEGPDGFPLIHARYLGEQRAFTPTQVLAM  120

Query  496  VVSNLKSIAE  525
            V+SNLKSIAE
Sbjct  121  VLSNLKSIAE  130



>gb|KHN32604.1| Heat shock 70 kDa protein 14 [Glycine soja]
Length=862

 Score =   246 bits (628),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRFLGTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFLGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGRQF+DPELQ+D+K+FPF VTEGPDG+PLIHARYLGE RTFTPTQV GM
Sbjct  61   KNSISQIKRLIGRQFADPELQQDIKTFPFVVTEGPDGYPLIHARYLGESRTFTPTQVFGM  120

Query  496  VVSNLKSIAE  525
            ++SNLK IAE
Sbjct  121  MLSNLKEIAE  130



>gb|EPS63387.1| hypothetical protein M569_11394, partial [Genlisea aurea]
Length=391

 Score =   236 bits (602),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPALVCFG+KQRFLGTAGAA+S+MNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPALVCFGDKQRFLGTAGAASSLMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNT+SQ+KRLIGR+FSDPELQ DLK  PFSV+EGPDGFPLIHARYL E + FTPTQVLGM
Sbjct  61   KNTVSQIKRLIGRKFSDPELQSDLKVLPFSVSEGPDGFPLIHARYLRENKAFTPTQVLGM  120

Query  496  VVSNLKSIAE  525
            V SNLKSIAE
Sbjct  121  VFSNLKSIAE  130



>ref|XP_007150665.1| hypothetical protein PHAVU_005G171400g [Phaseolus vulgaris]
 gb|ESW22659.1| hypothetical protein PHAVU_005G171400g [Phaseolus vulgaris]
Length=865

 Score =   246 bits (628),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRFLGTAGAAT+MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFLGTAGAATTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+K LIGRQFSDPELQRDLK++PF VTEGPDG+PLIHARYLG+++TFTPTQV GM
Sbjct  61   KNSISQIKSLIGRQFSDPELQRDLKTYPFLVTEGPDGYPLIHARYLGDVKTFTPTQVFGM  120

Query  496  VVSNLKSIAE  525
            ++SNLK IAE
Sbjct  121  MLSNLKEIAE  130



>ref|XP_003543647.1| PREDICTED: heat shock 70 kDa protein 14-like [Glycine max]
Length=863

 Score =   246 bits (628),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRFLGTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFLGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGRQF+DPELQ+D+K+FPF VTEGPDG+PLIHARYLGE RTFTPTQV GM
Sbjct  61   KNSISQIKRLIGRQFADPELQQDIKTFPFVVTEGPDGYPLIHARYLGESRTFTPTQVFGM  120

Query  496  VVSNLKSIAE  525
            ++SNLK IAE
Sbjct  121  MLSNLKEIAE  130



>ref|XP_006346576.1| PREDICTED: heat shock 70 kDa protein 15-like [Solanum tuberosum]
Length=847

 Score =   246 bits (627),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFLGTAGAASSMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNTISQ+KRLIGRQFSDPELQ+DLK+ PF VTEGPDG+PLIHA YLGEMRTFTPTQV+GM
Sbjct  61   KNTISQIKRLIGRQFSDPELQKDLKALPFLVTEGPDGYPLIHAHYLGEMRTFTPTQVVGM  120

Query  496  VVSNLKSIAE  525
            V S+LK+IAE
Sbjct  121  VFSDLKTIAE  130



>gb|EPS59607.1| hypothetical protein M569_15197, partial [Genlisea aurea]
Length=534

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLGTA AA+S+MNP
Sbjct  6    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAVVCFGEKQRFLGTAAAASSLMNP  65

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNT+SQVKRLIGR+FSDPELQ DLK+ PFSV+EGPDG+PLIHARYLGE  TFTPTQVLGM
Sbjct  66   KNTVSQVKRLIGRKFSDPELQSDLKALPFSVSEGPDGYPLIHARYLGETTTFTPTQVLGM  125

Query  496  VVSNLKSIAE  525
            V SNLKSIAE
Sbjct  126  VFSNLKSIAE  135



>ref|XP_006346577.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006346578.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X2 [Solanum 
tuberosum]
Length=849

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNE  VVAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNERGVVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFLGTAGAASSMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNTISQ+KRLIGRQFSDPELQRD+K+ PF VTEGPDG+PLIHARYLGE+RTFTPTQVLGM
Sbjct  61   KNTISQIKRLIGRQFSDPELQRDIKTLPFLVTEGPDGYPLIHARYLGEVRTFTPTQVLGM  120

Query  496  VVSNLKSIAE  525
            V S+LK+IAE
Sbjct  121  VFSDLKTIAE  130



>ref|XP_002304187.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEE79166.1| heat shock protein 70 [Populus trichocarpa]
Length=858

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNE+C+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGR FSDPELQRDLKSFP++VTEGPDGFPLIHA+YLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRPFSDPELQRDLKSFPYTVTEGPDGFPLIHAQYLGEMRTFTPTQVLGM  120

Query  496  VVSNLKSIAE  525
            V S+LK IA+
Sbjct  121  VFSDLKIIAQ  130



>gb|EYU21549.1| hypothetical protein MIMGU_mgv1a001311mg [Erythranthe guttata]
Length=842

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFG+KQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFLGTAGAASSMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNTISQ+KRLIGRQFSDPELQRD+KS PF VTEGPDG+PLIHARYLGE RTFTPTQVLGM
Sbjct  61   KNTISQIKRLIGRQFSDPELQRDIKSLPFLVTEGPDGYPLIHARYLGETRTFTPTQVLGM  120

Query  496  VVSNLKSIAE  525
            V S+LK IAE
Sbjct  121  VFSDLKIIAE  130



>ref|XP_009587742.1| PREDICTED: heat shock 70 kDa protein 15-like [Nicotiana tomentosiformis]
Length=844

 Score =   245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFLGTAGAASSMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNTISQ+KRLIGR+F DPELQRDLK+ PFSVTEGPDG+PLIHARYLGEMR+FTPTQ+LGM
Sbjct  61   KNTISQIKRLIGRKFVDPELQRDLKALPFSVTEGPDGYPLIHARYLGEMRSFTPTQLLGM  120

Query  496  VVSNLKSIAE  525
            V S+LK IAE
Sbjct  121  VFSDLKIIAE  130



>ref|XP_010254149.1| PREDICTED: heat shock 70 kDa protein 15-like [Nelumbo nucifera]
 ref|XP_010254150.1| PREDICTED: heat shock 70 kDa protein 15-like [Nelumbo nucifera]
 ref|XP_010254151.1| PREDICTED: heat shock 70 kDa protein 15-like [Nelumbo nucifera]
Length=851

 Score =   245 bits (625),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+V FGEKQRF+GTAGAA++ MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAVVSFGEKQRFIGTAGAASTTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGE R FTPTQVLGM
Sbjct  61   KNSISQLKRLIGRQFSDPELQRDLKSLPFTVTEGPDGYPLIHARYLGESRVFTPTQVLGM  120

Query  496  VVSNLKSIAE  525
            V+SNLKSIAE
Sbjct  121  VLSNLKSIAE  130



>ref|XP_006300740.1| hypothetical protein CARUB_v10019803mg [Capsella rubella]
 gb|EOA33638.1| hypothetical protein CARUB_v10019803mg [Capsella rubella]
Length=828

 Score =   245 bits (625),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGEMR FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEMRAFTPTQVMGM  120

Query  496  VVSNLKSIAE  525
            ++SNLK IAE
Sbjct  121  MLSNLKGIAE  130



>emb|CDO98063.1| unnamed protein product [Coffea canephora]
Length=858

 Score =   245 bits (625),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFG+KQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAVVCFGDKQRFLGTAGAASSMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNTISQ+KRLIGR FSDPELQRDLK+ PF+VTEGPDGFPLIHARYLGE+RTFTPTQVLGM
Sbjct  61   KNTISQMKRLIGRPFSDPELQRDLKALPFTVTEGPDGFPLIHARYLGELRTFTPTQVLGM  120

Query  496  VVSNLKSIAE  525
            V S+LKSIA+
Sbjct  121  VFSDLKSIAQ  130



>ref|XP_009388669.1| PREDICTED: heat shock 70 kDa protein 14-like [Musa acuminata 
subsp. malaccensis]
Length=847

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+SMMNP
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNDESKRETPAVVCFGEKQRFIGTAGAASSMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNT+SQ+KRLIGR+FSDPELQRD++S PF VTEGPDGFPLIH  YLGE RTFTPTQ+L M
Sbjct  61   KNTVSQIKRLIGRKFSDPELQRDIQSLPFKVTEGPDGFPLIHVNYLGEQRTFTPTQILAM  120

Query  496  VVSNLKSIAE  525
            V+S+LK IAE
Sbjct  121  VLSDLKGIAE  130



>ref|XP_010033884.1| PREDICTED: heat shock 70 kDa protein 14-like [Eucalyptus grandis]
 gb|KCW53736.1| hypothetical protein EUGRSUZ_J02991 [Eucalyptus grandis]
Length=874

 Score =   245 bits (625),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDSGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGR+FSDPELQRDL+S PF VTEGP+G+PLIHARYLGE RTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRKFSDPELQRDLQSLPFQVTEGPEGYPLIHARYLGESRTFTPTQVLGM  120

Query  496  VVSNLKSIAE  525
            + SNLK IAE
Sbjct  121  MFSNLKGIAE  130



>emb|CCM07272.1| Putative 97 kDa heat shock protein [Musa balbisiana]
Length=845

 Score =   244 bits (623),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+SMMNP
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNDESKRETPAVVCFGEKQRFIGTAGAASSMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNT+SQ+KRLIGR+FSDPELQRD++S PF VTEGPDGFPLIH  YLGE RTFTPTQ+L M
Sbjct  61   KNTVSQIKRLIGRKFSDPELQRDIQSLPFKVTEGPDGFPLIHVNYLGEQRTFTPTQILAM  120

Query  496  VVSNLKSIAE  525
            V+S+LK IAE
Sbjct  121  VLSDLKRIAE  130



>gb|AAG52244.1|AC011717_12 putative heat-shock protein; 41956-44878 [Arabidopsis thaliana]
Length=736

 Score =   243 bits (619),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE+R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEIRAFTPTQVMGM  120

Query  496  VVSNLKSIAE  525
            ++SNLK IAE
Sbjct  121  MLSNLKGIAE  130



>ref|XP_010098045.1| Heat shock 70 kDa protein 15 [Morus notabilis]
 gb|EXB74482.1| Heat shock 70 kDa protein 15 [Morus notabilis]
Length=860

 Score =   244 bits (623),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPAVVCFGDKQRFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGRQFSDPELQ+DLKS PF+VTEGPDG+PLIHARYLGE RTFTPTQVLG 
Sbjct  61   KNSISQIKRLIGRQFSDPELQKDLKSLPFTVTEGPDGYPLIHARYLGEARTFTPTQVLGT  120

Query  496  VVSNLKSIAE  525
            V ++LK IAE
Sbjct  121  VFADLKVIAE  130



>emb|CDY43337.1| BnaC04g25190D [Brassica napus]
Length=889

 Score =   244 bits (624),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +1

Query  127  ATKMSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSM  306
            A +MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFGEKQRF+GTAGAA++M
Sbjct  73   ALRMSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGEKQRFIGTAGAASTM  132

Query  307  MNPKNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQV  486
            MNPKN+ISQ+KRL+GRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE R FTPTQV
Sbjct  133  MNPKNSISQIKRLVGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHASYLGEKRAFTPTQV  192

Query  487  LGMVVSNLKSIAE  525
            +GM++SNLK IAE
Sbjct  193  MGMMLSNLKGIAE  205



>ref|NP_850984.4| Heat shock protein 70 [Arabidopsis thaliana]
 sp|F4HQD4.1|HSP7P_ARATH RecName: Full=Heat shock 70 kDa protein 15; AltName: Full=Heat 
shock protein 70-15; Short=AtHsp70-15 [Arabidopsis thaliana]
 gb|AEE36325.1| Heat shock protein 70 [Arabidopsis thaliana]
Length=831

 Score =   243 bits (621),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE+R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEIRAFTPTQVMGM  120

Query  496  VVSNLKSIAE  525
            ++SNLK IAE
Sbjct  121  MLSNLKGIAE  130



>ref|XP_009408938.1| PREDICTED: heat shock 70 kDa protein 15-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009408939.1| PREDICTED: heat shock 70 kDa protein 15-like [Musa acuminata 
subsp. malaccensis]
Length=852

 Score =   244 bits (622),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S+MNP
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNDESKRETPAVVCFGEKQRFIGTAGAASSVMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNT+SQ+KRL+GR+FSDPELQRD++S PF VTEG DGFPLIHA YLGE+R FTPTQ+L M
Sbjct  61   KNTVSQIKRLVGRKFSDPELQRDIQSLPFKVTEGRDGFPLIHANYLGELRAFTPTQILAM  120

Query  496  VVSNLKSIAET  528
            V+SNLK+IAET
Sbjct  121  VLSNLKTIAET  131



>gb|AAL38353.1| putative heat-shock protein [Arabidopsis thaliana]
Length=831

 Score =   243 bits (621),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE+R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEIRAFTPTQVMGM  120

Query  496  VVSNLKSIAE  525
            ++SNLK IAE
Sbjct  121  MLSNLKGIAE  130



>ref|NP_178110.6| Heat shock protein 70 [Arabidopsis thaliana]
 gb|AEE36326.1| Heat shock protein 70 [Arabidopsis thaliana]
Length=831

 Score =   243 bits (620),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE+R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEIRAFTPTQVMGM  120

Query  496  VVSNLKSIAE  525
            ++SNLK IAE
Sbjct  121  MLSNLKGIAE  130



>ref|XP_010473008.1| PREDICTED: heat shock 70 kDa protein 15-like [Camelina sativa]
Length=830

 Score =   243 bits (620),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE+R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEVRAFTPTQVMGM  120

Query  496  VVSNLKSIAE  525
            ++SNLK IAE
Sbjct  121  MLSNLKGIAE  130



>ref|XP_010430044.1| PREDICTED: heat shock 70 kDa protein 15 [Camelina sativa]
Length=830

 Score =   243 bits (620),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE+R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEVRAFTPTQVMGM  120

Query  496  VVSNLKSIAE  525
            ++SNLK IAE
Sbjct  121  MLSNLKGIAE  130



>ref|XP_007217050.1| hypothetical protein PRUPE_ppa001317mg [Prunus persica]
 gb|EMJ18249.1| hypothetical protein PRUPE_ppa001317mg [Prunus persica]
Length=855

 Score =   243 bits (620),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPALVCFG+KQRF+GTAGAA+S+MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPALVCFGDKQRFIGTAGAASSLMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNTISQ+KRLIGRQFSDP +QRD+KS PF+VTEGPDG+PLIHARYLGE RTFTPTQVLGM
Sbjct  61   KNTISQIKRLIGRQFSDPVVQRDIKSLPFAVTEGPDGYPLIHARYLGESRTFTPTQVLGM  120

Query  496  VVSNLKSIAE  525
            + S+LK IAE
Sbjct  121  LFSDLKIIAE  130



>ref|XP_006392781.1| hypothetical protein EUTSA_v10011242mg [Eutrema salsugineum]
 gb|ESQ30067.1| hypothetical protein EUTSA_v10011242mg [Eutrema salsugineum]
Length=829

 Score =   243 bits (620),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGEKQRFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRL+GRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE R FTPTQV+GM
Sbjct  61   KNSISQIKRLVGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGERRAFTPTQVMGM  120

Query  496  VVSNLKSIAE  525
            ++SNLK IAE
Sbjct  121  MLSNLKGIAE  130



>ref|XP_010033879.1| PREDICTED: heat shock 70 kDa protein 14-like [Eucalyptus grandis]
 gb|KCW53729.1| hypothetical protein EUGRSUZ_J02987 [Eucalyptus grandis]
 gb|KCW53730.1| hypothetical protein EUGRSUZ_J02987 [Eucalyptus grandis]
Length=851

 Score =   243 bits (620),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNESC+V VARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVGVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRL+G++F+DPELQRDL+S PF VTEGPDG+PLIHARYLGE RTFTPTQVLGM
Sbjct  61   KNSISQMKRLVGQKFADPELQRDLQSLPFHVTEGPDGYPLIHARYLGEARTFTPTQVLGM  120

Query  496  VVSNLKSIAE  525
            + SNLKSIAE
Sbjct  121  MFSNLKSIAE  130



>ref|XP_011000832.1| PREDICTED: heat shock 70 kDa protein 14-like isoform X2 [Populus 
euphratica]
Length=789

 Score =   242 bits (618),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNE+C+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGR FSDPELQRDLKSFP++VTEGPDGFPLIHA+YLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRLFSDPELQRDLKSFPYTVTEGPDGFPLIHAQYLGEMRTFTPTQVLGM  120

Query  496  VVSNLKSIAE  525
            V ++LK I +
Sbjct  121  VFADLKIIGQ  130



>ref|XP_010473009.1| PREDICTED: heat shock 70 kDa protein 15-like [Camelina sativa]
Length=829

 Score =   243 bits (619),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE+R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEVRAFTPTQVMGM  120

Query  496  VVSNLKSIAE  525
            ++SNLK IAE
Sbjct  121  MLSNLKGIAE  130



>ref|XP_010417777.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X2 [Camelina 
sativa]
Length=829

 Score =   243 bits (619),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE+R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEVRAFTPTQVMGM  120

Query  496  VVSNLKSIAE  525
            ++SNLK IAE
Sbjct  121  MLSNLKGIAE  130



>ref|XP_010417776.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Camelina 
sativa]
Length=829

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE+R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEVRAFTPTQVMGM  120

Query  496  VVSNLKSIAE  525
            ++SNLK IAE
Sbjct  121  MLSNLKGIAE  130



>emb|CDX76065.1| BnaA04g03290D [Brassica napus]
Length=814

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGEKQRFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRL+GRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE R FTPTQV+GM
Sbjct  61   KNSISQIKRLVGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHASYLGEKRAFTPTQVMGM  120

Query  496  VVSNLKSIAE  525
            ++SNLK IAE
Sbjct  121  MLSNLKGIAE  130



>ref|XP_008228510.1| PREDICTED: heat shock 70 kDa protein 15-like [Prunus mume]
Length=855

 Score =   243 bits (620),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPALVCFG+KQRF+GTAGAA+S+MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPALVCFGDKQRFIGTAGAASSLMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNTISQ+KRLIGRQFSDP +QRD+KS PF+VTEGPDG+PLIHARYLGE RTFTPTQVLGM
Sbjct  61   KNTISQIKRLIGRQFSDPVVQRDIKSLPFAVTEGPDGYPLIHARYLGESRTFTPTQVLGM  120

Query  496  VVSNLKSIAE  525
            + S+LK IAE
Sbjct  121  LFSDLKIIAE  130



>ref|NP_001031305.1| heat shock protein 91 [Arabidopsis thaliana]
 dbj|BAE98929.1| putative heat shock protein [Arabidopsis thaliana]
 gb|AEE36328.1| heat shock protein 91 [Arabidopsis thaliana]
Length=789

 Score =   242 bits (617),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEKRAFTPTQVMGM  120

Query  496  VVSNLKSIAE  525
            ++SNLK IAE
Sbjct  121  MLSNLKGIAE  130



>gb|EYU24689.1| hypothetical protein MIMGU_mgv1a001324mg [Erythranthe guttata]
Length=573

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNES VVAVARQRGIDVVLNDES R TPA+VCFG+KQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESNRLTPAIVCFGDKQRFLGTAGAASSMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNTISQ+KRLIGRQFSDPELQ D+KS PFSVTEGPDG+PLIHA YLGE RTFTPTQVLGM
Sbjct  61   KNTISQIKRLIGRQFSDPELQHDIKSLPFSVTEGPDGYPLIHAHYLGESRTFTPTQVLGM  120

Query  496  VVSNLKSIAE  525
            V S+LK IAE
Sbjct  121  VFSDLKIIAE  130



>ref|NP_178111.1| heat shock protein 91 [Arabidopsis thaliana]
 sp|Q9S7C0.1|HSP7O_ARATH RecName: Full=Heat shock 70 kDa protein 14; AltName: Full=Heat 
shock protein 70-14; Short=AtHsp70-14; AltName: Full=Heat 
shock protein 91 [Arabidopsis thaliana]
 gb|AAD55461.1|AC009322_1 Heat-shock protein [Arabidopsis thaliana]
 gb|AAG52240.1|AC011717_8 putative heat-shock protein; 37113-40399 [Arabidopsis thaliana]
 gb|AAL84971.1| At1g79930/F19K16_11 [Arabidopsis thaliana]
 gb|AAO11541.1| At1g79930/F19K16_11 [Arabidopsis thaliana]
 gb|AEE36327.1| heat shock protein 91 [Arabidopsis thaliana]
Length=831

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEKRAFTPTQVMGM  120

Query  496  VVSNLKSIAE  525
            ++SNLK IAE
Sbjct  121  MLSNLKGIAE  130



>ref|XP_010430043.1| PREDICTED: heat shock 70 kDa protein 15-like [Camelina sativa]
Length=829

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFS+TEGPDG+PLIHA YLGE+R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSITEGPDGYPLIHANYLGEVRAFTPTQVMGM  120

Query  496  VVSNLKSIAE  525
            ++SNLK IAE
Sbjct  121  MLSNLKGIAE  130



>ref|XP_008786326.1| PREDICTED: heat shock 70 kDa protein 15-like [Phoenix dactylifera]
Length=854

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNDESKRETPAVVCFGEKQRFIGTAGAASSTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN++SQ+KRL+GR+FSDPELQRDL+S  F V+EGPDGFPLIHARYLGE R FTPTQVL M
Sbjct  61   KNSVSQIKRLVGRKFSDPELQRDLQSLSFLVSEGPDGFPLIHARYLGEQRAFTPTQVLAM  120

Query  496  VVSNLKSIAE  525
            V+SNLKSIAE
Sbjct  121  VLSNLKSIAE  130



>ref|XP_011000830.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Populus 
euphratica]
 ref|XP_011000831.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Populus 
euphratica]
Length=859

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNE+C+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGR FSDPELQRDLKSFP++VTEGPDGFPLIHA+YLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRLFSDPELQRDLKSFPYTVTEGPDGFPLIHAQYLGEMRTFTPTQVLGM  120

Query  496  VVSNLKSIAE  525
            V ++LK I +
Sbjct  121  VFADLKIIGQ  130



>ref|XP_009147592.1| PREDICTED: heat shock 70 kDa protein 14 [Brassica rapa]
 ref|XP_009147593.1| PREDICTED: heat shock 70 kDa protein 14 [Brassica rapa]
Length=818

 Score =   241 bits (616),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GN++C+VAVARQRGIDVVLNDES RETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNDNCLVAVARQRGIDVVLNDESNRETPAIVCFGEKQRFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRL+GRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE R FTPTQV+GM
Sbjct  61   KNSISQIKRLVGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHASYLGEKRAFTPTQVMGM  120

Query  496  VVSNLKSIAE  525
            ++SNLK IAE
Sbjct  121  MLSNLKGIAE  130



>ref|XP_004506856.1| PREDICTED: heat shock 70 kDa protein 15-like [Cicer arietinum]
Length=851

 Score =   242 bits (617),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIG+QFSDPE+Q DLKS PFSVTEGPDG+PLIHARYLGE++TFTPTQV  M
Sbjct  61   KNSISQIKRLIGKQFSDPEVQGDLKSLPFSVTEGPDGYPLIHARYLGEVKTFTPTQVFAM  120

Query  496  VVSNLKSIAE  525
            ++SNLK IA+
Sbjct  121  MLSNLKEIAQ  130



>emb|CDY45119.1| BnaC06g06400D [Brassica napus]
Length=956

 Score =   243 bits (619),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  133  KMSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMN  312
            +MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFGEKQRF+GTAGAA++MMN
Sbjct  140  RMSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGEKQRFIGTAGAASTMMN  199

Query  313  PKNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLG  492
            PKN+ISQ+KRL+GRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE R FTPTQV+G
Sbjct  200  PKNSISQIKRLVGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHASYLGEKRAFTPTQVMG  259

Query  493  MVVSNLKSIAE  525
            M++SNLK IAE
Sbjct  260  MMLSNLKGIAE  270



>ref|XP_004506857.1| PREDICTED: heat shock 70 kDa protein 15-like [Cicer arietinum]
Length=849

 Score =   241 bits (616),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIG+QFSDP++Q DLKS PFSVTEGPDG+PLIHARYLGE++TFTPTQV  M
Sbjct  61   KNSISQIKRLIGKQFSDPDVQGDLKSLPFSVTEGPDGYPLIHARYLGEVKTFTPTQVFAM  120

Query  496  VVSNLKSIAE  525
            ++SNLK IAE
Sbjct  121  MLSNLKEIAE  130



>gb|AFW81561.1| hypothetical protein ZEAMMB73_352123 [Zea mays]
Length=564

 Score =   236 bits (603),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRL+GR+FSDPELQ DL SFPF VTEGPDGFPL+H R+LGE RTFTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQSDLASFPFRVTEGPDGFPLVHVRFLGEERTFTPTQLLAM  120

Query  496  VVSNLKSIAE  525
            V+SNLK IAE
Sbjct  121  VLSNLKGIAE  130



>emb|CDY24089.1| BnaA06g00870D [Brassica napus]
Length=858

 Score =   241 bits (616),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  133  KMSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMN  312
            +MSVVGFD GN++C+VAVARQRGIDVVLNDES RETPA+VCFGEKQRF+GTAGAA++MMN
Sbjct  40   RMSVVGFDFGNDNCLVAVARQRGIDVVLNDESNRETPAIVCFGEKQRFIGTAGAASTMMN  99

Query  313  PKNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLG  492
            PKN+ISQ+KRL+GRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE R FTPTQV+G
Sbjct  100  PKNSISQIKRLVGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHASYLGEKRAFTPTQVMG  159

Query  493  MVVSNLKSIAE  525
            M++SNLK IAE
Sbjct  160  MMLSNLKGIAE  170



>ref|XP_009139126.1| PREDICTED: heat shock 70 kDa protein 15 [Brassica rapa]
 ref|XP_009139127.1| PREDICTED: heat shock 70 kDa protein 15 [Brassica rapa]
Length=814

 Score =   241 bits (615),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGEKQRFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRL+GRQFSDP+LQRD+KS PFSVTEGPDG+PLIHA YLGE R FTPTQV+GM
Sbjct  61   KNSISQIKRLVGRQFSDPDLQRDIKSLPFSVTEGPDGYPLIHASYLGEKRAFTPTQVMGM  120

Query  496  VVSNLKSIAE  525
            ++SNLK IAE
Sbjct  121  MLSNLKGIAE  130



>ref|XP_006287070.1| hypothetical protein CARUB_v10000229mg [Capsella rubella]
 gb|EOA19968.1| hypothetical protein CARUB_v10000229mg [Capsella rubella]
Length=828

 Score =   241 bits (615),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVT+GPDG+PLIHA YLG+MR FTPTQ++GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTQGPDGYPLIHANYLGDMRAFTPTQLMGM  120

Query  496  VVSNLKSIAE  525
            ++SNLK IAE
Sbjct  121  MLSNLKGIAE  130



>ref|XP_002887853.1| hypothetical protein ARALYDRAFT_896005 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64112.1| hypothetical protein ARALYDRAFT_896005 [Arabidopsis lyrata subsp. 
lyrata]
Length=830

 Score =   241 bits (614),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVT+GPDG+PLIHA YLGE R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTQGPDGYPLIHANYLGEKRAFTPTQVMGM  120

Query  496  VVSNLKSIAE  525
            ++SNLK IAE
Sbjct  121  MLSNLKGIAE  130



>emb|CAA94389.1| heat-shock protein [Arabidopsis thaliana]
Length=831

 Score =   241 bits (614),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSV+GFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+ +RF+GTAGAA++MMNP
Sbjct  1    MSVIGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDNERFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGRQFSDPELQRD+KSFPFSVTEGPDG+PLIHA YLGE R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSFPFSVTEGPDGYPLIHANYLGEKRAFTPTQVMGM  120

Query  496  VVSNLKSIAE  525
            ++SNLK IAE
Sbjct  121  MLSNLKGIAE  130



>ref|XP_002439385.1| hypothetical protein SORBIDRAFT_09g005580 [Sorghum bicolor]
 gb|EES17815.1| hypothetical protein SORBIDRAFT_09g005580 [Sorghum bicolor]
Length=842

 Score =   241 bits (614),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRL+GR+FSDPELQ DL SFPF VTEGPDGFPL+HARYLGE RTFTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQSDLASFPFRVTEGPDGFPLVHARYLGEERTFTPTQLLAM  120

Query  496  VVSNLKSIAE  525
            V+SNLK IAE
Sbjct  121  VLSNLKGIAE  130



>ref|XP_009389931.1| PREDICTED: heat shock 70 kDa protein 14-like [Musa acuminata 
subsp. malaccensis]
Length=849

 Score =   240 bits (613),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN++SQ+KRL+GR+FSDPE+Q+D++SFPF VTEGPDGF LIHA YLGE R FTPTQ+L M
Sbjct  61   KNSVSQIKRLLGRKFSDPEVQKDIQSFPFRVTEGPDGFALIHANYLGEQRAFTPTQILAM  120

Query  496  VVSNLKSIAE  525
            V+SNLKSIAE
Sbjct  121  VLSNLKSIAE  130



>ref|XP_011013254.1| PREDICTED: heat shock 70 kDa protein 15-like [Populus euphratica]
Length=852

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNE+C+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGR FSDPELQRDLKS PF+VTEGPDGFPLI ARYLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRPFSDPELQRDLKSLPFTVTEGPDGFPLIQARYLGEMRTFTPTQVLGM  120

Query  496  VVSNLKSIAE  525
            V ++LK I +
Sbjct  121  VFADLKIIGQ  130



>ref|XP_003529646.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Glycine 
max]
 ref|XP_006582999.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X2 [Glycine 
max]
 gb|KHN39337.1| Heat shock 70 kDa protein 14 [Glycine soja]
Length=857

 Score =   239 bits (611),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNESCVVAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCVVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGR+F+DPELQRDLKS PF VTEG DG+PLIHARY+GE +TFTPTQV GM
Sbjct  61   KNSISQIKRLIGRKFADPELQRDLKSLPFLVTEGSDGYPLIHARYMGEAKTFTPTQVFGM  120

Query  496  VVSNLKSIAE  525
            ++SNLK IAE
Sbjct  121  MLSNLKEIAE  130



>gb|EYU24688.1| hypothetical protein MIMGU_mgv1a001324mg [Erythranthe guttata]
Length=840

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNES VVAVARQRGIDVVLNDES R TPA+VCFG+KQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESNRLTPAIVCFGDKQRFLGTAGAASSMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNTISQ+KRLIGRQFSDPELQ D+KS PFSVTEGPDG+PLIHA YLGE RTFTPTQVLGM
Sbjct  61   KNTISQIKRLIGRQFSDPELQHDIKSLPFSVTEGPDGYPLIHAHYLGESRTFTPTQVLGM  120

Query  496  VVSNLKSIAE  525
            V S+LK IAE
Sbjct  121  VFSDLKIIAE  130



>ref|XP_003531683.1| PREDICTED: heat shock 70 kDa protein 14-like isoform X1 [Glycine 
max]
Length=852

 Score =   238 bits (608),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ KRLIGR+FSDPELQRDLKS PF VTEG DG+PLIHARY+GE +TFTPTQV GM
Sbjct  61   KNSISQFKRLIGRKFSDPELQRDLKSLPFLVTEGSDGYPLIHARYMGESKTFTPTQVFGM  120

Query  496  VVSNLKSIAE  525
            ++SNLK IAE
Sbjct  121  MLSNLKEIAE  130



>gb|KHN47807.1| Heat shock 70 kDa protein 14 [Glycine soja]
Length=816

 Score =   238 bits (607),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ KRLIGR+FSDPELQRDLKS PF VTEG DG+PLIHARY+GE +TFTPTQV GM
Sbjct  61   KNSISQFKRLIGRKFSDPELQRDLKSLPFLVTEGSDGYPLIHARYMGESKTFTPTQVFGM  120

Query  496  VVSNLKSIAE  525
            ++SNLK IAE
Sbjct  121  MLSNLKEIAE  130



>ref|XP_006585595.1| PREDICTED: heat shock 70 kDa protein 14-like isoform X2 [Glycine 
max]
Length=850

 Score =   238 bits (608),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ KRLIGR+FSDPELQRDLKS PF VTEG DG+PLIHARY+GE +TFTPTQV GM
Sbjct  61   KNSISQFKRLIGRKFSDPELQRDLKSLPFLVTEGSDGYPLIHARYMGESKTFTPTQVFGM  120

Query  496  VVSNLKSIAE  525
            ++SNLK IAE
Sbjct  121  MLSNLKEIAE  130



>ref|XP_010925584.1| PREDICTED: heat shock 70 kDa protein 14-like [Elaeis guineensis]
 ref|XP_010932975.1| PREDICTED: heat shock 70 kDa protein 14-like [Elaeis guineensis]
Length=852

 Score =   238 bits (608),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAVVCFGEKQRFIGTAGAASSTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN++SQVKRLIGR+FSDPELQRDL+S PF VTEGPDG+PLIHA YLGE +TF PTQVLGM
Sbjct  61   KNSVSQVKRLIGRKFSDPELQRDLQSLPFLVTEGPDGYPLIHASYLGEKKTFMPTQVLGM  120

Query  496  VVSNLKSIAE  525
            ++SNLK +AE
Sbjct  121  ILSNLKGMAE  130



>ref|XP_003597778.1| 97 kDa heat shock protein [Medicago truncatula]
 ref|XP_003597784.1| 97 kDa heat shock protein [Medicago truncatula]
 gb|AES68029.1| heat shock 70 kDa protein [Medicago truncatula]
Length=858

 Score =   238 bits (607),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIG++F+DPELQRDLKS PF+VTEGPDG+PLIHARYLGE R FT TQV GM
Sbjct  61   KNSISQIKRLIGKKFADPELQRDLKSLPFNVTEGPDGYPLIHARYLGESREFTATQVFGM  120

Query  496  VVSNLKSIAE  525
            ++SNLK IA+
Sbjct  121  MLSNLKEIAQ  130



>ref|NP_001151579.1| heat shock 70 kDa protein 4 [Zea mays]
 gb|ACN33614.1| unknown [Zea mays]
Length=848

 Score =   238 bits (607),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRL+GR+FSDPELQ DL SFPF VTEGPDGFPL+H R+LGE RTFTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQSDLASFPFHVTEGPDGFPLVHVRFLGEERTFTPTQLLAM  120

Query  496  VVSNLKSIAE  525
            V+SNLK IAE
Sbjct  121  VLSNLKGIAE  130



>gb|ACG43420.1| heat shock 70 kDa protein 4 [Zea mays]
 gb|ACL52695.1| unknown [Zea mays]
 gb|AFW81562.1| heat shock protein 4 [Zea mays]
Length=848

 Score =   238 bits (606),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRL+GR+FSDPELQ DL SFPF VTEGPDGFPL+H R+LGE RTFTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQSDLASFPFRVTEGPDGFPLVHVRFLGEERTFTPTQLLAM  120

Query  496  VVSNLKSIAE  525
            V+SNLK IAE
Sbjct  121  VLSNLKGIAE  130



>ref|XP_006643833.1| PREDICTED: heat shock 70 kDa protein 14-like [Oryza brachyantha]
Length=843

 Score =   238 bits (606),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGR+FSDPELQ DL +FPF V+EGPDGFPL+HARYLGE R FTPTQ++ M
Sbjct  61   KNSISQIKRLIGRKFSDPELQSDLAAFPFRVSEGPDGFPLVHARYLGEERVFTPTQLMAM  120

Query  496  VVSNLKSIAET  528
            V+SNLK+IAE+
Sbjct  121  VLSNLKAIAES  131



>ref|XP_004960855.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Setaria 
italica]
Length=845

 Score =   238 bits (606),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRL+GR+FSDPELQRDL SFPF V+EGPDGFPL+HARYLGE + FTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQRDLASFPFRVSEGPDGFPLVHARYLGEEQAFTPTQLLAM  120

Query  496  VVSNLKSIAE  525
            V+SNLK IAE
Sbjct  121  VLSNLKVIAE  130



>ref|XP_008655087.1| PREDICTED: heat shock 70 kDa protein 4 isoform X1 [Zea mays]
Length=875

 Score =   238 bits (606),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRL+GR+FSDPELQ DL SFPF VTEGPDGFPL+H R+LGE RTFTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQSDLASFPFRVTEGPDGFPLVHVRFLGEERTFTPTQLLAM  120

Query  496  VVSNLKSIAE  525
            V+SNLK IAE
Sbjct  121  VLSNLKGIAE  130



>ref|XP_008654914.1| PREDICTED: heat shock 70 kDa protein 4 isoform X1 [Zea mays]
Length=833

 Score =   237 bits (605),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRL+GR+FSDPELQRDL SFPF VTEGPDGFPL+H RYLGE RTFT TQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQRDLASFPFRVTEGPDGFPLVHVRYLGEERTFTSTQLLAM  120

Query  496  VVSNLKSIAE  525
            V+SNLK IAE
Sbjct  121  VLSNLKGIAE  130



>ref|NP_001147805.1| heat shock 70 kDa protein 4 [Zea mays]
 gb|ACG28747.1| heat shock 70 kDa protein 4 [Zea mays]
Length=833

 Score =   237 bits (605),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRL+GR+FSDPELQRDL SFPF VTEGPDGFPL+H RYLGE RTFT TQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQRDLASFPFRVTEGPDGFPLVHVRYLGEERTFTSTQLLAM  120

Query  496  VVSNLKSIAE  525
            V+SNLK IAE
Sbjct  121  VLSNLKGIAE  130



>ref|XP_008775317.1| PREDICTED: heat shock 70 kDa protein 14-like [Phoenix dactylifera]
Length=852

 Score =   237 bits (605),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAVVCFGEKQRFIGTAGAASSTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN++SQVKRLIGR+FSDPELQ D++S PFSVTEGPDG+PLIHA YLGE  TFTPTQ+LGM
Sbjct  61   KNSVSQVKRLIGRKFSDPELQGDVQSLPFSVTEGPDGYPLIHASYLGEKGTFTPTQILGM  120

Query  496  VVSNLKSIAE  525
            ++SNLK IAE
Sbjct  121  ILSNLKGIAE  130



>ref|XP_007135698.1| hypothetical protein PHAVU_010G150800g [Phaseolus vulgaris]
 ref|XP_007135699.1| hypothetical protein PHAVU_010G150800g [Phaseolus vulgaris]
 gb|ESW07692.1| hypothetical protein PHAVU_010G150800g [Phaseolus vulgaris]
 gb|ESW07693.1| hypothetical protein PHAVU_010G150800g [Phaseolus vulgaris]
Length=841

 Score =   237 bits (604),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLG+AGAA+SMMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFLGSAGAASSMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ KRLIGR+FSDPELQRDLKS PF VTEG DG+PLIH +YLGE R FTPTQV GM
Sbjct  61   KNSISQFKRLIGRKFSDPELQRDLKSLPFLVTEGNDGYPLIHVQYLGEARKFTPTQVFGM  120

Query  496  VVSNLKSIAE  525
            ++SNLK IAE
Sbjct  121  MLSNLKEIAE  130



>ref|XP_006842242.1| hypothetical protein AMTR_s00078p00190750 [Amborella trichopoda]
 gb|ERN03917.1| hypothetical protein AMTR_s00078p00190750 [Amborella trichopoda]
Length=855

 Score =   237 bits (604),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S+MN 
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSLMNI  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN++SQ+KRLIGR+FSDPELQRDL++F F VTEGPDGFPLIH RYLGE + FTPTQVLGM
Sbjct  61   KNSVSQIKRLIGRRFSDPELQRDLQAFAFLVTEGPDGFPLIHVRYLGESKLFTPTQVLGM  120

Query  496  VVSNLKSIAE  525
            ++SNLK IAE
Sbjct  121  ILSNLKGIAE  130



>ref|XP_009358191.1| PREDICTED: heat shock 70 kDa protein 15-like [Pyrus x bretschneideri]
 ref|XP_009358192.1| PREDICTED: heat shock 70 kDa protein 15-like [Pyrus x bretschneideri]
Length=855

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNES +VAVARQRGIDVVLNDESKRETPALVCFGEKQRF+GTAGAA+++MNP
Sbjct  1    MSVVGFDFGNESGIVAVARQRGIDVVLNDESKRETPALVCFGEKQRFIGTAGAASALMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNTISQ+KRLIG+QFSDP LQRD+KS PF+V+EGPDG+PLIHARYLGE +TFTPTQVLGM
Sbjct  61   KNTISQIKRLIGKQFSDPVLQRDIKSLPFAVSEGPDGYPLIHARYLGEAKTFTPTQVLGM  120

Query  496  VVSNLKSIAE  525
            + S+LK IAE
Sbjct  121  LFSDLKIIAE  130



>ref|XP_009358190.1| PREDICTED: heat shock 70 kDa protein 15-like [Pyrus x bretschneideri]
Length=855

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNES +VAVARQRGIDVVLNDESKRETPALVCFGEKQRF+GTAGAA+++MNP
Sbjct  1    MSVVGFDFGNESGIVAVARQRGIDVVLNDESKRETPALVCFGEKQRFIGTAGAASALMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNTISQ+KRLIG+QFSDP LQRD+KS PF+V+EGPDG+PLIHARYLGE +TFTPTQVLGM
Sbjct  61   KNTISQIKRLIGKQFSDPVLQRDIKSLPFAVSEGPDGYPLIHARYLGEAKTFTPTQVLGM  120

Query  496  VVSNLKSIAE  525
            + S+LK IAE
Sbjct  121  LFSDLKIIAE  130



>ref|XP_002440718.1| hypothetical protein SORBIDRAFT_09g005570 [Sorghum bicolor]
 gb|EES19148.1| hypothetical protein SORBIDRAFT_09g005570 [Sorghum bicolor]
Length=851

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRL+GR+FSDPELQ DL SFPF VTEGPDGFPL+H R+LGE RTFTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQSDLASFPFRVTEGPDGFPLVHVRFLGEERTFTPTQLLAM  120

Query  496  VVSNLKSIAE  525
            V+SNLK IAE
Sbjct  121  VLSNLKGIAE  130



>ref|XP_004960853.1| PREDICTED: heat shock 70 kDa protein 14-like isoform X2 [Setaria 
italica]
Length=850

 Score =   236 bits (603),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRL+GR+FSDPELQ DL SFPF VTEGPDGFPL+H R+LGE RTFTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQSDLASFPFRVTEGPDGFPLVHVRFLGEERTFTPTQLLAM  120

Query  496  VVSNLKSIAE  525
            V+SNLK IAE
Sbjct  121  VLSNLKGIAE  130



>gb|EMS61926.1| Heat shock 70 kDa protein 4L [Triticum urartu]
Length=841

 Score =   236 bits (602),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNESC+V VARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA S MNP
Sbjct  1    MSVVGFDLGNESCIVGVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAANSTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRL+GR+F+DPELQRDL+SFPF V+EGPDGFPL+HARYLGE   FTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFADPELQRDLQSFPFRVSEGPDGFPLVHARYLGEEHAFTPTQLLAM  120

Query  496  VVSNLKSIAE  525
            V+SNLK+IAE
Sbjct  121  VLSNLKAIAE  130



>ref|XP_009399777.1| PREDICTED: heat shock 70 kDa protein 14-like [Musa acuminata 
subsp. malaccensis]
Length=851

 Score =   236 bits (602),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGA +S MNP
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNDESKRETPAVVCFGEKQRFIGTAGATSSTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN++SQ+KRL+GR+FSDPE+QRD++  PF VTEGPDGFPLIHA YLGE +TF+PTQ+L M
Sbjct  61   KNSVSQIKRLVGRKFSDPEVQRDIQLVPFKVTEGPDGFPLIHANYLGEQKTFSPTQILAM  120

Query  496  VVSNLKSIAET  528
            V+SNLKSIAE 
Sbjct  121  VLSNLKSIAEN  131



>ref|XP_010231645.1| PREDICTED: heat shock 70 kDa protein 14-like [Brachypodium distachyon]
Length=843

 Score =   236 bits (602),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNESC+V VARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA S MNP
Sbjct  1    MSVVGFDLGNESCIVGVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAANSTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRL+GR+F+DPELQ DL+SFPF V+EGPDGFPL+HARYLGE R+FTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFTDPELQHDLQSFPFHVSEGPDGFPLVHARYLGEERSFTPTQLLAM  120

Query  496  VVSNLKSIAE  525
            V+SNLK IAE
Sbjct  121  VLSNLKGIAE  130



>ref|XP_004960852.1| PREDICTED: heat shock 70 kDa protein 14-like isoform X1 [Setaria 
italica]
Length=878

 Score =   236 bits (602),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRL+GR+FSDPELQ DL SFPF VTEGPDGFPL+H R+LGE RTFTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQSDLASFPFRVTEGPDGFPLVHVRFLGEERTFTPTQLLAM  120

Query  496  VVSNLKSIAE  525
            V+SNLK IAE
Sbjct  121  VLSNLKGIAE  130



>gb|EMT09857.1| Heat shock 70 kDa protein 4L [Aegilops tauschii]
Length=901

 Score =   236 bits (601),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNESC+V VARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA S MNP
Sbjct  1    MSVVGFDLGNESCIVGVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAANSTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRL+GR+F+DPELQRDL+SFPF V+EGPDGFPL+HARYLGE   FTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFADPELQRDLQSFPFRVSEGPDGFPLVHARYLGEEHAFTPTQLLAM  120

Query  496  VVSNLKSIAE  525
            V+SNLK+IAE
Sbjct  121  VLSNLKAIAE  130



>ref|XP_008647466.1| PREDICTED: uncharacterized protein LOC100217188 isoform X1 [Zea 
mays]
 gb|AFW77385.1| heat shock protein 4 [Zea mays]
Length=841

 Score =   235 bits (599),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRL+GR++SDPE+QRDL SFPF VTEGPDGFPL+H RYLGE RTFT TQ+L M
Sbjct  61   KNSISQIKRLLGRKYSDPEVQRDLASFPFRVTEGPDGFPLVHVRYLGEERTFTSTQLLAM  120

Query  496  VVSNLKSIAE  525
            V+SNLK IAE
Sbjct  121  VLSNLKGIAE  130



>gb|EAY72790.1| hypothetical protein OsI_00654 [Oryza sativa Indica Group]
Length=813

 Score =   235 bits (599),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN++SQ+KRL+GR++SDPELQRD+ +FPF V+EGPDGFPL+HARYLGE R FTPTQ++ M
Sbjct  61   KNSVSQIKRLLGRKYSDPELQRDIAAFPFRVSEGPDGFPLVHARYLGEERVFTPTQLMAM  120

Query  496  VVSNLKSIAET  528
            V+SNLK IAE+
Sbjct  121  VLSNLKGIAES  131



>ref|XP_008362708.1| PREDICTED: heat shock 70 kDa protein 15-like [Malus domestica]
Length=855

 Score =   235 bits (600),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNES +VAVARQRGIDVVLNDESKRETPALVCFG KQRF+GTAGAA+++MNP
Sbjct  1    MSVVGFDFGNESXIVAVARQRGIDVVLNDESKRETPALVCFGXKQRFIGTAGAASALMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNTISQ+KRLIG+QFSDP LQRD+KS PF+V+EGPDG+PLIHARYLGE +TFTPTQVLGM
Sbjct  61   KNTISQIKRLIGKQFSDPVLQRDIKSLPFAVSEGPDGYPLIHARYLGEAKTFTPTQVLGM  120

Query  496  VVSNLKSIAE  525
            + S+LK IAE
Sbjct  121  LFSDLKIIAE  130



>ref|NP_001042210.1| Os01g0180800 [Oryza sativa Japonica Group]
 dbj|BAB32902.1| putative heat shock protein [Oryza sativa Japonica Group]
 dbj|BAB33024.1| putative heat shock protein [Oryza sativa Japonica Group]
 dbj|BAF04124.1| Os01g0180800 [Oryza sativa Japonica Group]
 gb|EAZ10794.1| hypothetical protein OsJ_00630 [Oryza sativa Japonica Group]
 gb|ADR66977.1| 70 kDa heat shock protein [Oryza sativa Japonica Group]
Length=845

 Score =   235 bits (599),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN++SQ+KRL+GR++SDPELQRD+ +FPF V+EGPDGFPL+HARYLGE R FTPTQ++ M
Sbjct  61   KNSVSQIKRLLGRKYSDPELQRDIAAFPFRVSEGPDGFPLVHARYLGEERVFTPTQLMAM  120

Query  496  VVSNLKSIAET  528
            V+SNLK IAE+
Sbjct  121  VLSNLKGIAES  131



>ref|XP_008371663.1| PREDICTED: heat shock 70 kDa protein 15-like [Malus domestica]
Length=855

 Score =   235 bits (599),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNES +VAVARQRGIDVVLNDESKRETPALVCFG KQRF+GTAGAA+++MNP
Sbjct  1    MSVVGFDFGNESXIVAVARQRGIDVVLNDESKRETPALVCFGXKQRFIGTAGAASALMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNTISQ+KRLIG+QFSDP LQRD+KS PF+V+EGPDG+PLIHARYLGE +TFTPTQVLGM
Sbjct  61   KNTISQIKRLIGKQFSDPVLQRDIKSLPFAVSEGPDGYPLIHARYLGEAKTFTPTQVLGM  120

Query  496  VVSNLKSIAE  525
            + S+LK IAE
Sbjct  121  LFSDLKIIAE  130



>ref|XP_010231644.1| PREDICTED: heat shock 70 kDa protein 15-like [Brachypodium distachyon]
Length=836

 Score =   235 bits (599),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNESC+V VARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA S MNP
Sbjct  1    MSVVGFDLGNESCIVGVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAANSTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRL+GR+F+DPE+Q D++SFPF V+EGPDGFPL+HARYLGE RTFTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFTDPEVQHDIQSFPFRVSEGPDGFPLVHARYLGEERTFTPTQLLAM  120

Query  496  VVSNLKSIAE  525
            V+SNLK IAE
Sbjct  121  VLSNLKGIAE  130



>ref|XP_002299641.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEE84446.1| heat shock protein 70 [Populus trichocarpa]
Length=852

 Score =   235 bits (599),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNE+ +VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENSLVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIGR FSDPELQRDL+S PF+VTEGPDGFPLI ARYLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRPFSDPELQRDLRSLPFTVTEGPDGFPLIQARYLGEMRTFTPTQVLGM  120

Query  496  VVSNLKSIAE  525
            V ++LK I +
Sbjct  121  VFADLKIIGQ  130



>ref|XP_008649434.1| PREDICTED: heat shock 70 kDa protein 14-like [Zea mays]
 gb|AFW77407.1| hypothetical protein ZEAMMB73_835876 [Zea mays]
Length=843

 Score =   234 bits (598),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            +N+ISQ+KRL+GR+FSDPE+Q D+ SFPF VTEGPDGFPL+H R+LGE RTFTPTQ+L M
Sbjct  61   RNSISQIKRLLGRKFSDPEVQSDIASFPFRVTEGPDGFPLVHVRFLGEERTFTPTQLLAM  120

Query  496  VVSNLKSIAE  525
            V+SNLKSIAE
Sbjct  121  VLSNLKSIAE  130



>ref|XP_004302913.1| PREDICTED: heat shock 70 kDa protein 15-like [Fragaria vesca 
subsp. vesca]
Length=848

 Score =   233 bits (595),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNES +VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGIVAVARQRGIDVVLNDESKRETPAVVCFGDKQRFIGTAGAASSMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNTISQ+KRLIG++FSDP LQRD+KS PF+V EGPDG+PLIHARYLGE +TFTPTQVLGM
Sbjct  61   KNTISQIKRLIGKKFSDPVLQRDIKSLPFAVLEGPDGYPLIHARYLGEAKTFTPTQVLGM  120

Query  496  VVSNLKSIAE  525
            V S+LK IA+
Sbjct  121  VFSDLKIIAQ  130



>ref|XP_008462146.1| PREDICTED: heat shock 70 kDa protein 15-like [Cucumis melo]
 ref|XP_008462147.1| PREDICTED: heat shock 70 kDa protein 15-like [Cucumis melo]
Length=844

 Score =   233 bits (595),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+V FG+KQRF+GTAGAA+ MMN 
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVSFGDKQRFIGTAGAASIMMNI  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN++SQVKRLIGR+FSDP LQ+DL+S PFSVTEGPDGFPL+H RYLGE++TFTPTQ+LGM
Sbjct  61   KNSVSQVKRLIGRKFSDPGLQKDLQSLPFSVTEGPDGFPLVHVRYLGELKTFTPTQLLGM  120

Query  496  VVSNLKSIAET  528
            + SNLK IAET
Sbjct  121  LFSNLKGIAET  131



>gb|EMT31029.1| Heat shock 70 kDa protein 4L [Aegilops tauschii]
Length=842

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNESC+V VARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA S MNP
Sbjct  1    MSVVGFDLGNESCIVGVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAANSTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRL+GR+F+DPELQ D+K+FPF V+EGPDGFPL+H RYLGE R+FTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFADPELQDDIKAFPFRVSEGPDGFPLVHVRYLGEERSFTPTQLLAM  120

Query  496  VVSNLKSIAE  525
            V+SNLK+IAE
Sbjct  121  VLSNLKAIAE  130



>gb|AFW77408.1| hypothetical protein ZEAMMB73_835876 [Zea mays]
Length=1186

 Score =   235 bits (600),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  133  KMSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMN  312
            KMSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MN
Sbjct  343  KMSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMN  402

Query  313  PKNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLG  492
            P+N+ISQ+KRL+GR+FSDPE+Q D+ SFPF VTEGPDGFPL+H R+LGE RTFTPTQ+L 
Sbjct  403  PRNSISQIKRLLGRKFSDPEVQSDIASFPFRVTEGPDGFPLVHVRFLGEERTFTPTQLLA  462

Query  493  MVVSNLKSIAE  525
            MV+SNLKSIAE
Sbjct  463  MVLSNLKSIAE  473



>ref|XP_004141777.1| PREDICTED: heat shock 70 kDa protein 15-like [Cucumis sativus]
 ref|XP_004168280.1| PREDICTED: heat shock 70 kDa protein 15-like [Cucumis sativus]
 gb|KGN45354.1| hypothetical protein Csa_7G446710 [Cucumis sativus]
Length=843

 Score =   233 bits (593),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+V FG+KQRF+GTAGAA+ MMN 
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVSFGDKQRFIGTAGAASIMMNI  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN++SQVKRLIGR+FSDP LQ+DL+S PFSV+EGPDGFPL+H RYLGE++TFTPTQ+LGM
Sbjct  61   KNSVSQVKRLIGRKFSDPGLQKDLQSLPFSVSEGPDGFPLVHVRYLGELKTFTPTQLLGM  120

Query  496  VVSNLKSIAET  528
            + SNLK IAET
Sbjct  121  LFSNLKGIAET  131



>gb|KEH28782.1| heat shock 70 kDa protein [Medicago truncatula]
Length=851

 Score =   233 bits (593),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN+ISQ+KRLIG+ +SDP+LQRDLKS PFSV EGPDG+PLI ARYLGE++ FTPTQV  M
Sbjct  61   KNSISQIKRLIGKLYSDPDLQRDLKSLPFSVAEGPDGYPLIQARYLGEVKMFTPTQVFAM  120

Query  496  VVSNLKSIAE  525
            ++ N+K IAE
Sbjct  121  MLGNMKEIAE  130



>gb|EMS52665.1| Heat shock 70 kDa protein 4L [Triticum urartu]
Length=1269

 Score =   234 bits (596),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = +1

Query  130  TKMSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMM  309
            ++MSVVGFD+GNESC+V VARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA S M
Sbjct  159  SEMSVVGFDLGNESCIVGVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAANSTM  218

Query  310  NPKNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVL  489
            NPKN+ISQ+KRL+GR+F+DPELQ D+K+FPF V+EGPDGFPL+H RYLGE R+FTPTQ+L
Sbjct  219  NPKNSISQIKRLLGRKFADPELQNDIKAFPFRVSEGPDGFPLVHVRYLGEERSFTPTQLL  278

Query  490  GMVVSNLKSIAE  525
             MV+SNLK+IAE
Sbjct  279  AMVLSNLKAIAE  290



>gb|EAY96776.1| hypothetical protein OsI_18700 [Oryza sativa Indica Group]
Length=853

 Score =   231 bits (588),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGNES +VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDVGNESGIVAVARQRGIDVVLNEESKRETPAVVCFGDKQRFIGTAGAASSTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            +N++SQ+KRL+GR F+DPELQRDL SFPF V+EGPDGFPL+HARYLGE R FTPTQ+L M
Sbjct  61   RNSVSQIKRLLGRAFADPELQRDLASFPFRVSEGPDGFPLVHARYLGEDRAFTPTQLLAM  120

Query  496  VVSNLKSIAE  525
            V+SNLK IAE
Sbjct  121  VLSNLKGIAE  130



>dbj|BAJ90753.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=835

 Score =   231 bits (588),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNESC+V VARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA S MNP
Sbjct  1    MSVVGFDLGNESCIVGVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAANSTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
             N+ISQ+KRL+GR+F+DPELQRDL+SFPF V+EGPDGFPL+ ARYLGE   FTPTQ+L M
Sbjct  61   NNSISQIKRLLGRKFADPELQRDLQSFPFLVSEGPDGFPLVQARYLGEEHAFTPTQLLAM  120

Query  496  VVSNLKSIAE  525
            V+SNLK+IAE
Sbjct  121  VLSNLKAIAE  130



>ref|NP_001054812.1| Os05g0181000 [Oryza sativa Japonica Group]
 gb|AAW57812.1| putative heat shock protein Hsp70 [Oryza sativa Japonica Group]
 dbj|BAF16726.1| Os05g0181000 [Oryza sativa Japonica Group]
 gb|EEE62549.1| hypothetical protein OsJ_17347 [Oryza sativa Japonica Group]
Length=853

 Score =   231 bits (588),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGNES +VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDVGNESGIVAVARQRGIDVVLNEESKRETPAVVCFGDKQRFIGTAGAASSTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            +N++SQ+KRL+GR F+DPELQRDL SFPF V+EGPDGFPL+HARYLGE R FTPTQ+L M
Sbjct  61   RNSVSQIKRLLGRAFADPELQRDLASFPFRVSEGPDGFPLVHARYLGEDRAFTPTQLLAM  120

Query  496  VVSNLKSIAE  525
            V+SNLK IAE
Sbjct  121  VLSNLKGIAE  130



>gb|AFG63451.1| hypothetical protein UMN_2640_01, partial [Pinus taeda]
 gb|AFG63452.1| hypothetical protein UMN_2640_01, partial [Pinus taeda]
 gb|AFG63453.1| hypothetical protein UMN_2640_01, partial [Pinus taeda]
 gb|AFG63454.1| hypothetical protein UMN_2640_01, partial [Pinus taeda]
 gb|AFG63455.1| hypothetical protein UMN_2640_01, partial [Pinus taeda]
 gb|AFG63456.1| hypothetical protein UMN_2640_01, partial [Pinus taeda]
 gb|AFG63457.1| hypothetical protein UMN_2640_01, partial [Pinus taeda]
Length=124

 Score =   213 bits (541),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGA++S+MNP
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGASSSLMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KN +SQ+KRLIG+QF DPE+QRDL+S P++V EGPDG   IHARYLG+ R FT TQ+L M
Sbjct  61   KNAVSQIKRLIGKQFRDPEVQRDLQSLPYTVDEGPDGGVRIHARYLGDSRAFTATQILAM  120

Query  496  VVSN  507
            ++SN
Sbjct  121  LLSN  124



>ref|XP_008354139.1| PREDICTED: heat shock 70 kDa protein 15-like [Malus domestica]
Length=834

 Score =   229 bits (584),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNES +VAVARQ  IDVVLNDESKRETPALVCFG KQRF+GTAGAA+++MNP
Sbjct  1    MSVVGFDFGNESXIVAVARQXXIDVVLNDESKRETPALVCFGXKQRFIGTAGAASALMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNTISQ+KRLIG+QFSDP LQRD+KS PF+V+EGPDG+PLIHARYLGE +TFTPTQVLGM
Sbjct  61   KNTISQIKRLIGKQFSDPVLQRDIKSLPFAVSEGPDGYPLIHARYLGEAKTFTPTQVLGM  120

Query  496  VVSNLKSIAE  525
            + S+LK IAE
Sbjct  121  LFSDLKIIAE  130



>ref|XP_001764380.1| predicted protein [Physcomitrella patens]
 gb|EDQ70934.1| predicted protein [Physcomitrella patens]
Length=820

 Score =   227 bits (578),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGNE+C+V VARQRGIDVVLNDESKRETP +V FGEKQRF+G AGAA+++MNP
Sbjct  1    MSVVGFDVGNENCIVGVARQRGIDVVLNDESKRETPGMVSFGEKQRFVGVAGAASALMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNTISQ+KR+IGR FSDPELQ DL+ FPFSVTEGPDGFP I+ +YLGE R FTPTQVLGM
Sbjct  61   KNTISQIKRMIGRPFSDPELQNDLRLFPFSVTEGPDGFPSINVQYLGEPRQFTPTQVLGM  120

Query  496  VVSNLKSIAE  525
            ++SNLKSIAE
Sbjct  121  LLSNLKSIAE  130



>ref|XP_001755636.1| predicted protein [Physcomitrella patens]
 gb|EDQ79696.1| predicted protein [Physcomitrella patens]
Length=770

 Score =   226 bits (575),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVG DVGNE+C+V VARQRGIDVVLNDESKRETP +V F EKQRFLG AGAA++MMNP
Sbjct  1    MSVVGLDVGNENCIVGVARQRGIDVVLNDESKRETPGMVSFAEKQRFLGVAGAASAMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            +NTISQ+KR+IGR FSDPE+Q DL+ FPFSVTEGPDGFPLI+ +YLGE R FTPTQVLGM
Sbjct  61   RNTISQIKRMIGRPFSDPEMQEDLRLFPFSVTEGPDGFPLINVQYLGEPRQFTPTQVLGM  120

Query  496  VVSNLKSIAE  525
            ++SNLKSIAE
Sbjct  121  LLSNLKSIAE  130



>ref|XP_006654112.1| PREDICTED: heat shock 70 kDa protein 15-like [Oryza brachyantha]
Length=856

 Score =   223 bits (568),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNESC+VAVAR RGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARLRGIDVVLNEESKRETPAVVCFGDKQRFIGTAGAASSTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            +N+ISQ+KRL+GR F+DPELQRDL SFPF V+EG  G+PL+HARYLGE R FTPTQ+L M
Sbjct  61   RNSISQIKRLLGRSFADPELQRDLGSFPFRVSEGLGGYPLVHARYLGEDRAFTPTQLLAM  120

Query  496  VVSNLKSIAE  525
            V+SNLK IAE
Sbjct  121  VLSNLKGIAE  130



>ref|XP_001760080.1| predicted protein [Physcomitrella patens]
 gb|EDQ75205.1| predicted protein [Physcomitrella patens]
Length=816

 Score =   222 bits (565),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVG DVGNE+C+V VARQRGIDVVLNDESKRETP +V FGEKQRF+G AGAA+++MNP
Sbjct  1    MSVVGLDVGNENCIVGVARQRGIDVVLNDESKRETPGVVSFGEKQRFVGVAGAASALMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            +NTISQ+KR+IGR FSDPELQ+DL  FPF+VTEGPDG PLI+ +YLGE R FTPTQVLGM
Sbjct  61   RNTISQIKRMIGRSFSDPELQKDLHLFPFTVTEGPDGSPLINVQYLGEPRQFTPTQVLGM  120

Query  496  VVSNLKSIAE  525
            ++SNLKSIAE
Sbjct  121  LLSNLKSIAE  130



>ref|XP_002986462.1| hypothetical protein SELMODRAFT_124091 [Selaginella moellendorffii]
 gb|EFJ12319.1| hypothetical protein SELMODRAFT_124091 [Selaginella moellendorffii]
Length=774

 Score =   215 bits (547),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVG DVGNE+C+V VARQRGIDVVLNDESKRETPA+V F EKQRFLGTA AA++ MNP
Sbjct  1    MSVVGLDVGNENCIVGVARQRGIDVVLNDESKRETPAMVSFSEKQRFLGTAAAASATMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            +NT+SQ+KRLIGR+F+DPE+Q+DL+  PF+VTE  DG  LIH RYLGE++ FTPTQ+LGM
Sbjct  61   RNTVSQIKRLIGRRFADPEVQKDLQLLPFNVTEAADGTCLIHVRYLGEVKAFTPTQILGM  120

Query  496  VVSNLKSIAET  528
            V+SNLK+IAET
Sbjct  121  VLSNLKTIAET  131



>ref|XP_002978946.1| hypothetical protein SELMODRAFT_109750 [Selaginella moellendorffii]
 gb|EFJ19903.1| hypothetical protein SELMODRAFT_109750 [Selaginella moellendorffii]
Length=779

 Score =   213 bits (542),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVG DVGNE+C+V VARQRGIDVVLNDESKRETP +V F EKQRFLGTA AA++ MNP
Sbjct  1    MSVVGLDVGNENCIVGVARQRGIDVVLNDESKRETPGMVSFSEKQRFLGTAAAASATMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            +NT+SQ+KRLIGR+F+DPE+Q+DL+  PF+VTE  DG  LIH RYLGE++ FTPTQ+LGM
Sbjct  61   RNTVSQIKRLIGRRFADPEVQKDLQLLPFNVTEAADGTCLIHVRYLGEVKAFTPTQILGM  120

Query  496  VVSNLKSIAET  528
            V+SNLK+IAET
Sbjct  121  VLSNLKTIAET  131



>ref|XP_008363587.1| PREDICTED: heat shock 70 kDa protein 16-like [Malus domestica]
Length=342

 Score =   199 bits (505),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDVGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+T+SQVKRLIGR+F++P++QRDL+  P   +E PDG  LIH +YLG   TFTP QV  M
Sbjct  61   KSTVSQVKRLIGRKFTEPDVQRDLQILPLDTSEAPDGGILIHLKYLGATHTFTPVQVTAM  120

Query  496  VVSNLKSIAE  525
            + ++LK + E
Sbjct  121  LFAHLKDLIE  130



>ref|XP_002317001.1| hypothetical protein POPTR_0011s14240g [Populus trichocarpa]
 gb|EEE97613.1| hypothetical protein POPTR_0011s14240g [Populus trichocarpa]
Length=770

 Score =   205 bits (521),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA+S+MNP
Sbjct  1    MSVVGFDIGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASSVMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+TI QVKRLIGR F DPE+Q +L   PF  +EG DG  LIH +YLGE RTFTP Q+L M
Sbjct  61   KSTIFQVKRLIGRNFKDPEVQNELTLLPFETSEGKDGGILIHLKYLGEARTFTPVQILAM  120

Query  496  VVSNLKSIAE  525
            + SNLK I E
Sbjct  121  LFSNLKDITE  130



>ref|XP_008353314.1| PREDICTED: heat shock 70 kDa protein 16-like [Malus domestica]
Length=395

 Score =   198 bits (503),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDVGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+T+SQVKRLIGR+F++P++QRDL+  P   +E PDG  LIH +YLG   TFTP QV  M
Sbjct  61   KSTVSQVKRLIGRKFTEPDVQRDLQILPLDTSEAPDGGILIHLKYLGATHTFTPVQVTAM  120

Query  496  VVSNLKSIAE  525
            + ++LK + E
Sbjct  121  LFAHLKDLIE  130



>ref|XP_008226915.1| PREDICTED: heat shock 70 kDa protein 16 [Prunus mume]
Length=777

 Score =   204 bits (519),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDIGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+T+SQVKRLIGR+FS+P++QRDL+  PF  +E PDG  LIH +YLGE  TFTP QV  M
Sbjct  61   KSTVSQVKRLIGRKFSEPDVQRDLRMLPFQTSEAPDGGILIHLKYLGETHTFTPVQVTAM  120

Query  496  VVSNLKSIAE  525
            + ++LK + E
Sbjct  121  LFAHLKDLIE  130



>ref|XP_007213641.1| hypothetical protein PRUPE_ppa001697mg [Prunus persica]
 gb|EMJ14840.1| hypothetical protein PRUPE_ppa001697mg [Prunus persica]
Length=777

 Score =   204 bits (518),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDIGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+T+SQVKRLIGR+FS+P++QRDL+  PF  +E PDG  LIH +YLGE  TFTP QV  M
Sbjct  61   KSTVSQVKRLIGRKFSEPDVQRDLRMLPFQTSEAPDGGILIHLKYLGETHTFTPVQVTAM  120

Query  496  VVSNLKSIAE  525
            + ++LK + E
Sbjct  121  LFAHLKDLIE  130



>ref|XP_008366399.1| PREDICTED: heat shock 70 kDa protein 16-like [Malus domestica]
Length=777

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDVGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+T+SQVKRLIGR+F++P++QRDL+  PF  +EGPDG  LIH +YLG   TFTP QV  M
Sbjct  61   KSTVSQVKRLIGRKFTEPDVQRDLRILPFETSEGPDGGILIHLKYLGXTHTFTPVQVTAM  120

Query  496  VVSNLKSIAE  525
            + ++LK + E
Sbjct  121  LFAHLKDLIE  130



>ref|XP_008345050.1| PREDICTED: heat shock 70 kDa protein 16-like [Malus domestica]
Length=440

 Score =   197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGNE+CV+AV  Q G+DV+LNDESKRETPALVCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDVGNENCVIAVVNQWGVDVLLNDESKRETPALVCFGEKQRFLGSAGAASAMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+T+SQVKRL+GR+F++P++QRDL+  PF  +E PDG  LIH +YLG   TFTP QV  M
Sbjct  61   KSTVSQVKRLMGRKFTEPDVQRDLRILPFETSEAPDGGILIHLKYLGATHTFTPVQVTAM  120

Query  496  VVSNLKSIAE  525
            + ++LK + E
Sbjct  121  LFAHLKDLIE  130



>ref|XP_011030786.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X2 [Populus 
euphratica]
Length=770

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA+S+MN 
Sbjct  1    MSVVGFDIGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASSVMNL  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+TI QVKRLIGR F DPE Q +LK  PF  +EG DG  LIH +YLGE RTFTP Q+L M
Sbjct  61   KSTIFQVKRLIGRNFKDPEFQNELKLLPFETSEGKDGGILIHLKYLGEARTFTPVQILAM  120

Query  496  VVSNLKSIAE  525
            + SNLK++ E
Sbjct  121  LFSNLKNVTE  130



>ref|XP_011030785.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X1 [Populus 
euphratica]
Length=771

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA+S+MN 
Sbjct  1    MSVVGFDIGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASSVMNL  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+TI QVKRLIGR F DPE Q +LK  PF  +EG DG  LIH +YLGE RTFTP Q+L M
Sbjct  61   KSTIFQVKRLIGRNFKDPEFQNELKLLPFETSEGKDGGILIHLKYLGEARTFTPVQILAM  120

Query  496  VVSNLKSIAE  525
            + SNLK++ E
Sbjct  121  LFSNLKNVTE  130



>ref|XP_008355346.1| PREDICTED: heat shock 70 kDa protein 16-like [Malus domestica]
Length=498

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGNE+CV+AV  Q G+DV+LNDESKRETPALVCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDVGNENCVIAVVNQWGVDVLLNDESKRETPALVCFGEKQRFLGSAGAASAMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+T+SQVKRL+GR+F++P++QRDL+  PF  +E PDG  LIH +YLG   TFTP QV  M
Sbjct  61   KSTVSQVKRLMGRKFTEPDVQRDLRILPFETSEAPDGGILIHLKYLGATHTFTPVQVTAM  120

Query  496  VVSNLKSIAE  525
            + ++LK + E
Sbjct  121  LFAHLKDLIE  130



>gb|KCW67010.1| hypothetical protein EUGRSUZ_F00767 [Eucalyptus grandis]
Length=711

 Score =   199 bits (506),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNE+CV+AV +QRGIDV+LNDES RETPA+VCFGEKQRFLG+AGAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAVVKQRGIDVLLNDESNRETPAIVCFGEKQRFLGSAGAASAMMHP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+T+SQVKRLIGR+F+DP++QR+LK  P    EGPDG  LI  +Y GE  TF+PTQV+ M
Sbjct  61   KSTVSQVKRLIGRKFADPDVQRELKMLPVETCEGPDGGILIRIQYAGEKHTFSPTQVMAM  120

Query  496  VVSNLKSIAE  525
            + ++LK IAE
Sbjct  121  LFAHLKDIAE  130



>ref|XP_009352450.1| PREDICTED: heat shock 70 kDa protein 16-like, partial [Pyrus 
x bretschneideri]
Length=736

 Score =   199 bits (506),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDVGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+T+SQVKRLIGR+F++P++Q DL+  PF  +E PDG  LIH +YLG   TFTP QV  M
Sbjct  61   KSTVSQVKRLIGRKFTEPDVQHDLRILPFETSEAPDGGILIHLKYLGATHTFTPVQVTAM  120

Query  496  VVSNLKSIAE  525
            + ++LK + E
Sbjct  121  LFAHLKDLIE  130



>ref|XP_009372708.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X2 [Pyrus 
x bretschneideri]
Length=718

 Score =   199 bits (505),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDVGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+T+SQVKRLIGR+F++P++Q DL+  PF  +E PDG  LIH +YLG   TFTP QV  M
Sbjct  61   KSTVSQVKRLIGRKFTEPDVQSDLRILPFETSEAPDGGILIHLKYLGATHTFTPVQVTAM  120

Query  496  VVSNLKSIAE  525
            + ++LK + E
Sbjct  121  LFAHLKDLIE  130



>gb|AII99893.1| heat shock protein [Cicer arietinum]
Length=771

 Score =   199 bits (505),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNE+CV+AVA+ RGIDV+LNDESKRETPA+VCFGEKQRFLG++GAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAVAKHRGIDVLLNDESKRETPAVVCFGEKQRFLGSSGAASAMMHP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+TISQVKRLIGR+F DP+++RDLK  P   +EGPDG  LIH +YL    TFTP Q++ M
Sbjct  61   KSTISQVKRLIGRRFQDPDMERDLKMLPLETSEGPDGGILIHLKYLEGTHTFTPVQIMSM  120

Query  496  VVSNLKSIAE  525
            + ++LK++ E
Sbjct  121  LFAHLKTMTE  130



>ref|XP_009372707.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X1 [Pyrus 
x bretschneideri]
Length=761

 Score =   199 bits (505),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDVGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+T+SQVKRLIGR+F++P++Q DL+  PF  +E PDG  LIH +YLG   TFTP QV  M
Sbjct  61   KSTVSQVKRLIGRKFTEPDVQSDLRILPFETSEAPDGGILIHLKYLGATHTFTPVQVTAM  120

Query  496  VVSNLKSIAE  525
            + ++LK + E
Sbjct  121  LFAHLKDLIE  130



>ref|XP_010060358.1| PREDICTED: heat shock 70 kDa protein 16 [Eucalyptus grandis]
Length=774

 Score =   199 bits (505),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNE+CV+AV +QRGIDV+LNDES RETPA+VCFGEKQRFLG+AGAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAVVKQRGIDVLLNDESNRETPAIVCFGEKQRFLGSAGAASAMMHP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+T+SQVKRLIGR+F+DP++QR+LK  P    EGPDG  LI  +Y GE  TF+PTQV+ M
Sbjct  61   KSTVSQVKRLIGRKFADPDVQRELKMLPVETCEGPDGGILIRIQYAGEKHTFSPTQVMAM  120

Query  496  VVSNLKSIAE  525
            + ++LK IAE
Sbjct  121  LFAHLKDIAE  130



>ref|XP_009352433.1| PREDICTED: heat shock 70 kDa protein 16-like [Pyrus x bretschneideri]
Length=762

 Score =   199 bits (505),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDVGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+T+SQVKRLIGR+F++P++Q DL+  PF  +E PDG  LIH +YLG   TFTP QV  M
Sbjct  61   KSTVSQVKRLIGRKFTEPDVQHDLQILPFETSEAPDGGILIHLKYLGATHTFTPVQVTAM  120

Query  496  VVSNLKSIAE  525
            + ++LK + E
Sbjct  121  LFAHLKDLIE  130



>ref|XP_010092150.1| Heat shock 70 kDa protein 16 [Morus notabilis]
 gb|EXB50301.1| Heat shock 70 kDa protein 16 [Morus notabilis]
Length=749

 Score =   198 bits (503),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNE+CV+AV +QRGIDV+LNDESKRETPA+VCFGEKQRFLG+AGAA+++MNP
Sbjct  1    MSVVGFDIGNENCVIAVVKQRGIDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAVMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+T+SQVKRLIG +FS+P++Q +LK FPF  +E PDG  LIH +YLGE  TFT  Q++ M
Sbjct  61   KSTVSQVKRLIGTKFSEPDIQNELKLFPFETSEAPDGGILIHLKYLGETHTFTLVQIMAM  120

Query  496  VVSNLKSIAE  525
            + ++L+ +AE
Sbjct  121  LFAHLRELAE  130



>ref|XP_003600064.1| Heat shock 70 kDa protein 4L [Medicago truncatula]
 gb|AES70315.1| heat shock 70 kDa protein [Medicago truncatula]
Length=774

 Score =   198 bits (503),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNE+CV+AVA+ RGIDV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAVAKHRGIDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMHP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+TISQVKR IGR+F DP++++DLK  P   +EGPDG  LIH +YL  + TFTP Q++ M
Sbjct  61   KSTISQVKRFIGRKFLDPDMEKDLKMLPLETSEGPDGGVLIHLKYLDGIHTFTPVQIMSM  120

Query  496  VVSNLKSIAE  525
            + ++LK++ E
Sbjct  121  LFAHLKTMTE  130



>gb|KDP39123.1| hypothetical protein JCGZ_00880 [Jatropha curcas]
Length=771

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNE+CV+A  +QRGIDV+LNDESKRETPA++CFGE+QR LG+AGAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAAVKQRGIDVLLNDESKRETPAVICFGERQRLLGSAGAASAMMHP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+TISQVKRLIGR F DP++Q DLK  PF  + G DG  LIH RYLGE+ TFTP Q++ M
Sbjct  61   KSTISQVKRLIGRNFKDPDVQNDLKLLPFETSGGQDGGILIHLRYLGEIHTFTPVQIMAM  120

Query  496  VVSNLKSIAE  525
            + S+LK I E
Sbjct  121  LFSHLKEITE  130



>ref|XP_004500055.1| PREDICTED: heat shock 70 kDa protein 16-like [Cicer arietinum]
Length=770

 Score =   197 bits (502),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 87/130 (67%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNE+CV+AVA+ RGIDV+LNDESKRETPA+VCFGEKQRFLG++GAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAVAKHRGIDVLLNDESKRETPAVVCFGEKQRFLGSSGAASAMMHP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+TISQVKRLIGR+F DP+++RDLK  P   +EGPDG  LIH +YL    TFTP Q++ M
Sbjct  61   KSTISQVKRLIGRRFQDPDMERDLKMLPLETSEGPDGGILIHLKYLEGTHTFTPVQIMSM  120

Query  496  VVSNLKSIAE  525
            + ++LK++ E
Sbjct  121  LFAHLKTMTE  130



>gb|EYU27799.1| hypothetical protein MIMGU_mgv1a001740mg [Erythranthe guttata]
Length=766

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNE+CV+AVA+QRGIDV+LNDES RE PA+V FGEKQRFLG+AGAA++ M+P
Sbjct  1    MSVVGFDIGNENCVIAVAKQRGIDVLLNDESNRENPAVVSFGEKQRFLGSAGAASATMHP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+TISQVKRLIGR FS+P +Q DL+  PF  +EGPDG  LIH RYL E +TFTP Q+L M
Sbjct  61   KSTISQVKRLIGRNFSEPTVQNDLRLLPFETSEGPDGGILIHLRYLEERQTFTPIQILAM  120

Query  496  VVSNLKSIAE  525
            ++++LK IAE
Sbjct  121  LLAHLKQIAE  130



>ref|XP_009760615.1| PREDICTED: heat shock 70 kDa protein 16 [Nicotiana sylvestris]
 ref|XP_009760616.1| PREDICTED: heat shock 70 kDa protein 16 [Nicotiana sylvestris]
Length=753

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGNE+CV+A A+QRGIDV+LNDESKRETPA+V FGEKQRF+G+AGAA++ MNP
Sbjct  1    MSVVGFDVGNENCVIAFAKQRGIDVILNDESKRETPAVVSFGEKQRFIGSAGAASATMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+TISQVKRLIGR++ +P +Q+DLK  PF+ +EGPDG  LIH +Y+ E ++FTP Q++ M
Sbjct  61   KSTISQVKRLIGRKYREPAVQKDLKLLPFTTSEGPDGGILIHLQYMNEKQSFTPVQIMAM  120

Query  496  VVSNLKSIAE  525
            + ++LK IAE
Sbjct  121  LFAHLKQIAE  130



>gb|EYU27798.1| hypothetical protein MIMGU_mgv1a001740mg [Erythranthe guttata]
Length=722

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNE+CV+AVA+QRGIDV+LNDES RE PA+V FGEKQRFLG+AGAA++ M+P
Sbjct  1    MSVVGFDIGNENCVIAVAKQRGIDVLLNDESNRENPAVVSFGEKQRFLGSAGAASATMHP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+TISQVKRLIGR FS+P +Q DL+  PF  +EGPDG  LIH RYL E +TFTP Q+L M
Sbjct  61   KSTISQVKRLIGRNFSEPTVQNDLRLLPFETSEGPDGGILIHLRYLEERQTFTPIQILAM  120

Query  496  VVSNLKSIAE  525
            ++++LK IAE
Sbjct  121  LLAHLKQIAE  130



>ref|XP_004151979.1| PREDICTED: heat shock 70 kDa protein 16-like [Cucumis sativus]
 gb|KGN57923.1| hypothetical protein Csa_3G391900 [Cucumis sativus]
Length=762

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNE+CV+AV+RQRGIDV+LN+ES+RETPA++ FGEKQRFLG+AGAA++ MNP
Sbjct  1    MSVVGFDIGNENCVIAVSRQRGIDVLLNEESQRETPAVIYFGEKQRFLGSAGAASATMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            ++TISQVKRLIGR FS+P++Q +LK FPF  +E  DG  L+H +YLGE  TFTP Q++GM
Sbjct  61   RSTISQVKRLIGRNFSEPDVQIELKMFPFKTSEALDGSILVHVKYLGETHTFTPVQIMGM  120

Query  496  VVSNLKSIAE  525
            ++++LK +AE
Sbjct  121  LLAHLKDVAE  130



>ref|XP_004167874.1| PREDICTED: LOW QUALITY PROTEIN: heat shock 70 kDa protein 16-like 
[Cucumis sativus]
Length=762

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNE+CV+AV+RQRGIDV+LN+ES+RETPA++ FGEKQRFLG+AGAA++ MNP
Sbjct  1    MSVVGFDIGNENCVIAVSRQRGIDVLLNEESQRETPAVIYFGEKQRFLGSAGAASATMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            ++TISQVKRLIGR FS+P++Q +LK FPF  +E  DG  L+H +YLGE  TFTP Q++GM
Sbjct  61   RSTISQVKRLIGRNFSEPDVQIELKMFPFKTSEALDGSILVHVKYLGETHTFTPVQIMGM  120

Query  496  VVSNLKSIAE  525
            ++++LK +AE
Sbjct  121  LLAHLKDVAE  130



>gb|AET00484.2| heat shock 70 kDa protein [Medicago truncatula]
Length=774

 Score =   196 bits (497),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNE+CV+AVA+Q G+DV+LN+ES RETPA+VCFGEKQRFLG+AGAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAVAKQGGVDVLLNNESNRETPAVVCFGEKQRFLGSAGAASAMMHP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+ +SQVKRLIGR+F DP++Q DLK FPF   EG DG  LIH  YL E   FTP Q+LGM
Sbjct  61   KSIVSQVKRLIGRRFDDPDVQNDLKMFPFETFEGSDGGILIHLEYLNETHKFTPVQILGM  120

Query  496  VVSNLKSIAET  528
            + ++LK+IAE 
Sbjct  121  LFAHLKTIAEN  131



>ref|XP_003617525.1| 97 kDa heat shock protein [Medicago truncatula]
Length=789

 Score =   196 bits (497),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNE+CV+AVA+Q G+DV+LN+ES RETPA+VCFGEKQRFLG+AGAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAVAKQGGVDVLLNNESNRETPAVVCFGEKQRFLGSAGAASAMMHP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+ +SQVKRLIGR+F DP++Q DLK FPF   EG DG  LIH  YL E   FTP Q+LGM
Sbjct  61   KSIVSQVKRLIGRRFDDPDVQNDLKMFPFETFEGSDGGILIHLEYLNETHKFTPVQILGM  120

Query  496  VVSNLKSIAET  528
            + ++LK+IAE 
Sbjct  121  LFAHLKTIAEN  131



>ref|XP_009614255.1| PREDICTED: heat shock 70 kDa protein 16 [Nicotiana tomentosiformis]
Length=753

 Score =   195 bits (496),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGNE+CV+A A+QRGIDV+LNDESKRETPA+V FGEKQRF+G+AGAA++ MNP
Sbjct  1    MSVVGFDVGNENCVIAFAKQRGIDVILNDESKRETPAVVSFGEKQRFIGSAGAASATMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+TISQVKRLIGR++ +P +Q DLK  PF+ +EGPDG  LIH +Y+ E ++FTP Q++ M
Sbjct  61   KSTISQVKRLIGRKYREPAVQMDLKLLPFATSEGPDGGILIHLQYMNEKQSFTPVQIMAM  120

Query  496  VVSNLKSIAE  525
            + ++LK IAE
Sbjct  121  LFAHLKQIAE  130



>ref|XP_007020850.1| Heat shock protein 70 family protein [Theobroma cacao]
 gb|EOY12375.1| Heat shock protein 70 family protein [Theobroma cacao]
Length=765

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNE+CV+A  +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAAVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMHP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            + T+SQVKRLIGR+F +P++Q++L+  PF  +EG DG  LIH +YLGE   FTP Q++ M
Sbjct  61   QTTVSQVKRLIGRKFREPDVQKELRLLPFETSEGQDGGILIHLKYLGETHRFTPVQIMAM  120

Query  496  VVSNLKSIAET  528
            + ++LK I ET
Sbjct  121  LFAHLKYITET  131



>ref|XP_002522946.1| Heat-shock protein 105 kDa, putative [Ricinus communis]
 gb|EEF39376.1| Heat-shock protein 105 kDa, putative [Ricinus communis]
Length=740

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNE+CVVA  +Q GIDV+LNDESKRETPA+VCFGEKQRFLG+AGAA++ MNP
Sbjct  1    MSVVGFDIGNENCVVATVKQGGIDVLLNDESKRETPAVVCFGEKQRFLGSAGAASATMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+TI QVKRLIGR F+DP+++ +LK  PF ++ G DG  LIH +YLGEM TFTP Q++ M
Sbjct  61   KSTICQVKRLIGRNFADPDIRNELKLLPFEISGGKDGGILIHLKYLGEMYTFTPVQIMAM  120

Query  496  VVSNLKSIAE  525
            + S+LK I E
Sbjct  121  LFSHLKEITE  130



>ref|XP_008465078.1| PREDICTED: heat shock 70 kDa protein 16 [Cucumis melo]
 ref|XP_008465079.1| PREDICTED: heat shock 70 kDa protein 16 [Cucumis melo]
Length=762

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNE+CV+AV+RQRGIDV+LN+ES+RET A++CFGEKQRFLG+A AA++ MNP
Sbjct  1    MSVVGFDIGNENCVIAVSRQRGIDVLLNEESQRETSAVICFGEKQRFLGSAAAASATMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            ++TISQVKRLIGR F++P +Q DLK FPF  +E  DG  L+H +YLGE  TFTP Q++GM
Sbjct  61   RSTISQVKRLIGRNFTEPGVQIDLKMFPFKTSEALDGSILVHVKYLGETHTFTPVQIMGM  120

Query  496  VVSNLKSIAE  525
            ++++L+ +AE
Sbjct  121  LLAHLRDVAE  130



>ref|XP_002278262.1| PREDICTED: heat shock 70 kDa protein 16 [Vitis vinifera]
Length=771

 Score =   192 bits (489),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNE+CV++V +QRGIDV+LNDESKRETP++VCFGEKQR LG+AGAA++ MNP
Sbjct  1    MSVVGFDIGNENCVISVVKQRGIDVLLNDESKRETPSVVCFGEKQRILGSAGAASATMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            ++TI QVKRLIG  FS+P ++ +LK FPF  +EGPDG  LIH +YLGE  TFTP Q+L M
Sbjct  61   RSTIFQVKRLIGLNFSEPHIKDELKMFPFETSEGPDGGILIHLQYLGERHTFTPVQILAM  120

Query  496  VVSNLKSIAE  525
            + ++LK I E
Sbjct  121  LFAHLKDITE  130



>ref|XP_006858197.1| hypothetical protein AMTR_s00062p00170870 [Amborella trichopoda]
 gb|ERN19664.1| hypothetical protein AMTR_s00062p00170870 [Amborella trichopoda]
Length=568

 Score =   190 bits (483),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+G+E+CVVAVA+QRGI+VVLNDESKRETPA+V FGEKQRFLG++G A++ MNP
Sbjct  1    MSVVGFDIGDENCVVAVAKQRGIEVVLNDESKRETPAIVSFGEKQRFLGSSGLASATMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+T+SQ+KRLIGR+F+ P  QRDL   PF+ +E PDG  LIH  Y+GE R FTP QVL M
Sbjct  61   KSTVSQIKRLIGRKFNCPYAQRDLHFLPFATSEAPDGGILIHIPYMGETRVFTPVQVLAM  120

Query  496  VVSNLKSIA  522
            ++S+LK IA
Sbjct  121  LLSHLKQIA  129



>ref|XP_010278704.1| PREDICTED: heat shock 70 kDa protein 16 [Nelumbo nucifera]
Length=777

 Score =   192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNESCV+A A+QRGIDV+LNDESKRETPA+V FGEKQRF+G +GAA+++MNP
Sbjct  1    MSVVGFDIGNESCVIAAAKQRGIDVLLNDESKRETPAVVSFGEKQRFIGASGAASALMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+TISQVKRLIG  F  P++Q++L++FPF  +EG DG  LIH +YLGE    TP Q+L M
Sbjct  61   KSTISQVKRLIGLNFRQPDVQKELRNFPFETSEGSDGNILIHLQYLGETLKLTPVQILAM  120

Query  496  VVSNLKSIAE  525
            + S+LK IAE
Sbjct  121  LFSHLKQIAE  130



>ref|XP_011096072.1| PREDICTED: heat shock 70 kDa protein 16 [Sesamum indicum]
 ref|XP_011096074.1| PREDICTED: heat shock 70 kDa protein 16 [Sesamum indicum]
 ref|XP_011096075.1| PREDICTED: heat shock 70 kDa protein 16 [Sesamum indicum]
Length=756

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNE+CV+AVA++RGIDV+LNDESKRE PA+V FGEKQRF+G AGAA++ M+P
Sbjct  1    MSVVGFDIGNENCVIAVAKERGIDVLLNDESKRENPAVVSFGEKQRFIGCAGAASATMHP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+TISQVKRLIGR +S+P +Q DL+  PF  +EGPDG  LIH +YL E +TFTP Q+L M
Sbjct  61   KSTISQVKRLIGRTYSEPTVQDDLRLLPFETSEGPDGGILIHLQYLDEKQTFTPIQILAM  120

Query  496  VVSNLKSIAE  525
            ++++LK I E
Sbjct  121  LLAHLKQITE  130



>ref|XP_010931798.1| PREDICTED: heat shock 70 kDa protein 16 [Elaeis guineensis]
Length=784

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GN++CV+A  +QRGIDV+LNDESKRETPA+V FGEKQRFLGT GAA++ MNP
Sbjct  1    MSVVGFDIGNDNCVIAAVKQRGIDVLLNDESKRETPAVVSFGEKQRFLGTTGAASAAMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            ++T+SQVKRLIGR F  P++Q DL+  PF  ++ PDG  LIH RYL E R FTP Q+LGM
Sbjct  61   RSTVSQVKRLIGRAFDHPDVQADLRRLPFLTSQAPDGGILIHLRYLNEDRAFTPVQILGM  120

Query  496  VVSNLKSIAE  525
            ++++LK +AE
Sbjct  121  LLAHLKDVAE  130



>ref|XP_004232717.1| PREDICTED: heat shock 70 kDa protein 16 [Solanum lycopersicum]
Length=753

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGNE+CV+ VA+QRGIDV+LNDES RETPA+V FGEKQRF+G AGAA++ MNP
Sbjct  1    MSVVGFDVGNENCVIGVAKQRGIDVILNDESNRETPAVVSFGEKQRFIGAAGAASATMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+TISQVKRLIGR++ +P +Q+DLK  PF+ +EGPDG  LI+  Y+ E  +FTP Q++ M
Sbjct  61   KSTISQVKRLIGRKYREPAVQKDLKLLPFATSEGPDGGILINLHYMDEKHSFTPVQIMAM  120

Query  496  VVSNLKSIAE  525
            + ++LK IAE
Sbjct  121  LFAHLKQIAE  130



>ref|XP_007020851.1| Heat shock protein 70 family protein [Theobroma cacao]
 gb|EOY12376.1| Heat shock protein 70 family protein [Theobroma cacao]
Length=764

 Score =   190 bits (483),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNE+CV++  +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MM+P
Sbjct  1    MSVVGFDIGNENCVISAVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMHP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K  +SQVKRLIGR+F DP++Q +L+  PF  +EG DG  LI  +YLGE   FTP Q++ M
Sbjct  61   KTMVSQVKRLIGRKFKDPDVQNELRLLPFETSEGQDGGILIQLKYLGETHRFTPLQIMAM  120

Query  496  VVSNLKSIAE  525
            + ++LK IAE
Sbjct  121  LFAHLKYIAE  130



>gb|AII99889.1| heat shock protein [Cicer arietinum]
Length=771

 Score =   190 bits (482),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNE+CV+AV +Q G+DV+LNDES RETPA+VCFGEKQRFLG+AGAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAVVKQGGVDVLLNDESNRETPAVVCFGEKQRFLGSAGAASAMMHP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+T+SQVKRLIGR+F+D ++Q DLK  P   +EG DG  LIH +YL E   FTP Q+L M
Sbjct  61   KSTVSQVKRLIGRRFADLDVQNDLKRLPIETSEGSDGGILIHLKYLKETHKFTPVQILAM  120

Query  496  VVSNLKSIAET  528
            + ++LK+IAE 
Sbjct  121  LFAHLKTIAEN  131



>ref|XP_004491392.1| PREDICTED: heat shock 70 kDa protein 16-like [Cicer arietinum]
Length=773

 Score =   190 bits (482),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNE+CV+AV +Q G+DV+LNDES RETPA+VCFGEKQRFLG+AGAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAVVKQGGVDVLLNDESNRETPAVVCFGEKQRFLGSAGAASAMMHP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+T+SQVKRLIGR+F+D ++Q DLK  P   +EG DG  LIH +YL E   FTP Q+L M
Sbjct  61   KSTVSQVKRLIGRRFADLDVQNDLKRLPIETSEGSDGGILIHLKYLKETHKFTPVQILAM  120

Query  496  VVSNLKSIAET  528
            + ++LK+IAE 
Sbjct  121  LFAHLKTIAEN  131



>ref|XP_010665569.1| PREDICTED: heat shock 70 kDa protein 16 [Beta vulgaris subsp. 
vulgaris]
Length=767

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNE+CV+A  +QRGIDV+LN+ESKRETP +V FGE QR  G+A AA++ MNP
Sbjct  1    MSVVGFDIGNENCVIAAVKQRGIDVLLNEESKRETPGVVSFGENQRLFGSAAAASATMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
             +TISQVKRLIGR+F +P++Q DL+ FPF  +EGPDG+ LIH +YLGE++TFTP Q+L M
Sbjct  61   TSTISQVKRLIGRRFDNPKVQNDLRLFPFETSEGPDGYILIHLKYLGELQTFTPVQLLAM  120

Query  496  VVSNLKSIAE  525
            + S+LK  A+
Sbjct  121  LFSHLKETAD  130



>ref|XP_006348107.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X1 [Solanum 
tuberosum]
Length=753

 Score =   188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSV+GFDVGNE+CV+ VA+QRGIDV+LNDES RETPA+V FG+KQRF+G AGAA++ MNP
Sbjct  1    MSVIGFDVGNENCVIGVAKQRGIDVILNDESNRETPAVVSFGDKQRFIGAAGAASATMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+TISQVKRLIGR++ +P +Q+DLK FPF+ +EG DG  LI+  Y+ E ++FTP Q++ M
Sbjct  61   KSTISQVKRLIGRKYREPAVQKDLKLFPFATSEGQDGGILINLHYMDEKQSFTPVQIMAM  120

Query  496  VVSNLKSIAE  525
            + ++LK IAE
Sbjct  121  LFAHLKQIAE  130



>gb|KJB69295.1| hypothetical protein B456_011G014900 [Gossypium raimondii]
 gb|KJB69296.1| hypothetical protein B456_011G014900 [Gossypium raimondii]
 gb|KJB69297.1| hypothetical protein B456_011G014900 [Gossypium raimondii]
 gb|KJB69298.1| hypothetical protein B456_011G014900 [Gossypium raimondii]
Length=774

 Score =   187 bits (476),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVG D+GNE+C++AVA+QRGIDV+LNDESKRETPA V FGEKQRF+G+AGAA++ MNP
Sbjct  1    MSVVGLDIGNENCIIAVAKQRGIDVLLNDESKRETPAAVSFGEKQRFIGSAGAASATMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            ++TI QVKRLIGR+F++P L+++LK FPF   E PDG  LI  +++GE+  FTP Q+LGM
Sbjct  61   RSTILQVKRLIGRKFNEPGLEKELKLFPFETFESPDGGILIRLQFMGEVHEFTPVQILGM  120

Query  496  VVSNLKSIAE  525
            + S+LK IAE
Sbjct  121  LFSHLKQIAE  130



>ref|XP_003553093.1| PREDICTED: heat shock 70 kDa protein 16-like [Glycine max]
Length=766

 Score =   187 bits (476),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNE+CV+AV RQRGIDV+LN ESKRETPA+VCFGEKQR LG+AGAA++MM+ 
Sbjct  1    MSVVGFDIGNENCVIAVVRQRGIDVLLNYESKRETPAVVCFGEKQRILGSAGAASAMMHI  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+TISQ+KRLIGR+F+DP+++++LK  P   +EG DG  LIH +Y+GE+  FTP Q+L M
Sbjct  61   KSTISQIKRLIGRKFADPDVEKELKMLPVETSEGQDGGILIHLKYMGEIHVFTPVQLLSM  120

Query  496  VVSNLKSIAE  525
            + ++LK++ E
Sbjct  121  LFAHLKTMTE  130



>gb|KHN45217.1| Heat shock 70 kDa protein 16 [Glycine soja]
Length=766

 Score =   187 bits (475),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNE+CV+AV RQRGIDV+LN ESKRETPA+VCFGEKQR LG+AGAA++MM+ 
Sbjct  1    MSVVGFDIGNENCVIAVVRQRGIDVLLNYESKRETPAVVCFGEKQRILGSAGAASAMMHI  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+TISQ+KRLIGR+F+DP+++++LK  P   +EG DG  LIH +Y+GE+  FTP Q+L M
Sbjct  61   KSTISQIKRLIGRKFADPDVEKELKMLPVETSEGQDGGILIHLKYMGEIHVFTPVQLLSM  120

Query  496  VVSNLKSIAE  525
            + ++LK++ E
Sbjct  121  LFAHLKTMTE  130



>ref|XP_008365284.1| PREDICTED: heat shock 70 kDa protein 16, partial [Malus domestica]
Length=683

 Score =   186 bits (473),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGNE+CV+AV  Q G+DV+LNDESKRETPA VCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDVGNENCVIAVVXQXGVDVLLNDESKRETPAXVCFGEKQRFLGSAGAASAMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+T+SQVKRL GR+F++P++QRDL       +E PDG  LIH +YLG   TFTP QV  M
Sbjct  61   KSTVSQVKRLXGRKFTEPDVQRDLXILXXXTSEAPDGGILIHLKYLGATHTFTPVQVTAM  120

Query  496  VVSNLKSIAE  525
            + ++LK + E
Sbjct  121  LFAHLKDLIE  130



>ref|XP_008806739.1| PREDICTED: heat shock 70 kDa protein 16 isoform X2 [Phoenix dactylifera]
Length=782

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GN++CV+A  +QRGIDV+LNDES+RETPA+V FGEKQRFLG+ GAA++ MNP
Sbjct  1    MSVVGFDIGNDNCVIAAVKQRGIDVLLNDESERETPAVVSFGEKQRFLGSTGAASAAMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            ++T+SQVKRL+GR F  P++Q DL+  PF  ++  DG  LIH RYL E RTFTP Q+LGM
Sbjct  61   RSTVSQVKRLVGRAFGHPDVQSDLRRLPFPTSQASDGGILIHIRYLNEDRTFTPVQILGM  120

Query  496  VVSNLKSIAE  525
            ++++LK +AE
Sbjct  121  LLAHLKDVAE  130



>ref|XP_008806738.1| PREDICTED: heat shock 70 kDa protein 16 isoform X1 [Phoenix dactylifera]
Length=783

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GN++CV+A  +QRGIDV+LNDES+RETPA+V FGEKQRFLG+ GAA++ MNP
Sbjct  1    MSVVGFDIGNDNCVIAAVKQRGIDVLLNDESERETPAVVSFGEKQRFLGSTGAASAAMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            ++T+SQVKRL+GR F  P++Q DL+  PF  ++  DG  LIH RYL E RTFTP Q+LGM
Sbjct  61   RSTVSQVKRLVGRAFGHPDVQSDLRRLPFPTSQASDGGILIHIRYLNEDRTFTPVQILGM  120

Query  496  VVSNLKSIAE  525
            ++++LK +AE
Sbjct  121  LLAHLKDVAE  130



>ref|XP_007146461.1| hypothetical protein PHAVU_006G042400g [Phaseolus vulgaris]
 gb|ESW18455.1| hypothetical protein PHAVU_006G042400g [Phaseolus vulgaris]
Length=771

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNE+CV+AV R+RGIDV+LN ESKRETPA+VCF EKQR LG+AGAA++MM+ 
Sbjct  1    MSVVGFDIGNENCVIAVVRERGIDVLLNYESKRETPAVVCFNEKQRLLGSAGAASAMMHI  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+TISQ+KRLIGR+F+DP++ ++LK  P   +E PDG  LIH +YLGE+  FTP Q++ M
Sbjct  61   KSTISQIKRLIGRKFADPDVDKELKMLPLETSESPDGGILIHLKYLGEIHVFTPVQIMSM  120

Query  496  VVSNLKSIAE  525
            + ++LK++ E
Sbjct  121  LFAHLKTMTE  130



>ref|XP_006306833.1| hypothetical protein CARUB_v10008380mg [Capsella rubella]
 gb|EOA39731.1| hypothetical protein CARUB_v10008380mg [Capsella rubella]
Length=737

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGNE+CV+AVA+QRGID++LNDES RE PA+V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDILLNDESNRENPAMVSFGEKQRFMGAAAAASATMHP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+TISQ+KRLIGR+F +P++Q DL+ FPF  +EG DG  LI  RY+GEM+ F+P Q+LGM
Sbjct  61   KSTISQLKRLIGRKFREPDVQNDLRLFPFETSEGSDGGILIQLRYMGEMQGFSPVQILGM  120

Query  496  VVSNLKSIAE  525
            ++S+LK IAE
Sbjct  121  LLSHLKQIAE  130



>ref|XP_006306834.1| hypothetical protein CARUB_v10008380mg [Capsella rubella]
 gb|EOA39732.1| hypothetical protein CARUB_v10008380mg [Capsella rubella]
Length=763

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGNE+CV+AVA+QRGID++LNDES RE PA+V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDILLNDESNRENPAMVSFGEKQRFMGAAAAASATMHP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+TISQ+KRLIGR+F +P++Q DL+ FPF  +EG DG  LI  RY+GEM+ F+P Q+LGM
Sbjct  61   KSTISQLKRLIGRKFREPDVQNDLRLFPFETSEGSDGGILIQLRYMGEMQGFSPVQILGM  120

Query  496  VVSNLKSIAE  525
            ++S+LK IAE
Sbjct  121  LLSHLKQIAE  130



>ref|XP_004294376.1| PREDICTED: heat shock 70 kDa protein 16 [Fragaria vesca subsp. 
vesca]
Length=767

 Score =   185 bits (469),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVG D+GNE+CV+AV +QRGIDV+LN+ESKRETPA+VCFGEKQRFLG+A +A++MM+P
Sbjct  1    MSVVGIDIGNENCVIAVVKQRGIDVLLNEESKRETPAVVCFGEKQRFLGSAASASAMMHP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+T+SQVKRLIGR+F++ ++Q+DL+  PF  +EGPDG  LIH  YLG    FTP Q+  M
Sbjct  61   KSTVSQVKRLIGRRFNEADVQKDLRMLPFKTSEGPDGSILIHLSYLGGTHMFTPVQITAM  120

Query  496  VVSNLKSIAE  525
            + ++L+ I E
Sbjct  121  LFAHLREIIE  130



>emb|CDP04389.1| unnamed protein product [Coffea canephora]
Length=767

 Score =   185 bits (469),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 107/130 (82%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSV+G DVGNE+CVVAVA+QRGIDV+LNDESKRETPA+V FGEKQRF+G  GAA++ MNP
Sbjct  1    MSVLGLDVGNENCVVAVAKQRGIDVLLNDESKRETPAVVSFGEKQRFMGAVGAASATMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            ++TISQVKRLIGR+F +P +Q DLK  PF  +EGPDG  LIH  YL E ++FTP Q++ M
Sbjct  61   RSTISQVKRLIGRKFREPSVQDDLKLVPFETSEGPDGGILIHLYYLDEKQSFTPFQIMVM  120

Query  496  VVSNLKSIAE  525
            +  +LK I+E
Sbjct  121  LFGHLKQISE  130



>ref|XP_002305580.2| hypothetical protein POPTR_0004s01640g [Populus trichocarpa]
 gb|EEE86091.2| hypothetical protein POPTR_0004s01640g [Populus trichocarpa]
Length=757

 Score =   184 bits (468),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 107/130 (82%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNE+CV+AVA++RGIDV+LNDES RETPA+V F EKQRF+G+ GAA+  MNP
Sbjct  1    MSVVGFDFGNENCVIAVAKERGIDVLLNDESNRETPAVVSFFEKQRFMGSEGAASLTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+T+SQVKRLIGR+F + E+Q DLK FPF + EG DG  LI  +YLGE+  F+P Q+LGM
Sbjct  61   KSTVSQVKRLIGRKFKEVEVQDDLKLFPFEIVEGHDGGILIKVQYLGEIHEFSPVQILGM  120

Query  496  VVSNLKSIAE  525
            + S+LK IAE
Sbjct  121  LFSHLKQIAE  130



>ref|XP_011037663.1| PREDICTED: heat shock 70 kDa protein 16 [Populus euphratica]
Length=769

 Score =   184 bits (468),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 107/130 (82%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNE+CV+AVA++RGIDV+LNDES RETPA+V F EKQRF+G+ GAA+  MNP
Sbjct  1    MSVVGFDFGNENCVIAVAKERGIDVLLNDESNRETPAVVSFFEKQRFMGSEGAASLTMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+T+SQVKRLIGR+F + E+Q DLK FPF + EG DG  LI  +YLGE+  F+P Q+LGM
Sbjct  61   KSTVSQVKRLIGRKFKEVEVQDDLKLFPFEIVEGHDGGILIKVQYLGEIHEFSPVQILGM  120

Query  496  VVSNLKSIAE  525
            + S+LK IAE
Sbjct  121  LFSHLKQIAE  130



>ref|XP_006595737.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X2 [Glycine 
max]
Length=773

 Score =   184 bits (467),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 107/130 (82%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MS VG D+GNE+CV+A  +QR IDV+LNDESKRETP +VCFGEKQRF+G+AGA ++MM+P
Sbjct  1    MSGVGIDIGNENCVIAAVKQRVIDVLLNDESKRETPGVVCFGEKQRFIGSAGAVSAMMHP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+TISQVKRLIGR+F+DP++Q DLK  P   +EGPDG  LI  +YL E+  FTP Q++ M
Sbjct  61   KSTISQVKRLIGRRFTDPDVQNDLKLLPVETSEGPDGGILIRLKYLKEIHAFTPVQIVAM  120

Query  496  VVSNLKSIAE  525
            + ++LK+IAE
Sbjct  121  LFAHLKTIAE  130



>ref|XP_006595736.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X1 [Glycine 
max]
 gb|KHN11927.1| Heat shock 70 kDa protein 16 [Glycine soja]
Length=802

 Score =   184 bits (467),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 107/130 (82%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MS VG D+GNE+CV+A  +QR IDV+LNDESKRETP +VCFGEKQRF+G+AGA ++MM+P
Sbjct  1    MSGVGIDIGNENCVIAAVKQRVIDVLLNDESKRETPGVVCFGEKQRFIGSAGAVSAMMHP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+TISQVKRLIGR+F+DP++Q DLK  P   +EGPDG  LI  +YL E+  FTP Q++ M
Sbjct  61   KSTISQVKRLIGRRFTDPDVQNDLKLLPVETSEGPDGGILIRLKYLKEIHAFTPVQIVAM  120

Query  496  VVSNLKSIAE  525
            + ++LK+IAE
Sbjct  121  LFAHLKTIAE  130



>emb|CBI36157.3| unnamed protein product [Vitis vinifera]
Length=784

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPD  423
            KN+ISQ+KRLIGRQFSDPELQ+DLKS PF+VTEGPD
Sbjct  61   KNSISQMKRLIGRQFSDPELQQDLKSLPFTVTEGPD  96



>ref|XP_006475182.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X2 [Citrus 
sinensis]
 gb|KDO62656.1| hypothetical protein CISIN_1g004296mg [Citrus sinensis]
Length=708

 Score =   182 bits (461),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNE+CV+A  + RG+DV+LN+ES RETP++VCFGEKQRF+G AG A++MM+P
Sbjct  1    MSVVGFDIGNENCVIATVKHRGVDVLLNEESNRETPSIVCFGEKQRFIGAAGYASAMMHP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+T+SQVKRLIGR++ DP +Q+DL   PF   E PDG   I  +YLGE  TF P QV+GM
Sbjct  61   KSTVSQVKRLIGRRYGDPVVQKDLMVLPFESCESPDGGISIKLKYLGETHTFCPVQVMGM  120

Query  496  VVSNLKSIAE  525
            + S+LK +AE
Sbjct  121  LFSHLKDVAE  130



>ref|XP_006452327.1| hypothetical protein CICLE_v10007538mg [Citrus clementina]
 ref|XP_006475181.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X1 [Citrus 
sinensis]
 gb|ESR65567.1| hypothetical protein CICLE_v10007538mg [Citrus clementina]
 gb|KDO62654.1| hypothetical protein CISIN_1g004296mg [Citrus sinensis]
 gb|KDO62655.1| hypothetical protein CISIN_1g004296mg [Citrus sinensis]
Length=763

 Score =   182 bits (462),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNE+CV+A  + RG+DV+LN+ES RETP++VCFGEKQRF+G AG A++MM+P
Sbjct  1    MSVVGFDIGNENCVIATVKHRGVDVLLNEESNRETPSIVCFGEKQRFIGAAGYASAMMHP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+T+SQVKRLIGR++ DP +Q+DL   PF   E PDG   I  +YLGE  TF P QV+GM
Sbjct  61   KSTVSQVKRLIGRRYGDPVVQKDLMVLPFESCESPDGGISIKLKYLGETHTFCPVQVMGM  120

Query  496  VVSNLKSIAE  525
            + S+LK +AE
Sbjct  121  LFSHLKDVAE  130



>gb|KJB22069.1| hypothetical protein B456_004G027900 [Gossypium raimondii]
Length=686

 Score =   182 bits (461),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNE CV+A  +QRG+DV+LNDESKRETPALVCFGEKQRFLG+A AA++MM+P
Sbjct  1    MSVVGFDIGNEKCVIAAVKQRGVDVLLNDESKRETPALVCFGEKQRFLGSAAAASAMMHP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K T+SQVKRLIGR+F DP++Q +L+  PF  +EG DG  LIH +YLGE   FTP Q++ M
Sbjct  61   KTTVSQVKRLIGRKFQDPDVQNELRMLPFETSEGQDGGILIHLKYLGETHRFTPVQIMAM  120

Query  496  VVSNLKSIAET  528
            + ++LK + ET
Sbjct  121  LFAHLKYMTET  131



>gb|KJB22068.1| hypothetical protein B456_004G027900 [Gossypium raimondii]
 gb|KJB22070.1| hypothetical protein B456_004G027900 [Gossypium raimondii]
Length=757

 Score =   181 bits (459),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNE CV+A  +QRG+DV+LNDESKRETPALVCFGEKQRFLG+A AA++MM+P
Sbjct  1    MSVVGFDIGNEKCVIAAVKQRGVDVLLNDESKRETPALVCFGEKQRFLGSAAAASAMMHP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K T+SQVKRLIGR+F DP++Q +L+  PF  +EG DG  LIH +YLGE   FTP Q++ M
Sbjct  61   KTTVSQVKRLIGRKFQDPDVQNELRMLPFETSEGQDGGILIHLKYLGETHRFTPVQIMAM  120

Query  496  VVSNLKSIAET  528
            + ++LK + ET
Sbjct  121  LFAHLKYMTET  131



>gb|KHG25442.1| Heat shock 70 kDa 16 -like protein [Gossypium arboreum]
Length=757

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNE CV+A  +QRG+DV+LNDESKRETPALVCFGEKQRFLG+A AA++MM+P
Sbjct  1    MSVVGFDIGNEKCVIAAVKQRGVDVLLNDESKRETPALVCFGEKQRFLGSAAAASAMMHP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K T+SQVKRLIGR+F DP++Q +L+  PF  +EG DG  LIH +YLGE   FTP Q++ M
Sbjct  61   KTTVSQVKRLIGRKFQDPDVQNELRMLPFETSEGQDGGILIHLKYLGETHRFTPVQIMAM  120

Query  496  VVSNLKSIAET  528
            + ++LK + ET
Sbjct  121  LFAHLKYMTET  131



>gb|KHM99573.1| Heat shock 70 kDa protein 16 [Glycine soja]
Length=769

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNE+CV+AV RQRGIDV+LN ESKRETPA+VCF EKQR LG+AGAA++MM+ 
Sbjct  1    MSVVGFDIGNENCVIAVVRQRGIDVLLNYESKRETPAVVCFSEKQRILGSAGAASAMMHI  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+TISQ+KRLIGR+F+DP+++++LK  P   +EG DG  LIH +Y GE+  FTP Q L M
Sbjct  61   KSTISQIKRLIGRKFADPDVKKELKMLPGKTSEGQDGGILIHLKYSGEIHVFTPVQFLSM  120

Query  496  VVSNLKSIAET  528
            + ++LK++ E 
Sbjct  121  LFAHLKTMTEN  131



>ref|XP_003532123.1| PREDICTED: heat shock 70 kDa protein 16-like [Glycine max]
Length=769

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GNE+CV+AV RQRGIDV+LN ESKRETPA+VCF EKQR LG+AGAA++MM+ 
Sbjct  1    MSVVGFDIGNENCVIAVVRQRGIDVLLNYESKRETPAVVCFSEKQRILGSAGAASAMMHI  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+TISQ+KRLIGR+F+DP+++++LK  P   +EG DG  LIH +Y GE+  FTP Q L M
Sbjct  61   KSTISQIKRLIGRKFADPDVKKELKMLPGKTSEGQDGGILIHLKYSGEIHVFTPVQFLSM  120

Query  496  VVSNLKSIAET  528
            + ++LK++ E 
Sbjct  121  LFAHLKTMTEN  131



>gb|KDO75458.1| hypothetical protein CISIN_1g004211mg [Citrus sinensis]
 gb|KDO75459.1| hypothetical protein CISIN_1g004211mg [Citrus sinensis]
Length=692

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 105/131 (80%), Gaps = 1/131 (1%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRG-IDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMN  312
            MSVVGFD+GNE+CV+A  +Q G +DV+LNDESKRETP +V F EKQRFLG+AGAA++MMN
Sbjct  1    MSVVGFDIGNENCVIAAVKQGGMLDVLLNDESKRETPTVVSFSEKQRFLGSAGAASAMMN  60

Query  313  PKNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLG  492
            PK+TISQVKRL+GR+F + ++Q+DLK FPF   E  DG  LI   YLGE   FTP Q+LG
Sbjct  61   PKSTISQVKRLLGRKFREDDVQKDLKLFPFETCESHDGGILIMLEYLGETHKFTPVQILG  120

Query  493  MVVSNLKSIAE  525
            M++SNLK I E
Sbjct  121  MLLSNLKQITE  131



>ref|XP_010493114.1| PREDICTED: heat shock 70 kDa protein 16-like [Camelina sativa]
 ref|XP_010493121.1| PREDICTED: heat shock 70 kDa protein 16-like [Camelina sativa]
Length=764

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGNE+CV+AVA+QRGIDV+LNDES RE PA+V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDVLLNDESNRENPAMVSFGEKQRFMGAAAAASATMHP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+TISQ+KRLIGR+F +P++Q DL+ FPF  +EG DG   I  RY+GE+++F+P Q+LGM
Sbjct  61   KSTISQLKRLIGRKFREPDVQNDLRLFPFEASEGSDGGIQIQLRYMGEIQSFSPVQILGM  120

Query  496  VVSNLKSIAE  525
            ++S+LK  AE
Sbjct  121  LLSHLKQTAE  130



>ref|XP_002889885.1| hypothetical protein ARALYDRAFT_888478 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66144.1| hypothetical protein ARALYDRAFT_888478 [Arabidopsis lyrata subsp. 
lyrata]
Length=773

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGNE+CV+AVA+QRGIDV+LNDES RE PA+V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDVLLNDESNRENPAMVSFGEKQRFMGAAAAASATMHP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+TISQ+KRLIGR+F +P++Q DL+ FPF  +E  DG   I  RY+GE+++F+P Q+LGM
Sbjct  61   KSTISQLKRLIGRKFREPDVQNDLRLFPFETSEDSDGGIQIQLRYMGEIQSFSPVQILGM  120

Query  496  VVSNLKSIAE  525
            ++S+LK IAE
Sbjct  121  LLSHLKQIAE  130



>ref|XP_006468028.1| PREDICTED: heat shock 70 kDa protein 16-like [Citrus sinensis]
 gb|KDO75456.1| hypothetical protein CISIN_1g004211mg [Citrus sinensis]
 gb|KDO75457.1| hypothetical protein CISIN_1g004211mg [Citrus sinensis]
Length=768

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 105/131 (80%), Gaps = 1/131 (1%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRG-IDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMN  312
            MSVVGFD+GNE+CV+A  +Q G +DV+LNDESKRETP +V F EKQRFLG+AGAA++MMN
Sbjct  1    MSVVGFDIGNENCVIAAVKQGGMLDVLLNDESKRETPTVVSFSEKQRFLGSAGAASAMMN  60

Query  313  PKNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLG  492
            PK+TISQVKRL+GR+F + ++Q+DLK FPF   E  DG  LI   YLGE   FTP Q+LG
Sbjct  61   PKSTISQVKRLLGRKFREDDVQKDLKLFPFETCESHDGGILIMLEYLGETHKFTPVQILG  120

Query  493  MVVSNLKSIAE  525
            M++SNLK I E
Sbjct  121  MLLSNLKQITE  131



>ref|NP_172631.2| heat shock protein 70 (Hsp 70) family protein [Arabidopsis thaliana]
 sp|Q9SAB1.1|HSP7Q_ARATH RecName: Full=Heat shock 70 kDa protein 16; AltName: Full=Heat 
shock protein 70-16; Short=AtHsp70-16 [Arabidopsis thaliana]
 gb|AAD30257.1|AC007296_18 Strong similarity to gb|Z70314 heat-shock protein from Arabidopsis 
thaliana and is a member of the PF|00012 Hsp70 protein 
family [Arabidopsis thaliana]
 gb|AEE28767.1| heat shock protein 70 (Hsp 70) family protein [Arabidopsis thaliana]
Length=763

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGNE+CV+AVA+QRGIDV+LNDES RE PA+V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDVLLNDESNRENPAMVSFGEKQRFMGAAAAASATMHP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+TISQ+KRLIGR+F +P++Q DL+ FPF  +E  DG   I  RY+GE+++F+P Q+LGM
Sbjct  61   KSTISQLKRLIGRKFREPDVQNDLRLFPFETSEDSDGGIQIRLRYMGEIQSFSPVQILGM  120

Query  496  VVSNLKSIAE  525
            ++S+LK IAE
Sbjct  121  LLSHLKQIAE  130



>ref|XP_010476099.1| PREDICTED: heat shock 70 kDa protein 16 [Camelina sativa]
Length=764

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGNE+CV+AVA+QRGIDV+LNDES RE PA+V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDVLLNDESNRENPAMVSFGEKQRFMGAAAAASATMHP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+TISQ+KRLIGR+F +P++Q DL+ FPF  +EG DG   I  RY+GE+++F+P Q+LGM
Sbjct  61   KSTISQLKRLIGRKFREPDVQNDLRLFPFEASEGSDGGIQIQLRYMGEIQSFSPVQILGM  120

Query  496  VVSNLKSIAE  525
            ++S+LK  AE
Sbjct  121  LLSHLKLTAE  130



>ref|XP_010458573.1| PREDICTED: heat shock 70 kDa protein 16-like [Camelina sativa]
Length=765

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGNE+CV+AVA+QRGIDV+LNDES RE PA+V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDVLLNDESNRENPAMVSFGEKQRFMGAAAAASATMHP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+TISQ+KRLIGR+F +P++Q DL+ FPF  +EG DG   I  RY+GE++ F+P Q+LGM
Sbjct  61   KSTISQLKRLIGRKFREPDVQNDLRLFPFEASEGSDGGIQIQLRYMGEIQRFSPVQILGM  120

Query  496  VVSNLKSIAE  525
            ++S+LK  AE
Sbjct  121  LLSHLKQTAE  130



>ref|XP_007142282.1| hypothetical protein PHAVU_008G267400g [Phaseolus vulgaris]
 gb|ESW14276.1| hypothetical protein PHAVU_008G267400g [Phaseolus vulgaris]
Length=765

 Score =   179 bits (453),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MS VG D+GNE+CV+A  +Q G+DV+LNDESKRETPA+VCFGEKQRFLG+AGA ++MM+P
Sbjct  1    MSGVGIDIGNENCVIAAVKQGGVDVLLNDESKRETPAVVCFGEKQRFLGSAGADSAMMHP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+ ISQVKRLIGR+F+DP++Q +LK  P   +E  DG  LIH +Y+ E   FTP Q++ M
Sbjct  61   KSAISQVKRLIGRRFADPDVQNELKMLPVETSESADGGILIHLKYMKESHVFTPVQIVAM  120

Query  496  VVSNLKSIAE  525
            + ++LK+IAE
Sbjct  121  LFAHLKTIAE  130



>gb|EPS74057.1| hypothetical protein M569_00693, partial [Genlisea aurea]
Length=738

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFD+GN++CV+AVA QRG+DV+LNDESKRETPA+V FG+KQRF+G++GAA++ M+P
Sbjct  1    MSVVGFDIGNDNCVIAVANQRGVDVLLNDESKRETPAVVSFGDKQRFMGSSGAASTTMHP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+TISQ+KRLI   + DP +Q +L+  PF  +EG DG  LIH RYLG+   FTP QVL M
Sbjct  61   KSTISQIKRLITLSYRDPSVQNELQLLPFETSEGADGGILIHLRYLGQRHIFTPVQVLAM  120

Query  496  VVSNLKSIAE  525
            ++  LK + E
Sbjct  121  LLGYLKELTE  130



>ref|XP_006417329.1| hypothetical protein EUTSA_v10006883mg [Eutrema salsugineum]
 gb|ESQ35682.1| hypothetical protein EUTSA_v10006883mg [Eutrema salsugineum]
Length=763

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGNE+CV+AVA+QRGIDV+LNDES RE PA+V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDVLLNDESNRENPAMVSFGEKQRFMGAAAAASATMHP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+TISQ+KRLIG ++ +P++Q DL+ FPF  +E  DG   I  RY+GEM++F+P Q+LGM
Sbjct  61   KSTISQLKRLIGMKYREPDVQNDLRLFPFETSEDSDGGIQIRLRYMGEMQSFSPVQLLGM  120

Query  496  VVSNLKSIAE  525
            ++S+LK IAE
Sbjct  121  LLSHLKQIAE  130



>ref|XP_009148495.1| PREDICTED: heat shock 70 kDa protein 16 [Brassica rapa]
 ref|XP_009148496.1| PREDICTED: heat shock 70 kDa protein 16 [Brassica rapa]
Length=761

 Score =   175 bits (444),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 110/131 (84%), Gaps = 1/131 (1%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGNE+CV+AVA+QRGIDV+LNDES RE P +V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDVLLNDESNRENPGMVSFGEKQRFMGAAAAASATMHP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTE-GPDGFPLIHARYLGEMRTFTPTQVLG  492
            K+TISQ+KRLIGR+F +P++Q+DLK FPF  +E   DG   I  RY+GE+++F+P Q+LG
Sbjct  61   KSTISQLKRLIGRKFKEPDVQKDLKLFPFETSEDSADGGIQIQLRYMGEVQSFSPVQILG  120

Query  493  MVVSNLKSIAE  525
            M++S+LK +AE
Sbjct  121  MLLSHLKQVAE  131



>emb|CDX97975.1| BnaA06g07260D [Brassica napus]
Length=761

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 110/131 (84%), Gaps = 1/131 (1%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGNE+CV+AVA+QRGIDV+LNDES RE P +V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDVLLNDESNRENPGMVSFGEKQRFMGAAAAASATMHP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTE-GPDGFPLIHARYLGEMRTFTPTQVLG  492
            K+TISQ+KRLIGR+F +P++Q+DLK FPF  +E   DG   I  RY+GE+++F+P Q+LG
Sbjct  61   KSTISQLKRLIGRKFKEPDVQKDLKLFPFETSEDSADGGIQIQLRYMGEVQSFSPVQILG  120

Query  493  MVVSNLKSIAE  525
            M++S+LK +AE
Sbjct  121  MLLSHLKQVAE  131



>emb|CDY49794.1| BnaCnng18070D [Brassica napus]
Length=761

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 110/131 (84%), Gaps = 1/131 (1%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGNE+CV+AVA+QRGIDV+LNDES RE P +V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDVLLNDESNRENPGMVSFGEKQRFMGAAAAASATMHP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTE-GPDGFPLIHARYLGEMRTFTPTQVLG  492
            K+TISQ+KRLIGR+F +P++Q+DLK FPF  +E   DG   I  RY+GE+++F+P Q+LG
Sbjct  61   KSTISQLKRLIGRKFREPDVQKDLKLFPFETSEDSADGGIQIRLRYMGEVQSFSPVQILG  120

Query  493  MVVSNLKSIAE  525
            M++S+LK +AE
Sbjct  121  MLLSHLKQVAE  131



>ref|XP_010533816.1| PREDICTED: heat shock 70 kDa protein 16 [Tarenaya hassleriana]
Length=763

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            M+VVGFDVGNE C++AVA+QRGIDV+LN+ES RETP++V FG+KQRF+G A AA++ M+P
Sbjct  1    MNVVGFDVGNEKCIIAVAKQRGIDVLLNEESNRETPSVVSFGDKQRFMGAAAAASATMHP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+TISQ+KRLIGR+F +P++Q DL+ FPF   EG DG   I  +Y G   +F+P Q+LGM
Sbjct  61   KSTISQLKRLIGRKFGEPDVQNDLRLFPFETFEGSDGGVQIRLQYSGMTHSFSPVQILGM  120

Query  496  VVSNLKSIAE  525
            ++S+LK I E
Sbjct  121  LLSHLKQITE  130



>ref|XP_009420545.1| PREDICTED: heat shock 70 kDa protein 16 [Musa acuminata subsp. 
malaccensis]
Length=781

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 103/130 (79%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGN+SCVVA  RQRGIDV+LNDES+RE PA+V FGEKQRFLG AGAA++   P
Sbjct  1    MSVVGFDVGNDSCVVAAVRQRGIDVLLNDESQRENPAVVSFGEKQRFLGAAGAASAARFP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            ++T+SQVKRL+GR F DP +Q DL+  PF  +E PDG  LI  R+L E R FTP Q+L M
Sbjct  61   RSTVSQVKRLLGRPFRDPAVQDDLRRLPFPTSEAPDGGILIRIRFLNEERVFTPVQILAM  120

Query  496  VVSNLKSIAE  525
            ++++LK IAE
Sbjct  121  LLAHLKLIAE  130



>ref|XP_001695858.1| heat shock protein 70E [Chlamydomonas reinhardtii]
 gb|EDP01195.1| heat shock protein 70E [Chlamydomonas reinhardtii]
Length=803

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 99/131 (76%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            +SVVGFDVGN++  VA+AR+RGIDV++N ESKRETPA + FGEK RFLGT GAA   + P
Sbjct  4    VSVVGFDVGNDTSCVALARKRGIDVIMNKESKRETPAAINFGEKMRFLGTDGAAKLGLQP  63

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            +NT+ Q+KR++G++F DP++Q D+   PF+V EGPDG  LI  RY  E   FTP QV+ M
Sbjct  64   QNTVHQLKRILGKKFKDPQVQEDIARLPFAVIEGPDGGCLIKVRYCNEEAVFTPEQVMAM  123

Query  496  VVSNLKSIAET  528
            V+ +LK IAE 
Sbjct  124  VIVDLKRIAEA  134



>ref|XP_002949519.1| heat shock protein Hsp70E [Volvox carteri f. nagariensis]
 gb|EFJ49538.1| heat shock protein Hsp70E [Volvox carteri f. nagariensis]
Length=809

 Score =   162 bits (410),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 98/130 (75%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            +SVVGFDVGN++  VA+AR+RGIDV++N ESKRETPA + FGEK RFLGT GAA   + P
Sbjct  4    VSVVGFDVGNDTSCVALARKRGIDVIMNKESKRETPAAINFGEKMRFLGTDGAAKLGLQP  63

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            +NT+ Q+KR++G++F DP +Q D+   PF+V EGPDG  LI  RY  E   FTP QV+ M
Sbjct  64   QNTVHQLKRILGKKFQDPLVQADIAKLPFAVLEGPDGGCLIKVRYCNEDAIFTPEQVMAM  123

Query  496  VVSNLKSIAE  525
            ++ +LK IAE
Sbjct  124  ILVDLKRIAE  133



>ref|XP_003082170.1| heat shock protein 91-Arabidopsis thaliana (ISS) [Ostreococcus 
tauri]
Length=779

 Score =   159 bits (402),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 98/130 (75%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVG D GN + VVA+AR++GIDVVLNDESKRETP++V FGEKQRF+G+A A    M P
Sbjct  29   MSVVGIDFGNATNVVALARRKGIDVVLNDESKRETPSMVNFGEKQRFIGSAAADKINMKP  88

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            +NT++QVKRL+GR F DPE+QRDL+   + V +G +G  L    YLG+ + FTP Q +  
Sbjct  89   RNTVTQVKRLVGRAFDDPEVQRDLRGLFYPVKKGKNGEVLCEMEYLGKKKEFTPEQCVAS  148

Query  496  VVSNLKSIAE  525
            ++S+LK IAE
Sbjct  149  ILSDLKRIAE  158



>ref|XP_005642775.1| heat shock protein 70E [Coccomyxa subellipsoidea C-169]
 gb|EIE18231.1| heat shock protein 70E [Coccomyxa subellipsoidea C-169]
Length=792

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 100/130 (77%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSV G D+G++   +AVAR+RGIDV++N ESKRETP+LV FG KQR LGT  A +  +NP
Sbjct  1    MSVAGIDIGDQKSCIAVARKRGIDVLMNKESKRETPSLVSFGTKQRQLGTDAAGSLTINP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNT+  +KRL+G+ FS+P++QRDL   P++V+EGPDG  LI+  YLGE ++FTP Q++  
Sbjct  61   KNTLFGLKRLLGKNFSNPDVQRDLPELPYNVSEGPDGGILINVDYLGERQSFTPEQIVAA  120

Query  496  VVSNLKSIAE  525
            ++ ++K IAE
Sbjct  121  IIVDMKDIAE  130



>emb|CEF99759.1| Heat shock protein 70 family [Ostreococcus tauri]
Length=801

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 98/130 (75%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVG D GN + VVA+AR++GIDVVLNDESKRETP++V FGEKQRF+G+A A    M P
Sbjct  1    MSVVGIDFGNATNVVALARRKGIDVVLNDESKRETPSMVNFGEKQRFIGSAAADKINMKP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            +NT++QVKRL+GR F DPE+QRDL+   + V +G +G  L    YLG+ + FTP Q +  
Sbjct  61   RNTVTQVKRLVGRAFDDPEVQRDLRGLFYPVKKGKNGEVLCEMEYLGKKKEFTPEQCVAS  120

Query  496  VVSNLKSIAE  525
            ++S+LK IAE
Sbjct  121  ILSDLKRIAE  130



>ref|XP_002973871.1| hypothetical protein SELMODRAFT_267697 [Selaginella moellendorffii]
 gb|EFJ24826.1| hypothetical protein SELMODRAFT_267697 [Selaginella moellendorffii]
Length=751

 Score =   156 bits (394),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 98/129 (76%), Gaps = 0/129 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MS +G D+GNE   +A+ARQ G+DV L++ES RETP+++ F ++ R +G +GAA+++ N 
Sbjct  1    MSCLGLDLGNEHSRIAIARQGGVDVFLDEESSRETPSVISFTQRDRCIGASGAASALGNL  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNT+ Q+KR+IGR+F DPELQ DLK  P  VTEG  G+P IH  YLGE R F  T++LGM
Sbjct  61   KNTVWQIKRIIGRKFRDPELQSDLKLMPCLVTEGRGGWPAIHVSYLGEHRIFGATELLGM  120

Query  496  VVSNLKSIA  522
            V+++LKSIA
Sbjct  121  VLAHLKSIA  129



>ref|XP_002969191.1| hypothetical protein SELMODRAFT_440676 [Selaginella moellendorffii]
 gb|EFJ30307.1| hypothetical protein SELMODRAFT_440676 [Selaginella moellendorffii]
Length=743

 Score =   156 bits (394),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 98/129 (76%), Gaps = 0/129 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MS +G D+GNE   +A+ARQ G+DV L++ES RETP+++ F ++ R +G +GAA+++ N 
Sbjct  1    MSCLGLDLGNEHSRIAIARQGGVDVFLDEESSRETPSVISFTQRDRCIGASGAASALGNL  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNT+ Q+KR+IGR+F DPELQ DLK  P  VTEG  G+P IH  YLGE R F  T++LGM
Sbjct  61   KNTVWQIKRIIGRKFRDPELQSDLKLMPCLVTEGRGGWPAIHVSYLGEHRIFGATELLGM  120

Query  496  VVSNLKSIA  522
            V+++LKSIA
Sbjct  121  VLAHLKSIA  129



>ref|XP_006449032.1| hypothetical protein CICLE_v10014383mg [Citrus clementina]
 gb|ESR62272.1| hypothetical protein CICLE_v10014383mg [Citrus clementina]
Length=646

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 92/131 (70%), Gaps = 17/131 (13%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRG-IDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMN  312
            MSVVGFD+GNE+CV+A  +Q G +DV+LNDESKRETP +V F EKQRFLG+AGAA++MMN
Sbjct  1    MSVVGFDIGNENCVIAAVKQGGMLDVLLNDESKRETPTVVSFSEKQRFLGSAGAASAMMN  60

Query  313  PKNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLG  492
            PK+TISQ                DLK FPF   E  DG  LI   YLGE+  FTP Q+LG
Sbjct  61   PKSTISQ----------------DLKLFPFETCESHDGGILIMLEYLGELHKFTPVQILG  104

Query  493  MVVSNLKSIAE  525
            M++SNLK I E
Sbjct  105  MLLSNLKQITE  115



>ref|XP_006449031.1| hypothetical protein CICLE_v10014383mg [Citrus clementina]
 gb|ESR62271.1| hypothetical protein CICLE_v10014383mg [Citrus clementina]
Length=752

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 92/131 (70%), Gaps = 17/131 (13%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRG-IDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMN  312
            MSVVGFD+GNE+CV+A  +Q G +DV+LNDESKRETP +V F EKQRFLG+AGAA++MMN
Sbjct  1    MSVVGFDIGNENCVIAAVKQGGMLDVLLNDESKRETPTVVSFSEKQRFLGSAGAASAMMN  60

Query  313  PKNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLG  492
            PK+TISQ                DLK FPF   E  DG  LI   YLGE+  FTP Q+LG
Sbjct  61   PKSTISQ----------------DLKLFPFETCESHDGGILIMLEYLGELHKFTPVQILG  104

Query  493  MVVSNLKSIAE  525
            M++SNLK I E
Sbjct  105  MLLSNLKQITE  115



>ref|XP_002505210.1| heat shock protein 70 [Micromonas sp. RCC299]
 gb|ACO66468.1| heat shock protein 70 [Micromonas sp. RCC299]
Length=811

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 99/130 (76%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVG D G+ + VVA+AR++GIDVVLN ESKRETPA+V FG+KQRF+G A A    M P
Sbjct  1    MSVVGLDFGSVNSVVALARRKGIDVVLNTESKRETPAMVNFGDKQRFIGCAAADKINMQP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNTI Q+KRLIG +FSDPE+Q  + +F F ++ GP+   LI   YLGE +TFTP +++ M
Sbjct  61   KNTIVQLKRLIGLRFSDPEVQALVPAFLFPISGGPNDEILITVDYLGEKKTFTPERLVAM  120

Query  496  VVSNLKSIAE  525
            ++S+LK IAE
Sbjct  121  ILSDLKVIAE  130



>ref|XP_003060408.1| heat shock protein 70 [Micromonas pusilla CCMP1545]
 gb|EEH55177.1| heat shock protein 70 [Micromonas pusilla CCMP1545]
Length=819

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 94/130 (72%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVG D GN + V+A+AR++GIDVVLN ESKRETP++V FGEKQRFLG A A    M P
Sbjct  1    MSVVGLDFGNANSVIALARRKGIDVVLNGESKRETPSMVNFGEKQRFLGCAAADKINMKP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            K+TI Q+K LIG ++SDPE+Q  L +F F +  GP+   LI   Y+ E + FTP +++ M
Sbjct  61   KDTIVQLKSLIGLRYSDPEVQAMLPNFVFPIAGGPNDEILITVTYMNEKKAFTPERLVAM  120

Query  496  VVSNLKSIAE  525
             +++LK IAE
Sbjct  121  ALADLKIIAE  130



>gb|KDD72574.1| heat shock protein Hsp70, partial [Helicosporidium sp. ATCC 50920]
Length=164

 Score =   131 bits (329),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 86/130 (66%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSV G D+GN +  +A+AR+ G+D++LN ES RETP++V F  KQR  GT        NP
Sbjct  1    MSVAGIDIGNSTSCIALARKGGVDLLLNKESNRETPSVVTFNAKQRQAGTDAVGAMATNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            +NT+ Q+KRL+G+QFSDP++QRDL  FPF V    DG   +   Y GE   F P Q++  
Sbjct  61   RNTVFQLKRLLGKQFSDPDVQRDLAEFPFKVAAASDGGCEVEVSYRGEPTRFAPEQLVAA  120

Query  496  VVSNLKSIAE  525
            ++++L++ AE
Sbjct  121  LLADLRAQAE  130



>ref|XP_011304595.1| PREDICTED: 97 kDa heat shock protein isoform X2 [Fopius arisanus]
Length=806

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 87/131 (66%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSV+G D GNESC VAVAR  GI+ + ND S R TP+ V F  K R LG A     + N 
Sbjct  4    MSVIGIDFGNESCYVAVARAGGIETIANDYSLRGTPSCVAFSGKNRILGVAAKNQMVTNM  63

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNT+   KRL+GR+++DP++Q++L+S P+ VT  PDG   IH +YLGE   FTP Q+  M
Sbjct  64   KNTVFGFKRLLGRKYNDPQVQKELRSLPYKVTAQPDGTIGIHVQYLGEEHIFTPEQITAM  123

Query  496  VVSNLKSIAET  528
            + + LK I+ET
Sbjct  124  LFTKLKEISET  134



>ref|XP_011304586.1| PREDICTED: 97 kDa heat shock protein isoform X1 [Fopius arisanus]
Length=842

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 87/131 (66%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSV+G D GNESC VAVAR  GI+ + ND S R TP+ V F  K R LG A     + N 
Sbjct  4    MSVIGIDFGNESCYVAVARAGGIETIANDYSLRGTPSCVAFSGKNRILGVAAKNQMVTNM  63

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNT+   KRL+GR+++DP++Q++L+S P+ VT  PDG   IH +YLGE   FTP Q+  M
Sbjct  64   KNTVFGFKRLLGRKYNDPQVQKELRSLPYKVTAQPDGTIGIHVQYLGEEHIFTPEQITAM  123

Query  496  VVSNLKSIAET  528
            + + LK I+ET
Sbjct  124  LFTKLKEISET  134



>ref|XP_003485911.1| PREDICTED: heat shock 70 kDa protein 4L-like [Bombus impatiens]
Length=866

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 86/131 (66%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSV+G D GNESC VAVAR  GI+ + ND S R TP+ V F  K R LG A     + N 
Sbjct  4    MSVIGIDFGNESCYVAVARAGGIETIANDYSLRNTPSCVAFSGKNRILGVAAKNQMVTNM  63

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNTI   KRL+GR+++DP++QR+L++ PF VT   DG   IH +YLGE   F+P Q+  M
Sbjct  64   KNTIHGFKRLLGRKYNDPQVQRELQTLPFKVTHQSDGSIGIHVQYLGEEHIFSPEQITAM  123

Query  496  VVSNLKSIAET  528
            + + LK I+ET
Sbjct  124  LFTKLKDISET  134



>ref|XP_001641799.1| predicted protein [Nematostella vectensis]
 gb|EDO49736.1| predicted protein [Nematostella vectensis]
Length=843

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 89/130 (68%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGN+SC +AVAR  GI+ V N+ S R TP+ V  G+KQR +GT+G    + N 
Sbjct  1    MSVVGFDVGNQSCYIAVARGGGIETVANEFSDRCTPSFVSLGDKQRLIGTSGKNQMISNL  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNTISQ KR IGR+FSDP +Q+++   P+ V E P+    I  +YLG+   F+P QV+ M
Sbjct  61   KNTISQFKRFIGRKFSDPAVQKEIPHLPYKVVELPNDSIGIQVQYLGKQEVFSPEQVMAM  120

Query  496  VVSNLKSIAE  525
            + + LK+ AE
Sbjct  121  LFTRLKTTAE  130



>ref|XP_003702344.1| PREDICTED: 97 kDa heat shock protein-like [Megachile rotundata]
Length=865

 Score =   137 bits (346),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 86/131 (66%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSV+G D GNESC VAVAR  GI+ + ND S R TP+ V F  K R LG A     + N 
Sbjct  4    MSVIGIDFGNESCYVAVARAGGIETIANDYSLRSTPSCVAFSGKNRILGVAAKNQMVTNM  63

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNTI   KRL+GR+++DP++QR++K  PF VT+  DG   IH +YLGE   F+P Q+  M
Sbjct  64   KNTIYGFKRLLGRKYNDPQVQREIKMLPFKVTQQADGNIGIHVQYLGEEHIFSPEQITAM  123

Query  496  VVSNLKSIAET  528
            + + LK I+ET
Sbjct  124  LFTKLKDISET  134



>ref|XP_006615729.1| PREDICTED: 97 kDa heat shock protein-like isoform X2 [Apis dorsata]
Length=831

 Score =   137 bits (345),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 85/131 (65%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSV+G D GNESC VAVAR  GI+ + ND S R TP+ V F  K R LG A     + N 
Sbjct  4    MSVIGIDFGNESCYVAVARAGGIETIANDYSLRSTPSCVAFSGKNRILGVAAKNQMVTNM  63

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNTI   KRL+GR+++DP++QR+L+  PF VT   DG   IH +YLGE   F+P Q+  M
Sbjct  64   KNTIHGFKRLLGRKYNDPQVQRELQMLPFKVTHQSDGSIGIHVQYLGEEHIFSPEQITAM  123

Query  496  VVSNLKSIAET  528
            + + LK I+ET
Sbjct  124  LFTKLKDISET  134



>ref|XP_006561225.1| PREDICTED: 97 kDa heat shock protein isoform X2 [Apis mellifera]
Length=831

 Score =   137 bits (345),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 85/131 (65%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSV+G D GNESC VAVAR  GI+ + ND S R TP+ V F  K R LG A     + N 
Sbjct  4    MSVIGIDFGNESCYVAVARAGGIETIANDYSLRSTPSCVAFSGKNRILGVAAKNQMVTNM  63

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNTI   KRL+GR+++DP++QR+L+  PF VT   DG   IH +YLGE   F+P Q+  M
Sbjct  64   KNTIHGFKRLLGRKYNDPQVQRELQMLPFKVTHQSDGSIGIHVQYLGEEHIFSPEQITAM  123

Query  496  VVSNLKSIAET  528
            + + LK I+ET
Sbjct  124  LFTKLKDISET  134



>ref|XP_006615728.1| PREDICTED: 97 kDa heat shock protein-like isoform X1 [Apis dorsata]
Length=867

 Score =   137 bits (346),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 85/131 (65%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSV+G D GNESC VAVAR  GI+ + ND S R TP+ V F  K R LG A     + N 
Sbjct  4    MSVIGIDFGNESCYVAVARAGGIETIANDYSLRSTPSCVAFSGKNRILGVAAKNQMVTNM  63

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNTI   KRL+GR+++DP++QR+L+  PF VT   DG   IH +YLGE   F+P Q+  M
Sbjct  64   KNTIHGFKRLLGRKYNDPQVQRELQMLPFKVTHQSDGSIGIHVQYLGEEHIFSPEQITAM  123

Query  496  VVSNLKSIAET  528
            + + LK I+ET
Sbjct  124  LFTKLKDISET  134



>ref|XP_623199.2| PREDICTED: 97 kDa heat shock protein isoformX1 [Apis mellifera]
Length=867

 Score =   137 bits (345),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 85/131 (65%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSV+G D GNESC VAVAR  GI+ + ND S R TP+ V F  K R LG A     + N 
Sbjct  4    MSVIGIDFGNESCYVAVARAGGIETIANDYSLRSTPSCVAFSGKNRILGVAAKNQMVTNM  63

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNTI   KRL+GR+++DP++QR+L+  PF VT   DG   IH +YLGE   F+P Q+  M
Sbjct  64   KNTIHGFKRLLGRKYNDPQVQRELQMLPFKVTHQSDGSIGIHVQYLGEEHIFSPEQITAM  123

Query  496  VVSNLKSIAET  528
            + + LK I+ET
Sbjct  124  LFTKLKDISET  134



>ref|XP_003691374.1| PREDICTED: heat shock 70 kDa protein 4L-like [Apis florea]
Length=866

 Score =   137 bits (345),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 85/131 (65%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSV+G D GNESC VAVAR  GI+ + ND S R TP+ V F  K R LG A     + N 
Sbjct  4    MSVIGIDFGNESCYVAVARAGGIETIANDYSLRSTPSCVAFSGKNRILGVAAKNQMVTNM  63

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNTI   KRL+GR+++DP++QR+L+  PF VT   DG   IH +YLGE   F+P Q+  M
Sbjct  64   KNTIHGFKRLLGRKYNDPQVQRELQMLPFKVTHQSDGSIGIHVQYLGEEHIFSPEQITAM  123

Query  496  VVSNLKSIAET  528
            + + LK I+ET
Sbjct  124  LFTKLKDISET  134



>ref|XP_003394081.1| PREDICTED: heat shock 70 kDa protein 4L-like [Bombus terrestris]
Length=866

 Score =   137 bits (345),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 86/131 (66%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSV+G D GNESC VAVAR  GI+ + ND S R TP+ V F  K R LG A     + N 
Sbjct  4    MSVIGIDFGNESCYVAVARAGGIETITNDYSLRNTPSCVAFSGKNRILGVAAKNQMVTNM  63

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNTI   KRL+GR+++DP++QR+L++ PF VT   DG   IH +YLGE   F+P Q+  M
Sbjct  64   KNTIHGFKRLLGRKYNDPQVQRELQTLPFKVTHQSDGGIGIHVQYLGEEHIFSPEQITAM  123

Query  496  VVSNLKSIAET  528
            + + LK I+E+
Sbjct  124  LFTKLKDISES  134



>ref|XP_005846866.1| hypothetical protein CHLNCDRAFT_35731 [Chlorella variabilis]
 gb|EFN54764.1| hypothetical protein CHLNCDRAFT_35731 [Chlorella variabilis]
Length=832

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 91/130 (70%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            M+  G DVG+ +  +A+AR+ G+DV+LN ESKRETP++V F  KQR +GT  +     NP
Sbjct  1    MACAGIDVGDATSCIALARKGGVDVLLNKESKRETPSVVTFTHKQRMMGTDASGGMSTNP  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            +NTISQ+KRL+G++F+DP +Q DLK+FP+ V  GPDG  + +  Y  +   F+  Q+L M
Sbjct  61   RNTISQLKRLLGKKFNDPHVQEDLKNFPYKVEAGPDGECVFNVEYQDKQARFSAVQLLAM  120

Query  496  VVSNLKSIAE  525
            ++ +LK IAE
Sbjct  121  LLVDLKLIAE  130



>sp|Q06068.2|HSP97_STRPU RecName: Full=97 kDa heat shock protein; AltName: Full=Egg sperm 
receptor [Strongylocentrotus purpuratus]
 gb|AAB09737.1| sperm receptor [Strongylocentrotus purpuratus]
Length=889

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 89/130 (68%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGN S  +AVAR  GI+ + N+ S R TP++V FGEK R  G A  + ++ N 
Sbjct  1    MSVVGFDVGNLSSYIAVARGGGIETMANEYSDRLTPSVVSFGEKSRTQGHAARSQAITNY  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNT+SQ KR I R+FSDP +Q+D K  P+ +T+ P+G   +  +YLGE  TFTP Q+  M
Sbjct  61   KNTLSQFKRFIARRFSDPSVQKDAKVVPYKITQLPNGNVGMQVQYLGETETFTPEQIYAM  120

Query  496  VVSNLKSIAE  525
            +++ LKS AE
Sbjct  121  ILTKLKSTAE  130



>ref|NP_999695.1| 97 kDa heat shock protein [Strongylocentrotus purpuratus]
 gb|AAB17669.1| egg receptor for sperm [Strongylocentrotus purpuratus]
Length=889

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 89/130 (68%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGN S  +AVAR  GI+ + N+ S R TP++V FGEK R  G A  + ++ N 
Sbjct  1    MSVVGFDVGNLSSYIAVARGGGIETMANEYSDRLTPSVVSFGEKSRTQGHAARSQAITNY  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNT+SQ KR I R+FSDP +Q+D K  P+ +T+ P+G   +  +YLGE  TFTP Q+  M
Sbjct  61   KNTLSQFKRFIARRFSDPSVQKDAKVVPYKITQLPNGNVGMQVQYLGETETFTPEQIYAM  120

Query  496  VVSNLKSIAE  525
            +++ LKS AE
Sbjct  121  ILTKLKSTAE  130



>sp|Q94738.1|HSP97_STRFN RecName: Full=97 kDa heat shock protein; AltName: Full=Heat shock 
protein 110 [Strongylocentrotus franciscanus]
 gb|AAB09038.1| heat shock protein 110 [Strongylocentrotus franciscanus]
Length=886

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 88/130 (68%), Gaps = 0/130 (0%)
 Frame = +1

Query  136  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  315
            MSVVGFDVGN S  +AVAR  GI+ + N+ S R TP++V FGEK R  G A  + ++ N 
Sbjct  1    MSVVGFDVGNLSSYIAVARGGGIETMANEYSDRLTPSVVSFGEKSRTQGHAARSQAITNY  60

Query  316  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  495
            KNT+SQ KR I RQFSDP +Q+D    P+ VT+ P+G   +  +YLGE  TFTP Q+  M
Sbjct  61   KNTLSQFKRFIARQFSDPSVQKDAHVVPYKVTQLPNGNVGMQVQYLGETETFTPEQIYAM  120

Query  496  VVSNLKSIAE  525
            +++ LK+ AE
Sbjct  121  ILTKLKATAE  130



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 565229601645