BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS071H02

Length=625
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006338348.1|  PREDICTED: receptor-like protein kinase FERO...    220   5e-63   Solanum tuberosum [potatoes]
ref|XP_004232151.1|  PREDICTED: receptor-like protein kinase FERONIA    216   1e-61   Solanum lycopersicum
emb|CDP05402.1|  unnamed protein product                                216   2e-61   Coffea canephora [robusta coffee]
emb|CDP05401.1|  unnamed protein product                                214   1e-60   Coffea canephora [robusta coffee]
emb|CDP19885.1|  unnamed protein product                                213   2e-60   Coffea canephora [robusta coffee]
ref|XP_009588433.1|  PREDICTED: receptor-like protein kinase FERONIA    207   2e-58   Nicotiana tomentosiformis
gb|EYU44220.1|  hypothetical protein MIMGU_mgv1a003782mg                200   4e-57   Erythranthe guttata [common monkey flower]
ref|XP_009790513.1|  PREDICTED: receptor-like protein kinase FERONIA    203   4e-57   Nicotiana sylvestris
ref|XP_009790514.1|  PREDICTED: receptor-like protein kinase FERONIA    203   7e-57   Nicotiana sylvestris
emb|CDP19887.1|  unnamed protein product                                196   2e-54   Coffea canephora [robusta coffee]
ref|XP_006373376.1|  hypothetical protein POPTR_0017s13200g             186   3e-54   
ref|NP_001141864.1|  uncharacterized protein LOC100274007               184   4e-54   
emb|CDY48659.1|  BnaC07g27500D                                          182   7e-54   Brassica napus [oilseed rape]
ref|XP_007217058.1|  hypothetical protein PRUPE_ppa001157mg             193   2e-53   
ref|XP_008230913.1|  PREDICTED: receptor-like protein kinase FERONIA    191   5e-53   Prunus mume [ume]
emb|CDP06209.1|  unnamed protein product                                189   7e-53   Coffea canephora [robusta coffee]
ref|XP_006373380.1|  hypothetical protein POPTR_0017s13240g             191   1e-52   
ref|XP_011099030.1|  PREDICTED: receptor-like protein kinase FERONIA    191   1e-52   Sesamum indicum [beniseed]
ref|XP_009373799.1|  PREDICTED: receptor-like protein kinase FERONIA    191   2e-52   
emb|CAN68061.1|  hypothetical protein VITISV_037438                     181   3e-52   Vitis vinifera
emb|CAN65310.1|  hypothetical protein VITISV_043086                     181   3e-52   Vitis vinifera
ref|XP_011018979.1|  PREDICTED: receptor-like protein kinase FERONIA    181   3e-52   Populus euphratica
emb|CAN77538.1|  hypothetical protein VITISV_025026                     189   4e-52   Vitis vinifera
ref|XP_002277584.3|  PREDICTED: receptor-like protein kinase FERONIA    189   4e-52   Vitis vinifera
emb|CBI21192.3|  unnamed protein product                                190   5e-52   Vitis vinifera
gb|ABY40731.1|  FERONIA receptor-like kinase                            184   7e-52   Citrus trifoliata [hardy orange]
ref|XP_010660576.1|  PREDICTED: receptor-like protein kinase FERONIA    188   1e-51   
ref|XP_010694018.1|  PREDICTED: putative receptor-like protein ki...    188   2e-51   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010244547.1|  PREDICTED: receptor-like protein kinase FERONIA    187   3e-51   Nelumbo nucifera [Indian lotus]
ref|XP_004142677.1|  PREDICTED: receptor-like protein kinase FERO...    187   3e-51   Cucumis sativus [cucumbers]
gb|EPS73118.1|  hypothetical protein M569_01631                         187   3e-51   Genlisea aurea
ref|XP_006373370.1|  hypothetical protein POPTR_0017s13150g             187   3e-51   
ref|XP_008463270.1|  PREDICTED: receptor-like protein kinase FERONIA    187   4e-51   Cucumis melo [Oriental melon]
emb|CDP20271.1|  unnamed protein product                                187   4e-51   Coffea canephora [robusta coffee]
ref|XP_010034429.1|  PREDICTED: receptor-like protein kinase FERONIA    187   5e-51   Eucalyptus grandis [rose gum]
ref|XP_010693989.1|  PREDICTED: receptor-like protein kinase FERO...    187   7e-51   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001238686.1|  receptor-like kinase                               186   8e-51   Glycine max [soybeans]
ref|XP_004306057.1|  PREDICTED: receptor-like protein kinase FERONIA    186   9e-51   Fragaria vesca subsp. vesca
gb|KHN40613.1|  Receptor-like protein kinase FERONIA                    186   1e-50   Glycine soja [wild soybean]
ref|XP_010034431.1|  PREDICTED: receptor-like protein kinase FERONIA    185   2e-50   
ref|XP_006373383.1|  hypothetical protein POPTR_0017s13270g             184   2e-50   
ref|XP_011099029.1|  PREDICTED: receptor-like protein kinase FERONIA    185   2e-50   Sesamum indicum [beniseed]
ref|XP_008368476.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    185   2e-50   
ref|XP_006419383.1|  hypothetical protein CICLE_v10004295mg             184   2e-50   Citrus clementina [clementine]
ref|XP_010485852.1|  PREDICTED: receptor-like protein kinase ANXUR1     184   2e-50   
ref|XP_002467915.1|  hypothetical protein SORBIDRAFT_01g036260          185   2e-50   Sorghum bicolor [broomcorn]
ref|XP_010098025.1|  Receptor-like protein kinase FERONIA               185   3e-50   Morus notabilis
ref|XP_010252026.1|  PREDICTED: receptor-like protein kinase FERONIA    185   3e-50   Nelumbo nucifera [Indian lotus]
gb|KDO71938.1|  hypothetical protein CISIN_1g041565mg                   184   3e-50   Citrus sinensis [apfelsine]
ref|XP_006488842.1|  PREDICTED: receptor-like protein kinase ANXU...    184   3e-50   Citrus sinensis [apfelsine]
ref|XP_007033491.1|  Malectin/receptor-like protein kinase family...    184   3e-50   Theobroma cacao [chocolate]
gb|KHN29489.1|  Receptor-like protein kinase FERONIA                    184   3e-50   Glycine soja [wild soybean]
ref|XP_006373375.1|  hypothetical protein POPTR_0017s13190g             184   4e-50   
ref|XP_006429617.1|  hypothetical protein CICLE_v10011034mg             184   4e-50   Citrus clementina [clementine]
gb|KDO64141.1|  hypothetical protein CISIN_1g036624mg                   184   4e-50   Citrus sinensis [apfelsine]
ref|NP_001237656.1|  FERONIA receptor-like kinase precursor             184   4e-50   Glycine max [soybeans]
ref|XP_009151260.1|  PREDICTED: receptor-like protein kinase ANXUR2     184   5e-50   Brassica rapa
gb|KJB29840.1|  hypothetical protein B456_005G120700                    184   5e-50   Gossypium raimondii
emb|CDX86206.1|  BnaA06g29230D                                          184   5e-50   
ref|XP_010694005.1|  PREDICTED: putative receptor-like protein ki...    184   5e-50   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010694013.1|  PREDICTED: putative receptor-like protein ki...    184   5e-50   
ref|XP_010684237.1|  PREDICTED: receptor-like protein kinase ANXUR1     184   5e-50   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010417830.1|  PREDICTED: receptor-like protein kinase ANXUR1     183   5e-50   Camelina sativa [gold-of-pleasure]
ref|XP_006408164.1|  hypothetical protein EUTSA_v10020050mg             183   6e-50   Eutrema salsugineum [saltwater cress]
ref|XP_002884459.1|  kinase family protein                              183   6e-50   Arabidopsis lyrata subsp. lyrata
tpg|DAA45217.1|  TPA: putative receptor-like protein kinase famil...    184   6e-50   
ref|XP_009388382.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    178   7e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009791682.1|  PREDICTED: receptor-like protein kinase FERONIA    184   7e-50   Nicotiana sylvestris
ref|XP_010683454.1|  PREDICTED: receptor-like protein kinase FERONIA    183   7e-50   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009617447.1|  PREDICTED: receptor-like protein kinase FERONIA    183   8e-50   Nicotiana tomentosiformis
ref|XP_002279218.3|  PREDICTED: receptor-like protein kinase FERONIA    183   9e-50   
ref|XP_006842554.1|  hypothetical protein AMTR_s00077p00138840          183   1e-49   
ref|XP_007208402.1|  hypothetical protein PRUPE_ppa001164mg             183   1e-49   Prunus persica
ref|XP_008244701.1|  PREDICTED: receptor-like protein kinase FERONIA    183   1e-49   Prunus mume [ume]
ref|XP_006341293.1|  PREDICTED: receptor-like protein kinase FERO...    183   1e-49   Solanum tuberosum [potatoes]
ref|XP_002528705.1|  kinase, putative                                   183   1e-49   
ref|XP_010553161.1|  PREDICTED: receptor-like protein kinase FERONIA    182   1e-49   Tarenaya hassleriana [spider flower]
ref|XP_004246282.1|  PREDICTED: receptor-like protein kinase FERONIA    183   1e-49   Solanum lycopersicum
ref|XP_009337788.1|  PREDICTED: receptor-like protein kinase FERONIA    183   1e-49   Pyrus x bretschneideri [bai li]
gb|KDP21852.1|  hypothetical protein JCGZ_00639                         181   1e-49   Jatropha curcas
ref|XP_010921463.1|  PREDICTED: receptor-like protein kinase ANXUR2     182   1e-49   Elaeis guineensis
ref|XP_008341792.1|  PREDICTED: receptor-like protein kinase FERONIA    183   1e-49   
ref|XP_010463957.1|  PREDICTED: receptor-like protein kinase ANXUR1     182   1e-49   Camelina sativa [gold-of-pleasure]
ref|XP_008341797.1|  PREDICTED: receptor-like protein kinase FERONIA    182   1e-49   
gb|KJB38065.1|  hypothetical protein B456_006G235700                    182   1e-49   Gossypium raimondii
ref|XP_010043538.1|  PREDICTED: receptor-like protein kinase FERONIA    182   1e-49   Eucalyptus grandis [rose gum]
ref|XP_010494105.1|  PREDICTED: receptor-like protein kinase ANXUR2     182   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010455191.1|  PREDICTED: receptor-like protein kinase ANXUR2     182   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_008660180.1|  PREDICTED: receptor-like protein kinase FERONIA    182   2e-49   Zea mays [maize]
ref|XP_002271113.1|  PREDICTED: receptor-like protein kinase ANXUR1     182   2e-49   Vitis vinifera
gb|KCW52050.1|  hypothetical protein EUGRSUZ_J01490                     181   2e-49   Eucalyptus grandis [rose gum]
ref|XP_011079535.1|  PREDICTED: receptor-like protein kinase ANXUR1     182   2e-49   Sesamum indicum [beniseed]
dbj|BAJ91215.1|  predicted protein                                      176   3e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010529939.1|  PREDICTED: receptor-like protein kinase FERONIA    182   3e-49   Tarenaya hassleriana [spider flower]
ref|XP_009365906.1|  PREDICTED: receptor-like protein kinase FERO...    182   3e-49   
ref|XP_009365902.1|  PREDICTED: receptor-like protein kinase FERO...    182   3e-49   
ref|XP_010252025.1|  PREDICTED: receptor-like protein kinase FERONIA    182   3e-49   Nelumbo nucifera [Indian lotus]
ref|XP_006646366.1|  PREDICTED: receptor-like protein kinase FERO...    181   3e-49   Oryza brachyantha
ref|XP_003609098.1|  FERONIA receptor-like kinase                       182   3e-49   
gb|KEH23293.1|  feronia receptor-like kinase                            182   3e-49   Medicago truncatula
ref|XP_009365907.1|  PREDICTED: receptor-like protein kinase FERONIA    182   4e-49   Pyrus x bretschneideri [bai li]
ref|XP_009365903.1|  PREDICTED: receptor-like protein kinase FERO...    181   4e-49   
ref|XP_009397265.1|  PREDICTED: probable receptor-like protein ki...    181   4e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011095158.1|  PREDICTED: receptor-like protein kinase FERONIA    181   4e-49   Sesamum indicum [beniseed]
ref|XP_004984479.1|  PREDICTED: receptor-like protein kinase FERO...    181   5e-49   Setaria italica
ref|XP_008364006.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    180   5e-49   
ref|XP_010099327.1|  Receptor-like protein kinase FERONIA               182   5e-49   
ref|XP_011016728.1|  PREDICTED: receptor-like protein kinase FERONIA    181   6e-49   Populus euphratica
ref|XP_010678455.1|  PREDICTED: probable receptor-like protein ki...    181   6e-49   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006395027.1|  hypothetical protein EUTSA_v10003639mg             181   6e-49   Eutrema salsugineum [saltwater cress]
gb|KCW52041.1|  hypothetical protein EUGRSUZ_J01482                     181   6e-49   Eucalyptus grandis [rose gum]
ref|XP_010242732.1|  PREDICTED: receptor-like protein kinase ANXUR1     181   6e-49   Nelumbo nucifera [Indian lotus]
ref|XP_010034435.1|  PREDICTED: receptor-like protein kinase FERONIA    181   7e-49   
ref|XP_007140079.1|  hypothetical protein PHAVU_008G082400g             181   7e-49   Phaseolus vulgaris [French bean]
gb|EEC76216.1|  hypothetical protein OsI_13615                          180   7e-49   Oryza sativa Indica Group [Indian rice]
ref|XP_002463853.1|  hypothetical protein SORBIDRAFT_01g007450          180   7e-49   
ref|XP_004302537.1|  PREDICTED: receptor-like protein kinase FERONIA    181   7e-49   Fragaria vesca subsp. vesca
ref|XP_010034437.1|  PREDICTED: receptor-like protein kinase FERONIA    181   7e-49   Eucalyptus grandis [rose gum]
gb|KJB71481.1|  hypothetical protein B456_011G124900                    179   7e-49   Gossypium raimondii
ref|XP_008370279.1|  PREDICTED: receptor-like protein kinase FERONIA    181   8e-49   
ref|XP_002323088.2|  kinase family protein                              181   8e-49   Populus trichocarpa [western balsam poplar]
ref|XP_009129817.1|  PREDICTED: receptor-like protein kinase ANXUR2     180   9e-49   Brassica rapa
emb|CDY05602.1|  BnaC02g39350D                                          180   9e-49   
ref|NP_001050022.1|  Os03g0333200                                       181   9e-49   
ref|XP_010938035.1|  PREDICTED: receptor-like protein kinase FERONIA    181   9e-49   Elaeis guineensis
ref|NP_187120.1|  receptor-like protein kinase ANXUR1                   180   9e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009370899.1|  PREDICTED: receptor-like protein kinase FERONIA    180   1e-48   Pyrus x bretschneideri [bai li]
emb|CDY33885.1|  BnaA02g31020D                                          180   1e-48   Brassica napus [oilseed rape]
emb|CDP06378.1|  unnamed protein product                                180   1e-48   Coffea canephora [robusta coffee]
gb|KJB42941.1|  hypothetical protein B456_007G175600                    179   1e-48   Gossypium raimondii
ref|XP_007032831.1|  Malectin/receptor-like protein kinase family...    180   1e-48   
ref|XP_008230912.1|  PREDICTED: receptor-like protein kinase FERONIA    180   1e-48   Prunus mume [ume]
ref|XP_010421701.1|  PREDICTED: receptor-like protein kinase ANXUR2     180   1e-48   Camelina sativa [gold-of-pleasure]
gb|AAK63934.1|AC084282_15  putative protein kinase                      179   1e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003633771.1|  PREDICTED: receptor-like protein kinase FERONIA    180   1e-48   
emb|CDX78012.1|  BnaA09g32070D                                          179   1e-48   
ref|XP_010660596.1|  PREDICTED: receptor-like protein kinase FERONIA    180   1e-48   
ref|NP_001159308.1|  uncharacterized protein LOC100304400               173   1e-48   
ref|XP_009416326.1|  PREDICTED: receptor-like protein kinase FERONIA    180   2e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001044372.1|  Os01g0769700                                       180   2e-48   
ref|XP_007032827.1|  Malectin/receptor-like protein kinase family...    179   2e-48   
ref|XP_011021061.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    179   2e-48   Populus euphratica
ref|XP_007140062.1|  hypothetical protein PHAVU_008G081000g             180   2e-48   Phaseolus vulgaris [French bean]
ref|XP_010032549.1|  PREDICTED: receptor-like protein kinase FERONIA    180   2e-48   Eucalyptus grandis [rose gum]
gb|ABT18100.1|  FERONIA receptor-like kinase                            180   2e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010099328.1|  Receptor-like protein kinase FERONIA               179   2e-48   Morus notabilis
gb|KJB71482.1|  hypothetical protein B456_011G124900                    180   2e-48   Gossypium raimondii
gb|AAK59558.1|  putative receptor-protein kinase                        180   2e-48   Arabidopsis thaliana [mouse-ear cress]
gb|ABF98993.1|  protein kinase family protein, putative, expressed      179   2e-48   Oryza sativa Japonica Group [Japonica rice]
ref|NP_190723.1|  receptor-like protein kinase FERONIA                  179   2e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006338349.1|  PREDICTED: receptor-like protein kinase FERO...    179   2e-48   
ref|XP_009115840.1|  PREDICTED: receptor-like protein kinase FERONIA    179   2e-48   Brassica rapa
ref|XP_011001679.1|  PREDICTED: receptor-like protein kinase FERONIA    179   2e-48   Populus euphratica
ref|XP_002877809.1|  hypothetical protein ARALYDRAFT_485507             179   2e-48   Arabidopsis lyrata subsp. lyrata
ref|XP_010426729.1|  PREDICTED: receptor-like protein kinase FERONIA    179   2e-48   Camelina sativa [gold-of-pleasure]
gb|KJB42940.1|  hypothetical protein B456_007G175600                    179   2e-48   Gossypium raimondii
ref|XP_010503851.1|  PREDICTED: receptor-like protein kinase FERONIA    179   2e-48   
ref|XP_002308259.1|  kinase family protein                              179   2e-48   
ref|XP_009412649.1|  PREDICTED: receptor-like protein kinase FERONIA    179   2e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004981691.1|  PREDICTED: probable receptor-like protein ki...    179   2e-48   
ref|XP_010515573.1|  PREDICTED: receptor-like protein kinase FERONIA    179   2e-48   Camelina sativa [gold-of-pleasure]
gb|EEE63237.1|  hypothetical protein OsJ_18047                          179   2e-48   Oryza sativa Japonica Group [Japonica rice]
gb|EAY97521.1|  hypothetical protein OsI_19449                          179   2e-48   Oryza sativa Indica Group [Indian rice]
gb|KHN07117.1|  Receptor-like protein kinase FERONIA                    179   2e-48   Glycine soja [wild soybean]
emb|CBI21198.3|  unnamed protein product                                179   2e-48   Vitis vinifera
gb|EYU42039.1|  hypothetical protein MIMGU_mgv1a001343mg                179   3e-48   Erythranthe guttata [common monkey flower]
ref|XP_008810848.1|  PREDICTED: receptor-like protein kinase FERONIA    179   3e-48   Phoenix dactylifera
ref|XP_007151348.1|  hypothetical protein PHAVU_004G038800g             179   3e-48   Phaseolus vulgaris [French bean]
gb|ABT18099.1|  FERONIA receptor-like kinase                            179   3e-48   Cardamine flexuosa
emb|CDY33271.1|  BnaA01g19380D                                          179   3e-48   Brassica napus [oilseed rape]
ref|XP_006403905.1|  hypothetical protein EUTSA_v10010114mg             179   3e-48   Eutrema salsugineum [saltwater cress]
ref|XP_010229562.1|  PREDICTED: probable receptor-like protein ki...    179   3e-48   Brachypodium distachyon [annual false brome]
ref|XP_009136619.1|  PREDICTED: receptor-like protein kinase FERONIA    179   3e-48   Brassica rapa
gb|KHN07112.1|  Receptor-like protein kinase FERONIA                    178   3e-48   Glycine soja [wild soybean]
emb|CDY16299.1|  BnaC01g23340D                                          179   3e-48   Brassica napus [oilseed rape]
ref|XP_009385155.1|  PREDICTED: receptor-like protein kinase ANXUR2     179   3e-48   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABT18098.1|  FERONIA receptor-like kinase                            179   3e-48   Cardamine flexuosa
ref|XP_010032628.1|  PREDICTED: receptor-like protein kinase FERONIA    179   3e-48   Eucalyptus grandis [rose gum]
emb|CDP17056.1|  unnamed protein product                                179   4e-48   Coffea canephora [robusta coffee]
gb|ABT18094.1|  FERONIA receptor-like kinase                            179   4e-48   Brassica oleracea
ref|XP_009383157.1|  PREDICTED: probable receptor-like protein ki...    179   4e-48   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDO98765.1|  unnamed protein product                                178   4e-48   Coffea canephora [robusta coffee]
ref|XP_010230703.1|  PREDICTED: receptor-like protein kinase ANXUR1     181   4e-48   Brachypodium distachyon [annual false brome]
ref|XP_006290584.1|  hypothetical protein CARUB_v10016673mg             179   4e-48   Capsella rubella
ref|XP_010519979.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    178   4e-48   
ref|XP_009385224.1|  PREDICTED: receptor-like protein kinase ANXUR1     178   4e-48   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW45810.1|  hypothetical protein EUGRSUZ_L00361                     169   5e-48   Eucalyptus grandis [rose gum]
gb|EEC75192.1|  hypothetical protein OsI_11431                          179   5e-48   Oryza sativa Indica Group [Indian rice]
emb|CDY29022.1|  BnaC07g32280D                                          177   5e-48   Brassica napus [oilseed rape]
ref|XP_002530995.1|  kinase, putative                                   178   5e-48   Ricinus communis
emb|CDX90645.1|  BnaA03g41360D                                          178   5e-48   
emb|CDX73714.1|  BnaC08g22890D                                          180   5e-48   
ref|XP_010032550.1|  PREDICTED: receptor-like protein kinase FERONIA    178   5e-48   
ref|XP_002990231.1|  hypothetical protein SELMODRAFT_40963              177   6e-48   
ref|XP_002272797.2|  PREDICTED: receptor-like protein kinase ANXUR1     178   6e-48   Vitis vinifera
gb|ABT18095.1|  FERONIA receptor-like kinase                            178   6e-48   Cardamine flexuosa
ref|XP_006844774.1|  hypothetical protein AMTR_s00016p00259140          178   6e-48   
gb|KEH25126.1|  feronia receptor-like kinase                            178   6e-48   Medicago truncatula
ref|XP_011071382.1|  PREDICTED: receptor-like protein kinase ANXUR1     178   6e-48   Sesamum indicum [beniseed]
ref|XP_006650625.1|  PREDICTED: probable receptor-like protein ki...    178   6e-48   Oryza brachyantha
gb|ABT18097.1|  FERONIA receptor-like kinase                            178   6e-48   Cardamine flexuosa
gb|AAL40864.1|  receptor protein kinase-like protein                    176   7e-48   Capsicum annuum
ref|XP_004492579.1|  PREDICTED: receptor-like protein kinase FERO...    178   7e-48   Cicer arietinum [garbanzo]
ref|XP_008344811.1|  PREDICTED: receptor-like protein kinase FERONIA    171   7e-48   
ref|XP_006289663.1|  hypothetical protein CARUB_v10003221mg             177   7e-48   Capsella rubella
ref|XP_006654257.1|  PREDICTED: receptor-like protein kinase FERO...    178   8e-48   Oryza brachyantha
ref|XP_010247768.1|  PREDICTED: receptor-like protein kinase FERONIA    177   8e-48   Nelumbo nucifera [Indian lotus]
gb|EYU23499.1|  hypothetical protein MIMGU_mgv1a023218mg                177   8e-48   Erythranthe guttata [common monkey flower]
ref|XP_010039671.1|  PREDICTED: receptor-like protein kinase HERK 1     169   9e-48   
gb|EMT15162.1|  Putative receptor-like protein kinase                   177   9e-48   
ref|XP_010034433.1|  PREDICTED: receptor-like protein kinase FERONIA    177   1e-47   Eucalyptus grandis [rose gum]
gb|KCW87969.1|  hypothetical protein EUGRSUZ_A00377                     177   1e-47   Eucalyptus grandis [rose gum]
ref|XP_004137258.1|  PREDICTED: receptor-like protein kinase FERO...    177   1e-47   Cucumis sativus [cucumbers]
ref|XP_002992454.1|  hypothetical protein SELMODRAFT_135346             177   1e-47   
ref|XP_008379440.1|  PREDICTED: receptor-like protein kinase FERONIA    177   1e-47   
ref|XP_010065050.1|  PREDICTED: receptor-like protein kinase ANXUR2     177   1e-47   Eucalyptus grandis [rose gum]
ref|XP_002447169.1|  hypothetical protein SORBIDRAFT_06g029710          177   1e-47   Sorghum bicolor [broomcorn]
ref|XP_010318820.1|  PREDICTED: probable receptor-like protein ki...    177   2e-47   
gb|KJB80895.1|  hypothetical protein B456_013G120400                    177   2e-47   Gossypium raimondii
ref|XP_010034426.1|  PREDICTED: receptor-like protein kinase FERONIA    177   2e-47   Eucalyptus grandis [rose gum]
ref|XP_004304217.1|  PREDICTED: receptor-like protein kinase FERONIA    177   2e-47   Fragaria vesca subsp. vesca
gb|KCW52051.1|  hypothetical protein EUGRSUZ_J01491                     176   2e-47   Eucalyptus grandis [rose gum]
ref|XP_002874434.1|  kinase family protein                              176   2e-47   Arabidopsis lyrata subsp. lyrata
ref|XP_010914574.1|  PREDICTED: receptor-like protein kinase ANXUR2     176   2e-47   Elaeis guineensis
ref|NP_198220.1|  receptor-like protein kinase ANXUR2                   176   3e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008464585.1|  PREDICTED: receptor-like protein kinase FERONIA    176   3e-47   Cucumis melo [Oriental melon]
gb|EMS48200.1|  Receptor-like protein kinase HERK 1                     176   3e-47   Triticum urartu
ref|XP_010921184.1|  PREDICTED: receptor-like protein kinase FERONIA    176   3e-47   Elaeis guineensis
ref|XP_004962463.1|  PREDICTED: receptor-like protein kinase FERO...    176   3e-47   Setaria italica
ref|XP_007217052.1|  hypothetical protein PRUPE_ppa001190mg             176   3e-47   
ref|XP_008813242.1|  PREDICTED: receptor-like protein kinase FERONIA    176   3e-47   Phoenix dactylifera
ref|XP_009414253.1|  PREDICTED: receptor-like protein kinase FERONIA    176   3e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004962493.1|  PREDICTED: receptor-like protein kinase ANXU...    176   4e-47   Setaria italica
ref|XP_009391670.1|  PREDICTED: receptor-like protein kinase FERONIA    176   4e-47   Musa acuminata subsp. malaccensis [pisang utan]
tpg|DAA51500.1|  TPA: putative receptor-like protein kinase famil...    176   4e-47   
dbj|BAK06468.1|  predicted protein                                      176   4e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007030540.1|  Malectin/receptor-like protein kinase family...    176   4e-47   
ref|XP_004154760.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    176   4e-47   
ref|XP_006593700.1|  PREDICTED: receptor-like protein kinase FERO...    175   4e-47   
ref|XP_008344357.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    172   5e-47   
ref|XP_008464586.1|  PREDICTED: receptor-like protein kinase FERONIA    176   5e-47   Cucumis melo [Oriental melon]
ref|XP_008665441.1|  PREDICTED: probable receptor-like protein ki...    175   5e-47   
ref|XP_006840306.1|  hypothetical protein AMTR_s00045p00071050          175   5e-47   
ref|XP_011009253.1|  PREDICTED: receptor-like protein kinase FERONIA    175   5e-47   Populus euphratica
ref|XP_006493304.1|  PREDICTED: receptor-like protein kinase FERO...    176   6e-47   Citrus sinensis [apfelsine]
gb|KEH24563.1|  malectin/receptor-like kinase family protein            175   6e-47   Medicago truncatula
ref|NP_001237588.1|  FERONIA receptor-like kinase                       174   6e-47   Glycine max [soybeans]
gb|EMS63765.1|  Receptor-like protein kinase FERONIA                    174   7e-47   Triticum urartu
dbj|BAJ93584.1|  predicted protein                                      175   8e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002530992.1|  kinase, putative                                   175   8e-47   
gb|EMT27556.1|  Receptor-like protein kinase ANXUR1                     177   8e-47   
ref|XP_008464587.1|  PREDICTED: receptor-like protein kinase FERONIA    175   8e-47   Cucumis melo [Oriental melon]
gb|EYU46822.1|  hypothetical protein MIMGU_mgv1a022107mg                175   9e-47   Erythranthe guttata [common monkey flower]
ref|XP_009148931.1|  PREDICTED: receptor-like protein kinase FERONIA    175   9e-47   Brassica rapa
gb|EMT16871.1|  Receptor-like protein kinase FERONIA                    175   9e-47   
gb|KJB08837.1|  hypothetical protein B456_001G107000                    174   9e-47   Gossypium raimondii
ref|XP_002439522.1|  hypothetical protein SORBIDRAFT_09g009320          175   1e-46   Sorghum bicolor [broomcorn]
ref|XP_008355123.1|  PREDICTED: receptor-like protein kinase FERONIA    169   1e-46   
gb|EMS54122.1|  Receptor-like protein kinase FERONIA                    174   1e-46   Triticum urartu
gb|EMT27425.1|  Receptor-like protein kinase FERONIA                    174   1e-46   
ref|XP_009781981.1|  PREDICTED: receptor-like protein kinase HERK 1     174   1e-46   Nicotiana sylvestris
ref|XP_003557976.1|  PREDICTED: receptor-like protein kinase FERONIA    175   1e-46   Brachypodium distachyon [annual false brome]
gb|EYU38427.1|  hypothetical protein MIMGU_mgv1a001092mg                174   1e-46   Erythranthe guttata [common monkey flower]
ref|XP_009586639.1|  PREDICTED: receptor-like protein kinase HERK 1     174   1e-46   Nicotiana tomentosiformis
ref|XP_009759079.1|  PREDICTED: LOW QUALITY PROTEIN: probable rec...    176   1e-46   Nicotiana sylvestris
ref|XP_010258502.1|  PREDICTED: receptor-like protein kinase ANXUR1     174   1e-46   Nelumbo nucifera [Indian lotus]
ref|XP_008668826.1|  PREDICTED: receptor-like protein kinase FERONIA    174   1e-46   
ref|XP_006355833.1|  PREDICTED: receptor-like protein kinase ANXU...    174   2e-46   Solanum tuberosum [potatoes]
ref|XP_004240568.1|  PREDICTED: receptor-like protein kinase ANXUR1     174   2e-46   Solanum lycopersicum
gb|EMT17007.1|  Receptor-like protein kinase FERONIA                    174   2e-46   
ref|XP_008809255.1|  PREDICTED: receptor-like protein kinase ANXUR1     174   2e-46   Phoenix dactylifera
ref|XP_004507304.1|  PREDICTED: receptor-like protein kinase FERO...    174   2e-46   Cicer arietinum [garbanzo]
ref|XP_006441077.1|  hypothetical protein CICLE_v10024057mg             173   2e-46   
gb|KJB21613.1|  hypothetical protein B456_004G003200                    174   2e-46   Gossypium raimondii
ref|XP_003543886.1|  PREDICTED: receptor-like protein kinase FERO...    174   2e-46   
ref|XP_010260899.1|  PREDICTED: probable receptor-like protein ki...    174   2e-46   Nelumbo nucifera [Indian lotus]
gb|AFW77551.1|  putative receptor-like protein kinase family protein    174   2e-46   
gb|KHN07118.1|  Receptor-like protein kinase FERONIA                    174   2e-46   Glycine soja [wild soybean]
ref|XP_004495609.1|  PREDICTED: receptor-like protein kinase ANXU...    174   2e-46   Cicer arietinum [garbanzo]
ref|XP_011089398.1|  PREDICTED: receptor-like protein kinase HERK 1     173   3e-46   
ref|XP_007037435.1|  Kinase superfamily protein                         174   3e-46   
gb|KJB50961.1|  hypothetical protein B456_008G195200                    174   3e-46   
ref|XP_008379872.1|  PREDICTED: receptor-like protein kinase FERONIA    169   3e-46   
ref|XP_009617176.1|  PREDICTED: LOW QUALITY PROTEIN: probable rec...    175   3e-46   
emb|CDP18314.1|  unnamed protein product                                172   3e-46   
ref|XP_010550913.1|  PREDICTED: receptor-like protein kinase ANXUR2     173   3e-46   
gb|AAQ82660.1|  Pto-like serine/threonine kinase                        167   4e-46   
ref|XP_008456162.1|  PREDICTED: receptor-like protein kinase ANXU...    172   4e-46   
ref|XP_004240344.1|  PREDICTED: receptor-like protein kinase HERK 1     172   4e-46   
ref|XP_007032823.1|  Malectin/receptor-like protein kinase family...    173   5e-46   
ref|XP_008456155.1|  PREDICTED: receptor-like protein kinase ANXU...    172   5e-46   
ref|XP_009785956.1|  PREDICTED: receptor-like protein kinase ANXUR1     173   5e-46   
ref|XP_009354064.1|  PREDICTED: receptor-like protein kinase FERONIA    170   5e-46   
ref|XP_006366328.1|  PREDICTED: receptor-like protein kinase HERK...    172   5e-46   
gb|EPS72234.1|  hypothetical protein M569_02521                         172   6e-46   
gb|KEH30081.1|  receptor-like kinase theseus protein                    171   6e-46   
ref|XP_009354054.1|  PREDICTED: receptor-like protein kinase FERONIA    170   6e-46   
ref|XP_009799586.1|  PREDICTED: receptor-like protein kinase ANXUR1     172   6e-46   
ref|XP_006441078.1|  hypothetical protein CICLE_v10018785mg             172   6e-46   
ref|XP_003568697.1|  PREDICTED: receptor-like protein kinase FERONIA    172   7e-46   
ref|XP_008341790.1|  PREDICTED: receptor-like protein kinase FERONIA    172   7e-46   
gb|KDP35955.1|  hypothetical protein JCGZ_09927                         161   7e-46   
gb|EYU36239.1|  hypothetical protein MIMGU_mgv1a001323mg                172   9e-46   
ref|XP_008356283.1|  PREDICTED: receptor-like protein kinase FERONIA    169   9e-46   
emb|CDY49572.1|  BnaA10g12680D                                          164   9e-46   
ref|XP_010102280.1|  Receptor-like protein kinase                       172   9e-46   
ref|XP_004137257.1|  PREDICTED: receptor-like protein kinase FERO...    172   9e-46   
ref|XP_002519226.1|  ATP binding protein, putative                      172   9e-46   
emb|CAN77769.1|  hypothetical protein VITISV_009237                     171   1e-45   
ref|XP_003568703.1|  PREDICTED: receptor-like protein kinase ANXUR1     172   1e-45   
ref|XP_009602553.1|  PREDICTED: receptor-like protein kinase ANXUR1     172   1e-45   
ref|XP_004154759.1|  PREDICTED: receptor-like protein kinase FERO...    172   1e-45   
gb|KHN21779.1|  Putative receptor-like protein kinase                   171   1e-45   
ref|XP_003535601.1|  PREDICTED: probable receptor-like protein ki...    171   1e-45   
emb|CBI16212.3|  unnamed protein product                                171   1e-45   
ref|XP_002446044.1|  hypothetical protein SORBIDRAFT_06g000910          165   1e-45   
gb|KCW61585.1|  hypothetical protein EUGRSUZ_H04319                     171   1e-45   
ref|XP_007208221.1|  hypothetical protein PRUPE_ppa018611mg             172   1e-45   
ref|XP_004294627.1|  PREDICTED: receptor-like protein kinase HERK 1     171   1e-45   
ref|XP_002972798.1|  hypothetical protein SELMODRAFT_15419              163   1e-45   
ref|XP_010660577.1|  PREDICTED: receptor-like protein kinase FERONIA    172   1e-45   
gb|KDP27273.1|  hypothetical protein JCGZ_19972                         172   1e-45   
ref|XP_010535512.1|  PREDICTED: receptor-like protein kinase HERK 1     171   1e-45   
ref|NP_001055089.1|  Os05g0280700                                       171   1e-45   
ref|XP_006654205.1|  PREDICTED: receptor-like protein kinase FERO...    171   1e-45   
ref|XP_010034409.1|  PREDICTED: receptor-like protein kinase FERONIA    171   1e-45   
gb|AFK35668.1|  unknown                                                 164   1e-45   
ref|XP_010932179.1|  PREDICTED: probable receptor-like protein ki...    171   1e-45   
ref|XP_006487358.1|  PREDICTED: probable receptor-like protein ki...    171   2e-45   
ref|XP_003606567.1|  Kinase-like protein                                171   2e-45   
gb|EMT04378.1|  Receptor-like protein kinase FERONIA                    171   2e-45   
ref|XP_007035799.1|  Malectin/receptor-like protein kinase family...    171   2e-45   
ref|XP_006363345.1|  PREDICTED: receptor-like protein kinase HERK...    171   2e-45   
ref|XP_006374449.1|  hypothetical protein POPTR_0015s07280g             169   2e-45   
ref|XP_008353542.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    170   2e-45   
ref|XP_010025009.1|  PREDICTED: receptor-like protein kinase ANXUR1     171   2e-45   
ref|XP_010651080.1|  PREDICTED: receptor-like protein kinase HERK 1     171   2e-45   
gb|KJB20195.1|  hypothetical protein B456_003G137700                    171   2e-45   
ref|XP_006436142.1|  hypothetical protein CICLE_v10030714mg             171   2e-45   
gb|KDO67824.1|  hypothetical protein CISIN_1g003436mg                   171   2e-45   
ref|XP_010663864.1|  PREDICTED: probable receptor-like protein ki...    172   2e-45   
ref|XP_007016572.1|  Kinase                                             171   2e-45   
ref|XP_002514719.1|  kinase, putative                                   172   2e-45   
ref|XP_008364675.1|  PREDICTED: receptor-like protein kinase FERONIA    170   2e-45   
ref|XP_009793250.1|  PREDICTED: receptor-like protein kinase THES...    171   2e-45   
emb|CDP08976.1|  unnamed protein product                                170   3e-45   
ref|XP_004154761.1|  PREDICTED: receptor-like protein kinase FERO...    171   3e-45   
ref|XP_004304753.1|  PREDICTED: receptor-like protein kinase ANXUR1     171   3e-45   
gb|KDO49453.1|  hypothetical protein CISIN_1g047569mg                   170   3e-45   
gb|KDP27915.1|  hypothetical protein JCGZ_18995                         171   3e-45   
ref|XP_004139382.1|  PREDICTED: receptor-like protein kinase ANXU...    171   3e-45   
ref|XP_002534744.1|  kinase, putative                                   167   3e-45   
ref|XP_004156494.1|  PREDICTED: receptor-like protein kinase ANXU...    171   3e-45   
ref|XP_009601576.1|  PREDICTED: receptor-like protein kinase ANXUR1     171   3e-45   
ref|XP_010093014.1|  Receptor-like protein kinase HERK 1                171   3e-45   
ref|XP_007216888.1|  hypothetical protein PRUPE_ppa020589mg             171   3e-45   
ref|XP_006493305.1|  PREDICTED: receptor-like protein kinase FERO...    171   4e-45   
ref|XP_008453681.1|  PREDICTED: probable receptor-like protein ki...    172   4e-45   
ref|XP_010259987.1|  PREDICTED: receptor-like protein kinase HERK 1     170   4e-45   
ref|XP_008341791.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    170   4e-45   
ref|XP_006482015.1|  PREDICTED: receptor-like protein kinase FERO...    170   4e-45   
ref|XP_009613068.1|  PREDICTED: receptor-like protein kinase THES...    170   5e-45   
ref|XP_007147183.1|  hypothetical protein PHAVU_006G102700g             170   5e-45   
ref|XP_004240569.1|  PREDICTED: receptor-like protein kinase ANXUR1     170   5e-45   
ref|XP_010089888.1|  putative receptor-like protein kinase              170   5e-45   
ref|XP_008796451.1|  PREDICTED: probable receptor-like protein ki...    170   5e-45   
ref|XP_003597308.1|  Kinase-like protein                                170   5e-45   
gb|KDO73009.1|  hypothetical protein CISIN_1g003341mg                   169   5e-45   
ref|XP_009596877.1|  PREDICTED: receptor-like protein kinase HERK 1     169   5e-45   
ref|XP_007032808.1|  Malectin/receptor-like protein kinase family...    170   6e-45   
ref|XP_008218280.1|  PREDICTED: receptor-like protein kinase ANXUR1     170   6e-45   
ref|XP_004251295.1|  PREDICTED: receptor-like protein kinase HERK 1     169   6e-45   
gb|EPS64671.1|  hypothetical protein M569_10103                         169   7e-45   
ref|XP_010327142.1|  PREDICTED: receptor-like protein kinase THES...    169   7e-45   
ref|XP_008796520.1|  PREDICTED: probable receptor-like protein ki...    169   7e-45   
gb|KJB42937.1|  hypothetical protein B456_007G175500                    169   7e-45   
ref|XP_002313457.1|  kinase family protein                              169   7e-45   
ref|XP_010426068.1|  PREDICTED: receptor-like protein kinase HERK 1     167   7e-45   
ref|XP_010270692.1|  PREDICTED: probable receptor-like protein ki...    169   7e-45   
ref|XP_009339695.1|  PREDICTED: probable receptor-like protein ki...    169   7e-45   
ref|XP_004138305.1|  PREDICTED: probable receptor-like protein ki...    169   8e-45   
gb|KEH43006.1|  malectin/receptor-like kinase family protein            169   8e-45   
gb|KDP31288.1|  hypothetical protein JCGZ_11664                         169   8e-45   
ref|XP_006843268.1|  hypothetical protein AMTR_s00080p00131040          169   8e-45   
ref|XP_006592253.1|  PREDICTED: receptor-like protein kinase HERK...    169   9e-45   
emb|CAB62020.1|  receptor-like protein kinase homolog                   166   9e-45   
ref|XP_006382811.1|  serine-threonine kinase family protein             169   9e-45   
ref|XP_011047185.1|  PREDICTED: probable receptor-like protein ki...    169   9e-45   
ref|XP_007132136.1|  hypothetical protein PHAVU_011G069600g             169   1e-44   
ref|NP_001132279.1|  uncharacterized protein LOC100193715               162   1e-44   
ref|XP_008230910.1|  PREDICTED: receptor-like protein kinase FERONIA    169   1e-44   
ref|XP_010520289.1|  PREDICTED: receptor-like protein kinase HERK...    169   1e-44   
ref|XP_002311383.2|  hypothetical protein POPTR_0008s10500g             169   1e-44   
ref|XP_011019995.1|  PREDICTED: receptor-like protein kinase ANXUR1     169   1e-44   
ref|XP_010520290.1|  PREDICTED: receptor-like protein kinase HERK...    169   1e-44   
gb|KJB11637.1|  hypothetical protein B456_001G269100                    169   1e-44   
gb|KDO73010.1|  hypothetical protein CISIN_1g003341mg                   169   1e-44   
ref|XP_006424719.1|  hypothetical protein CICLE_v10027823mg             169   1e-44   
emb|CAB38831.1|  putative receptor-like protein kinase (fragment)       167   1e-44   
ref|XP_004137259.1|  PREDICTED: probable receptor-like protein ki...    171   1e-44   
ref|XP_009150283.1|  PREDICTED: receptor-like protein kinase HERK 1     169   1e-44   
ref|XP_011041960.1|  PREDICTED: receptor-like protein kinase HERK 1     169   1e-44   
ref|XP_001760779.1|  predicted protein                                  162   1e-44   
ref|XP_009354540.1|  PREDICTED: receptor-like protein kinase HERK 1     168   1e-44   
ref|XP_011006280.1|  PREDICTED: probable receptor-like protein ki...    169   1e-44   
dbj|BAF79940.1|  receptor-like kinase                                   169   1e-44   
gb|KJB10590.1|  hypothetical protein B456_001G209200                    169   1e-44   
ref|XP_010045589.1|  PREDICTED: probable receptor-like protein ki...    170   1e-44   
ref|XP_008348094.1|  PREDICTED: receptor-like protein kinase FERONIA    169   2e-44   
ref|XP_010431866.1|  PREDICTED: probable receptor-like protein ki...    169   2e-44   
gb|EEE63235.1|  hypothetical protein OsJ_18045                          158   2e-44   
ref|XP_009350739.1|  PREDICTED: receptor-like protein kinase HERK 1     167   2e-44   
ref|XP_010672753.1|  PREDICTED: receptor-like protein kinase HERK 1     168   2e-44   
gb|KDP44164.1|  hypothetical protein JCGZ_05631                         168   2e-44   
gb|KDP41754.1|  hypothetical protein JCGZ_26772                         168   2e-44   
ref|XP_010437013.1|  PREDICTED: probable receptor-like protein ki...    168   2e-44   
ref|XP_004301135.1|  PREDICTED: probable receptor-like protein ki...    169   2e-44   
gb|KDP27679.1|  hypothetical protein JCGZ_20099                         160   2e-44   
ref|XP_004977713.1|  PREDICTED: probable receptor-like protein ki...    166   2e-44   
gb|KJB28740.1|  hypothetical protein B456_005G067100                    168   2e-44   
ref|XP_007143463.1|  hypothetical protein PHAVU_007G074000g             168   2e-44   
ref|XP_011032387.1|  PREDICTED: receptor-like protein kinase ANXUR1     168   2e-44   
ref|XP_009766353.1|  PREDICTED: receptor-like protein kinase HERK 1     167   2e-44   
ref|XP_002319081.1|  kinase family protein                              168   2e-44   
ref|XP_010514958.1|  PREDICTED: receptor-like protein kinase HERK...    167   3e-44   
ref|XP_009360627.1|  PREDICTED: receptor-like protein kinase FERONIA    167   3e-44   
ref|XP_004494710.1|  PREDICTED: receptor-like protein kinase ANXU...    168   3e-44   
ref|XP_004244196.1|  PREDICTED: receptor-like protein kinase THES...    167   3e-44   
ref|XP_002313029.1|  Pto-like kinase OGw family protein                 167   3e-44   
ref|XP_010416895.1|  PREDICTED: probable receptor-like protein ki...    166   3e-44   
ref|XP_009615839.1|  PREDICTED: probable receptor-like protein ki...    167   3e-44   
gb|KHN43182.1|  Receptor-like protein kinase ANXUR2                     167   3e-44   
gb|KDO55483.1|  hypothetical protein CISIN_1g037607mg                   167   3e-44   
emb|CDX78036.1|  BnaA09g32310D                                          167   3e-44   
ref|XP_006418923.1|  hypothetical protein EUTSA_v10002401mg             167   3e-44   
ref|XP_010503244.1|  PREDICTED: receptor-like protein kinase HERK 1     167   3e-44   
ref|XP_009149977.1|  PREDICTED: receptor-like protein kinase HERK 1     167   3e-44   
emb|CDX82981.1|  BnaA01g19810D                                          167   3e-44   
gb|KDO54400.1|  hypothetical protein CISIN_1g039107mg                   167   3e-44   
ref|XP_009150927.1|  PREDICTED: probable receptor-like protein ki...    167   4e-44   
emb|CDX86076.1|  BnaC03g55910D                                          167   4e-44   
emb|CDY41962.1|  BnaA01g05340D                                          167   4e-44   
ref|XP_010685859.1|  PREDICTED: receptor-like protein kinase HERK 1     167   4e-44   
emb|CDX99115.1|  BnaA06g18060D                                          167   4e-44   
ref|XP_004148239.1|  PREDICTED: receptor-like protein kinase HERK...    167   4e-44   
ref|XP_006427852.1|  hypothetical protein CICLE_v10024830mg             167   4e-44   
ref|XP_010243447.1|  PREDICTED: receptor-like protein kinase FERONIA    167   4e-44   
ref|XP_008385197.1|  PREDICTED: receptor-like protein kinase HERK 1     167   4e-44   
ref|XP_010455405.1|  PREDICTED: probable receptor-like protein ki...    167   4e-44   
ref|XP_006487877.1|  PREDICTED: receptor-like protein kinase ANXU...    167   4e-44   
gb|KHN22011.1|  Receptor-like protein kinase HERK 1                     167   4e-44   
ref|XP_007227151.1|  hypothetical protein PRUPE_ppa026453mg             167   4e-44   
ref|XP_009766613.1|  PREDICTED: probable receptor-like protein ki...    167   4e-44   
ref|XP_010526599.1|  PREDICTED: probable receptor-like protein ki...    167   4e-44   
ref|XP_007009484.1|  Receptor-like protein kinase THESEUS 1             167   4e-44   
gb|KCW51315.1|  hypothetical protein EUGRSUZ_J00871                     166   4e-44   
ref|XP_009115877.1|  PREDICTED: putative receptor-like protein ki...    167   4e-44   
ref|XP_009139817.1|  PREDICTED: putative receptor-like protein ki...    167   4e-44   
ref|NP_001235040.1|  protein kinase precursor                           167   4e-44   
ref|XP_009410356.1|  PREDICTED: probable receptor-like protein ki...    167   4e-44   
ref|XP_006440650.1|  hypothetical protein CICLE_v10018803mg             167   5e-44   
ref|XP_009365901.1|  PREDICTED: receptor-like protein kinase FERONIA    165   5e-44   
ref|XP_008342048.1|  PREDICTED: receptor-like protein kinase FERONIA    165   5e-44   
ref|XP_006424004.1|  hypothetical protein CICLE_v10029897mg             167   5e-44   
gb|KCW54833.1|  hypothetical protein EUGRSUZ_I007772                    161   5e-44   
ref|XP_009358295.1|  PREDICTED: receptor-like protein kinase HERK 1     167   5e-44   
emb|CDX72717.1|  BnaC07g47390D                                          167   5e-44   
ref|XP_007208086.1|  hypothetical protein PRUPE_ppa001409mg             167   5e-44   
ref|XP_007133803.1|  hypothetical protein PHAVU_011G210400g             167   5e-44   
emb|CDY56768.1|  BnaA06g40790D                                          167   5e-44   
ref|XP_009593506.1|  PREDICTED: receptor-like protein kinase THES...    167   5e-44   
ref|NP_195622.1|  putative receptor-like protein kinase                 167   6e-44   
emb|CDY12121.1|  BnaC03g60370D                                          167   6e-44   
gb|KDP46096.1|  hypothetical protein JCGZ_06607                         166   6e-44   
ref|XP_006342301.1|  PREDICTED: probable receptor-like protein ki...    166   6e-44   
ref|XP_004234787.1|  PREDICTED: probable receptor-like protein ki...    166   6e-44   
ref|XP_009125099.1|  PREDICTED: putative receptor-like protein ki...    167   6e-44   
ref|XP_008222676.1|  PREDICTED: receptor-like protein kinase HERK 1     167   6e-44   
gb|KFK32894.1|  hypothetical protein AALP_AA6G301900                    167   6e-44   
ref|XP_009139815.1|  PREDICTED: putative receptor-like protein ki...    167   6e-44   
gb|KCW54816.1|  hypothetical protein EUGRSUZ_I00757                     166   6e-44   
ref|XP_009139816.1|  PREDICTED: putative receptor-like protein ki...    167   6e-44   
gb|KDP27274.1|  hypothetical protein JCGZ_19973                         165   6e-44   
ref|NP_001238536.1|  receptor-like kinase                               168   6e-44   
ref|XP_011087289.1|  PREDICTED: probable receptor-like protein ki...    167   6e-44   
tpg|DAA53962.1|  TPA: putative receptor-like protein kinase famil...    167   7e-44   
emb|CDX74492.1|  BnaA04g08970D                                          167   7e-44   
ref|XP_006360136.1|  PREDICTED: receptor-like protein kinase THES...    166   7e-44   
ref|XP_007150266.1|  hypothetical protein PHAVU_005G139800g             166   7e-44   
ref|XP_008379865.1|  PREDICTED: receptor-like protein kinase FERONIA    166   7e-44   
emb|CDX90312.1|  BnaA08g16720D                                          167   7e-44   
ref|XP_006285865.1|  hypothetical protein CARUB_v10007359mg             167   7e-44   
ref|XP_002868886.1|  kinase family protein                              167   7e-44   
ref|XP_011096691.1|  PREDICTED: probable receptor-like protein ki...    167   7e-44   
ref|XP_011038554.1|  PREDICTED: receptor-like protein kinase ANXUR1     167   7e-44   
ref|XP_009109497.1|  PREDICTED: probable receptor-like protein ki...    167   8e-44   
ref|XP_006411710.1|  hypothetical protein EUTSA_v10024369mg             167   8e-44   
ref|XP_010253388.1|  PREDICTED: receptor-like protein kinase HERK 1     166   8e-44   
ref|XP_008223394.1|  PREDICTED: receptor-like protein kinase ANXUR1     166   8e-44   
ref|XP_010927482.1|  PREDICTED: probable receptor-like protein ki...    166   9e-44   



>ref|XP_006338348.1| PREDICTED: receptor-like protein kinase FERONIA-like [Solanum 
tuberosum]
Length=873

 Score =   220 bits (560),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 113/209 (54%), Positives = 150/209 (72%), Gaps = 6/209 (3%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEYY+R+Q+TEKSDVYSFGVVLFEVLCAR A+IPN+P+ +V+LA+W
Sbjct  670  HVSTVVKGSFGYLDPEYYKRQQLTEKSDVYSFGVVLFEVLCARPALIPNMPKGQVNLADW  729

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
              RS + G++ +I+DPNL+GQIA ECL ++ E A NCLKDQG+ RP+MNDVVW LEF L+
Sbjct  730  ACRSCKKGNLQQIIDPNLEGQIAPECLNKFAEAAYNCLKDQGVQRPSMNDVVWNLEFILK  789

Query  265  LQDAADKRGG-LSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAEKLFRTKs  89
            LQDAAD RG  +     P  P FPL+   G G     +DE +  AF+ S      + + +
Sbjct  790  LQDAADNRGHKMELNSYPTSPSFPLIMN-GHGHTNISTDEGF-EAFSGSHEVGGKYTSSA  847

Query  88   satatstsddSLRGQSHTIFSELSNQLGR  2
            ++  +++ D   + +S TIFSE+ N  GR
Sbjct  848  TSMTSNSDD---KLKSDTIFSEILNPSGR  873



>ref|XP_004232151.1| PREDICTED: receptor-like protein kinase FERONIA [Solanum lycopersicum]
Length=869

 Score =   216 bits (551),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 114/209 (55%), Positives = 149/209 (71%), Gaps = 8/209 (4%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEYY+R+Q+TEKSDVYSFGVVLFEVLCAR A+IPN+P+ +V+LA+W
Sbjct  668  HVSTVVKGSFGYLDPEYYKRQQLTEKSDVYSFGVVLFEVLCARPALIPNMPKGQVNLADW  727

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
              RS + G++ +I+DPNL+GQIA ECL ++ E A NCLKDQG+ RP+MNDVVW LEF L+
Sbjct  728  ACRSCKKGNLQQIIDPNLEGQIAPECLNKFAEAAYNCLKDQGVQRPSMNDVVWNLEFILK  787

Query  265  LQDAADKRGG-LSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAEKLFRTKs  89
            LQ+AAD RG  +     P  P FPL+       + ++  E++ G+   +E  EK   + S
Sbjct  788  LQEAADNRGHKMELNSYPTSPSFPLIMNDHTNISTDEGFEEFSGS---NEVGEKYTSSAS  844

Query  88   satatstsddSLRGQSHTIFSELSNQLGR  2
            S T TS      + +S TIFSE+ N  GR
Sbjct  845  SMTTTSDD----KLKSETIFSEILNPSGR  869



>emb|CDP05402.1| unnamed protein product [Coffea canephora]
Length=892

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 112/209 (54%), Positives = 143/209 (68%), Gaps = 9/209 (4%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGYVDPEYY+R+Q+TEKSDVYSFGVVL EVLC R A+IPNLP+ +V+LAEW
Sbjct  692  HVSTQVKGSFGYVDPEYYKRQQLTEKSDVYSFGVVLLEVLCGRGAIIPNLPKEQVNLAEW  751

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
            G+R Y  G + + VDP++KG+IA ECL  + E A NCLKDQGI+RP MNDVVW LEFALQ
Sbjct  752  GKRYYAKGIIHQTVDPHMKGEIAPECLRSFAETAINCLKDQGIERPGMNDVVWSLEFALQ  811

Query  265  LQDAADKRGGLSPPRTPERP-GFPLLAKGGDGEAANKSDEDYGGAFTTSENAEKLFRTKs  89
            LQ+AA+   G        RP  F +   G D +A  + DED        +++  L +++S
Sbjct  812  LQEAAENESG-------RRPFAFRMHGLGRDEQATTEDDEDVFSDSGVEKDSAALMKSRS  864

Query  88   satatstsddSLRGQSHTIFSELSNQLGR  2
              T T T+   +  +S  +FSE+ N  GR
Sbjct  865  ITTGTFTASSDML-KSDNVFSEIMNPTGR  892



>emb|CDP05401.1| unnamed protein product [Coffea canephora]
Length=888

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/209 (53%), Positives = 143/209 (68%), Gaps = 9/209 (4%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGYVDPEYY+R+Q+T+KSDVYSFGVVL EVLC R A+IPNLP+ +V+LAEW
Sbjct  688  HVSTQVKGSFGYVDPEYYKRQQLTDKSDVYSFGVVLLEVLCGRGAIIPNLPKEQVNLAEW  747

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
            G+R Y  G + + VDP++KG+IA ECL  + E A NCLKDQGI+RP MNDVVW LEFALQ
Sbjct  748  GKRYYAKGIIHQTVDPHMKGEIAPECLRNFAETAINCLKDQGIERPGMNDVVWSLEFALQ  807

Query  265  LQDAADKRGGLSPPRTPERP-GFPLLAKGGDGEAANKSDEDYGGAFTTSENAEKLFRTKs  89
            LQ+AA+   G        RP  F +   G D +A  + DED        +++  + +++S
Sbjct  808  LQEAAENESG-------RRPFAFRMHGLGRDEQATTEDDEDVFSDSGIEKDSAAMMKSRS  860

Query  88   satatstsddSLRGQSHTIFSELSNQLGR  2
              T T T+   +  +S  +FSE+ N  GR
Sbjct  861  ITTGTFTASSDML-KSDNVFSEIMNPTGR  888



>emb|CDP19885.1| unnamed protein product [Coffea canephora]
Length=895

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 111/209 (53%), Positives = 142/209 (68%), Gaps = 9/209 (4%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGYVDPEYY+R+Q+TEKSDVYSFGVVL EVLC R A+IPNLP+ +V+LAEW
Sbjct  695  HVSTQVKGSFGYVDPEYYKRQQLTEKSDVYSFGVVLLEVLCGRGAIIPNLPKEQVNLAEW  754

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
            G+R Y  G + + VDP++KG+IA ECL  + E A NCLKDQGI+RP MNDVVW LEFALQ
Sbjct  755  GKRYYAKGIIHQTVDPHMKGEIAPECLRSFAETAINCLKDQGIERPGMNDVVWSLEFALQ  814

Query  265  LQDAADKRGGLSPPRTPERP-GFPLLAKGGDGEAANKSDEDYGGAFTTSENAEKLFRTKs  89
            LQ+AA+   G        RP  F +   G D +A  + DED        +++    +++S
Sbjct  815  LQEAAENESG-------RRPFAFRMHGLGRDEQATTEDDEDVFSDSGVEKDSAARMKSRS  867

Query  88   satatstsddSLRGQSHTIFSELSNQLGR  2
              T T T+   +  +S  +FSE+ N  GR
Sbjct  868  ITTGTFTASSDML-KSDNVFSEIMNPTGR  895



>ref|XP_009588433.1| PREDICTED: receptor-like protein kinase FERONIA [Nicotiana tomentosiformis]
Length=882

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 114/210 (54%), Positives = 147/210 (70%), Gaps = 12/210 (6%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVSTAVKGSFGY+DPEYY+R+Q+TEKSDVYSFGVVLFEVLCAR A+I NLP+ +V+LA+W
Sbjct  683  HVSTAVKGSFGYLDPEYYKRQQLTEKSDVYSFGVVLFEVLCARPAIIQNLPKGQVNLADW  742

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
              R  + G + +I+DPNL+GQIA ECL ++ E+A +CL DQG+DRPAM DVVW LEFALQ
Sbjct  743  ACRCCKKGKLDQIIDPNLEGQIAPECLNKFAEVAYSCLSDQGVDRPAMGDVVWTLEFALQ  802

Query  265  LQDAADKRG-GLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTS-ENAEKLFRTK  92
            LQ+AAD RG  +     P  P  PL+         ++S+     AF+ S E   KL  + 
Sbjct  803  LQEAADNRGHAVEGYSYPTSPSLPLILNDQTNILTDESE-----AFSGSGEVGGKLTNST  857

Query  91   ssatatstsddSLRGQSHTIFSELSNQLGR  2
            +S T++S      + +S TIFSE+ N  GR
Sbjct  858  NSMTSSSD-----KLKSDTIFSEIQNPSGR  882



>gb|EYU44220.1| hypothetical protein MIMGU_mgv1a003782mg [Erythranthe guttata]
Length=564

 Score =   200 bits (509),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 118/156 (76%), Gaps = 7/156 (4%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGYVDPEYYRR+Q+T+KSDVYSFGVVLFEVLCAR A+IP+LPR +V+L EW
Sbjct  362  HVSTVVKGSFGYVDPEYYRRQQLTDKSDVYSFGVVLFEVLCARPAIIPSLPREQVNLGEW  421

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             +  Y+ G + +IVD NL GQIA ECL ++VE A  CLK++GIDRPAM DVVW LEFA+Q
Sbjct  422  AKFCYKKGTLEQIVDSNLDGQIAPECLGKFVETAITCLKEKGIDRPAMGDVVWSLEFAMQ  481

Query  265  LQDAADKRGGLSPPRTPE-------RPGFPLLAKGG  179
            LQ+AA++RGG  P             P FPLL   G
Sbjct  482  LQEAAERRGGDGPAADGGDGDIFSINPSFPLLVGAG  517



>ref|XP_009790513.1| PREDICTED: receptor-like protein kinase FERONIA [Nicotiana sylvestris]
Length=874

 Score =   203 bits (517),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 110/209 (53%), Positives = 143/209 (68%), Gaps = 13/209 (6%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            H+STAVKGSFGYVDPEYY+R+Q+TEKSDVYSFGVVLFEVLCAR A+IPNLP+ +V+LAEW
Sbjct  678  HISTAVKGSFGYVDPEYYKRQQLTEKSDVYSFGVVLFEVLCARPAIIPNLPKGQVNLAEW  737

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
              R     ++ +I+DPNL+GQIA ECL ++ E+A  CL+DQG+ RP+M+DVV  LEFALQ
Sbjct  738  ACRGCRKRNLEQIIDPNLQGQIAPECLSKFAELAYRCLRDQGVQRPSMDDVVRTLEFALQ  797

Query  265  LQDAADKRGG-LSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAEKLFRTKs  89
            LQ+AAD RG  L          F L+    +G+A   SDED    F+ S   E+   +  
Sbjct  798  LQEAADNRGHELEGYIYAPSSSFCLIT---NGDANMSSDED--EVFSGSGEVERKLASSG  852

Query  88   satatstsddSLRGQSHTIFSELSNQLGR  2
            ++ +        R ++  IFSE+ N LGR
Sbjct  853  TSVSK-------RMKNVAIFSEIVNPLGR  874



>ref|XP_009790514.1| PREDICTED: receptor-like protein kinase FERONIA [Nicotiana sylvestris]
Length=879

 Score =   203 bits (516),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 108/209 (52%), Positives = 144/209 (69%), Gaps = 11/209 (5%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVSTAVKGSFGY+DPEYY+R+Q+TEKSDVYSFGVVLFEVLCAR A+I NLP+ +V+LA+W
Sbjct  681  HVSTAVKGSFGYLDPEYYKRQQLTEKSDVYSFGVVLFEVLCARPAIIQNLPKGQVNLADW  740

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
              R    G++ +I+DP L+GQIA ECL ++ E+A +CLKDQG+ RP M+DVVW LEFALQ
Sbjct  741  ACRCCRKGNLDQIIDPCLEGQIAPECLSKFAEVASSCLKDQGVQRPPMSDVVWTLEFALQ  800

Query  265  LQDAADKRGGLSPPRT-PERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAEKLFRTKs  89
            LQ+AAD RG      + P  P  P++       + ++S+     AF+ S      + +  
Sbjct  801  LQEAADNRGHTVEGYSYPASPSLPMILNDQTNISTDESE-----AFSGSGEVGGKWTSSG  855

Query  88   satatstsddSLRGQSHTIFSELSNQLGR  2
            S+  +S      + +S TIFSE+ N LGR
Sbjct  856  SSMTSSD-----KLKSGTIFSEIRNPLGR  879



>emb|CDP19887.1| unnamed protein product [Coffea canephora]
Length=825

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST V+GSFGYVDPEYY+R+Q+TEKSDVYSFGVVL EVLC R A+I NLP+ +V+LA W
Sbjct  694  HVSTQVRGSFGYVDPEYYKRQQLTEKSDVYSFGVVLLEVLCGRGAIIRNLPKEQVNLAGW  753

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
            G+R+Y  G + + VDP++KG+IA ECL  + E A NCLKDQGI+RP MNDVVW LEFALQ
Sbjct  754  GKRNYAKGIIHQTVDPHMKGEIAPECLRSFAETAINCLKDQGIERPGMNDVVWSLEFALQ  813

Query  265  LQDAADK  245
            LQ+AA+ 
Sbjct  814  LQEAAEN  820



>ref|XP_006373376.1| hypothetical protein POPTR_0017s13200g [Populus trichocarpa]
 gb|ERP51173.1| hypothetical protein POPTR_0017s13200g [Populus trichocarpa]
Length=307

 Score =   186 bits (473),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST V+GS GYVDPEYYRR+ +TEKSDVYSFGVVLFEVLCAR  VIP+ P+++ SLAEW
Sbjct  111  HVSTVVRGSIGYVDPEYYRRQHLTEKSDVYSFGVVLFEVLCARPPVIPSSPKDQASLAEW  170

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             R+ Y+ G + EIVDP+LKG++A   L ++ EIA +CL  QGI+RP M DVVWGLEFALQ
Sbjct  171  ARKCYQRGTLDEIVDPHLKGEVAPVSLNKFAEIANSCLHGQGIERPKMGDVVWGLEFALQ  230

Query  265  LQDAADK  245
            LQ +A+K
Sbjct  231  LQQSAEK  237



>ref|NP_001141864.1| uncharacterized protein LOC100274007 [Zea mays]
 gb|ACF87195.1| unknown [Zea mays]
Length=216

 Score =   184 bits (466),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 111/150 (74%), Gaps = 2/150 (1%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P LP+ +VSLAEW
Sbjct  21   HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPTLPKEEVSLAEW  80

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                 + G + +IVDP LKG+IA +C  ++ E A  C+ DQGIDRP+M DV+W LEFALQ
Sbjct  81   ALHCQKKGILDQIVDPYLKGKIAPQCFKKFAETAEKCVSDQGIDRPSMGDVLWNLEFALQ  140

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKGGD  176
            +Q+ A++ G L    + E  G PL+    D
Sbjct  141  MQEGAEESGSLGCGMSDE--GAPLMVGKKD  168



>emb|CDY48659.1| BnaC07g27500D [Brassica napus]
Length=186

 Score =   182 bits (461),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 119/174 (68%), Gaps = 8/174 (5%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HV+T VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P+LP+ +VSL +W
Sbjct  5    HVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPSLPKEQVSLGDW  64

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                 + G + +IVDPNLKG+I  ECL ++ + A  CL D G+DRP M DV+W LEFALQ
Sbjct  65   AMNCKKKGTLEDIVDPNLKGKINPECLKKFADTAEKCLSDSGLDRPTMGDVLWNLEFALQ  124

Query  265  LQDAAD-------KRGGLSPPRTPERPGFPLLAKG-GDGEAANKSDEDYGGAFT  128
            LQ+ A+        RGG S     E  G  +   G G+ + ++ S E+  G F+
Sbjct  125  LQETAEGSRQTTPSRGGESEDLAGEGGGMAVNVGGAGEHDVSDLSSEESSGIFS  178



>ref|XP_007217058.1| hypothetical protein PRUPE_ppa001157mg [Prunus persica]
 gb|EMJ18257.1| hypothetical protein PRUPE_ppa001157mg [Prunus persica]
Length=893

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/211 (49%), Positives = 146/211 (69%), Gaps = 14/211 (7%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            H+ST VKGSFGY+DPEYYRR+Q+TEKSDVYSFGVVL EVLCAR A+I  + + ++SLAEW
Sbjct  694  HISTVVKGSFGYLDPEYYRRQQLTEKSDVYSFGVVLCEVLCARPALIRTVEKKQMSLAEW  753

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             +  +  G + +I+DP+L+G+I + CL +YVEIA +C++D GI+RP+MNDVVWGLEFALQ
Sbjct  754  TKVCHRNGKIDQIIDPSLRGKIGNACLNKYVEIAVSCIQDNGIERPSMNDVVWGLEFALQ  813

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANK--SDEDYGGAFTTSENAEKLFR-T  95
            LQ +      LS  +           KG D E+     SD  +  ++  S +  K+ R T
Sbjct  814  LQQSGGGVLNLSEEK-----------KGEDEESLMNAASDAGFSCSWEDSSSESKVSRVT  862

Query  94   KssatatstsddSLRGQSHTIFSELSNQLGR  2
            KSS+   S+++ S++G S T+FSE+++  GR
Sbjct  863  KSSSDHNSSTNKSMKGMSGTVFSEINDPNGR  893



>ref|XP_008230913.1| PREDICTED: receptor-like protein kinase FERONIA [Prunus mume]
Length=721

 Score =   191 bits (486),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 104/211 (49%), Positives = 147/211 (70%), Gaps = 14/211 (7%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            H+ST VKGSFGY+DPEYYRR+Q+TEKSDVYSFGVVL EVLCAR A+I  + + ++SLAEW
Sbjct  522  HISTVVKGSFGYLDPEYYRRQQLTEKSDVYSFGVVLCEVLCARPALIRTVEKKQMSLAEW  581

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             +  +  G + +I+DP+L+G+I + CL +YVEIA +CL+D GI+RP+MNDVVWGLEFALQ
Sbjct  582  TKVCHRNGKIDQIIDPSLRGKIGNACLNKYVEIAVSCLQDNGIERPSMNDVVWGLEFALQ  641

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKGGDGEA--ANKSDEDYGGAFTTSENAEKLFR-T  95
            LQ +      LS  +           KG D E+  +  SD  +  ++  S +  K+ R T
Sbjct  642  LQQSGGGVLNLSEEK-----------KGEDEESLMSAASDAGFSCSWEDSSSELKVSRVT  690

Query  94   KssatatstsddSLRGQSHTIFSELSNQLGR  2
            KSS+   S++++S++G S  +FSE+++  GR
Sbjct  691  KSSSDHNSSTNESMKGMSGAVFSEINDPNGR  721



>emb|CDP06209.1| unnamed protein product [Coffea canephora]
Length=566

 Score =   189 bits (480),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 115/160 (72%), Gaps = 7/160 (4%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            H+ST VKGSFGY+DPEYY R+Q+T+KSDVYSFGVVL EVLC RA +I +LP+ +V+LAEW
Sbjct  404  HISTQVKGSFGYIDPEYYTRQQLTDKSDVYSFGVVLLEVLCGRAPIILDLPQEQVNLAEW  463

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             ++ Y+ G +  +VDP++KG+IA +CL  + E A NCLKDQGI RP M+DVV  LEFALQ
Sbjct  464  AKKCYKKGIIHRVVDPDVKGEIAPQCLRIFAETAINCLKDQGIQRPGMDDVVGRLEFALQ  523

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDED  146
            +Q+AA+  GG   P       FPL   GGD +     D D
Sbjct  524  VQEAAENEGGRPDP-------FPLHMHGGDVQNMTDDDTD  556



>ref|XP_006373380.1| hypothetical protein POPTR_0017s13240g [Populus trichocarpa]
 gb|ERP51177.1| hypothetical protein POPTR_0017s13240g [Populus trichocarpa]
Length=879

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST V+GS GYVDPEYYRR+ VTEKSDVYSFGVVLFEVLCAR  VIP+ P+++ SLAEW
Sbjct  683  HVSTVVRGSIGYVDPEYYRRQHVTEKSDVYSFGVVLFEVLCARPPVIPSSPKDQASLAEW  742

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             RR Y+ G + +IVDP+LKG++AS  L ++ EIA +CL  QGI+RP M DVVWGLEFALQ
Sbjct  743  ARRCYQRGTLDQIVDPHLKGEVASVSLNKFAEIANSCLHVQGIERPKMGDVVWGLEFALQ  802

Query  265  LQDAADKRG  239
            LQ  A+K G
Sbjct  803  LQQTAEKNG  811



>ref|XP_011099030.1| PREDICTED: receptor-like protein kinase FERONIA [Sesamum indicum]
Length=886

 Score =   191 bits (485),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 105/212 (50%), Positives = 139/212 (66%), Gaps = 15/212 (7%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEYYRR+Q+T+KSDVYSF +VL EVLCAR A+IP+LP+ +V+LAEW
Sbjct  686  HVSTVVKGSFGYMDPEYYRRQQLTDKSDVYSFAIVLLEVLCARPAIIPSLPKEQVNLAEW  745

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             +  Y  G   +I+D NLK QIA ECL ++VE A +C+ D+GIDRPAM+DV+W LEFA+Q
Sbjct  746  AKFCYRKGTFEQIIDSNLKDQIAPECLKKFVETAIHCISDKGIDRPAMSDVLWMLEFAMQ  805

Query  265  LQDAADKRGGLS----PPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAEKLFR  98
             Q+  D RG              P  PLLA G      +K+DE+    + +SE A    +
Sbjct  806  QQEGTDCRGSNKVEGGDSFFAASPSLPLLAVG----EPDKTDEEM--LWGSSEAALSGSK  859

Query  97   TKssatatstsddSLRGQSHTIFSELSNQLGR  2
            +   +T +S      + +S  IFSE+ N LGR
Sbjct  860  SSGLSTPSSE-----KLKSGDIFSEIMNPLGR  886



>ref|XP_009373799.1| PREDICTED: receptor-like protein kinase FERONIA [Pyrus x bretschneideri]
Length=890

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 145/208 (70%), Gaps = 11/208 (5%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            H+ST VKGSFGY+DPEYYRR+Q+TEKSDVYSFGVVL EVLCAR A+I    + ++SLAEW
Sbjct  694  HISTVVKGSFGYLDPEYYRRQQLTEKSDVYSFGVVLCEVLCARPALIRTAEKKQMSLAEW  753

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             +  +  G + +I+DP+L+G+I + CL +YVEIA +C+ D GI+RP+MNDVVWGLEFALQ
Sbjct  754  TKICHRNGKLDQIIDPSLRGKIGNACLKKYVEIAVSCMHDSGIERPSMNDVVWGLEFALQ  813

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAEKLFRTKss  86
            LQ +    GG S            +  G D E+  +SD  +  ++  S + EK   +K+S
Sbjct  814  LQQSV---GGDSNSNDE-------MGSGDDVESVTRSDVGF-ISWEESSDLEKSRVSKTS  862

Query  85   atatstsddSLRGQSHTIFSELSNQLGR  2
            +   ST++DS++G S T+FSE+++  GR
Sbjct  863  SDHNSTTNDSIKGMSGTVFSEINDPNGR  890



>emb|CAN68061.1| hypothetical protein VITISV_037438 [Vitis vinifera]
Length=289

 Score =   181 bits (459),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 101/212 (48%), Positives = 136/212 (64%), Gaps = 8/212 (4%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEYYRR+Q+TEKSDVYSFGVVLFEVLCAR  +   + + +VSLA+W
Sbjct  82   HVSTVVKGSFGYLDPEYYRRQQLTEKSDVYSFGVVLFEVLCARPPLNQTVEKERVSLAQW  141

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y  G + +IVDP LKG+IA +CL ++ EIA +CL+DQGI+RP+M DVVWGL+FA+Q
Sbjct  142  APSCYRDGKLEQIVDPFLKGKIAPDCLQKFGEIAVSCLQDQGIERPSMTDVVWGLQFAMQ  201

Query  265  LQDAA----DKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAEKLFR  98
            LQ++A    +K G     +  E P    +    D      SD   GG + +  +   +  
Sbjct  202  LQESAEQETEKSGSWRKVKDEEAPLKTSITDDSDDAYVLTSDS--GGTWDSQSSGIMIPS  259

Query  97   TKssatatstsddSLRGQSHTIFSELSNQLGR  2
            +    ++TS   D+L   S  +FSE+ N  GR
Sbjct  260  SGEEKSSTSRESDAL--MSGAVFSEILNPKGR  289



>emb|CAN65310.1| hypothetical protein VITISV_043086 [Vitis vinifera]
Length=289

 Score =   181 bits (459),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 101/212 (48%), Positives = 137/212 (65%), Gaps = 8/212 (4%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEYYRR+Q+TEKSDVYSFGVVLFEVLCAR  +   + + +VSLA+W
Sbjct  82   HVSTVVKGSFGYLDPEYYRRQQLTEKSDVYSFGVVLFEVLCARPPLNQTVEKERVSLAQW  141

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y  G + +IVDP LKG+IA +CL ++ EIA +CL+DQGI+RP+M+DVVWGL+FA+Q
Sbjct  142  APACYRDGKLEQIVDPFLKGKIAPDCLQKFGEIAVSCLQDQGIERPSMSDVVWGLQFAMQ  201

Query  265  LQDAA----DKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAEKLFR  98
            LQ++A    +K G     +  E P    +    D      SD   GG + +  +   +  
Sbjct  202  LQESAEQEMEKSGSWRKVKDEEAPLKXSITDDSDDAYVLTSDS--GGTWDSKSSGVMIQS  259

Query  97   TKssatatstsddSLRGQSHTIFSELSNQLGR  2
            +    ++TS   D+L   S  +FSE+ N  GR
Sbjct  260  SGEEKSSTSCESDAL--MSGAVFSEILNPKGR  289



>ref|XP_011018979.1| PREDICTED: receptor-like protein kinase FERONIA, partial [Populus 
euphratica]
Length=297

 Score =   181 bits (459),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAEW
Sbjct  97   HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAEW  156

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                ++ G + +I+DP LKG+IA EC  ++ E A  C+ DQ IDRP+M DV+W LEFALQ
Sbjct  157  AAHCHKKGILDQILDPYLKGKIAPECFKKFAETAMKCVSDQSIDRPSMGDVLWNLEFALQ  216

Query  265  LQDAAD  248
            LQ++A+
Sbjct  217  LQESAE  222



>emb|CAN77538.1| hypothetical protein VITISV_025026 [Vitis vinifera]
Length=853

 Score =   189 bits (481),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVSTAVKGSFGYVDPEY+R RQ+TEKSDVYSFGVVLFEVLCAR AVIP+ P  +V LAEW
Sbjct  645  HVSTAVKGSFGYVDPEYFRLRQLTEKSDVYSFGVVLFEVLCARPAVIPDAPEKQVCLAEW  704

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
            GRRSY  G +  I+D NL+ ++A ECL ++ EIA +C++D+GI+RP M+DVVW LEFALQ
Sbjct  705  GRRSYRKGALVRIMDQNLRDEVAPECLKKFGEIADSCVRDKGIERPPMSDVVWALEFALQ  764

Query  265  LQDAADKRGGLS  230
            LQ+ A++   ++
Sbjct  765  LQETAERNSQIN  776



>ref|XP_002277584.3| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
Length=895

 Score =   189 bits (481),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVSTAVKGSFGYVDPEY+R RQ+TEKSDVYSFGVVLFEVLCAR AVIP+ P  +V LAEW
Sbjct  687  HVSTAVKGSFGYVDPEYFRLRQLTEKSDVYSFGVVLFEVLCARPAVIPDAPEKQVCLAEW  746

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
            GRRSY  G +  I+D NL+ ++A ECL ++ EIA +C++D+GI+RP M+DVVW LEFALQ
Sbjct  747  GRRSYRKGALVRIMDQNLRDEVAPECLKKFGEIADSCVRDKGIERPPMSDVVWALEFALQ  806

Query  265  LQDAADKRGGLS  230
            LQ+ A++   ++
Sbjct  807  LQETAERNSQIN  818



>emb|CBI21192.3| unnamed protein product [Vitis vinifera]
Length=974

 Score =   190 bits (483),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVSTAVKGSFGYVDPEY+R RQ+TEKSDVYSFGVVLFEVLCAR AVIP+ P  +V LAEW
Sbjct  769  HVSTAVKGSFGYVDPEYFRLRQLTEKSDVYSFGVVLFEVLCARPAVIPDAPEKQVCLAEW  828

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
            GRRSY  G +  I+D NL+ ++A ECL ++ EIA +C++D+GI+RP M+DVVW LEFALQ
Sbjct  829  GRRSYRKGALVRIMDQNLRDEVAPECLKKFGEIADSCVRDKGIERPPMSDVVWALEFALQ  888

Query  265  LQDAADKRGGLS  230
            LQ+ A++   ++
Sbjct  889  LQETAERNSQIN  900



>gb|ABY40731.1| FERONIA receptor-like kinase [Citrus trifoliata]
Length=447

 Score =   184 bits (467),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAEW
Sbjct  245  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAEW  304

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                ++ G + +I+DP LKG+IA EC  ++ E A  C+ DQGI+RP+M DV+W LEFALQ
Sbjct  305  AAHCHKKGILEQIMDPYLKGKIAPECFKKFAETAMKCVSDQGIERPSMGDVLWNLEFALQ  364

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  365  LQESAEESG  373



>ref|XP_010660576.1| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
Length=875

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 124/170 (73%), Gaps = 4/170 (2%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVSTAVKGSFGYVDPEY+R RQ+TEKSDVYSFGVVLFEVLC R AVIP  P+ +VS+AEW
Sbjct  667  HVSTAVKGSFGYVDPEYFRLRQLTEKSDVYSFGVVLFEVLCGRPAVIPGAPKEQVSVAEW  726

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
            GRRSY  G +  I+D NL+ ++A ECL ++ EIA +C++++GI+RP M+DVVW LEFALQ
Sbjct  727  GRRSYRNGALDRIMDQNLRDEVAPECLKKFGEIADSCVRNEGIERPPMSDVVWALEFALQ  786

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSEN  116
            LQ+ A++   ++   + +      +    DG   + S    GGA TTS+N
Sbjct  787  LQETAERNAQIN---SGDEVYMGRVGVKPDGSQPSSSAVTRGGA-TTSDN  832



>ref|XP_010694018.1| PREDICTED: putative receptor-like protein kinase At5g39000 isoform 
X3 [Beta vulgaris subsp. vulgaris]
 ref|XP_010694023.1| PREDICTED: putative receptor-like protein kinase At5g39000 isoform 
X4 [Beta vulgaris subsp. vulgaris]
Length=899

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            H+STAVKGS GY+DPEYY+RRQ+TEKSDVYSFGVVLFEVLCARA V PNLPR + +LA W
Sbjct  694  HISTAVKGSVGYLDPEYYQRRQLTEKSDVYSFGVVLFEVLCARAVVKPNLPREQANLARW  753

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y++G ++ IVDP+L GQI+ ECL ++ EIA  C++D+G +RP M D+VWGLEFALQ
Sbjct  754  ATTRYKSGTLNTIVDPDLTGQISPECLRKFGEIASMCVRDRGSERPPMGDIVWGLEFALQ  813

Query  265  LQDAADK  245
            LQ+AA+K
Sbjct  814  LQEAAEK  820



>ref|XP_010244547.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=890

 Score =   187 bits (475),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 107/132 (81%), Gaps = 0/132 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P L + +VSLAEW
Sbjct  688  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPTLAKEQVSLAEW  747

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                 + G + +I+DP LKG+IA EC  ++ EIA  C+ DQGIDRPAM DV+W LEFALQ
Sbjct  748  ALHCQKKGILDQIIDPYLKGKIAPECFKKFAEIAEKCVADQGIDRPAMGDVLWHLEFALQ  807

Query  265  LQDAADKRGGLS  230
            LQ++A++ GGL+
Sbjct  808  LQESAEENGGLA  819



>ref|XP_004142677.1| PREDICTED: receptor-like protein kinase FERONIA-like [Cucumis 
sativus]
 ref|XP_004161706.1| PREDICTED: receptor-like protein kinase FERONIA-like [Cucumis 
sativus]
 gb|KGN54458.1| hypothetical protein Csa_4G334690 [Cucumis sativus]
Length=897

 Score =   187 bits (475),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFEVLCAR A+ P LP+ +VSLAEW
Sbjct  696  HVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPALNPTLPKEQVSLAEW  755

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y  G + +I+D  LKG+IASECL ++ E A  C+ DQGIDRP+M DV+W LEFALQ
Sbjct  756  AAHCYNKGILDQIIDTFLKGKIASECLKKFAETAMKCVSDQGIDRPSMGDVLWNLEFALQ  815

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  816  LQESAEESG  824



>gb|EPS73118.1| hypothetical protein M569_01631 [Genlisea aurea]
Length=873

 Score =   187 bits (475),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 116/172 (67%), Gaps = 0/172 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVL EVLCAR A+ P+LP+ +VSLAEW
Sbjct  682  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLLEVLCARPALNPSLPKEQVSLAEW  741

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
            G   ++ G + +I+DP L G+IASEC  +Y E A  CL D G+DRPAM DV+W LEFAL 
Sbjct  742  GVHCHKKGTLDQIIDPYLYGKIASECFKKYTETAVKCLSDVGMDRPAMGDVLWNLEFALN  801

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAE  110
            LQ++A++ G +      +        KG DG A +      G   +    +E
Sbjct  802  LQESAEESGMVPKGGGGDMESSSFKGKGFDGTATDSKSSSSGMTMSIGGRSE  853



>ref|XP_006373370.1| hypothetical protein POPTR_0017s13150g [Populus trichocarpa]
 gb|ERP51167.1| hypothetical protein POPTR_0017s13150g [Populus trichocarpa]
Length=855

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST V+GSFGYVDPEYYRR+ +TEKSDVYSFGVVLFEVLCAR  VIP+ P+ + SLAEW
Sbjct  659  HVSTVVRGSFGYVDPEYYRRQHLTEKSDVYSFGVVLFEVLCARPPVIPSSPKEQASLAEW  718

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             R+ Y  G + EIVDP+LKG++A   L ++ EIA +CL  QGI+RP M DVVWGLEFALQ
Sbjct  719  ARKCYLRGTLDEIVDPHLKGEVAPVSLNKFAEIANSCLHGQGIERPKMGDVVWGLEFALQ  778

Query  265  LQDAADKRG  239
            LQ  A+K  
Sbjct  779  LQQTAEKNA  787



>ref|XP_008463270.1| PREDICTED: receptor-like protein kinase FERONIA [Cucumis melo]
 ref|XP_008463271.1| PREDICTED: receptor-like protein kinase FERONIA [Cucumis melo]
 ref|XP_008463272.1| PREDICTED: receptor-like protein kinase FERONIA [Cucumis melo]
Length=897

 Score =   187 bits (475),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFEVLCAR A+ P LP+ +VSLAEW
Sbjct  696  HVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPALNPTLPKEQVSLAEW  755

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y  G + +I+D  LKG+IASECL ++ E A  C+ DQGIDRP+M DV+W LEFALQ
Sbjct  756  AAHCYNKGILDQIIDTFLKGKIASECLKKFAETAMKCVSDQGIDRPSMGDVLWNLEFALQ  815

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  816  LQESAEESG  824



>emb|CDP20271.1| unnamed protein product [Coffea canephora]
Length=886

 Score =   187 bits (475),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 115/160 (72%), Gaps = 7/160 (4%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            H+ST VKGSFGY+DPEYY R+Q+T+KSDVYSFGVVLFEVLC RA +I +LP+ +V+LAEW
Sbjct  685  HISTQVKGSFGYIDPEYYTRQQLTDKSDVYSFGVVLFEVLCGRAPIILDLPQEQVNLAEW  744

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             ++ Y+ G +  +VDP++ G+IA +CL  + E A NCLKDQGI RP M+DVV  LE ALQ
Sbjct  745  AKKCYKKGIIHRVVDPDVNGEIAPQCLRIFAETAINCLKDQGIQRPGMDDVVGDLELALQ  804

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDED  146
            +Q+AA+  GG   P       FPL      G+  N +D+D
Sbjct  805  VQEAAENEGGRPDP-------FPLHLHMHGGDVQNMTDDD  837



>ref|XP_010034429.1| PREDICTED: receptor-like protein kinase FERONIA [Eucalyptus grandis]
Length=888

 Score =   187 bits (474),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 118/176 (67%), Gaps = 5/176 (3%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVSTAVKG+FGY+DPEYYRR+++T+KSDVYSFGVVLFEVLCAR AV    P  ++SLAEW
Sbjct  694  HVSTAVKGTFGYLDPEYYRRQRLTDKSDVYSFGVVLFEVLCARPAVSRMAPMEQISLAEW  753

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             +   ++G V E+VDP+LKG IA ECL ++ EIA +CL+D+G  RP+MNDVVWGL FALQ
Sbjct  754  AQSCCKSGSVEEMVDPHLKGAIALECLNKFCEIAMSCLQDEGAKRPSMNDVVWGLNFALQ  813

Query  265  LQ-----DAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENA  113
            LQ     +  D  G               +   G  EA N SD D GG  ++ E A
Sbjct  814  LQVSTELEVKDHAGVSVHDSDDSDHDAASIRGSGSDEAINTSDSDSGGWKSSRETA  869



>ref|XP_010693989.1| PREDICTED: receptor-like protein kinase FERONIA isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010693992.1| PREDICTED: receptor-like protein kinase FERONIA isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=934

 Score =   187 bits (474),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            H+STAVKGS GY+DPEYY+RRQ+TEKSDVYSFGVVLFEVLCARA V PNLPR + +LA+W
Sbjct  729  HISTAVKGSVGYLDPEYYQRRQLTEKSDVYSFGVVLFEVLCARAVVKPNLPREQANLAKW  788

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y++G ++ IVDP+L GQI+ ECL ++ EIA  C++D+G +RP M D+VWGLEFALQ
Sbjct  789  ATTRYKSGTLNTIVDPDLTGQISPECLRKFGEIASMCVRDRGSERPPMGDIVWGLEFALQ  848

Query  265  LQDAADK  245
            LQ+ A+K
Sbjct  849  LQEDAEK  855



>ref|NP_001238686.1| receptor-like kinase [Glycine max]
 gb|ACM89482.1| receptor-like kinase [Glycine max]
Length=883

 Score =   186 bits (472),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFEVLCAR A+ P L + +VSLAEW
Sbjct  685  HVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPALNPTLAKEQVSLAEW  744

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y+ G +  I+DP LKG+IASEC  ++ E A  C+ DQGIDRP+M DV+W LEFALQ
Sbjct  745  AAHCYKKGILDSIIDPYLKGKIASECFKKFAETAMKCVADQGIDRPSMGDVLWNLEFALQ  804

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  805  LQESAEESG  813



>ref|XP_004306057.1| PREDICTED: receptor-like protein kinase FERONIA [Fragaria vesca 
subsp. vesca]
Length=885

 Score =   186 bits (472),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 100/210 (48%), Positives = 143/210 (68%), Gaps = 16/210 (8%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            H+ST VKGSFGY+DPEYYRR+Q+TEKSDVYSFGVVL EVLCAR A+I  + + ++SLAEW
Sbjct  690  HISTMVKGSFGYLDPEYYRRQQLTEKSDVYSFGVVLCEVLCARPALIRTVEKKQMSLAEW  749

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             +  +  G + +I+DPNL+G+IA+ CL ++VE+A +C+ D G +RP+MNDVVWGLEFALQ
Sbjct  750  TKSCHRNGSIYQIIDPNLRGKIAATCLNKFVELAVSCMNDNGNERPSMNDVVWGLEFALQ  809

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAA--NKSDEDYGGAFTTSENAEKLFRTK  92
            LQ +A+               F  +   G+ E A    +D+    ++  S +++    TK
Sbjct  810  LQQSAEV--------------FLDVDMEGEDEVAFIKGNDDGTSCSWEYSSDSKNSRTTK  855

Query  91   ssatatstsddSLRGQSHTIFSELSNQLGR  2
            +S+   ST+++S+RG S TIFSE+ +   R
Sbjct  856  TSSGKMSTTNESIRGMSGTIFSEIKDPTVR  885



>gb|KHN40613.1| Receptor-like protein kinase FERONIA [Glycine soja]
Length=894

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFEVLCAR A+ P L + +VSLAEW
Sbjct  696  HVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPALNPTLAKEQVSLAEW  755

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y+ G +  I+DP LKG+IASEC  ++ E A  C+ DQGIDRP+M DV+W LEFALQ
Sbjct  756  AAHCYKKGILDSIIDPYLKGKIASECFKKFAETAMKCVADQGIDRPSMGDVLWNLEFALQ  815

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  816  LQESAEESG  824



>ref|XP_010034431.1| PREDICTED: receptor-like protein kinase FERONIA [Eucalyptus grandis]
 gb|KCW52043.1| hypothetical protein EUGRSUZ_J01484 [Eucalyptus grandis]
Length=883

 Score =   185 bits (470),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 114/168 (68%), Gaps = 5/168 (3%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVSTAVKG+FGY+DPEYYRR+++T+KSDVYSFGVVLFEVLCAR AV    P  ++SLAEW
Sbjct  684  HVSTAVKGTFGYLDPEYYRRQRLTDKSDVYSFGVVLFEVLCARPAVSRMAPMEQISLAEW  743

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             +   ++G V E+VDP+LKG IA ECL ++ EIA +CL+D+G  RP+MNDVVWGL FALQ
Sbjct  744  AQSCCKSGSVEEMVDPHLKGAIALECLNKFCEIAMSCLQDEGAKRPSMNDVVWGLNFALQ  803

Query  265  LQ-----DAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGG  137
            LQ     +  D  G               +   G  EA N SD D GG
Sbjct  804  LQVSTELEVKDHAGVSVHDSDDSDHDAASIRGSGSDEAINTSDSDSGG  851



>ref|XP_006373383.1| hypothetical protein POPTR_0017s13270g [Populus trichocarpa]
 gb|ERP51180.1| hypothetical protein POPTR_0017s13270g [Populus trichocarpa]
Length=829

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST V+GS GYVDPEYYRR+ +TEKSDVYSFGVVLFEVLCAR  VIP+ P+++ SLAEW
Sbjct  690  HVSTVVRGSIGYVDPEYYRRQHLTEKSDVYSFGVVLFEVLCARPPVIPSSPKDQASLAEW  749

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             R+ Y+ G + +IVDP+LKG++A   L ++ EIA +CL  QGI+RP M DVVWGLEFALQ
Sbjct  750  ARKCYQRGTLDQIVDPHLKGEVAPVSLNKFAEIANSCLHGQGIERPKMGDVVWGLEFALQ  809

Query  265  LQDAADK  245
            LQ  A+K
Sbjct  810  LQQTAEK  816



>ref|XP_011099029.1| PREDICTED: receptor-like protein kinase FERONIA [Sesamum indicum]
Length=885

 Score =   185 bits (470),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 109/152 (72%), Gaps = 4/152 (3%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGS GYVDPEYYRR+Q+T+KSDVYSF +VL EVLCAR A+IP+LPR +V+LAEW
Sbjct  685  HVSTVVKGSLGYVDPEYYRRQQLTDKSDVYSFAIVLLEVLCARPAIIPSLPREQVNLAEW  744

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             +  Y  G   +I+D NLK QIA ECL ++VE A +C+ D+GIDR AM+DV+W LEFA+Q
Sbjct  745  AKFCYRKGTFEQIIDSNLKDQIAPECLKKFVETAIHCISDKGIDRLAMSDVLWMLEFAMQ  804

Query  265  LQDAADKRGGLSP----PRTPERPGFPLLAKG  182
             Q+ AD RG              P  PLLA G
Sbjct  805  QQEGADCRGSNKAEGGDSFFAASPSLPLLAVG  836



>ref|XP_008368476.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
FERONIA [Malus domestica]
Length=892

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 102/211 (48%), Positives = 144/211 (68%), Gaps = 17/211 (8%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            H+ST VKGSFGY+DPEYYRR+Q+TEKSDVYSFGVVL EVLCAR A+I    + ++SLAEW
Sbjct  696  HISTVVKGSFGYLDPEYYRRQQLTEKSDVYSFGVVLCEVLCARPALIRTAEKKQMSLAEW  755

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             +  +  G + +I+DP+L+G+I + CL +YVEIA +C+ D GI+RP+MNDVVWGLEFALQ
Sbjct  756  TKICHRNGKLDQIIDPSLRGKIGNACLKKYVEIAVSCMHDSGIERPSMNDVVWGLEFALQ  815

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAEKLFR---T  95
            LQ +    GG S               GG  +  + +  D G  F + E + +L +   +
Sbjct  816  LQQSV---GGDSNSND---------EMGGGDDIGSVTGSDVG--FISWEESSELKKSRVS  861

Query  94   KssatatstsddSLRGQSHTIFSELSNQLGR  2
            K+S+   ST+++S++G S T+FSE+++  GR
Sbjct  862  KTSSDHNSTTNESIKGMSGTVFSEINDPNGR  892



>ref|XP_006419383.1| hypothetical protein CICLE_v10004295mg [Citrus clementina]
 gb|ESR32623.1| hypothetical protein CICLE_v10004295mg [Citrus clementina]
Length=862

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+  NLP+ +VSLA+W
Sbjct  684  HVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNVNLPKEQVSLADW  743

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                   G + +I+DPNLKG I  +CL ++ E A  CL DQGIDRP+M DV+W LEFALQ
Sbjct  744  ALHCQRMGTIEDIIDPNLKGNITDQCLRKFTETAEKCLSDQGIDRPSMGDVLWNLEFALQ  803

Query  265  LQDAAD  248
            LQD  D
Sbjct  804  LQDNPD  809



>ref|XP_010485852.1| PREDICTED: receptor-like protein kinase ANXUR1 [Camelina sativa]
Length=851

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 116/176 (66%), Gaps = 15/176 (9%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HV+T VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ PNLP+ +VSL +W
Sbjct  673  HVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPNLPKEQVSLGDW  732

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                   G + +I+DPNLKG+I SECL ++ + A  CL D G++RP M DV+W LEFALQ
Sbjct  733  AMNCKRRGTLDDIIDPNLKGKINSECLKKFADTAEKCLSDSGLERPTMGDVLWNLEFALQ  792

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAA----------NKSDEDYGGAFT  128
            LQ+ AD        RTP R G       G G AA          + S ED  G F+
Sbjct  793  LQETAD-----GTRRTPNRGGSSEDVGDGGGMAAVNVAGRDDVSDLSSEDSSGIFS  843



>ref|XP_002467915.1| hypothetical protein SORBIDRAFT_01g036260 [Sorghum bicolor]
 gb|EER94913.1| hypothetical protein SORBIDRAFT_01g036260 [Sorghum bicolor]
Length=895

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 112/148 (76%), Gaps = 2/148 (1%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P LP+ +VSLAEW
Sbjct  699  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPTLPKEEVSLAEW  758

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                 + G + +IVDP LKG+IA +C  ++ E A  C+ DQGIDRP+M DV+W LEFALQ
Sbjct  759  ALHCQKKGILDQIVDPYLKGKIAPQCFKKFAETAEKCVSDQGIDRPSMGDVLWNLEFALQ  818

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKG  182
            +Q++A++ G L    + E  G PL+  G
Sbjct  819  MQESAEESGSLGCGMSDE--GTPLVMVG  844



>ref|XP_010098025.1| Receptor-like protein kinase FERONIA [Morus notabilis]
 gb|EXB74408.1| Receptor-like protein kinase FERONIA [Morus notabilis]
Length=888

 Score =   185 bits (469),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAEW
Sbjct  691  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAEW  750

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                ++ G + +I+DP LKG+IA EC  ++ E A  C+ DQGI+RP+M DV+W LEFALQ
Sbjct  751  AAHCHKKGILDQILDPYLKGKIAPECFKKFAETAMKCVSDQGIERPSMGDVLWNLEFALQ  810

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  811  LQESAEESG  819



>ref|XP_010252026.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=886

 Score =   185 bits (469),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAEW
Sbjct  688  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAEW  747

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                 + G + +I+DP LKG+IA EC  ++ E A  C+ DQGIDRPAM DV+W LEFALQ
Sbjct  748  ALHCQKKGILDQIIDPYLKGKIAPECFKKFAETAEKCVSDQGIDRPAMGDVLWNLEFALQ  807

Query  265  LQDAADKRG  239
            LQ++A+  G
Sbjct  808  LQESAESSG  816



>gb|KDO71938.1| hypothetical protein CISIN_1g041565mg [Citrus sinensis]
Length=862

 Score =   184 bits (468),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+  NLP+ +VSLA+W
Sbjct  684  HVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNVNLPKEQVSLADW  743

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                   G + +I+DPNLKG I  +CL ++ E A  CL DQGIDRP+M DV+W LEFALQ
Sbjct  744  ALHCQRMGTIEDIIDPNLKGNITDQCLRKFTETAEKCLSDQGIDRPSMGDVLWNLEFALQ  803

Query  265  LQDAAD  248
            LQD  D
Sbjct  804  LQDNPD  809



>ref|XP_006488842.1| PREDICTED: receptor-like protein kinase ANXUR1-like [Citrus sinensis]
Length=862

 Score =   184 bits (468),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+  NLP+ +VSLA+W
Sbjct  684  HVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNVNLPKEQVSLADW  743

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                   G + +I+DPNLKG I  +CL ++ E A  CL DQGIDRP+M DV+W LEFALQ
Sbjct  744  ALHCQRMGTIEDIIDPNLKGNITDQCLRKFTETAEKCLSDQGIDRPSMGDVLWNLEFALQ  803

Query  265  LQDAAD  248
            LQD  D
Sbjct  804  LQDNPD  809



>ref|XP_007033491.1| Malectin/receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY04417.1| Malectin/receptor-like protein kinase family protein [Theobroma 
cacao]
Length=892

 Score =   184 bits (468),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAEW
Sbjct  691  HVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAEW  750

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                ++ G + +I+DP LKG+IA EC  ++ E A  C+ DQGIDRP+M DV+W LEFALQ
Sbjct  751  AAHCHKKGILDQIMDPYLKGKIAPECFKKFAETAMKCVADQGIDRPSMGDVLWNLEFALQ  810

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  811  LQESAEESG  819



>gb|KHN29489.1| Receptor-like protein kinase FERONIA [Glycine soja]
Length=896

 Score =   184 bits (468),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 116/171 (68%), Gaps = 6/171 (4%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFEVLCAR A+ P L + +VSLAEW
Sbjct  698  HVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPALNPTLAKEQVSLAEW  757

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y+ G +  I+DP LKG+IA EC  ++ E A  C+ DQGIDRP+M DV+W LEFALQ
Sbjct  758  AAHCYQKGILDSIIDPYLKGKIAPECFKKFAETAMKCVADQGIDRPSMGDVLWNLEFALQ  817

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENA  113
            LQ++A++ G        E P +       D +    SD  Y G  T S ++
Sbjct  818  LQESAEESGNGFGDIHCEEPLY------TDSKGKKDSDPGYDGNVTDSRSS  862



>ref|XP_006373375.1| hypothetical protein POPTR_0017s13190g, partial [Populus trichocarpa]
 gb|ERP51172.1| hypothetical protein POPTR_0017s13190g, partial [Populus trichocarpa]
Length=855

 Score =   184 bits (467),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST V+GS GYVDP+YYRR+ +TEKSDVYSFGVVLFEVLCAR  VIP+ P+++ SLA+W
Sbjct  688  HVSTVVRGSIGYVDPQYYRRQHLTEKSDVYSFGVVLFEVLCARPPVIPSSPKDQASLADW  747

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             R+ Y  G + +IVDP+LKG++A   L ++ EIA +CL  QGI+RP M DVVWGLEFALQ
Sbjct  748  ARKCYHRGTLDQIVDPHLKGEVAPVSLNKFAEIANSCLHVQGIERPKMGDVVWGLEFALQ  807

Query  265  LQDAADKRG  239
            LQ +A+K G
Sbjct  808  LQQSAEKNG  816



>ref|XP_006429617.1| hypothetical protein CICLE_v10011034mg [Citrus clementina]
 ref|XP_006481221.1| PREDICTED: receptor-like protein kinase FERONIA-like [Citrus 
sinensis]
 gb|ESR42857.1| hypothetical protein CICLE_v10011034mg [Citrus clementina]
Length=895

 Score =   184 bits (468),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAEW
Sbjct  693  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAEW  752

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                ++ G + +I+DP LKG+IA EC  ++ E A  C+ DQGI+RP+M DV+W LEFALQ
Sbjct  753  AAHCHKKGILEQIMDPYLKGKIAPECFKKFAETAMKCVSDQGIERPSMGDVLWNLEFALQ  812

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  813  LQESAEESG  821



>gb|KDO64141.1| hypothetical protein CISIN_1g036624mg [Citrus sinensis]
Length=893

 Score =   184 bits (467),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAEW
Sbjct  691  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAEW  750

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                ++ G + +I+DP LKG+IA EC  ++ E A  C+ DQGI+RP+M DV+W LEFALQ
Sbjct  751  AAHCHKKGILEQIMDPYLKGKIAPECFKKFAETAMKCVSDQGIERPSMGDVLWNLEFALQ  810

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  811  LQESAEESG  819



>ref|NP_001237656.1| FERONIA receptor-like kinase precursor [Glycine max]
 gb|ACM89524.1| FERONIA receptor-like kinase [Glycine max]
Length=892

 Score =   184 bits (467),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 116/171 (68%), Gaps = 6/171 (4%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFEVLCAR A+ P L + +VSLAEW
Sbjct  694  HVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPALNPTLAKEQVSLAEW  753

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y+ G +  I+DP LKG+IA EC  ++ E A  C+ DQGIDRP+M DV+W LEFALQ
Sbjct  754  AAHCYQKGILDSIIDPYLKGKIAPECFKKFAETAMKCVADQGIDRPSMGDVLWNLEFALQ  813

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENA  113
            LQ++A++ G        E P +       D +    SD  Y G  T S ++
Sbjct  814  LQESAEESGNGFGDIHCEEPLY------TDSKGKKDSDPGYDGNVTDSRSS  858



>ref|XP_009151260.1| PREDICTED: receptor-like protein kinase ANXUR2 [Brassica rapa]
 ref|XP_009151261.1| PREDICTED: receptor-like protein kinase ANXUR2 [Brassica rapa]
Length=859

 Score =   184 bits (466),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 119/174 (68%), Gaps = 8/174 (5%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HV+T VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P+LP+ +VSL +W
Sbjct  678  HVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPSLPKEQVSLGDW  737

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                 + G + +I+DPNLKG+I  ECL ++ + A  CL D G+DRP M DV+W LEFALQ
Sbjct  738  ATNCKKKGTLEDIIDPNLKGKINPECLKKFADTAEKCLSDSGLDRPTMGDVLWNLEFALQ  797

Query  265  LQDAAD-------KRGGLSPPRTPERPGFPLLAKG-GDGEAANKSDEDYGGAFT  128
            LQ+ AD        RGG S     E  G  +   G G+ + ++ S E+  G F+
Sbjct  798  LQETADGSRQPTPSRGGESEDLAGEGGGMAVNVGGAGEHDVSDLSSEESSGIFS  851



>gb|KJB29840.1| hypothetical protein B456_005G120700 [Gossypium raimondii]
Length=889

 Score =   184 bits (467),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAEW
Sbjct  688  HVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAEW  747

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                ++ G + +I+DP LKG+IA EC  ++ E A  C+ DQGIDRP+M DV+W LEFALQ
Sbjct  748  AAHCHKKGILDQIMDPYLKGKIAPECFKKFAETAMKCVADQGIDRPSMGDVLWNLEFALQ  807

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  808  LQESAEESG  816



>emb|CDX86206.1| BnaA06g29230D [Brassica napus]
Length=859

 Score =   184 bits (466),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 119/174 (68%), Gaps = 8/174 (5%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HV+T VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P+LP+ +VSL +W
Sbjct  678  HVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPSLPKEQVSLGDW  737

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                 + G + +I+DPNLKG+I  ECL ++ + A  CL D G+DRP M DV+W LEFALQ
Sbjct  738  ATNCKKKGTLEDIIDPNLKGKINPECLKKFADTAEKCLSDSGLDRPTMGDVLWNLEFALQ  797

Query  265  LQDAAD-------KRGGLSPPRTPERPGFPLLAKG-GDGEAANKSDEDYGGAFT  128
            LQ+ AD        RGG S     E  G  +   G G+ + ++ S E+  G F+
Sbjct  798  LQETADGSRQPTPSRGGESEDLAGEGGGMAVNVGGAGEHDVSDLSSEESSGIFS  851



>ref|XP_010694005.1| PREDICTED: putative receptor-like protein kinase At5g39000 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=910

 Score =   184 bits (467),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            H+STAVKGS GY+DPEYY+RRQ+TEKSDVYSFGVVLFEVLCARAAV PNLP+ + +LA+W
Sbjct  704  HISTAVKGSVGYLDPEYYQRRQLTEKSDVYSFGVVLFEVLCARAAVKPNLPKEQANLAKW  763

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                 ++G +  IVDPNL GQI+ ECL ++ E+A  C++D+G +RP M D+VWGLEF+LQ
Sbjct  764  ATARCKSGTLYTIVDPNLTGQISPECLRKFGEVASMCVRDRGSERPPMGDIVWGLEFSLQ  823

Query  265  LQDAADK  245
            LQ+AA+K
Sbjct  824  LQEAAEK  830



>ref|XP_010694013.1| PREDICTED: putative receptor-like protein kinase At5g39000 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=908

 Score =   184 bits (467),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            H+STAVKGS GY+DPEYY+RRQ+TEKSDVYSFGVVLFEVLCARAAV PNLP+ + +LA+W
Sbjct  702  HISTAVKGSVGYLDPEYYQRRQLTEKSDVYSFGVVLFEVLCARAAVKPNLPKEQANLAKW  761

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                 ++G +  IVDPNL GQI+ ECL ++ E+A  C++D+G +RP M D+VWGLEF+LQ
Sbjct  762  ATARCKSGTLYTIVDPNLTGQISPECLRKFGEVASMCVRDRGSERPPMGDIVWGLEFSLQ  821

Query  265  LQDAADK  245
            LQ+AA+K
Sbjct  822  LQEAAEK  828



>ref|XP_010684237.1| PREDICTED: receptor-like protein kinase ANXUR1 [Beta vulgaris 
subsp. vulgaris]
Length=865

 Score =   184 bits (466),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P+LP+ +VSLA+W
Sbjct  683  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPSLPKEQVSLADW  742

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             R S   G++ EI+D ++KG I  ECL ++V+ A  CL D GIDRP+M+D++W LEF+LQ
Sbjct  743  ARSSVRKGNIDEIIDTHIKGTIKPECLKKFVDTAFKCLSDHGIDRPSMSDLLWNLEFSLQ  802

Query  265  LQDAAD  248
            LQ+  D
Sbjct  803  LQETED  808



>ref|XP_010417830.1| PREDICTED: receptor-like protein kinase ANXUR1 [Camelina sativa]
Length=852

 Score =   183 bits (465),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 105/141 (74%), Gaps = 5/141 (4%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HV+T VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ PNLP+ +VSL +W
Sbjct  673  HVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPNLPKEQVSLGDW  732

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                   G + +I+DPNLKG+I SECL ++ + A  CL D G++RP M DV+W LEFALQ
Sbjct  733  AMNCKRRGTLDDIIDPNLKGKINSECLKKFADTAEKCLSDSGLERPTMGDVLWNLEFALQ  792

Query  265  LQDAADKRGGLSPPRTPERPG  203
            LQ+ AD        RTP R G
Sbjct  793  LQETAD-----GTRRTPNRGG  808



>ref|XP_006408164.1| hypothetical protein EUTSA_v10020050mg [Eutrema salsugineum]
 gb|ESQ49617.1| hypothetical protein EUTSA_v10020050mg [Eutrema salsugineum]
Length=854

 Score =   183 bits (465),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 118/178 (66%), Gaps = 16/178 (9%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HV+T VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P+LP+ +VSL +W
Sbjct  673  HVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPSLPKEQVSLGDW  732

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                   G + +I+DPNLKG+I SECL ++ + A  CL D G+DRP M DV+W LEFALQ
Sbjct  733  AMNCKRKGTLEDIIDPNLKGKINSECLKKFADTAEKCLSDSGLDRPTMGDVLWNLEFALQ  792

Query  265  LQDAADKRGGLSPPRTPERPG------------FPLLAKGGDGEAANKSDEDYGGAFT  128
            LQ+ AD     +  RTP   G              L  +G D + ++ S ED  G F+
Sbjct  793  LQETADG----TRHRTPINGGSSEDIGGGGMVAVNLGGRGEDHDVSDLSSEDNSGIFS  846



>ref|XP_002884459.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60718.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=850

 Score =   183 bits (465),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 118/172 (69%), Gaps = 5/172 (3%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HV+T VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P+LP+ +VSL +W
Sbjct  673  HVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPSLPKEQVSLGDW  732

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                   G++ +I+DPNLKG+I SECL ++ + A  CL D G++RP M DV+W LEFALQ
Sbjct  733  AMNCKRKGNLEDIIDPNLKGKINSECLKKFADTAEKCLNDSGLERPTMGDVLWNLEFALQ  792

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAE  110
            LQ+ AD     +  RTP   G      GG G A N +  D     ++ +N E
Sbjct  793  LQETADG----TRHRTPNSGG-SSEDLGGGGMAVNVAGRDDVSDLSSEDNTE  839



>tpg|DAA45217.1| TPA: putative receptor-like protein kinase family protein [Zea 
mays]
Length=886

 Score =   184 bits (466),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 111/150 (74%), Gaps = 2/150 (1%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P LP+ +VSLAEW
Sbjct  691  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPTLPKEEVSLAEW  750

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                 + G + +IVDP LKG+IA +C  ++ E A  C+ DQGIDRP+M DV+W LEFALQ
Sbjct  751  ALHCQKKGILDQIVDPYLKGKIAPQCFKKFAETAEKCVSDQGIDRPSMGDVLWNLEFALQ  810

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKGGD  176
            +Q+ A++ G L    + E  G PL+    D
Sbjct  811  MQEGAEESGSLGCGMSDE--GAPLMVGKKD  838



>ref|XP_009388382.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
ANXUR2 [Musa acuminata subsp. malaccensis]
Length=402

 Score =   178 bits (451),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFEVLCARAA+ PNLP+ +VSLA+W
Sbjct  224  HVSTMVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARAALSPNLPKEQVSLADW  283

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                 + G +++I+DP+L+G+ + ECL +  E A  CL D G+DRP+M DV+W LEFALQ
Sbjct  284  ALHCXKKGVLADIIDPHLEGKSSPECLKKSAETAEKCLLDHGVDRPSMGDVLWNLEFALQ  343

Query  265  LQD  257
            LQD
Sbjct  344  LQD  346



>ref|XP_009791682.1| PREDICTED: receptor-like protein kinase FERONIA [Nicotiana sylvestris]
Length=888

 Score =   184 bits (466),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAEW
Sbjct  688  HVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFELLCARPALNPTLPKEQVSLAEW  747

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y+ G   +I+DP LKG+IA ECL ++ E A  C+ D G+DRP+M DV+W LEFALQ
Sbjct  748  AFHCYKKGTFDQIIDPYLKGKIAPECLKKFTETAVKCVSDVGVDRPSMGDVLWNLEFALQ  807

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  808  LQESAEECG  816



>ref|XP_010683454.1| PREDICTED: receptor-like protein kinase FERONIA [Beta vulgaris 
subsp. vulgaris]
Length=881

 Score =   183 bits (465),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE+LCAR A+ P+LP+ +VSLAEW
Sbjct  684  HVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARPALNPSLPKEQVSLAEW  743

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y+ G + +I+DP LKG+IA EC  ++ E A  C+ DQ IDRP+M DV+W LEFALQ
Sbjct  744  AVYCYKKGILEQIMDPYLKGKIAPECFKKFAETAMKCVSDQSIDRPSMGDVLWNLEFALQ  803

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  804  LQESAEESG  812



>ref|XP_009617447.1| PREDICTED: receptor-like protein kinase FERONIA [Nicotiana tomentosiformis]
Length=888

 Score =   183 bits (465),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAEW
Sbjct  688  HVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFELLCARPALNPTLPKEQVSLAEW  747

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y+ G   +I+DP LKG+IA ECL ++ E A  C+ D G+DRP+M DV+W LEFALQ
Sbjct  748  AFHCYKKGTFDQIIDPYLKGKIAPECLKKFTETAVKCVSDVGVDRPSMGDVLWNLEFALQ  807

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  808  LQESAEECG  816



>ref|XP_002279218.3| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
Length=893

 Score =   183 bits (465),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAEW
Sbjct  692  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAEW  751

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                 + G + +I+DP LKG+IA EC  +  E A  C+ DQGIDRP+M DV+W LEFALQ
Sbjct  752  ALHCQKKGILDQIIDPYLKGKIAPECFKKIAETAVKCVSDQGIDRPSMGDVLWNLEFALQ  811

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  812  LQESAEEAG  820



>ref|XP_006842554.1| hypothetical protein AMTR_s00077p00138840 [Amborella trichopoda]
 gb|ERN04229.1| hypothetical protein AMTR_s00077p00138840 [Amborella trichopoda]
Length=899

 Score =   183 bits (465),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 111/152 (73%), Gaps = 0/152 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P LP+ +VSLAEW
Sbjct  704  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPTLPKEQVSLAEW  763

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                 + G + +I+DP L+G+IA EC  ++ E A  C+ DQGIDRPAM DV+W LEFALQ
Sbjct  764  ALHCQKKGVLEQIMDPYLRGKIAPECFKKFAETAEKCVGDQGIDRPAMGDVLWNLEFALQ  823

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKGGDGE  170
            LQ+++++       +       PL  KG DG+
Sbjct  824  LQESSEEDIVADTTQIENDEEAPLTMKGKDGQ  855



>ref|XP_007208402.1| hypothetical protein PRUPE_ppa001164mg [Prunus persica]
 gb|EMJ09601.1| hypothetical protein PRUPE_ppa001164mg [Prunus persica]
Length=891

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P+LP+ +VSLAEW
Sbjct  691  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPSLPKEQVSLAEW  750

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                ++ G +  I+DP LKG+I  EC  ++ E A  C+ DQ IDRP+M DV+W LEFALQ
Sbjct  751  AAHCHKKGSLDHILDPYLKGKITPECFKKFAETAMKCVSDQSIDRPSMGDVLWNLEFALQ  810

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  811  LQESAEESG  819



>ref|XP_008244701.1| PREDICTED: receptor-like protein kinase FERONIA [Prunus mume]
Length=891

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P+LP+ +VSLAEW
Sbjct  691  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPSLPKEQVSLAEW  750

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                ++ G +  I+DP LKG+I  EC  ++ E A  C+ DQ IDRP+M DV+W LEFALQ
Sbjct  751  AAHCHKKGSLDHILDPYLKGKITPECFKKFAETAMKCVSDQSIDRPSMGDVLWNLEFALQ  810

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  811  LQESAEESG  819



>ref|XP_006341293.1| PREDICTED: receptor-like protein kinase FERONIA-like [Solanum 
tuberosum]
Length=889

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAEW
Sbjct  688  HVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAEW  747

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y+ G   +I+DP LKG++A ECL ++ E A  C+ D G+DRP+M DV+W LEFALQ
Sbjct  748  AFHCYKKGTFDQIIDPYLKGKLAPECLKKFTETAVKCVSDVGVDRPSMGDVLWNLEFALQ  807

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  808  LQESAEECG  816



>ref|XP_002528705.1| kinase, putative [Ricinus communis]
 gb|EEF33694.1| kinase, putative [Ricinus communis]
Length=891

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE++CAR A+ P LP+ +VSLAEW
Sbjct  690  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEIICARPALNPALPKEQVSLAEW  749

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                ++ G + +IVDP LKG+IA EC  ++ E A  C+ D GIDRP+M DV+W LEFALQ
Sbjct  750  AAHCHKKGILDQIVDPYLKGKIAPECFKKFAETAMKCVSDVGIDRPSMGDVLWNLEFALQ  809

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  810  LQESAEESG  818



>ref|XP_010553161.1| PREDICTED: receptor-like protein kinase FERONIA [Tarenaya hassleriana]
Length=852

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYS+GVVLFEVLCAR  + P LP+ +VSLAEW
Sbjct  691  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSYGVVLFEVLCARPPLNPTLPKEQVSLAEW  750

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
              R ++ G++ EI+DP LKG+IA EC  +Y E A  C+ DQGI+RP M DV+W LEFALQ
Sbjct  751  AARCFKKGELEEIIDPYLKGKIAPECFNKYAETAIKCVADQGIERPPMGDVLWNLEFALQ  810

Query  265  LQD  257
            LQ+
Sbjct  811  LQE  813



>ref|XP_004246282.1| PREDICTED: receptor-like protein kinase FERONIA [Solanum lycopersicum]
Length=889

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAEW
Sbjct  688  HVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAEW  747

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y+ G   +I+DP LKG++A ECL ++ E A  C+ D G+DRP+M DV+W LEFALQ
Sbjct  748  AFHCYKKGTFDQIIDPYLKGKLAPECLKKFTETAVKCVSDVGVDRPSMGDVLWNLEFALQ  807

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  808  LQESAEECG  816



>ref|XP_009337788.1| PREDICTED: receptor-like protein kinase FERONIA [Pyrus x bretschneideri]
Length=893

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAEW
Sbjct  691  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAEW  750

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                ++ G +  I+DP+LKG+I  EC  ++ E A  C+ DQ IDRP+M DV+W LEFALQ
Sbjct  751  AAHCHKKGILEHILDPHLKGKITPECFKKFAETAMKCVSDQSIDRPSMGDVLWNLEFALQ  810

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  811  LQESAEESG  819



>gb|KDP21852.1| hypothetical protein JCGZ_00639 [Jatropha curcas]
Length=652

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P L + +VSLAEW
Sbjct  451  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPTLAKEQVSLAEW  510

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                ++ G + +I+DP LKG+IA EC  ++ E A  C+ DQGI+RP+M DV+W LEFALQ
Sbjct  511  AAHCHKKGILDQILDPYLKGKIAPECFKKFAETAMKCVSDQGIERPSMGDVLWNLEFALQ  570

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  571  LQESAEESG  579



>ref|XP_010921463.1| PREDICTED: receptor-like protein kinase ANXUR2 [Elaeis guineensis]
Length=870

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 116/172 (67%), Gaps = 5/172 (3%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P LPR +VSLA+W
Sbjct  687  HVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPTLPREQVSLADW  746

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                   G + +I+DPN+KG+I  ECL ++ E A  CL DQG+DRP M DV+W LEFALQ
Sbjct  747  ALNCQRRGALGDIIDPNVKGKIGPECLKKFAETAEKCLSDQGVDRPYMGDVLWNLEFALQ  806

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAE  110
            LQ+  +       P T E P   L +   DG + + S    GG    S +++
Sbjct  807  LQENFET----GKPVTAEAPS-SLESATSDGNSGSHSPMVIGGGSEVSVDSD  853



>ref|XP_008341792.1| PREDICTED: receptor-like protein kinase FERONIA [Malus domestica]
Length=892

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 101/211 (48%), Positives = 143/211 (68%), Gaps = 17/211 (8%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            H+ST VKGSFGY+DPEYYRR+Q+TEKSDVYSFG VL EVLCAR A+I    + ++SLAEW
Sbjct  696  HISTVVKGSFGYLDPEYYRRQQLTEKSDVYSFGXVLCEVLCARPALIRTAEKKQMSLAEW  755

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             +  +  G + +I+DP+L+G+I + CL +YVEIA +C+ D GI+RP+MNDVVWGLEFALQ
Sbjct  756  TKICHRNGKLDQIIDPSLRGKIGNACLKKYVEIAVSCMHDSGIERPSMNDVVWGLEFALQ  815

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAEKLFR---T  95
            LQ +    GG S               GG  +  + +  D G  F + E + +L +   +
Sbjct  816  LQQSV---GGDSNSND---------EMGGGDDIXSVTGSDVG--FISWEESSELKKSRVS  861

Query  94   KssatatstsddSLRGQSHTIFSELSNQLGR  2
            K+S+   ST+++S++G S T+FSE+++  GR
Sbjct  862  KTSSDHNSTTNESIKGMSGTVFSEINDPNGR  892



>ref|XP_010463957.1| PREDICTED: receptor-like protein kinase ANXUR1 [Camelina sativa]
Length=853

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 104/139 (75%), Gaps = 5/139 (4%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HV+T VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ PNLP+ +VSL +W
Sbjct  673  HVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPNLPKEQVSLGDW  732

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                   G + +I+DPNLKG+I SECL ++ + A  CL D G++RP M DV+W LEFALQ
Sbjct  733  AMNCKRKGTLDDIIDPNLKGKINSECLKKFADTAEKCLSDSGLERPTMGDVLWNLEFALQ  792

Query  265  LQDAADKRGGLSPPRTPER  209
            LQ+ AD        RTP R
Sbjct  793  LQETAD-----GTRRTPNR  806



>ref|XP_008341797.1| PREDICTED: receptor-like protein kinase FERONIA [Malus domestica]
Length=892

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 101/211 (48%), Positives = 143/211 (68%), Gaps = 17/211 (8%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            H+ST VKGSFGY+DPEYYRR+Q+TEKSDVYSFG VL EVLCAR A+I    + ++SLAEW
Sbjct  696  HISTVVKGSFGYLDPEYYRRQQLTEKSDVYSFGXVLCEVLCARPALIRTAEKKQMSLAEW  755

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             +  +  G + +I+DP+L+G+I + CL +YVEIA +C+ D GI+RP+MNDVVWGLEFALQ
Sbjct  756  TKICHRNGKLDQIIDPSLRGKIGNACLKKYVEIAVSCMHDSGIERPSMNDVVWGLEFALQ  815

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAEKLFR---T  95
            LQ +    GG S               GG  +  + +  D G  F + E + +L +   +
Sbjct  816  LQQSV---GGDSNSND---------EMGGGDDIGSVTGSDVG--FISWEESSELKKSRVS  861

Query  94   KssatatstsddSLRGQSHTIFSELSNQLGR  2
            K+S+   ST+++S++G S T+FSE+++  GR
Sbjct  862  KTSSDHNSTTNESIKGMSGTVFSEINDPNGR  892



>gb|KJB38065.1| hypothetical protein B456_006G235700 [Gossypium raimondii]
Length=895

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAEW
Sbjct  692  HVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAEW  751

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                ++ G + +I+DP LKG+IA EC  ++ E A  C+ DQGI+RP+M DV+W LEFALQ
Sbjct  752  AAHCHKKGILDQIMDPYLKGKIAPECFKKFAETAMKCVADQGIERPSMGDVLWNLEFALQ  811

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  812  LQESAEESG  820



>ref|XP_010043538.1| PREDICTED: receptor-like protein kinase FERONIA [Eucalyptus grandis]
 ref|XP_010043545.1| PREDICTED: receptor-like protein kinase FERONIA [Eucalyptus grandis]
 gb|KCW88392.1| hypothetical protein EUGRSUZ_A00782 [Eucalyptus grandis]
Length=897

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAEW
Sbjct  695  HVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAEW  754

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                ++ G +  I+DP+LKG+I+ EC  ++ E A  C+ DQGI+RP+M DV+W LEFALQ
Sbjct  755  AAHCHKKGILEHIMDPHLKGKISPECFKKFAETAMKCVNDQGIERPSMGDVLWNLEFALQ  814

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  815  LQESAEESG  823



>ref|XP_010494105.1| PREDICTED: receptor-like protein kinase ANXUR2 [Camelina sativa]
 ref|XP_010494106.1| PREDICTED: receptor-like protein kinase ANXUR2 [Camelina sativa]
Length=859

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 117/174 (67%), Gaps = 7/174 (4%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HV+T VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P+LP+ +VSL +W
Sbjct  678  HVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPSLPKEQVSLGDW  737

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                   G + +I+DPNLKG+I  ECL ++ + A  CL D G+DRP M DV+W LEFALQ
Sbjct  738  AMNCKRKGTLEDIIDPNLKGKINPECLKKFADTAEKCLSDSGLDRPTMGDVLWNLEFALQ  797

Query  265  LQDAADKRGGLSPPRTPERPGFPL-LAKGGDGEAANKSDE--DYGGAFTTSENA  113
            LQ+ AD        RTP   G    L +GG G A N   E  D     ++ EN+
Sbjct  798  LQETADG----PRHRTPSHGGGSEDLGRGGGGVAVNIDIEENDVADDLSSEENS  847



>ref|XP_010455191.1| PREDICTED: receptor-like protein kinase ANXUR2 [Camelina sativa]
Length=858

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 118/174 (68%), Gaps = 7/174 (4%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HV+T VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P+LP+ +VSL +W
Sbjct  677  HVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPSLPKEQVSLGDW  736

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                   G + +I+DPNLKG+I  ECL ++ + A  CL D G+DRP M DV+W LEFALQ
Sbjct  737  AMNCKRKGTLEDIIDPNLKGKINPECLKKFADTAEKCLSDSGLDRPTMGDVLWNLEFALQ  796

Query  265  LQDAADKRGGLSPPRTPERPGFPL-LAKGGDGEAANKSDE--DYGGAFTTSENA  113
            LQ+ AD +      RTP   G    L +GG   A N + E  D     ++ EN+
Sbjct  797  LQETADGQRN----RTPSHGGGSEDLGRGGGAVAVNVAIEENDVADDLSSEENS  846



>ref|XP_008660180.1| PREDICTED: receptor-like protein kinase FERONIA [Zea mays]
 gb|AFW88468.1| putative receptor-like protein kinase family protein [Zea mays]
Length=888

 Score =   182 bits (463),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 111/148 (75%), Gaps = 2/148 (1%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P LP+ +VSLAEW
Sbjct  692  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPTLPKEEVSLAEW  751

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                 + G + +IVDP LKG+IA +C  ++ E A  C+ DQ IDRP+M DV+W LEFALQ
Sbjct  752  ALHCQKKGVLDQIVDPYLKGKIAPQCFKKFAETAEKCVSDQSIDRPSMGDVLWNLEFALQ  811

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKG  182
            +Q++A++ G L    + E  G PL+  G
Sbjct  812  MQESAEESGSLGCGMSDE--GTPLVMVG  837



>ref|XP_002271113.1| PREDICTED: receptor-like protein kinase ANXUR1 [Vitis vinifera]
Length=857

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 115/172 (67%), Gaps = 8/172 (5%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P+LP+ +VSLA+W
Sbjct  674  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPSLPKEQVSLADW  733

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                 + G + +I+DP+LKG I  ECL ++ + A  CL D G+DRP+M D++W LEFALQ
Sbjct  734  ALHCQKKGILEDIIDPHLKGTINPECLKKFADTAEKCLSDHGLDRPSMGDILWNLEFALQ  793

Query  265  LQDAADKRGGLSPPRTPERPGF--------PLLAKGGDGEAANKSDEDYGGA  134
            LQ+  D    +S    PE             +L+ G D    N+  +D  G+
Sbjct  794  LQENPDGAKAVSERENPEEFNHNNIMGMHRNMLSLGSDDSDMNEVSDDLNGS  845



>gb|KCW52050.1| hypothetical protein EUGRSUZ_J01490 [Eucalyptus grandis]
Length=682

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 121/176 (69%), Gaps = 5/176 (3%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVSTAVKG+FGY+DPEYYRR+++T+KSDVYSFGVVLFEVLCAR AV    P  ++SLAEW
Sbjct  488  HVSTAVKGTFGYLDPEYYRRQRLTDKSDVYSFGVVLFEVLCARPAVSRMAPVEQISLAEW  547

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             +   ++G V E+VDP+LKG IA ECL ++ EIA +CL+D+G  RP+MNDVVWGL FALQ
Sbjct  548  AQSCCKSGSVEEMVDPHLKGAIALECLNRFCEIAMSCLQDEGAKRPSMNDVVWGLNFALQ  607

Query  265  LQDAAD----KRGGLSPPRTPERPGFPLLAKG-GDGEAANKSDEDYGGAFTTSENA  113
            LQ + +       G+S   +          +G G  EA N SD D G   ++ E A
Sbjct  608  LQVSTELEVKDHAGVSVHDSDGSDHDAASIRGSGSNEAINTSDSDSGRWKSSRETA  663



>ref|XP_011079535.1| PREDICTED: receptor-like protein kinase ANXUR1 [Sesamum indicum]
Length=894

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 104/143 (73%), Gaps = 2/143 (1%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P+LP+ +VSLA+W
Sbjct  704  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPSLPKEQVSLADW  763

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
              R      + +I+DP LKG+I  ECL ++ E A  CL D G+DRP M DV+W LE ALQ
Sbjct  764  ALRCARNKTLEDIIDPQLKGKINPECLKKFAETAEKCLADHGVDRPTMGDVLWSLELALQ  823

Query  265  LQDAADKRGGLSPPRTPERPGFP  197
            LQD  +  GG +  RT  R   P
Sbjct  824  LQD--NHEGGSTTSRTKNRKNNP  844



>dbj|BAJ91215.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=402

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 109/148 (74%), Gaps = 2/148 (1%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P L + +VSLAEW
Sbjct  206  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPTLAKEEVSLAEW  265

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                 + G + +IVDP LKG+I  +C  ++ E A  C+ D GI+RP+M DV+W LEFALQ
Sbjct  266  ALHCQKKGILDQIVDPYLKGKIVPQCFKKFAETAEKCVADNGIERPSMGDVLWNLEFALQ  325

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKG  182
            +Q++A++ G +    + E  G PL+  G
Sbjct  326  MQESAEESGSIGCGMSDE--GTPLVMVG  351



>ref|XP_010529939.1| PREDICTED: receptor-like protein kinase FERONIA [Tarenaya hassleriana]
Length=892

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAEW
Sbjct  689  HVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAEW  748

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y+ G + +IVDP LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFA+Q
Sbjct  749  APHCYKKGMLDQIVDPFLKGKITPECFKKFAETAMKCVSDQGIERPSMGDVLWNLEFAMQ  808

Query  265  LQDAADKRG  239
            LQ++ ++ G
Sbjct  809  LQESVEESG  817



>ref|XP_009365906.1| PREDICTED: receptor-like protein kinase FERONIA isoform X4 [Pyrus 
x bretschneideri]
Length=902

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 97/208 (47%), Positives = 139/208 (67%), Gaps = 11/208 (5%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            H++T  KGSFGY+DPEYYR  Q+TEKSDVYSFGVVL EVLCAR A++    + ++SLA W
Sbjct  706  HITTVAKGSFGYLDPEYYRLNQLTEKSDVYSFGVVLCEVLCARPALVRGPDKKQMSLAHW  765

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             +  Y  G++ +I+DPNL+G+I + C+ ++ +IA +C+ D GIDRP+MNDVVWGLEFALQ
Sbjct  766  AKSCYLKGELDQIMDPNLQGKIGTACMNKFADIAMSCMHDNGIDRPSMNDVVWGLEFALQ  825

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAEKLFRTKss  86
            L    +++G L         GF +  KG D  A     +  G + +  E+++ + +T  S
Sbjct  826  LHQ-KEEQGDL---------GFDIEKKGEDEVAVMNDIDALGFSSSLGESSDWMTKTH-S  874

Query  85   atatstsddSLRGQSHTIFSELSNQLGR  2
            +   ST++D ++G S TIFS + NQ GR
Sbjct  875  SEQNSTTNDPIKGMSRTIFSGIDNQDGR  902



>ref|XP_009365902.1| PREDICTED: receptor-like protein kinase FERONIA isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009365905.1| PREDICTED: receptor-like protein kinase FERONIA isoform X3 [Pyrus 
x bretschneideri]
Length=902

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 97/208 (47%), Positives = 139/208 (67%), Gaps = 11/208 (5%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            H++T  KGSFGY+DPEYYR  Q+TEKSDVYSFGVVL EVLCAR A++    + ++SLA W
Sbjct  706  HITTVAKGSFGYLDPEYYRLNQLTEKSDVYSFGVVLCEVLCARPALVRGPDKKQMSLAHW  765

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             +  Y  G++ +I+DPNL+G+I + C+ ++ +IA +C+ D GIDRP+MNDVVWGLEFALQ
Sbjct  766  AKSCYLKGELDQIMDPNLQGKIGTACMNKFADIAMSCMHDNGIDRPSMNDVVWGLEFALQ  825

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAEKLFRTKss  86
            L    +++G L         GF +  KG D  A     +  G + +  E+++ + +T  S
Sbjct  826  LHQ-KEEQGDL---------GFDIEKKGEDEVAVMNDIDALGFSSSLGESSDWMTKTH-S  874

Query  85   atatstsddSLRGQSHTIFSELSNQLGR  2
            +   ST++D ++G S TIFS + NQ GR
Sbjct  875  SEQNSTTNDPIKGMSRTIFSGIDNQDGR  902



>ref|XP_010252025.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=886

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 103/132 (78%), Gaps = 1/132 (1%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR Q+TEKSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAEW
Sbjct  689  HVSTVVKGSFGYLDPEYFRRLQLTEKSDVYSFGVVLFEILCARPALSPTLPKEQVSLAEW  748

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                 + G + E +DP LKG+IA EC  ++ EIA  C+ DQG DRPAM DV+W LEFALQ
Sbjct  749  AVHCQKKGILEEFIDPYLKGKIAPECFKKFAEIAEKCVSDQGSDRPAMGDVLWNLEFALQ  808

Query  265  LQDAADKRGGLS  230
            LQ++A+  GG S
Sbjct  809  LQESAES-GGFS  819



>ref|XP_006646366.1| PREDICTED: receptor-like protein kinase FERONIA-like, partial 
[Oryza brachyantha]
Length=824

 Score =   181 bits (459),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 112/148 (76%), Gaps = 2/148 (1%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P L + +VSLAEW
Sbjct  628  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPTLAKEEVSLAEW  687

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                 + G + +IVDP+LKG+IA +C  ++ E A  C+ D+GIDRP+M DV+W LEFALQ
Sbjct  688  ALHCQKKGILDQIVDPHLKGKIAPQCFKKFAETAEKCVSDEGIDRPSMGDVLWNLEFALQ  747

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKG  182
            +Q++A++ G +    + E  G PL+  G
Sbjct  748  MQESAEESGSIGCGMSDE--GTPLVMTG  773



>ref|XP_003609098.1| FERONIA receptor-like kinase [Medicago truncatula]
Length=893

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFEVLCAR A+ P L + +VSLAEW
Sbjct  692  HVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPALNPTLAKEQVSLAEW  751

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y+ G + +I DP LKG+IA EC  ++ E A  C+ DQGI+RP+M DV+W LEFALQ
Sbjct  752  AAHCYKKGILDQITDPYLKGKIAPECFKKFAETAMKCVNDQGIERPSMGDVLWNLEFALQ  811

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  812  LQESAEESG  820



>gb|KEH23293.1| feronia receptor-like kinase [Medicago truncatula]
Length=899

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFEVLCAR A+ P L + +VSLAEW
Sbjct  698  HVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPALNPTLAKEQVSLAEW  757

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y+ G + +I DP LKG+IA EC  ++ E A  C+ DQGI+RP+M DV+W LEFALQ
Sbjct  758  AAHCYKKGILDQITDPYLKGKIAPECFKKFAETAMKCVNDQGIERPSMGDVLWNLEFALQ  817

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  818  LQESAEESG  826



>ref|XP_009365907.1| PREDICTED: receptor-like protein kinase FERONIA [Pyrus x bretschneideri]
Length=899

 Score =   182 bits (461),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 97/208 (47%), Positives = 139/208 (67%), Gaps = 11/208 (5%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            H++T  KGSFGY+DPEYYR  Q+TEKSDVYSFGVVL EVLCAR A++    + ++SLA W
Sbjct  703  HITTVAKGSFGYLDPEYYRLNQLTEKSDVYSFGVVLCEVLCARPALVRGPDKKQMSLAHW  762

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             +  Y  G++ +I+DPNL+G+I + C+ ++ +IA +C+ D GIDRP+MNDVVWGLEFALQ
Sbjct  763  AKSCYLKGELDQIMDPNLQGKIGTACMNKFADIAMSCMHDNGIDRPSMNDVVWGLEFALQ  822

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAEKLFRTKss  86
            L    +++G L         GF +  KG D  A     +  G + +  E+++ + +T  S
Sbjct  823  LHQ-KEEQGDL---------GFDIEKKGEDEVAVMNDIDALGFSSSLGESSDWMTKTN-S  871

Query  85   atatstsddSLRGQSHTIFSELSNQLGR  2
            +   ST++D ++G S TIFS + NQ GR
Sbjct  872  SEQNSTTNDPIKGMSRTIFSGIDNQDGR  899



>ref|XP_009365903.1| PREDICTED: receptor-like protein kinase FERONIA isoform X2 [Pyrus 
x bretschneideri]
Length=902

 Score =   181 bits (460),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 97/208 (47%), Positives = 139/208 (67%), Gaps = 11/208 (5%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            H++T  KGSFGY+DPEYYR  Q+TEKSDVYSFGVVL EVLCAR A++    + ++SLA W
Sbjct  706  HITTVAKGSFGYLDPEYYRLNQLTEKSDVYSFGVVLCEVLCARPALVRGPDKKQMSLAHW  765

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             +  Y  G++ +I+DPNL+G+I + C+ ++ +IA +C+ D GIDRP+MNDVVWGLEFALQ
Sbjct  766  AKSCYLKGELDQIMDPNLQGKIGTACMNKFADIAMSCMHDNGIDRPSMNDVVWGLEFALQ  825

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAEKLFRTKss  86
            L    +++G L         GF +  KG D  A     +  G + +  E+++ + +T  S
Sbjct  826  LHQ-KEEQGDL---------GFDIEKKGEDEVAVMNDIDALGFSSSLGESSDWMTKTH-S  874

Query  85   atatstsddSLRGQSHTIFSELSNQLGR  2
            +   ST++D ++G S TIFS + NQ GR
Sbjct  875  SEQNSTTNDPIKGMSRTIFSGIDNQDGR  902



>ref|XP_009397265.1| PREDICTED: probable receptor-like protein kinase At5g61350 [Musa 
acuminata subsp. malaccensis]
Length=868

 Score =   181 bits (460),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 103/130 (79%), Gaps = 0/130 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVSTAVKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR+A+ P LPR +V+LAEW
Sbjct  697  HVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARSAINPALPREQVNLAEW  756

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
              + +  G + +I+DP+L G I+   L +YVE A  CL D G+DRP+M DV+W LE+ALQ
Sbjct  757  AMQCHRKGQLEKIIDPHLVGTISPASLKKYVEAAEKCLADHGVDRPSMGDVLWNLEYALQ  816

Query  265  LQDAADKRGG  236
            LQDA  +  G
Sbjct  817  LQDAVMEHPG  826



>ref|XP_011095158.1| PREDICTED: receptor-like protein kinase FERONIA [Sesamum indicum]
Length=883

 Score =   181 bits (460),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYS+GVVLFE+LCAR A+ P LP+ +VSLAEW
Sbjct  684  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSYGVVLFEILCARPALNPTLPKEQVSLAEW  743

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             +  ++ G + +I+DP LKG+IA EC  ++ E A  C+ D G DRP+M DV+W LEFALQ
Sbjct  744  AQHCHKKGILDQIIDPYLKGKIAPECFKKFAETAVKCVSDVGTDRPSMGDVLWNLEFALQ  803

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  804  LQESAEESG  812



>ref|XP_004984479.1| PREDICTED: receptor-like protein kinase FERONIA-like [Setaria 
italica]
Length=884

 Score =   181 bits (460),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 111/148 (75%), Gaps = 2/148 (1%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P L + +VSLAEW
Sbjct  688  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPTLAKEEVSLAEW  747

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                 + G + +IVDP LKG+IA +C  ++ E A  C+ DQGIDRP+M DV+W LEFALQ
Sbjct  748  ALHCQKKGILDQIVDPYLKGKIAPQCFKKFAETAEKCVSDQGIDRPSMGDVLWNLEFALQ  807

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKG  182
            +Q++A++ G L    + E  G PL+  G
Sbjct  808  MQESAEESGSLGCGMSDE--GTPLVMVG  833



>ref|XP_008364006.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
FERONIA [Malus domestica]
Length=747

 Score =   180 bits (456),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 100/125 (80%), Gaps = 0/125 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAEW
Sbjct  547  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAEW  606

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                ++ G +  I+DP+LKG+I  EC  ++ E A  C+ DQ IDRP+M DV+W LEFALQ
Sbjct  607  AAHCHKKGILEHILDPHLKGKITPECFKKFAETAMKCVSDQSIDRPSMGDVLWNLEFALQ  666

Query  265  LQDAA  251
            LQ++A
Sbjct  667  LQESA  671



>ref|XP_010099327.1| Receptor-like protein kinase FERONIA [Morus notabilis]
 gb|EXB77673.1| Receptor-like protein kinase FERONIA [Morus notabilis]
Length=950

 Score =   182 bits (461),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 133/213 (62%), Gaps = 14/213 (7%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGS GY+DPEYYRR+Q++EKSDVYSFGVVL EVLC R  ++ N  + +VSLAEW
Sbjct  747  HVSTVVKGSIGYLDPEYYRRQQLSEKSDVYSFGVVLCEVLCGRPPIMRNAEKRQVSLAEW  806

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             +  Y  G + +I+D NL  +I  ECL +Y EIA NC+ D GI+RP+MNDVVWGLEFA+Q
Sbjct  807  AQHCYRNGTLHQIIDRNLTSKIVPECLKKYSEIAVNCMHDNGIERPSMNDVVWGLEFAMQ  866

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTS-----ENAEKLF  101
            LQ  A+           +R G  ++   G+ E A  ++ +  G FT +     E    + 
Sbjct  867  LQQNAEDN---------DRIGGAIMEAKGEDEVAFMNNNNSDGTFTYTWEESLELKSSVM  917

Query  100  RTKssatatstsddSLRGQSHTIFSELSNQLGR  2
               SS+   S + +S++  S  +FSE+ +  GR
Sbjct  918  TKISSSEQGSITVESMKEMSGAVFSEIKDPKGR  950



>ref|XP_011016728.1| PREDICTED: receptor-like protein kinase FERONIA [Populus euphratica]
Length=893

 Score =   181 bits (459),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAEW
Sbjct  693  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAEW  752

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                ++ G + +I+DP LKG+IA EC  ++ E A  C+ DQ IDRP+M DV+W LEFALQ
Sbjct  753  AAHCHKKGILDQILDPYLKGKIAPECFKKFAETAMKCVSDQSIDRPSMGDVLWNLEFALQ  812

Query  265  LQDAAD  248
            LQ++A+
Sbjct  813  LQESAE  818



>ref|XP_010678455.1| PREDICTED: probable receptor-like protein kinase At5g61350 [Beta 
vulgaris subsp. vulgaris]
Length=896

 Score =   181 bits (459),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVSTAVKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVL EVL AR A+ P LPR++V+LAEW
Sbjct  716  HVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLLEVLTARPAINPALPRDQVNLAEW  775

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
            G  +Y  G++ +IVDPNL+G I+S  L +YVE A  CL + G+DRP+M DV+W LE+ALQ
Sbjct  776  GMSNYRKGNLEKIVDPNLQGTISSGSLKKYVEAAEKCLAEYGVDRPSMGDVLWNLEYALQ  835

Query  265  LQDAADK  245
            LQ+A+ K
Sbjct  836  LQEASSK  842



>ref|XP_006395027.1| hypothetical protein EUTSA_v10003639mg [Eutrema salsugineum]
 gb|ESQ32313.1| hypothetical protein EUTSA_v10003639mg [Eutrema salsugineum]
Length=858

 Score =   181 bits (458),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HV+T VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P+LP+ +VSL +W
Sbjct  678  HVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPSLPKEQVSLGDW  737

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                   G + EIVDPNLKG+I  ECL ++ + A  CL D G+DRP M DV+W LEFALQ
Sbjct  738  AMNCKRKGTLEEIVDPNLKGKINPECLKKFADTAEKCLSDSGLDRPTMGDVLWNLEFALQ  797

Query  265  LQDAAD  248
            LQ+ AD
Sbjct  798  LQETAD  803



>gb|KCW52041.1| hypothetical protein EUGRSUZ_J01482 [Eucalyptus grandis]
Length=856

 Score =   181 bits (458),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 115/171 (67%), Gaps = 24/171 (14%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVSTAVKG+FGY+DPEYYRR+++T+KSDVYSFGVVLFEVLCAR AV    P  ++SLAEW
Sbjct  691  HVSTAVKGTFGYLDPEYYRRQRLTDKSDVYSFGVVLFEVLCARPAVSRMAPMEQISLAEW  750

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             +   ++G V E+VDP+LKG IA ECL ++ EIA +CL+D+G  RP+MNDVVWGL FALQ
Sbjct  751  AQSCCKSGSVEEMVDPHLKGAIALECLNKFCEIAMSCLQDEGAKRPSMNDVVWGLNFALQ  810

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENA  113
            LQ + +                         EA N SD D GG  ++ E A
Sbjct  811  LQVSTEL------------------------EAINTSDSDSGGWKSSRETA  837



>ref|XP_010242732.1| PREDICTED: receptor-like protein kinase ANXUR1 [Nelumbo nucifera]
Length=858

 Score =   181 bits (458),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 105/139 (76%), Gaps = 3/139 (2%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P+LP+ +VSLA+W
Sbjct  678  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPSLPKEQVSLADW  737

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                   G + +I+DP LKG+I  ECL ++ E A  CL D G+DRP+M DV+W LEFALQ
Sbjct  738  ALHCQARGTLEDIIDPELKGKITPECLKKFAETAEKCLSDHGVDRPSMGDVLWNLEFALQ  797

Query  265  LQDAADKRGGLSPPRTPER  209
            LQ+  D   G+ P +  E+
Sbjct  798  LQENPD---GVKPEKDEEK  813



>ref|XP_010034435.1| PREDICTED: receptor-like protein kinase FERONIA [Eucalyptus grandis]
Length=883

 Score =   181 bits (458),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 121/176 (69%), Gaps = 5/176 (3%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVSTAVKG+FGY+DPEYYRR+++T+KSDVYSFGVVLFEVLCAR AV    P  ++SLAEW
Sbjct  689  HVSTAVKGTFGYLDPEYYRRQRLTDKSDVYSFGVVLFEVLCARPAVSRMAPVEQISLAEW  748

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             +   ++G V E+VDP+LKG IA ECL ++ EIA +CL+D+G  RP+MNDVVWGL FALQ
Sbjct  749  AQSCCKSGSVEEMVDPHLKGAIALECLNRFCEIAMSCLQDEGAKRPSMNDVVWGLNFALQ  808

Query  265  LQDAAD----KRGGLSPPRTPERPGFPLLAKG-GDGEAANKSDEDYGGAFTTSENA  113
            LQ + +       G+S   +          +G G  EA N SD D G   ++ E A
Sbjct  809  LQVSTELEVKDHAGVSVHDSDGSDHDAASIRGSGSNEAINTSDSDSGRWKSSRETA  864



>ref|XP_007140079.1| hypothetical protein PHAVU_008G082400g [Phaseolus vulgaris]
 gb|ESW12073.1| hypothetical protein PHAVU_008G082400g [Phaseolus vulgaris]
Length=898

 Score =   181 bits (459),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE+LCAR A+ P L + +VSLAEW
Sbjct  697  HVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARPALNPALAKEQVSLAEW  756

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y  G + +I+DP LKG+IA EC  ++ E A  C+ DQGI+RP+M DV+W LEFALQ
Sbjct  757  AAHCYLKGTLDQIIDPYLKGKIAPECFKKFAETAMKCVADQGIERPSMGDVLWNLEFALQ  816

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  817  LQESAEESG  825



>gb|EEC76216.1| hypothetical protein OsI_13615 [Oryza sativa Indica Group]
Length=809

 Score =   180 bits (456),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 104/132 (79%), Gaps = 0/132 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVSTAVKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P LPR++V+LAEW
Sbjct  648  HVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPAINPTLPRDQVNLAEW  707

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             R  +  G++++I+DP++ GQI  + L  + E A  CL D G+DRP+M DV+W LEFALQ
Sbjct  708  ARTWHRKGELNKIIDPHISGQIRPDSLEIFAEAAEKCLADYGVDRPSMGDVLWKLEFALQ  767

Query  265  LQDAADKRGGLS  230
            LQ+  D   G S
Sbjct  768  LQEKGDIVDGTS  779



>ref|XP_002463853.1| hypothetical protein SORBIDRAFT_01g007450 [Sorghum bicolor]
 gb|EER90851.1| hypothetical protein SORBIDRAFT_01g007450 [Sorghum bicolor]
Length=839

 Score =   180 bits (457),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVSTAVKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P LPR++V+LAEW
Sbjct  679  HVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPAINPALPRDQVNLAEW  738

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y  G++S+I+DP++ GQI  + L  + E A  CL D G+DRP+M DV+W LEFALQ
Sbjct  739  ALTWYRKGELSKIIDPHIAGQIRPDSLEMFAEAAEKCLADYGVDRPSMGDVLWKLEFALQ  798

Query  265  LQDAADKRGGLS  230
            LQ+  D   G S
Sbjct  799  LQEKGDVVDGTS  810



>ref|XP_004302537.1| PREDICTED: receptor-like protein kinase FERONIA [Fragaria vesca 
subsp. vesca]
Length=883

 Score =   181 bits (458),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAEW
Sbjct  684  HVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAEW  743

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                ++ G + +I+DP LKG+I  EC  ++ E A  C+ DQ IDRP+M DV+W LEFALQ
Sbjct  744  AAHCHKKGMLDQILDPYLKGKITPECFRKFAETAMKCVSDQSIDRPSMGDVLWNLEFALQ  803

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  804  LQESAEESG  812



>ref|XP_010034437.1| PREDICTED: receptor-like protein kinase FERONIA [Eucalyptus grandis]
Length=917

 Score =   181 bits (459),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 119/177 (67%), Gaps = 7/177 (4%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVSTAVKG+FGY+DPEY+R +++T+KSDVYSFGVVLFEVLCAR AV    P  ++SLAEW
Sbjct  718  HVSTAVKGTFGYLDPEYFRHQRLTDKSDVYSFGVVLFEVLCARPAVSRMAPMEQISLAEW  777

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             +   ++G V EIVDP+LKG I  ECL ++ EIA +CL+D+G  RP+MNDVVWGL FALQ
Sbjct  778  AQSCCKSGAVEEIVDPHLKGSITPECLNKFCEIAMSCLQDKGAKRPSMNDVVWGLNFALQ  837

Query  265  LQ-----DAADKRG-GLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENA  113
            LQ     +  D  G  +      +     +   G D EA N SD D GG  ++ E A
Sbjct  838  LQVSTELEVTDHVGVSVHDSNDSDHDAASIRGSGSD-EAINTSDSDSGGWKSSRETA  893



>gb|KJB71481.1| hypothetical protein B456_011G124900 [Gossypium raimondii]
Length=742

 Score =   179 bits (455),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAEW
Sbjct  541  HVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAEW  600

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                ++ G + +I+DP LKG+I  EC  ++ E A  C+ D+GI+RP+M DV+W LEFALQ
Sbjct  601  AAHCHKKGILDQIMDPYLKGKITPECFKKFAETAMKCVADEGIERPSMGDVLWNLEFALQ  660

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  661  LQESAEESG  669



>ref|XP_008370279.1| PREDICTED: receptor-like protein kinase FERONIA [Malus domestica]
Length=891

 Score =   181 bits (458),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 100/125 (80%), Gaps = 0/125 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAEW
Sbjct  691  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAEW  750

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                ++ G +  I+DP+LKG+I  EC  ++ E A  C+ DQ IDRP+M DV+W LEFALQ
Sbjct  751  AAHCHKKGILEHILDPHLKGKITPECFKKFAETAMKCVSDQSIDRPSMGDVLWNLEFALQ  810

Query  265  LQDAA  251
            LQ++A
Sbjct  811  LQESA  815



>ref|XP_002323088.2| kinase family protein [Populus trichocarpa]
 gb|EEF04849.2| kinase family protein [Populus trichocarpa]
Length=894

 Score =   181 bits (458),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAEW
Sbjct  694  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAEW  753

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                ++ G + +I+DP LKG+I  EC  ++ E A  C+ DQ IDRP+M DV+W LEFALQ
Sbjct  754  AAHCHKKGILDQILDPYLKGKITPECFKKFAETAMKCVSDQSIDRPSMGDVLWNLEFALQ  813

Query  265  LQDAADKRG  239
            LQ++A+  G
Sbjct  814  LQESAEDGG  822



>ref|XP_009129817.1| PREDICTED: receptor-like protein kinase ANXUR2 [Brassica rapa]
Length=854

 Score =   180 bits (457),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P+LP+ +VSL +W
Sbjct  672  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPSLPKEQVSLGDW  731

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                   G++ +I+DPNLKG+I +ECL ++ + A  CL D G+DRP+M DV+W LEFALQ
Sbjct  732  ALNCKRKGNLDDIIDPNLKGKINAECLKKFADTAEKCLSDSGLDRPSMGDVLWNLEFALQ  791

Query  265  LQDAAD  248
            +Q+ AD
Sbjct  792  VQETAD  797



>emb|CDY05602.1| BnaC02g39350D [Brassica napus]
Length=854

 Score =   180 bits (457),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P+LP+ +VSL +W
Sbjct  672  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPSLPKEQVSLGDW  731

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                   G++ +I+DPNLKG+I +ECL ++ + A  CL D G+DRP+M DV+W LEFALQ
Sbjct  732  ALNCKRKGNLDDIIDPNLKGKINAECLKKFADTAEKCLSDSGLDRPSMGDVLWNLEFALQ  791

Query  265  LQDAAD  248
            +Q+ AD
Sbjct  792  VQETAD  797



>ref|NP_001050022.1| Os03g0333200 [Oryza sativa Japonica Group]
 gb|ABF95782.1| protein kinase family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11936.1| Os03g0333200 [Oryza sativa Japonica Group]
 gb|EEE59005.1| hypothetical protein OsJ_10725 [Oryza sativa Japonica Group]
Length=893

 Score =   181 bits (458),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFEVLCAR A+ P L + +VSLAEW
Sbjct  697  HVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPALNPTLAKEEVSLAEW  756

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                 + G + +IVDP+LKG+IA +C  ++ E A  C+ DQGIDRP+M DV+W LEFALQ
Sbjct  757  ALHCQKKGILDQIVDPHLKGKIAPQCFKKFAETAEKCVSDQGIDRPSMGDVLWNLEFALQ  816

Query  265  LQDAADKRGGL  233
            +Q++A++ G L
Sbjct  817  MQESAEESGSL  827



>ref|XP_010938035.1| PREDICTED: receptor-like protein kinase FERONIA [Elaeis guineensis]
Length=891

 Score =   181 bits (458),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 103/131 (79%), Gaps = 0/131 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P LP+ +VSLAEW
Sbjct  694  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPTLPKEQVSLAEW  753

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                 + G + +I+DP L+G IA +C  ++ E A  C+ DQGI+RP+M DV+W LEFALQ
Sbjct  754  ALHCQKKGILDQIIDPYLRGNIAPQCFKKFAETAEKCVADQGIERPSMGDVLWNLEFALQ  813

Query  265  LQDAADKRGGL  233
            LQ+ A++ G L
Sbjct  814  LQEGAEENGSL  824



>ref|NP_187120.1| receptor-like protein kinase ANXUR1 [Arabidopsis thaliana]
 sp|Q9SR05.1|ANX1_ARATH RecName: Full=Receptor-like protein kinase ANXUR1; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF04910.1|AC011437_25 putative protein kinase [Arabidopsis thaliana]
 gb|AEE74120.1| receptor-like protein kinase ANXUR1 [Arabidopsis thaliana]
Length=850

 Score =   180 bits (456),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 119/173 (69%), Gaps = 7/173 (4%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HV+T VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P+LP+ +VSL +W
Sbjct  673  HVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPSLPKEQVSLGDW  732

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                   G++ +I+DPNLKG+I +ECL ++ + A  CL D G++RP M DV+W LEFALQ
Sbjct  733  AMNCKRKGNLEDIIDPNLKGKINAECLKKFADTAEKCLNDSGLERPTMGDVLWNLEFALQ  792

Query  265  LQDAADKRGGLSPPRTPERPGFPL-LAKGGDGEAANKSDEDYGGAFTTSENAE  110
            LQ+ AD     +  RTP   G    L +G  G A N +  D     ++ +N E
Sbjct  793  LQETADG----TRHRTPNNGGSSEDLGRG--GMAVNVAGRDDVSDLSSEDNTE  839



>ref|XP_009370899.1| PREDICTED: receptor-like protein kinase FERONIA [Pyrus x bretschneideri]
 ref|XP_009370904.1| PREDICTED: receptor-like protein kinase FERONIA [Pyrus x bretschneideri]
Length=892

 Score =   180 bits (457),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 100/125 (80%), Gaps = 0/125 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAEW
Sbjct  691  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAEW  750

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                ++ G +  I+DP+LKG+I  EC  ++ E A  C+ DQ IDRP+M DV+W LEFALQ
Sbjct  751  AAHCHKKGILEHILDPHLKGKITPECFKKFAETAMKCVSDQSIDRPSMGDVLWNLEFALQ  810

Query  265  LQDAA  251
            LQ++A
Sbjct  811  LQESA  815



>emb|CDY33885.1| BnaA02g31020D [Brassica napus]
Length=841

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P+LP+ +VSL +W
Sbjct  659  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPSLPKEQVSLGDW  718

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                   G++ +I+DPNLKG+I +ECL ++ + A  CL D G+DRP+M DV+W LEFALQ
Sbjct  719  ALNCKRKGNLDDIIDPNLKGKINAECLKKFADTAEKCLSDSGLDRPSMGDVLWNLEFALQ  778

Query  265  LQDAAD  248
            +Q+ AD
Sbjct  779  VQETAD  784



>emb|CDP06378.1| unnamed protein product [Coffea canephora]
Length=889

 Score =   180 bits (457),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAEW
Sbjct  685  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPALPKEQVSLAEW  744

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y+ G + +++DP LKG+IA+EC  +  E A  C+ D G DRP+M DV+W LEFALQ
Sbjct  745  ALHCYKKGILDQVMDPYLKGKIAAECFKKIAETAVKCVADVGTDRPSMGDVLWNLEFALQ  804

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  805  LQESAEESG  813



>gb|KJB42941.1| hypothetical protein B456_007G175600 [Gossypium raimondii]
Length=825

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGS GYVDPEYYR++Q+TEKSDVYSFGVVLFEVLCAR A+IP LP++++SLA W
Sbjct  613  HVSTVVKGSVGYVDPEYYRKQQLTEKSDVYSFGVVLFEVLCARPAMIPGLPKDQISLARW  672

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             +   + G +  IVDPNL G I+  CL ++ E+A +C+KD+GI+RP MN+VVWGLEFALQ
Sbjct  673  AKICLKRGSLESIVDPNLMGDISPLCLKKFGELAESCIKDEGIERPIMNEVVWGLEFALQ  732

Query  265  LQDAAD  248
            +Q++ +
Sbjct  733  VQESGN  738



>ref|XP_007032831.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
 gb|EOY03757.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
Length=884

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGS GYVDPEYYRR+Q+T+KSDVYSFGVVLFEVLCAR ++IP LP+++VSLA W
Sbjct  682  HVSTVVKGSIGYVDPEYYRRQQLTQKSDVYSFGVVLFEVLCARPSMIPGLPKDQVSLARW  741

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             R  +  G + EI+DPNL G I   CL ++ E+A +C++D GI+RP M+DVVWGLEFALQ
Sbjct  742  ARICHARGTLEEIMDPNLVGDITPLCLKKFGELAGSCIRDNGIERPMMSDVVWGLEFALQ  801

Query  265  LQDAADK  245
            +Q A  +
Sbjct  802  IQGATGR  808



>ref|XP_008230912.1| PREDICTED: receptor-like protein kinase FERONIA [Prunus mume]
Length=914

 Score =   180 bits (457),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 100/212 (47%), Positives = 140/212 (66%), Gaps = 17/212 (8%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            H+ST VKGSFGY+DPEYYRR Q+TEKSDVYSFGVVL EVLCAR A++  + + ++SLAEW
Sbjct  716  HISTMVKGSFGYLDPEYYRRNQLTEKSDVYSFGVVLCEVLCARPALLRTVEKKQMSLAEW  775

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             +  +  G + +I+DP+LKG+I + CL ++VE+A +C+ D GI+RP+MNDVVWGLE+A+Q
Sbjct  776  VKSCHRKGTLDQIIDPSLKGKIGNACLNKFVEMAISCMHDNGIERPSMNDVVWGLEYAMQ  835

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAE----KLFR  98
            L             R      F L  KG D E A  +D ++   FTTS + E        
Sbjct  836  LHQ-----------REEREKDFDLENKGED-EVALMND-NHSTGFTTSRSWEGETLNSGL  882

Query  97   TKssatatstsddSLRGQSHTIFSELSNQLGR  2
            TK+S    ST+++S++G S  +FS +++  GR
Sbjct  883  TKTSGEQNSTTNESIKGMSRIVFSGINDSDGR  914



>ref|XP_010421701.1| PREDICTED: receptor-like protein kinase ANXUR2 [Camelina sativa]
Length=858

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 116/174 (67%), Gaps = 7/174 (4%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HV+T VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P+LP+ +VSL +W
Sbjct  677  HVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPSLPKEQVSLGDW  736

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                   G + +I+DPNLKG+I  ECL ++ + A  CL D G+DRP M DV+W LEFALQ
Sbjct  737  AMNCKRKGTLEDIIDPNLKGKINPECLKKFADTAEKCLSDSGLDRPTMGDVLWNLEFALQ  796

Query  265  LQDAADKRGGLSPPRTPERPGFPL-LAKGGDGEAANKSDE--DYGGAFTTSENA  113
            LQ+ AD        RTP   G      +GG   A N + E  D     ++ EN+
Sbjct  797  LQETADGPRN----RTPSHGGGSADFGRGGGAVALNVAIEENDVADDLSSQENS  846



>gb|AAK63934.1|AC084282_15 putative protein kinase [Oryza sativa Japonica Group]
Length=843

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 104/132 (79%), Gaps = 0/132 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVSTAVKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P LPR++V+LAEW
Sbjct  682  HVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPAINPTLPRDQVNLAEW  741

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             R  +  G++++I+DP++ GQI  + L  + E A  CL D G+DRP+M DV+W LEFALQ
Sbjct  742  ARTWHRKGELNKIIDPHISGQIRPDSLEIFAEAAEKCLADYGVDRPSMGDVLWKLEFALQ  801

Query  265  LQDAADKRGGLS  230
            LQ+  D   G S
Sbjct  802  LQEKGDIVDGTS  813



>ref|XP_003633771.1| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
Length=894

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEYYRR+Q+TEKSDVYSFGVVLFEVLCAR  +   + + +VSLA+W
Sbjct  687  HVSTVVKGSFGYLDPEYYRRQQLTEKSDVYSFGVVLFEVLCARPPLNQTVEKERVSLAQW  746

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y  G + +IVDP LKG+IA +CL ++ EIA +CL+DQGI+RP+M DVVWGL+FA+Q
Sbjct  747  APSCYRDGKLEQIVDPFLKGKIAPDCLQKFGEIAVSCLQDQGIERPSMTDVVWGLQFAMQ  806

Query  265  LQDAADK  245
            LQ++A++
Sbjct  807  LQESAEQ  813



>emb|CDX78012.1| BnaA09g32070D [Brassica napus]
Length=851

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE LCAR A+ P L + +VSLAEW
Sbjct  670  HVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAEW  729

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y+ G + +IVDP+LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFALQ
Sbjct  730  APYCYKKGMLDQIVDPHLKGKITPECFKKFAETAMKCVLDQGIERPSMGDVLWNLEFALQ  789

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  790  LQESAEESG  798



>ref|XP_010660596.1| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
Length=895

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEYYRR+Q+TEKSDVYSFGVVLFEVLCAR  +   + + +VSLA+W
Sbjct  688  HVSTVVKGSFGYLDPEYYRRQQLTEKSDVYSFGVVLFEVLCARPPLNQTVEKERVSLAQW  747

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y  G + +IVDP LKG+IA +CL ++ EIA +CL+DQGI+RP+M+DVVWGL+FA+Q
Sbjct  748  APACYRDGKLEQIVDPFLKGKIAPDCLQKFGEIAVSCLQDQGIERPSMSDVVWGLQFAMQ  807

Query  265  LQDAADK  245
            LQ++A++
Sbjct  808  LQESAEQ  814



>ref|NP_001159308.1| uncharacterized protein LOC100304400 [Zea mays]
 gb|ACN25746.1| unknown [Zea mays]
Length=357

 Score =   173 bits (439),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 100/129 (78%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYS+GVVLFEVLCAR A+ P+LPR +VSLA+ 
Sbjct  174  HVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSYGVVLFEVLCARPALNPSLPREQVSLADH  233

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                   G + +I+DP LKG+IA +CL +Y E A  CL D G+DRP+M DV+W LEFALQ
Sbjct  234  ALSCQRKGTLEDIIDPVLKGKIAPDCLKKYAETAEKCLCDHGVDRPSMGDVLWNLEFALQ  293

Query  265  LQDAADKRG  239
            +QD  +  G
Sbjct  294  MQDTFENGG  302



>ref|XP_009416326.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416327.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
Length=882

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 105/132 (80%), Gaps = 0/132 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P LP+ +VSLAEW
Sbjct  686  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPTLPKEQVSLAEW  745

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                 + G + +I+DP LKG+IA +CL ++ E A  C+ D G +RP+M DV+W LEFALQ
Sbjct  746  AAHCQKKGILDQIIDPYLKGKIAPQCLKKFAETAEKCVADVGTERPSMGDVLWNLEFALQ  805

Query  265  LQDAADKRGGLS  230
            LQ++A++ G +S
Sbjct  806  LQESAEESGSIS  817



>ref|NP_001044372.1| Os01g0769700 [Oryza sativa Japonica Group]
 dbj|BAB56062.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAD53342.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAF06286.1| Os01g0769700 [Oryza sativa Japonica Group]
 gb|EEE55446.1| hypothetical protein OsJ_03602 [Oryza sativa Japonica Group]
Length=896

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 111/148 (75%), Gaps = 2/148 (1%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P L + +VSLAEW
Sbjct  700  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPTLAKEEVSLAEW  759

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                 + G + +IVDP+LKG+IA +C  ++ E A  C+ D+GIDRP+M DV+W LEFALQ
Sbjct  760  ALHCQKKGILDQIVDPHLKGKIAPQCFKKFAETAEKCVSDEGIDRPSMGDVLWNLEFALQ  819

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKG  182
            +Q++A+  G +    + E  G PL+  G
Sbjct  820  MQESAEDSGSIGCGMSDE--GTPLVMPG  845



>ref|XP_007032827.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
 gb|EOY03753.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
Length=866

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 110/164 (67%), Gaps = 10/164 (6%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEYY R+Q+TEKSDVYSFGVVLFE LCAR  VI NLP+ +VSLA W
Sbjct  669  HVSTVVKGSFGYLDPEYYLRQQLTEKSDVYSFGVVLFEALCARPPVIQNLPKQQVSLANW  728

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
            GR   + G + +I+DP L G+IA ECL ++ EIA +C+ D+ I+RP M+DVVW LEFA Q
Sbjct  729  GRICCQRGTLDQIIDPYLTGEIAPECLKKFGEIAKSCVSDKAIERPTMSDVVWSLEFASQ  788

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGA  134
            LQD  +K             G   + K    E  +  DE + G+
Sbjct  789  LQDTTEKTND----------GMKKVQKSEGKEVVSTDDEIFSGS  822



>ref|XP_011021061.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
FERONIA, partial [Populus euphratica]
Length=834

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 101/130 (78%), Gaps = 0/130 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST V+GS GYVDPEYYRR+ +TEKSDVYSF VVLFEVLCAR  VIP+LP++  SLA+W
Sbjct  694  HVSTVVRGSIGYVDPEYYRRQHLTEKSDVYSFAVVLFEVLCARPPVIPSLPKDLSSLADW  753

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             R+ Y+ G + +IVDP+LKG+++   L ++ EIA +CL  QGI RP M DVVWGLEFALQ
Sbjct  754  ARKCYQRGTLDQIVDPHLKGEVSPVSLNKFAEIANSCLHGQGIVRPKMGDVVWGLEFALQ  813

Query  265  LQDAADKRGG  236
            LQ  A+K   
Sbjct  814  LQQTAEKNAN  823



>ref|XP_007140062.1| hypothetical protein PHAVU_008G081000g [Phaseolus vulgaris]
 gb|ESW12056.1| hypothetical protein PHAVU_008G081000g [Phaseolus vulgaris]
Length=899

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE+LCAR A+ P L + +VSLAEW
Sbjct  698  HVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARPALNPALAKEQVSLAEW  757

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y  G + +++DP LKG+IA EC  ++ E A  C+ DQGI+RP+M DV+W LEFALQ
Sbjct  758  AAHCYLKGTLDQLIDPYLKGKIAPECFKKFAETAMKCVADQGIERPSMGDVLWNLEFALQ  817

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  818  LQESAEESG  826



>ref|XP_010032549.1| PREDICTED: receptor-like protein kinase FERONIA [Eucalyptus grandis]
 gb|KCW51941.1| hypothetical protein EUGRSUZ_J01388 [Eucalyptus grandis]
Length=910

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKG+FGY+DPEYYRR+Q+T+KSDVYSFGVVLFEVLCAR AV     + ++SLA W
Sbjct  696  HVSTVVKGTFGYLDPEYYRRQQLTDKSDVYSFGVVLFEVLCARPAVNRTAQKKQISLAAW  755

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             +   ++G + +IVDP+LKG IA ECL ++ EIA +CL+D+G  RP+MNDVVWGLEFALQ
Sbjct  756  AQSCCKSGSIDKIVDPHLKGAIAPECLNKFCEIAMSCLQDEGTKRPSMNDVVWGLEFALQ  815

Query  265  LQDAADKR  242
            LQ ++++R
Sbjct  816  LQVSSEQR  823



>gb|ABT18100.1| FERONIA receptor-like kinase [Arabidopsis thaliana]
Length=893

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE LCAR A+ P L + +VSLAEW
Sbjct  691  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAEW  750

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y+ G + +IVDP LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFALQ
Sbjct  751  APYCYKKGMLDQIVDPYLKGKITPECFKKFAETAMKCVLDQGIERPSMGDVLWNLEFALQ  810

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  811  LQESAEENG  819



>ref|XP_010099328.1| Receptor-like protein kinase FERONIA [Morus notabilis]
 gb|EXB77674.1| Receptor-like protein kinase FERONIA [Morus notabilis]
Length=867

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/215 (45%), Positives = 133/215 (62%), Gaps = 16/215 (7%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGS GY+DPEYYRR+Q++EKSDVYSFGVVL EVLC R  ++ N  + +VSL+EW
Sbjct  662  HVSTVVKGSIGYLDPEYYRRQQLSEKSDVYSFGVVLCEVLCGRPPIMRNARKGEVSLSEW  721

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             +  Y    + +I+D NL G+IA ECL +Y EI   C+ D G +RP+MNDVVWGLEFA+Q
Sbjct  722  AQHCYHNRTLHQIIDRNLTGKIAPECLKKYSEIVVTCMHDNGTERPSMNDVVWGLEFAMQ  781

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAA--NKSDEDYGGAFTTSENAEKLFRTK  92
            LQ  A+   G+         G  ++   G+ E A  N ++  + G FT S       R+ 
Sbjct  782  LQQNAEDNDGI---------GGAIMEANGEDEVAFFNNNNSSWDGTFTCSWEESLGLRSS  832

Query  91   ssatat-----stsddSLRGQSHTIFSELSNQLGR  2
                 +     ST+D+S++G S  +FSE+ +  GR
Sbjct  833  GMTKISSSEQGSTTDESMKGMSGAVFSEIKDSKGR  867



>gb|KJB71482.1| hypothetical protein B456_011G124900 [Gossypium raimondii]
Length=893

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAEW
Sbjct  692  HVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAEW  751

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                ++ G + +I+DP LKG+I  EC  ++ E A  C+ D+GI+RP+M DV+W LEFALQ
Sbjct  752  AAHCHKKGILDQIMDPYLKGKITPECFKKFAETAMKCVADEGIERPSMGDVLWNLEFALQ  811

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  812  LQESAEESG  820



>gb|AAK59558.1| putative receptor-protein kinase [Arabidopsis thaliana]
Length=895

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE LCAR A+ P L + +VSLAEW
Sbjct  693  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAEW  752

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y+ G + +IVDP LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFALQ
Sbjct  753  APYCYKKGMLDQIVDPYLKGKITPECFKKFAETAMKCVLDQGIERPSMGDVLWNLEFALQ  812

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  813  LQESAEENG  821



>gb|ABF98993.1| protein kinase family protein, putative, expressed [Oryza sativa 
Japonica Group]
 gb|EEE59968.1| hypothetical protein OsJ_12665 [Oryza sativa Japonica Group]
Length=892

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 104/132 (79%), Gaps = 0/132 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVSTAVKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P LPR++V+LAEW
Sbjct  731  HVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPAINPTLPRDQVNLAEW  790

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             R  +  G++++I+DP++ GQI  + L  + E A  CL D G+DRP+M DV+W LEFALQ
Sbjct  791  ARTWHRKGELNKIIDPHISGQIRPDSLEIFAEAAEKCLADYGVDRPSMGDVLWKLEFALQ  850

Query  265  LQDAADKRGGLS  230
            LQ+  D   G S
Sbjct  851  LQEKGDIVDGTS  862



>ref|NP_190723.1| receptor-like protein kinase FERONIA [Arabidopsis thaliana]
 sp|Q9SCZ4.1|FERON_ARATH RecName: Full=Receptor-like protein kinase FERONIA; AltName: 
Full=Protein SIRENE; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB63019.1| receptor-protein kinase-like protein [Arabidopsis thaliana]
 gb|AEE78805.1| receptor-like protein kinase FERONIA [Arabidopsis thaliana]
Length=895

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE LCAR A+ P L + +VSLAEW
Sbjct  693  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAEW  752

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y+ G + +IVDP LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFALQ
Sbjct  753  APYCYKKGMLDQIVDPYLKGKITPECFKKFAETAMKCVLDQGIERPSMGDVLWNLEFALQ  812

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  813  LQESAEENG  821



>ref|XP_006338349.1| PREDICTED: receptor-like protein kinase FERONIA-like [Solanum 
tuberosum]
Length=856

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 109/148 (74%), Gaps = 8/148 (5%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVSTAVKGSFGYVDPEYY+R+++T KSDVYSFGVVLFEVLCAR A+ PNLP  +V+LAEW
Sbjct  668  HVSTAVKGSFGYVDPEYYKRQRLTVKSDVYSFGVVLFEVLCARPAINPNLPSGQVNLAEW  727

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
              RS +  ++ EI+DPNLKGQIA ECL ++ E+A +CL+ +G+ RP+M DVV  LE ALQ
Sbjct  728  ASRSCKKRELEEIIDPNLKGQIAPECLSKFAELAYHCLRKEGVQRPSMGDVVKTLESALQ  787

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKG  182
            +Q+  D           E   FPL+  G
Sbjct  788  VQEGEDHE--------VEGSSFPLIING  807



>ref|XP_009115840.1| PREDICTED: receptor-like protein kinase FERONIA [Brassica rapa]
 ref|XP_009115841.1| PREDICTED: receptor-like protein kinase FERONIA [Brassica rapa]
Length=895

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE LCAR A+ P L + +VSLAEW
Sbjct  692  HVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAEW  751

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y+ G + +IVDP+LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFALQ
Sbjct  752  APYCYKKGMLDQIVDPHLKGKITPECFKKFAETAMKCVLDQGIERPSMGDVLWNLEFALQ  811

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  812  LQESAEESG  820



>ref|XP_011001679.1| PREDICTED: receptor-like protein kinase FERONIA [Populus euphratica]
Length=894

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAEW
Sbjct  694  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAEW  753

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                ++ G + +I+DP LKG+I  EC  ++ E A  C+ DQ IDRP+M DV+W LEFALQ
Sbjct  754  AAHCHKKGILDQILDPYLKGKITPECFKKFAETAMKCVSDQSIDRPSMGDVLWNLEFALQ  813

Query  265  LQDAAD  248
            LQ++A+
Sbjct  814  LQESAE  819



>ref|XP_002877809.1| hypothetical protein ARALYDRAFT_485507 [Arabidopsis lyrata subsp. 
lyrata]
 gb|ABT18096.1| FERONIA receptor-like kinase [Arabidopsis lyrata]
 gb|EFH54068.1| hypothetical protein ARALYDRAFT_485507 [Arabidopsis lyrata subsp. 
lyrata]
Length=891

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE LCAR A+ P L + +VSLAEW
Sbjct  689  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAEW  748

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y+ G + +IVDP LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFALQ
Sbjct  749  APYCYKKGMLDQIVDPYLKGKITPECFKKFAETAMKCVLDQGIERPSMGDVLWNLEFALQ  808

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  809  LQESAEESG  817



>ref|XP_010426729.1| PREDICTED: receptor-like protein kinase FERONIA [Camelina sativa]
Length=894

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE LCAR A+ P L + +VSLAEW
Sbjct  692  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAEW  751

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y+ G + +IVDP LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFALQ
Sbjct  752  APYCYKKGMLDQIVDPYLKGKITPECFKKFAETAMKCVLDQGIERPSMGDVLWNLEFALQ  811

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  812  LQESAEESG  820



>gb|KJB42940.1| hypothetical protein B456_007G175600 [Gossypium raimondii]
Length=891

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGS GYVDPEYYR++Q+TEKSDVYSFGVVLFEVLCAR A+IP LP++++SLA W
Sbjct  679  HVSTVVKGSVGYVDPEYYRKQQLTEKSDVYSFGVVLFEVLCARPAMIPGLPKDQISLARW  738

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             +   + G +  IVDPNL G I+  CL ++ E+A +C+KD+GI+RP MN+VVWGLEFALQ
Sbjct  739  AKICLKRGSLESIVDPNLMGDISPLCLKKFGELAESCIKDEGIERPIMNEVVWGLEFALQ  798

Query  265  LQDAAD  248
            +Q++ +
Sbjct  799  VQESGN  804



>ref|XP_010503851.1| PREDICTED: receptor-like protein kinase FERONIA [Camelina sativa]
Length=895

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE LCAR A+ P L + +VSLAEW
Sbjct  693  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAEW  752

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y+ G + +IVDP LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFALQ
Sbjct  753  APYCYKKGMLDQIVDPYLKGKITPECFKKFAETAMKCVLDQGIERPSMGDVLWNLEFALQ  812

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  813  LQESAEESG  821



>ref|XP_002308259.1| kinase family protein [Populus trichocarpa]
 gb|EEE91782.1| kinase family protein [Populus trichocarpa]
Length=893

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAEW
Sbjct  693  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAEW  752

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                ++ G + +I+DP LKG+IA EC  ++ E A  C+ D+ IDRP+M DV+W LEFALQ
Sbjct  753  AAHCHKKGILDQILDPYLKGKIAPECFKKFAETAMKCVSDESIDRPSMGDVLWNLEFALQ  812

Query  265  LQDAAD  248
            LQ++A+
Sbjct  813  LQESAE  818



>ref|XP_009412649.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412650.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
Length=889

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P+LP+ +VSLAEW
Sbjct  694  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPSLPKEQVSLAEW  753

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                 + G + +I+DP LKG+IA++C  ++ E A  C+ D G +RP+M DV+W LEFALQ
Sbjct  754  AVHCQKKGTLDQIMDPYLKGKIAAQCFKKFAETAKKCVADAGTERPSMGDVLWNLEFALQ  813

Query  265  LQDAADKRGGL  233
            LQ++A++ G L
Sbjct  814  LQESAEENGSL  824



>ref|XP_004981691.1| PREDICTED: probable receptor-like protein kinase At5g61350-like 
[Setaria italica]
Length=847

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVSTAVKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P LPR++V+LAEW
Sbjct  687  HVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPAINPALPRDQVNLAEW  746

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y  G++++I+DP++ GQI  + L  + E A  CL D G+DRP+M DV+W LEFALQ
Sbjct  747  ALTWYRKGELNKIIDPHIAGQIRPDSLEMFAEAAEKCLADYGVDRPSMGDVLWKLEFALQ  806

Query  265  LQDAADKRGGLS  230
            LQ+  D   G S
Sbjct  807  LQEKGDVVDGTS  818



>ref|XP_010515573.1| PREDICTED: receptor-like protein kinase FERONIA [Camelina sativa]
Length=896

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE LCAR A+ P L + +VSLAEW
Sbjct  694  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAEW  753

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y+ G + +IVDP LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFALQ
Sbjct  754  APYCYKKGMLDQIVDPYLKGKITPECFKKFAETAMKCVLDQGIERPSMGDVLWNLEFALQ  813

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  814  LQESAEESG  822



>gb|EEE63237.1| hypothetical protein OsJ_18047 [Oryza sativa Japonica Group]
Length=859

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 105/132 (80%), Gaps = 0/132 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P+LP+ +VSLA+W
Sbjct  664  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARNALSPSLPKEQVSLADW  723

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
              R  + G + EI+DP LKG+IA +C +++ E A  C+ D+ +DRP+M DV+W LEFALQ
Sbjct  724  ALRCQKKGVLGEIIDPLLKGKIAPQCFLKFAETAEKCVADRSVDRPSMGDVLWNLEFALQ  783

Query  265  LQDAADKRGGLS  230
            LQ++ +    L+
Sbjct  784  LQESTEDSSSLT  795



>gb|EAY97521.1| hypothetical protein OsI_19449 [Oryza sativa Indica Group]
Length=859

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 105/132 (80%), Gaps = 0/132 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P+LP+ +VSLA+W
Sbjct  664  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARNALSPSLPKEQVSLADW  723

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
              R  + G + EI+DP LKG+IA +C +++ E A  C+ D+ +DRP+M DV+W LEFALQ
Sbjct  724  ALRCQKKGVLGEIIDPLLKGKIAPQCFLKFAETAEKCVADRSVDRPSMGDVLWNLEFALQ  783

Query  265  LQDAADKRGGLS  230
            LQ++ +    L+
Sbjct  784  LQESTEDSSSLT  795



>gb|KHN07117.1| Receptor-like protein kinase FERONIA [Glycine soja]
Length=857

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 102/128 (80%), Gaps = 0/128 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEYY+R ++TEKSDVYSFGVVLFE+LCAR  +I N    +VSLA W
Sbjct  713  HVSTNVKGSFGYLDPEYYKRNRLTEKSDVYSFGVVLFEILCARPPLIHNAETEQVSLANW  772

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             RR Y+ G +++IVDP+LKG IA EC  ++ EI  +CL + G+ RP++ND+VW LEFALQ
Sbjct  773  ARRCYQNGTMAQIVDPSLKGTIAPECFEKFCEIGMSCLLEDGMHRPSINDIVWLLEFALQ  832

Query  265  LQDAADKR  242
            LQ+ AD+R
Sbjct  833  LQEDADQR  840



>emb|CBI21198.3| unnamed protein product [Vitis vinifera]
Length=932

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEYYRR+Q+TEKSDVYSFGVVLFEVLCAR  +   + + +VSLA+W
Sbjct  716  HVSTVVKGSFGYLDPEYYRRQQLTEKSDVYSFGVVLFEVLCARPPLNQTVEKERVSLAQW  775

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y  G + +IVDP LKG+IA +CL ++ EIA +CL+DQGI+RP+M+DVVWGL+FA+Q
Sbjct  776  APACYRDGKLEQIVDPFLKGKIAPDCLQKFGEIAVSCLQDQGIERPSMSDVVWGLQFAMQ  835

Query  265  LQDAADK  245
            LQ++A++
Sbjct  836  LQESAEQ  842



>gb|EYU42039.1| hypothetical protein MIMGU_mgv1a001343mg [Erythranthe guttata]
Length=837

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYS+GVVLFE++CAR A+ P LP+ +VSLAEW
Sbjct  636  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSYGVVLFEIICARPALNPTLPKEQVSLAEW  695

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             +  ++ G + +++DP LKG+IA EC  ++ E A  C+ D G DRP+M DV+W LEFALQ
Sbjct  696  AQHCHKKGILEQMMDPYLKGKIAPECFKKFAETAVKCVSDVGTDRPSMGDVLWNLEFALQ  755

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  756  LQESAEESG  764



>ref|XP_008810848.1| PREDICTED: receptor-like protein kinase FERONIA [Phoenix dactylifera]
Length=891

 Score =   179 bits (454),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 103/131 (79%), Gaps = 0/131 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFEVLCAR A+ P LP+ +VSLAEW
Sbjct  694  HVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPALNPTLPKEQVSLAEW  753

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                 + G + +I+DP LKG+IA  C  ++ E A  C+ DQGI+RP+M DV+W LEFALQ
Sbjct  754  ALHCQKKGILDQIIDPYLKGKIAPPCFKKFAETAEKCVADQGIERPSMGDVLWNLEFALQ  813

Query  265  LQDAADKRGGL  233
            LQ+ A++ G L
Sbjct  814  LQEGAEESGSL  824



>ref|XP_007151348.1| hypothetical protein PHAVU_004G038800g [Phaseolus vulgaris]
 gb|ESW23342.1| hypothetical protein PHAVU_004G038800g [Phaseolus vulgaris]
Length=891

 Score =   179 bits (454),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 103/128 (80%), Gaps = 0/128 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGS GY+DPEYY+R+++TEKSDVYSFGVVLFE+LCAR  +I    + +V LAEW
Sbjct  690  HVSTVVKGSMGYLDPEYYKRQRLTEKSDVYSFGVVLFELLCARPPLIRTAEKKQVLLAEW  749

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             R  Y+ G +++IVDP LKG+IA+ECL ++ EI  +CL D G  RP+MNDVVW LEFALQ
Sbjct  750  ARHCYQNGTIAQIVDPALKGRIAAECLKKFCEIGVSCLLDDGTQRPSMNDVVWMLEFALQ  809

Query  265  LQDAADKR  242
            LQ++A++R
Sbjct  810  LQESAEQR  817



>gb|ABT18099.1| FERONIA receptor-like kinase [Cardamine flexuosa]
Length=898

 Score =   179 bits (454),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE LCAR A+ P L + +VSLAEW
Sbjct  696  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAEW  755

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y+ G + +IVDP LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFALQ
Sbjct  756  APYCYKKGMLDQIVDPYLKGKITPECFKKFSETAMKCVLDQGIERPSMGDVLWNLEFALQ  815

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  816  LQESAEENG  824



>emb|CDY33271.1| BnaA01g19380D [Brassica napus]
Length=856

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE LCAR A+ P L + +VSLAEW
Sbjct  667  HVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAEW  726

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y+ G + +IVDP+LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFALQ
Sbjct  727  APYCYKKGMLDQIVDPHLKGKITPECFKKFAETAMKCVLDQGIERPSMGDVLWNLEFALQ  786

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  787  LQESAEESG  795



>ref|XP_006403905.1| hypothetical protein EUTSA_v10010114mg [Eutrema salsugineum]
 gb|ESQ45358.1| hypothetical protein EUTSA_v10010114mg [Eutrema salsugineum]
Length=891

 Score =   179 bits (454),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE LCAR A+ P L + +VSLAEW
Sbjct  692  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAEW  751

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y+ G + +IVDP LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFALQ
Sbjct  752  APYCYKKGMLDQIVDPYLKGKITPECFKKFAETAMKCVLDQGIERPSMGDVLWNLEFALQ  811

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  812  LQESAEESG  820



>ref|XP_010229562.1| PREDICTED: probable receptor-like protein kinase At5g61350 [Brachypodium 
distachyon]
Length=847

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVSTAVKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P LPR++V+LAEW
Sbjct  686  HVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPAINPALPRDQVNLAEW  745

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             R  +  G++++I+DP++ GQI  + L  + E A  CL D G+DRP+M DV+W LEFALQ
Sbjct  746  ARSWHRKGELNKIIDPHIAGQIRPDSLEMFAEAAEKCLADYGVDRPSMGDVLWKLEFALQ  805

Query  265  LQDAAD  248
            LQ+  D
Sbjct  806  LQEKGD  811



>ref|XP_009136619.1| PREDICTED: receptor-like protein kinase FERONIA [Brassica rapa]
Length=896

 Score =   179 bits (454),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE LCAR A+ P L + +VSLAEW
Sbjct  692  HVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAEW  751

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y+ G + +IVDP+LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFALQ
Sbjct  752  APYCYKKGMLDQIVDPHLKGKITPECFKKFAETAMKCVLDQGIERPSMGDVLWNLEFALQ  811

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  812  LQESAEESG  820



>gb|KHN07112.1| Receptor-like protein kinase FERONIA [Glycine soja]
Length=819

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 102/128 (80%), Gaps = 0/128 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEYY+R ++TEKSDVYSFGVVLFE+LCAR  +I N    +VSLA W
Sbjct  675  HVSTNVKGSFGYLDPEYYKRYRLTEKSDVYSFGVVLFEILCARPPLIHNAETEQVSLANW  734

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             RR Y+ G +++IVDP+LKG IA EC  ++ EI  +CL + G+ RP++ND+VW LEFALQ
Sbjct  735  ARRCYQNGTMAQIVDPSLKGTIAPECFEKFCEIGMSCLLEDGMHRPSINDIVWLLEFALQ  794

Query  265  LQDAADKR  242
            LQ+ AD+R
Sbjct  795  LQEDADQR  802



>emb|CDY16299.1| BnaC01g23340D [Brassica napus]
Length=866

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE LCAR A+ P L + +VSLAEW
Sbjct  676  HVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAEW  735

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y+ G + +IVDP+LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFALQ
Sbjct  736  APYCYKKGMLDQIVDPHLKGKITPECFKKFAETAMKCVLDQGIERPSMGDVLWNLEFALQ  795

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  796  LQESAEESG  804



>ref|XP_009385155.1| PREDICTED: receptor-like protein kinase ANXUR2 [Musa acuminata 
subsp. malaccensis]
Length=852

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 106/140 (76%), Gaps = 1/140 (1%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ PNLPR +VSLA+W
Sbjct  681  HVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPNLPREQVSLADW  740

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                 +   +++IVDP L+G+I  ECL ++ E A  CL D G+DRP+M DV+W LEFALQ
Sbjct  741  ALHCQKKAVLADIVDPLLEGKIGPECLKKFAETAEKCLLDHGVDRPSMGDVLWNLEFALQ  800

Query  265  LQDAADKRGGLSPPRTPERP  206
            LQ++ +  G      T ERP
Sbjct  801  LQESFES-GKPVTEETTERP  819



>gb|ABT18098.1| FERONIA receptor-like kinase [Cardamine flexuosa]
Length=892

 Score =   179 bits (454),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE LCAR A+ P L + +VSLAEW
Sbjct  690  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAEW  749

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y+ G + +IVDP LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFALQ
Sbjct  750  APYCYKKGMLDQIVDPYLKGKITPECFKKFSETAMKCVLDQGIERPSMGDVLWNLEFALQ  809

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  810  LQESAEENG  818



>ref|XP_010032628.1| PREDICTED: receptor-like protein kinase FERONIA [Eucalyptus grandis]
 gb|KCW52053.1| hypothetical protein EUGRSUZ_J01493 [Eucalyptus grandis]
Length=885

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 119/168 (71%), Gaps = 5/168 (3%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVSTAVKG+FGY+DPEYYRR+++T+KSDVYSFGVVLFEVLCAR AV    P  ++SLAEW
Sbjct  687  HVSTAVKGTFGYLDPEYYRRQRLTDKSDVYSFGVVLFEVLCARPAVSRMAPMEQISLAEW  746

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             +   ++G + E+VDP+LKG I  ECL ++ EIA +CL+D+G  RP+MNDVVWGL+FALQ
Sbjct  747  AQSCCKSGAIEEMVDPHLKGSIVPECLNKFCEIAMSCLQDEGTKRPSMNDVVWGLKFALQ  806

Query  265  LQDAAD----KRGGLSPPRTPERPGFPLLAKGGDGEAA-NKSDEDYGG  137
            LQ + +       G+S   + +        +G D + A + SD D GG
Sbjct  807  LQVSTELEVTDHMGVSVHNSDDNNHDVAPIRGNDSDGAFSTSDSDSGG  854



>emb|CDP17056.1| unnamed protein product [Coffea canephora]
Length=881

 Score =   179 bits (453),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE LCAR A+ P+LP+ +VSLA+W
Sbjct  689  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARPALNPSLPKEQVSLADW  748

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                +  G + +IVDP +KG+I++ECL ++ E A  CL D G+DRP+M DV+W LE+ALQ
Sbjct  749  AMHCHRKGALEDIVDPQIKGEISAECLKKFAETAGKCLADHGVDRPSMGDVLWNLEYALQ  808

Query  265  LQDAAD  248
            LQ+  D
Sbjct  809  LQENPD  814



>gb|ABT18094.1| FERONIA receptor-like kinase [Brassica oleracea]
Length=895

 Score =   179 bits (453),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE LCAR A+ P L + +VSLAEW
Sbjct  691  HVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAEW  750

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y+ G + +IVDP+LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFALQ
Sbjct  751  APYCYKKGMLDQIVDPHLKGKITPECFKKFAETAMKCVLDQGIERPSMGDVLWNLEFALQ  810

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  811  LQESAEESG  819



>ref|XP_009383157.1| PREDICTED: probable receptor-like protein kinase At5g61350 [Musa 
acuminata subsp. malaccensis]
Length=872

 Score =   179 bits (453),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 109/150 (73%), Gaps = 9/150 (6%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVSTAVKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P LPR +V+LAEW
Sbjct  701  HVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPALPREQVNLAEW  760

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
              + +  G + +I+DP+L G I+S  L +YVE A  CL + G+DRP+M DV+W LE+ALQ
Sbjct  761  AMQWHRKGQLEKIIDPHLVGTISSASLKKYVEAAEKCLAEHGVDRPSMGDVLWNLEYALQ  820

Query  265  LQDA---------ADKRGGLSPPRTPERPG  203
            LQ+A         A+K     P  +P R G
Sbjct  821  LQEASMGQPSDDPAEKSAANIPLESPARNG  850



>emb|CDO98765.1| unnamed protein product [Coffea canephora]
Length=859

 Score =   178 bits (452),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 109/157 (69%), Gaps = 12/157 (8%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLC R A+ PNLP+ +VSLA+W
Sbjct  683  HVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCGRPALDPNLPKEQVSLADW  742

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
              R +  G + +I+DP +KG++A ECL  + E A  CL DQGIDRP+M  V+W LE+ LQ
Sbjct  743  ALRCHSRGVLDDIIDPCIKGEMAPECLKHFAETAAKCLSDQGIDRPSMGAVLWNLEYCLQ  802

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKS  155
            LQ+             P+ P F +  K  D  A +++
Sbjct  803  LQN------------NPDGPEFVVQQKANDAYAMHET  827



>ref|XP_010230703.1| PREDICTED: receptor-like protein kinase ANXUR1 [Brachypodium 
distachyon]
Length=1610

 Score =   181 bits (458),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 115/167 (69%), Gaps = 0/167 (0%)
 Frame = -1

Query  625   HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
             HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFEVL AR A+ P LPR++VSLA++
Sbjct  1414  HVSTMVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLMARPALNPALPRDQVSLADY  1473

Query  445   GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                    G ++++VDP +K QIA ECLI++ E A  CL DQG DRP+M DV+W LEFA+Q
Sbjct  1474  ALSCQRKGTLADVVDPTIKNQIAPECLIKFAETAEKCLADQGTDRPSMGDVLWNLEFAMQ  1533

Query  265   LQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTT  125
             LQD  D R G    R  +  G P + +  +   +  S    G + T+
Sbjct  1534  LQDTFDGRSGRPQGRDDDGSGRPAVLEPSNSYGSTASVTTIGTSSTS  1580


 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 73/143 (51%), Gaps = 6/143 (4%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            ++ST V G+FGYV PEY     +  KSDVYS+GVVL E+L  R  V  +    + +L  W
Sbjct  563  YLSTRVMGTFGYVAPEYAMTGHLIVKSDVYSYGVVLLELLTGRRPVDMSQSSGQENLVTW  622

Query  445  GRRSYETGD-VSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  269
             R      D + E+ DP L GQ   +  ++   IA  C+  +   RP M +VV  L+   
Sbjct  623  TRPVLRDKDRLQELADPRLGGQYPKDDFVRVCTIAAACVSPEANQRPTMGEVVQSLKM--  680

Query  268  QLQDAADKRGGLSPPRTPERPGF  200
             +Q +A+ +  +  P  P RP  
Sbjct  681  -VQRSAEFQESI--PTPPARPNI  700



>ref|XP_006290584.1| hypothetical protein CARUB_v10016673mg [Capsella rubella]
 gb|EOA23482.1| hypothetical protein CARUB_v10016673mg [Capsella rubella]
Length=892

 Score =   179 bits (453),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE LCAR A+ P L + +VSLAEW
Sbjct  690  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARPALNPTLEKEQVSLAEW  749

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y+ G + +IVDP LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFALQ
Sbjct  750  APYCYKKGMLDQIVDPYLKGKITPECFKKFAETAMKCVLDQGIERPSMGDVLWNLEFALQ  809

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  810  LQESAEESG  818



>ref|XP_010519979.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
ANXUR2 [Tarenaya hassleriana]
Length=860

 Score =   178 bits (452),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 90/180 (50%), Positives = 120/180 (67%), Gaps = 9/180 (5%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HV+T VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ PNL + +VSLA+W
Sbjct  676  HVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPNLSKEQVSLADW  735

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                 + G + +I+DPNLKG+I  ECL ++ + A  CL D G++RP M DV+W LEFALQ
Sbjct  736  ALNCKKKGTLEDIIDPNLKGKINPECLRKFADTAEKCLSDSGVERPTMGDVLWNLEFALQ  795

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKGGDGEA-----ANKSDEDYGGAFTTSENAEKLF  101
            LQ+ +D     S  R P + G      GG   A     AN   ED+  +  +S++   +F
Sbjct  796  LQETSDG----SHHRKPSQGGGSDEFAGGGAVAVHVAGANNRSEDHDVSDQSSDDNSGIF  851



>ref|XP_009385224.1| PREDICTED: receptor-like protein kinase ANXUR1 [Musa acuminata 
subsp. malaccensis]
Length=863

 Score =   178 bits (452),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCARAA+ P+LPR +VSLA+W
Sbjct  688  HVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARAALNPSLPREQVSLADW  747

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
              +  + G +++I+DP L+G+I  ECL ++ E A  CL D G+DRP+M +V+W LEFALQ
Sbjct  748  ALQCQKRGVLADIIDPQLEGKIGRECLHKFAETAETCLLDHGVDRPSMGNVLWNLEFALQ  807

Query  265  LQDA  254
            LQ++
Sbjct  808  LQES  811



>gb|KCW45810.1| hypothetical protein EUGRSUZ_L00361 [Eucalyptus grandis]
Length=270

 Score =   169 bits (429),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVSTAVKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVL EVLCAR  + P+LPR KV+LAEW
Sbjct  88   HVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLLEVLCARPVIDPSLPREKVNLAEW  147

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
              +  + G + +I+DP L G+I  + L ++ E A  CL D G+DRP+M DV+W LE+ALQ
Sbjct  148  AMKWQKKGQLDQIIDPTLVGKIRPDSLRKFGETAEKCLADYGVDRPSMGDVLWNLEYALQ  207

Query  265  LQDAA  251
            LQ+A 
Sbjct  208  LQEAV  212



>gb|EEC75192.1| hypothetical protein OsI_11431 [Oryza sativa Indica Group]
Length=893

 Score =   179 bits (453),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 111/148 (75%), Gaps = 2/148 (1%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFEVLCAR A+ P L + +VSLAEW
Sbjct  697  HVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPALNPTLAKEEVSLAEW  756

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                 + G + +IVDP+LKG+IA +C  ++ E A  C+ D+GIDRP+M DV+W LEFALQ
Sbjct  757  ALHCQKKGILDQIVDPHLKGKIAPQCFKKFAETAEKCVSDEGIDRPSMGDVLWNLEFALQ  816

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKG  182
            +Q++A+  G +    + E  G PL+  G
Sbjct  817  MQESAEDSGSIGCGMSDE--GTPLVMPG  842



>emb|CDY29022.1| BnaC07g32280D [Brassica napus]
Length=803

 Score =   177 bits (450),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE LCAR A+ P L + +VSLAEW
Sbjct  623  HVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAEW  682

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y+ G + +IVDP+LKG+I  EC  ++ E    C+ DQGI+RP+M DV+W LEFALQ
Sbjct  683  APYCYKKGMLDQIVDPHLKGKITPECFKKFAETGMKCVLDQGIERPSMGDVLWNLEFALQ  742

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  743  LQESAEESG  751



>ref|XP_002530995.1| kinase, putative [Ricinus communis]
 gb|EEF31383.1| kinase, putative [Ricinus communis]
Length=888

 Score =   178 bits (452),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST V+GSFGYVDPEYYRR+ +TEKSDVYSFGVVL EVLCAR  VIP LP+ +V+LA+W
Sbjct  682  HVSTVVRGSFGYVDPEYYRRQHLTEKSDVYSFGVVLLEVLCARPPVIPGLPKEQVNLADW  741

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             R  Y  G +++I+DPNL G +A  CL+++ EIA +CL+DQGI RPAM+DVV+GL+  LQ
Sbjct  742  ARICYRRGALNQIIDPNLMGDVAPACLVKFGEIAESCLRDQGILRPAMSDVVFGLQLVLQ  801

Query  265  LQDA  254
            LQ++
Sbjct  802  LQES  805



>emb|CDX90645.1| BnaA03g41360D [Brassica napus]
Length=814

 Score =   178 bits (451),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE LCAR A+ P L + +VSLAEW
Sbjct  634  HVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAEW  693

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y+ G + +IVDP LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFALQ
Sbjct  694  APYCYKKGMLDQIVDPYLKGKITPECFKKFAETAMKCVLDQGIERPSMGDVLWNLEFALQ  753

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  754  LQESAEESG  762



>emb|CDX73714.1| BnaC08g22890D [Brassica napus]
Length=1176

 Score =   180 bits (456),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = -1

Query  625   HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
             HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE LCAR A+ P L + +VSLAEW
Sbjct  987   HVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAEW  1046

Query  445   GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                 Y+ G + +IVDP+LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFALQ
Sbjct  1047  APYCYKKGMLDQIVDPHLKGKITPECFKKFAETAMKCVLDQGIERPSMGDVLWNLEFALQ  1106

Query  265   LQDAADKRG  239
             LQ++A++ G
Sbjct  1107  LQESAEESG  1115



>ref|XP_010032550.1| PREDICTED: receptor-like protein kinase FERONIA [Eucalyptus grandis]
 gb|KCW51942.1| hypothetical protein EUGRSUZ_J01389 [Eucalyptus grandis]
Length=908

 Score =   178 bits (452),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKG+FGY+DPEYYRR+Q+T+KSDVYSFGVVLFEVLCAR AV     + ++SLA W
Sbjct  696  HVSTVVKGTFGYLDPEYYRRQQLTDKSDVYSFGVVLFEVLCARPAVNRTAQKKQISLAAW  755

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             +   ++G + +IVDP LKG IA ECL ++ EIA +CL+D+G  RP+MNDVVWGLEFALQ
Sbjct  756  AQSCCKSGSIDKIVDPQLKGAIAPECLNKFCEIAMSCLQDEGTKRPSMNDVVWGLEFALQ  815

Query  265  LQDAADK  245
            LQ +++K
Sbjct  816  LQVSSEK  822



>ref|XP_002990231.1| hypothetical protein SELMODRAFT_40963, partial [Selaginella moellendorffii]
 gb|EFJ08791.1| hypothetical protein SELMODRAFT_40963, partial [Selaginella moellendorffii]
Length=753

 Score =   177 bits (449),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 100/124 (81%), Gaps = 0/124 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVSTAVKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P LPR +V++AEW
Sbjct  630  HVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPAINPALPREQVNIAEW  689

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
              +    G + +IVD NLKGQ + E L ++ E A  CL +QGIDRPAM DV+W LE+ALQ
Sbjct  690  AMQYQRMGALEQIVDANLKGQCSQESLQKFGETAEKCLAEQGIDRPAMGDVLWNLEYALQ  749

Query  265  LQDA  254
            LQ+A
Sbjct  750  LQEA  753



>ref|XP_002272797.2| PREDICTED: receptor-like protein kinase ANXUR1 [Vitis vinifera]
 emb|CBI22880.3| unnamed protein product [Vitis vinifera]
Length=857

 Score =   178 bits (451),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE LCAR A+ P+LP+ +VSLA+W
Sbjct  681  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARPALNPSLPKEQVSLADW  740

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
              +  + G + EI+DP+LKG I  ECL+++ E A  CL D G++RP+M DV+W LEFALQ
Sbjct  741  ALQCQKKGILEEIIDPHLKGNITPECLMKFAETAEKCLSDHGLERPSMGDVLWNLEFALQ  800

Query  265  LQD  257
            LQ+
Sbjct  801  LQE  803



>gb|ABT18095.1| FERONIA receptor-like kinase [Cardamine flexuosa]
Length=891

 Score =   178 bits (452),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 105/133 (79%), Gaps = 1/133 (1%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE LCAR A+ P L + +VSLAEW
Sbjct  689  HVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAEW  748

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y+ G + +IVDP LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFALQ
Sbjct  749  APYCYKKGMLDQIVDPYLKGKITPECFKKFAETAMKCVLDQGIERPSMGDVLWNLEFALQ  808

Query  265  LQDAADKRG-GLS  230
            LQ++A++ G G+S
Sbjct  809  LQESAEENGKGMS  821



>ref|XP_006844774.1| hypothetical protein AMTR_s00016p00259140 [Amborella trichopoda]
 gb|ERN06449.1| hypothetical protein AMTR_s00016p00259140 [Amborella trichopoda]
Length=856

 Score =   178 bits (451),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 108/141 (77%), Gaps = 3/141 (2%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFEVLCAR A+ P+LP+ +VSLA+W
Sbjct  675  HVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPALNPSLPKEQVSLADW  734

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                 + G + +++DP LKG+I  ECL ++ E A  CL D G+DRPAM DV+W LEFALQ
Sbjct  735  ALHCQKKGVLEDLIDPFLKGKINPECLKKFSETAEKCLSDSGVDRPAMGDVLWNLEFALQ  794

Query  265  LQDAADK---RGGLSPPRTPE  212
            LQ+ +++      ++P R PE
Sbjct  795  LQEGSEEGKIPADVAPARLPE  815



>gb|KEH25126.1| feronia receptor-like kinase [Medicago truncatula]
Length=900

 Score =   178 bits (452),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 117/167 (70%), Gaps = 8/167 (5%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGS GY+DPEYY+R+++TEKSDVYSFGVVLFE+LCAR  +I    + +VSLA+W
Sbjct  693  HVSTVVKGSVGYLDPEYYKRQRLTEKSDVYSFGVVLFEILCARPPLIRTAEKRQVSLADW  752

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
            GR  ++ G +  IVDP++K  IA ECL ++ EIA +CL D G  RP+MNDVVW LEFALQ
Sbjct  753  GRYCHKNGMLGSIVDPSVKWSIAPECLRKFGEIAVSCLLDDGTMRPSMNDVVWMLEFALQ  812

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTT  125
            LQ++A+KR   + P T        L +G D    ++ DE+    F++
Sbjct  813  LQESAEKREPQAVPHT--------LGRGNDDVEGDRIDENDNDVFSS  851



>ref|XP_011071382.1| PREDICTED: receptor-like protein kinase ANXUR1 [Sesamum indicum]
Length=871

 Score =   178 bits (451),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 115/173 (66%), Gaps = 18/173 (10%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFEVLC R A+ PNLP+++VSLA+W
Sbjct  697  HVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCGRPALNPNLPKDQVSLADW  756

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
               ++  G + EI+DPN+KG+I++ECL  + E A  CL D G DRP + +V+W LE+ LQ
Sbjct  757  AMLNHRRGTLGEILDPNIKGEISAECLKHFSETAVKCLSDHGTDRPTIGEVLWNLEYCLQ  816

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAEK  107
            LQ   D              G  ++AK    + AN +  +YG   +  E  EK
Sbjct  817  LQTNPD--------------GAKMVAK----QKANNACANYGTLLSIEEEKEK  851



>ref|XP_006650625.1| PREDICTED: probable receptor-like protein kinase At5g61350-like 
[Oryza brachyantha]
Length=855

 Score =   178 bits (451),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 104/132 (79%), Gaps = 0/132 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVSTAVKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P LPR++V+LAEW
Sbjct  694  HVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPAINPALPRDQVNLAEW  753

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                +  G++++I+DP++ GQI S+ L  + E A  CL D G+DRP+M DV+W LEFALQ
Sbjct  754  ALTWHRKGELNKIIDPHISGQIRSDSLEIFAEAAEKCLADYGVDRPSMGDVLWKLEFALQ  813

Query  265  LQDAADKRGGLS  230
            LQ+  D   G S
Sbjct  814  LQEKGDIVDGTS  825



>gb|ABT18097.1| FERONIA receptor-like kinase [Cardamine flexuosa]
Length=891

 Score =   178 bits (452),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 120/173 (69%), Gaps = 6/173 (3%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE LCAR A+ P L + +VSLAEW
Sbjct  689  HVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAEW  748

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y+ G + +IVDP LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFALQ
Sbjct  749  APYCYKKGMLDQIVDPYLKGKITPECFKKFAETAMKCVLDQGIERPSMGDVLWNLEFALQ  808

Query  265  LQDAADKRG-GLSPPRTPERPGFPLLAKGGDGEAANKSDED-YGGAFTTSENA  113
            LQ++A++ G G+S     +   +      G+G+  N+   D Y G  T S ++
Sbjct  809  LQESAEENGKGMSGDMDMDEIKY----NDGNGKGKNEMSSDVYEGNVTDSRSS  857



>gb|AAL40864.1| receptor protein kinase-like protein [Capsicum annuum]
Length=648

 Score =   176 bits (447),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAEW
Sbjct  448  HVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAEW  507

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y+ G   +I+DP L G++A ECL ++ E A  C+ D G DRP+M DV+W LEFALQ
Sbjct  508  AFHCYKKGTFDQIIDPYLNGKLAPECLKKFTETAVKCVSDVGADRPSMGDVLWNLEFALQ  567

Query  265  LQDAADK  245
            LQ++ ++
Sbjct  568  LQESVEE  574



>ref|XP_004492579.1| PREDICTED: receptor-like protein kinase FERONIA-like [Cicer arietinum]
Length=896

 Score =   178 bits (451),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE+LCAR A+ P L + +VSLAEW
Sbjct  695  HVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARPALNPTLAKEQVSLAEW  754

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y+ G + +I DP LKG+IA EC  ++ E A  C+ DQ I+RP+M DV+W LEFALQ
Sbjct  755  AAHCYKKGILDQISDPYLKGKIAPECFKKFAETAMKCVADQSIERPSMGDVLWNLEFALQ  814

Query  265  LQDAADKRG  239
            LQ++A++ G
Sbjct  815  LQESAEESG  823



>ref|XP_008344811.1| PREDICTED: receptor-like protein kinase FERONIA [Malus domestica]
Length=357

 Score =   171 bits (434),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            H+ST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVL+EVLCAR A++  +   +++LAEW
Sbjct  195  HISTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLWEVLCARPALLHTVESRQINLAEW  254

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             +  +    + +I+DPN+KGQI  ECL +++EIA +CL D+GI+RP+MNDVV GLEFALQ
Sbjct  255  AKSCHGDETLDQIIDPNVKGQIEVECLNKFIEIAISCLHDKGIERPSMNDVVKGLEFALQ  314

Query  265  LQDAA  251
            L   +
Sbjct  315  LHQKS  319



>ref|XP_006289663.1| hypothetical protein CARUB_v10003221mg [Capsella rubella]
 gb|EOA22561.1| hypothetical protein CARUB_v10003221mg [Capsella rubella]
Length=859

 Score =   177 bits (450),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 103/141 (73%), Gaps = 4/141 (3%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HV+T VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P+L + +VSL +W
Sbjct  677  HVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPSLSKEQVSLGDW  736

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                   G + +I+DPNLKG+I  ECL ++ + A  CL D G+DRP M DV+W LEFALQ
Sbjct  737  AMNCKRKGTLEDIIDPNLKGKINPECLKKFADTAEKCLSDSGLDRPTMGDVLWNLEFALQ  796

Query  265  LQDAADKRGGLSPPRTPERPG  203
            LQ+ AD     S  RTP   G
Sbjct  797  LQETADG----SRHRTPSHGG  813



>ref|XP_006654257.1| PREDICTED: receptor-like protein kinase FERONIA-like [Oryza brachyantha]
Length=889

 Score =   178 bits (451),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 104/132 (79%), Gaps = 0/132 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVL EVLCAR A+ P+LPR +VSLA+W
Sbjct  689  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLLEVLCARTALSPSLPREQVSLADW  748

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                   G + +IVDP L+G+IA +C +++ E A  C+ D+  DRP+M DV+W LEFALQ
Sbjct  749  ALHCQRKGVLGDIVDPLLRGKIAPQCFMKFAETAEKCVVDRSADRPSMGDVLWNLEFALQ  808

Query  265  LQDAADKRGGLS  230
            LQ++A+  GGL+
Sbjct  809  LQESAEDSGGLT  820



>ref|XP_010247768.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=876

 Score =   177 bits (450),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 95/216 (44%), Positives = 129/216 (60%), Gaps = 21/216 (10%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            H+ST VKGSFGY+DPEYYRR+Q+TEKSDVYSFGVVLFEVLCAR A+  NL   ++ LA+W
Sbjct  674  HISTVVKGSFGYLDPEYYRRQQLTEKSDVYSFGVVLFEVLCARPALDRNLDHRQICLADW  733

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
              +    G + +I+DP L G+IA ECL ++ EIA NCL D+GI+RP M DV+W LEFALQ
Sbjct  734  ALQCRRDGTLDQIIDPFLWGKIAPECLRKFAEIAANCLADEGINRPTMADVLWNLEFALQ  793

Query  265  LQDAADKRGG--------LSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAE  110
            LQ++A+K G         ++  +TP       +   G    ++         FT+  N++
Sbjct  794  LQESAEKLGDGDFDSVNQMNDKKTPLSSSISEVFVSGGVSGSSDMKSSGTSTFTSDGNSK  853

Query  109  KLFRTKssatatstsddSLRGQSHTIFSELSNQLGR  2
                + +               S T+FSE+ N  GR
Sbjct  854  SYSESDAL-------------MSGTVFSEIGNPKGR  876



>gb|EYU23499.1| hypothetical protein MIMGU_mgv1a023218mg [Erythranthe guttata]
Length=866

 Score =   177 bits (450),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVSTAVKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCARAA+ P+LPR++V+LAEW
Sbjct  673  HVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARAALDPSLPRDQVNLAEW  732

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             +   + G + +IVDP + G I  + LI++VE A  CL + G+DRP+M DV+W LEFALQ
Sbjct  733  AKMQNKKGSIKKIVDPVIVGDINQDSLIKFVESAEKCLAEYGVDRPSMGDVLWNLEFALQ  792

Query  265  LQ  260
            LQ
Sbjct  793  LQ  794



>ref|XP_010039671.1| PREDICTED: receptor-like protein kinase HERK 1, partial [Eucalyptus 
grandis]
Length=282

 Score =   169 bits (428),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVSTAVKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVL EVLCAR  + P+LPR KV+LAEW
Sbjct  100  HVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLLEVLCARPVIDPSLPREKVNLAEW  159

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
              +  + G + +I+DP L G+I  + L ++ E A  CL D G+DRP+M DV+W LE+ALQ
Sbjct  160  AMKWQKKGQLDQIIDPTLVGKIRPDSLRKFGETAEKCLADYGVDRPSMGDVLWNLEYALQ  219

Query  265  LQDAA  251
            LQ+A 
Sbjct  220  LQEAV  224



>gb|EMT15162.1| Putative receptor-like protein kinase [Aegilops tauschii]
Length=836

 Score =   177 bits (449),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 101/132 (77%), Gaps = 0/132 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVSTAVKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFEVLCAR A+ P LPR++V+L EW
Sbjct  675  HVSTAVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPAINPALPRDQVNLGEW  734

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             R  +  G++ +I+DPN+ GQI  + L  + E A  CL D G+DRP M DV+W LEFALQ
Sbjct  735  ARTWHRKGELGKIIDPNIAGQIRPDSLEMFAEAAEKCLADYGVDRPTMGDVLWKLEFALQ  794

Query  265  LQDAADKRGGLS  230
            LQ+  D   G S
Sbjct  795  LQEKGDVVDGAS  806



>ref|XP_010034433.1| PREDICTED: receptor-like protein kinase FERONIA [Eucalyptus grandis]
 gb|KCW52047.1| hypothetical protein EUGRSUZ_J01487 [Eucalyptus grandis]
Length=870

 Score =   177 bits (450),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 117/176 (66%), Gaps = 9/176 (5%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVSTAVKG+FGY+DPEYYR +++T+KSDVYSFGVVLFEVLCAR AV    P  ++SLAEW
Sbjct  675  HVSTAVKGTFGYLDPEYYRHQRLTDKSDVYSFGVVLFEVLCARPAVSRMAPMEQISLAEW  734

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             +   ++G V EIVDP+LKG I  ECL ++ EIA +CL+D+G +RP+MNDVVWGL FALQ
Sbjct  735  AQSCCKSGAVEEIVDPHLKGSITPECLNKFCEIAMSCLQDKGANRPSMNDVVWGLNFALQ  794

Query  265  LQ-----DAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENA  113
            LQ     +A D  G               +   G  EA+N S    GG  ++ E A
Sbjct  795  LQVSTELEAMDHVGVSVHDSDDSDHDAASIRGSGSDEASNTS----GGWKSSRETA  846



>gb|KCW87969.1| hypothetical protein EUGRSUZ_A00377, partial [Eucalyptus grandis]
Length=831

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P+LP+ +VSLA+W
Sbjct  657  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPSLPKEQVSLADW  716

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             R     G + +I+DP +KGQ+  EC  ++ E A  CL DQG+DRP M DV+W LE ALQ
Sbjct  717  ARHCQRKGTLDDIIDPCIKGQVTPECYKKFAETAGKCLADQGLDRPPMGDVLWSLELALQ  776

Query  265  LQDAAD  248
            LQ+  D
Sbjct  777  LQENPD  782



>ref|XP_004137258.1| PREDICTED: receptor-like protein kinase FERONIA-like [Cucumis 
sativus]
 gb|KGN53792.1| hypothetical protein Csa_4G129580 [Cucumis sativus]
Length=910

 Score =   177 bits (450),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            H+ST VKGSFGY+DPEYYRR+Q+TEKSDVYSFGVVL EVLCAR  ++    + +V LAEW
Sbjct  703  HISTVVKGSFGYLDPEYYRRQQLTEKSDVYSFGVVLCEVLCARPPLMRLTDKKQVYLAEW  762

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             RR      +++I+DPN+K +I+ ECL +++EIA  C++D GI+RP+MNDVVWGLEFA+Q
Sbjct  763  VRRCNRDNTIAQIIDPNIKNEISPECLRKFIEIAVRCIQDDGINRPSMNDVVWGLEFAVQ  822

Query  265  LQDAADKR  242
            LQ+A+ K+
Sbjct  823  LQEASKKK  830



>ref|XP_002992454.1| hypothetical protein SELMODRAFT_135346 [Selaginella moellendorffii]
 gb|EFJ06392.1| hypothetical protein SELMODRAFT_135346 [Selaginella moellendorffii]
Length=872

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVSTAVKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P LPR +V++AEW
Sbjct  686  HVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPAINPALPREQVNIAEW  745

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
              +    G + +IVD NLKGQ + E L ++ E A  CL +QGIDRPAM DV+W LE+ALQ
Sbjct  746  AMQYQRMGALEQIVDANLKGQCSQESLQKFGETAEKCLAEQGIDRPAMGDVLWNLEYALQ  805

Query  265  LQDAA  251
            LQ+A+
Sbjct  806  LQEAS  810



>ref|XP_008379440.1| PREDICTED: receptor-like protein kinase FERONIA [Malus domestica]
Length=905

 Score =   177 bits (450),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/208 (45%), Positives = 139/208 (67%), Gaps = 11/208 (5%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            H++T  KGSFGY+DPEYYR  Q+TEKSDVYSFGVVL EVLCAR A++    + ++SLA W
Sbjct  709  HITTVAKGSFGYLDPEYYRLNQLTEKSDVYSFGVVLCEVLCARPALVRGPDKKQMSLAHW  768

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             +  Y  G++ +I+DPNLKG+I + C+ ++ ++A +C+ D GI+RP+M+DVVWGLEFALQ
Sbjct  769  AKSCYLKGELDQIMDPNLKGKIGTACMNKFADVAMSCMHDNGINRPSMDDVVWGLEFALQ  828

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAEKLFRTKss  86
            L    +++G L         GF +  KG D  A     +  G + +  E+++ + +T  S
Sbjct  829  LHQ-KEEQGEL---------GFDIDKKGEDEVAVMNDSDALGFSSSLGESSDWMTKTN-S  877

Query  85   atatstsddSLRGQSHTIFSELSNQLGR  2
            +   ST+++ ++G S TIFS + +Q GR
Sbjct  878  SEQNSTTNEPIKGMSRTIFSGIDDQDGR  905



>ref|XP_010065050.1| PREDICTED: receptor-like protein kinase ANXUR2 [Eucalyptus grandis]
Length=858

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P+LP+ +VSLA+W
Sbjct  684  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPSLPKEQVSLADW  743

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             R     G + +I+DP +KGQ+  EC  ++ E A  CL DQG+DRP M DV+W LE ALQ
Sbjct  744  ARHCQRKGTLDDIIDPCIKGQVTPECYKKFAETAGKCLADQGLDRPPMGDVLWSLELALQ  803

Query  265  LQDAAD  248
            LQ+  D
Sbjct  804  LQENPD  809



>ref|XP_002447169.1| hypothetical protein SORBIDRAFT_06g029710 [Sorghum bicolor]
 gb|EES11497.1| hypothetical protein SORBIDRAFT_06g029710 [Sorghum bicolor]
Length=877

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 105/132 (80%), Gaps = 0/132 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P+LP+ +VSLA+W
Sbjct  684  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALSPSLPKEQVSLADW  743

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
               S + G + +I+DP L+G+I+ +C +++ E A  C+ D  IDRP+M DV+W LEFALQ
Sbjct  744  ALHSQKKGILGQIIDPYLQGKISPQCFMKFAETAEKCVADHSIDRPSMADVLWNLEFALQ  803

Query  265  LQDAADKRGGLS  230
            LQ++A+    ++
Sbjct  804  LQESAEDSSSVT  815



>ref|XP_010318820.1| PREDICTED: probable receptor-like protein kinase At5g61350 [Solanum 
lycopersicum]
Length=847

 Score =   177 bits (448),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 108/149 (72%), Gaps = 8/149 (5%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVSTAVKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P LPR +V+LAEW
Sbjct  665  HVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALDPALPREQVNLAEW  724

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
              + ++ G + +I+DP+L G I+ E L +YVE A  CL + G+DRP M DV+W LE+ALQ
Sbjct  725  AMQQHKKGSLEKIIDPHLAGTISPEALRKYVEAAEKCLAEYGVDRPTMGDVLWNLEYALQ  784

Query  265  LQDAA--------DKRGGLSPPRTPERPG  203
            L+ A         +     S P + E+PG
Sbjct  785  LESATPSSVPVKNENENENSKPSSSEQPG  813



>gb|KJB80895.1| hypothetical protein B456_013G120400 [Gossypium raimondii]
Length=851

 Score =   177 bits (448),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE LCAR A+ P+LP+ +VSLA+W
Sbjct  672  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARPALNPSLPKEQVSLADW  731

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                ++ G + +I+DP+LK +I  ECL ++   A  CL DQGIDRP M DV+W LEFALQ
Sbjct  732  ALSCHKKGTLDDIIDPHLKDKIDPECLKKFAGTAVKCLSDQGIDRPHMGDVLWNLEFALQ  791

Query  265  LQDAA  251
            LQ+ A
Sbjct  792  LQETA  796



>ref|XP_010034426.1| PREDICTED: receptor-like protein kinase FERONIA [Eucalyptus grandis]
 gb|KCW52040.1| hypothetical protein EUGRSUZ_J01480 [Eucalyptus grandis]
Length=881

 Score =   177 bits (448),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 114/176 (65%), Gaps = 5/176 (3%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVSTAVKG+FGY+DPEYYR +++T+KSDVYSFGVVLFEVLCAR AV    P  ++SLAEW
Sbjct  687  HVSTAVKGTFGYLDPEYYRHQRLTDKSDVYSFGVVLFEVLCARPAVNRMAPMEQISLAEW  746

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             +   ++G V EIVDP+LKG I  ECL ++ EIA +CL+D+G  R +MNDVVWGL FALQ
Sbjct  747  AQSCCKSGAVEEIVDPHLKGSITPECLNKFCEIAMSCLQDKGAKRSSMNDVVWGLNFALQ  806

Query  265  LQ-----DAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENA  113
            LQ     +A D  G               +   G  E  N SD D G   ++ E A
Sbjct  807  LQVSTELEATDHVGVSVHDSDDSDHDAASIRGSGSDEEINTSDSDSGRWKSSRETA  862



>ref|XP_004304217.1| PREDICTED: receptor-like protein kinase FERONIA [Fragaria vesca 
subsp. vesca]
Length=876

 Score =   177 bits (448),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 97/214 (45%), Positives = 138/214 (64%), Gaps = 20/214 (9%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            H+ST VKGSFGY+DPEYYRR+Q+TEKSDVYSFGVVL EVLCAR A+I    + +++LA W
Sbjct  677  HISTVVKGSFGYLDPEYYRRQQLTEKSDVYSFGVVLCEVLCARPALIRTKEKKQMNLAAW  736

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             +  Y  G + +I+DPNL+G+I + CL ++VE+A +C+ D G +RP+MNDVVW LEFAL+
Sbjct  737  FKTCYGNGTLDQIIDPNLRGKIVNVCLNKFVEVAISCMHDNGNERPSMNDVVWALEFALK  796

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKGG-----DGEAANKSDEDYGGAFTTSENAEKLF  101
            LQ  A+              G  L    G     +    N SDE + G +  S +++   
Sbjct  797  LQQTAE--------------GLELDFNAGKKNEDEAPLVNDSDERFSGIWADSSSSKNSR  842

Query  100  RTKssatatstsdd-SLRGQSHTIFSELSNQLGR  2
             TK+S++  ++S   S++G S T+FSE+ +  GR
Sbjct  843  VTKTSSSDQNSSTSESIKGLSGTVFSEIYDPNGR  876



>gb|KCW52051.1| hypothetical protein EUGRSUZ_J01491 [Eucalyptus grandis]
Length=849

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 113/171 (66%), Gaps = 24/171 (14%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVSTAVKG+FGY+DPEY+R +++T+KSDVYSFGVVLFEVLCAR AV    P  ++SLAEW
Sbjct  679  HVSTAVKGTFGYLDPEYFRHQRLTDKSDVYSFGVVLFEVLCARPAVSRMAPMEQISLAEW  738

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             +   ++G V EIVDP+LKG I  ECL ++ EIA +CL+D+G  RP+MNDVVWGL FALQ
Sbjct  739  AQSCCKSGAVEEIVDPHLKGSITPECLNKFCEIAMSCLQDKGAKRPSMNDVVWGLNFALQ  798

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENA  113
            LQ + +                         EA N SD D GG  ++ E A
Sbjct  799  LQVSTEL------------------------EAINTSDSDSGGWKSSRETA  825



>ref|XP_002874434.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50693.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=857

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 102/139 (73%), Gaps = 4/139 (3%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HV+T VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P+L + +VSL +W
Sbjct  677  HVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPSLSKEQVSLGDW  736

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                   G + +I+DPNLKG+I  ECL ++ + A  CL D G+DRP M DV+W LEFALQ
Sbjct  737  AMNCKRKGTLEDIIDPNLKGKINPECLKKFADTAEKCLSDSGLDRPTMGDVLWNLEFALQ  796

Query  265  LQDAADKRGGLSPPRTPER  209
            LQ+ AD     S  RTP  
Sbjct  797  LQETADG----SRHRTPSH  811



>ref|XP_010914574.1| PREDICTED: receptor-like protein kinase ANXUR2 [Elaeis guineensis]
Length=865

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFEVLCAR A+ P+LPR++VSLA+W
Sbjct  681  HVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPALNPSLPRDQVSLADW  740

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                 + G + +I+DP LKG+I  ECL ++ + A  CL DQG+DRP M DV+W LEFALQ
Sbjct  741  ALHCKKKGFLEDIIDPVLKGKIDPECLKKFADTAEKCLSDQGVDRPTMGDVLWNLEFALQ  800

Query  265  LQD  257
            LQ+
Sbjct  801  LQE  803



>ref|NP_198220.1| receptor-like protein kinase ANXUR2 [Arabidopsis thaliana]
 sp|Q3E8W4.1|ANX2_ARATH RecName: Full=Receptor-like protein kinase ANXUR2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AED93826.1| receptor-like protein kinase ANXUR2 [Arabidopsis thaliana]
Length=858

 Score =   176 bits (446),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 102/137 (74%), Gaps = 4/137 (3%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HV+T VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P+L + +VSL +W
Sbjct  677  HVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPSLSKEQVSLGDW  736

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                   G + +I+DPNLKG+I  ECL ++ + A  CL D G+DRP M DV+W LEFALQ
Sbjct  737  AMNCKRKGTLEDIIDPNLKGKINPECLKKFADTAEKCLSDSGLDRPTMGDVLWNLEFALQ  796

Query  265  LQDAADKRGGLSPPRTP  215
            LQ+ AD     S  RTP
Sbjct  797  LQETADG----SRHRTP  809



>ref|XP_008464585.1| PREDICTED: receptor-like protein kinase FERONIA [Cucumis melo]
Length=898

 Score =   176 bits (447),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            H+ST VKGSFGY+DPEYYRR+Q+TEKSDVYSFGVVL EVLCAR  ++    + +  +A W
Sbjct  701  HISTVVKGSFGYLDPEYYRRQQLTEKSDVYSFGVVLCEVLCARPPLMRVADKKQTHIAGW  760

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             +R  +   +++I+DPN+K +I+ ECL ++VEIA +C++D+GI RP+MNDVVW LEFALQ
Sbjct  761  VQRCAQNNTIAQIIDPNIKNEISPECLRKFVEIAVSCIQDEGIRRPSMNDVVWSLEFALQ  820

Query  265  LQDAADKRGG  236
            LQDA+ K GG
Sbjct  821  LQDASKKNGG  830



>gb|EMS48200.1| Receptor-like protein kinase HERK 1 [Triticum urartu]
Length=807

 Score =   176 bits (445),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 102/134 (76%), Gaps = 2/134 (1%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+++TEKSDVYSFGVVLFEVLC R A+ P+LPR +VSLA+ 
Sbjct  622  HVSTMVKGSFGYLDPEYFRRQKLTEKSDVYSFGVVLFEVLCGRPALNPSLPREQVSLADH  681

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                   G + EIVDP L+G+IA +CL ++ E A  CL DQG+DRP+M DV+W LEFALQ
Sbjct  682  ALSCQRKGTLEEIVDPVLEGKIAPDCLKKFAETAEKCLADQGVDRPSMGDVLWNLEFALQ  741

Query  265  LQDAADKRGGLSPP  224
            +QD  D  G   PP
Sbjct  742  MQDTFDNGG--KPP  753



>ref|XP_010921184.1| PREDICTED: receptor-like protein kinase FERONIA [Elaeis guineensis]
Length=895

 Score =   176 bits (447),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 109/145 (75%), Gaps = 1/145 (1%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR  +   LP+ +VSLAEW
Sbjct  697  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPPLNSTLPKEQVSLAEW  756

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                 + G + +I+DP L+G+IA +C  ++ E A  C+ DQGI+RP+M DV+W LEFALQ
Sbjct  757  ALHCQKKGILDQIIDPYLRGRIAPQCFKKFAETAEKCVADQGIERPSMGDVLWNLEFALQ  816

Query  265  LQDAADKRGGLSPPRTPERPGFPLL  191
            LQ++A++ G L    T E  G PL+
Sbjct  817  LQESAEESGCLIDGATSEE-GTPLM  840



>ref|XP_004962463.1| PREDICTED: receptor-like protein kinase FERONIA-like [Setaria 
italica]
Length=873

 Score =   176 bits (446),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 104/132 (79%), Gaps = 0/132 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P+LP+ +VSLA+W
Sbjct  680  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALSPSLPKEQVSLADW  739

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                 + G + +I+DP L+G+I+ +C +++ E A  C+ D  IDRP+M DV+W LEFALQ
Sbjct  740  ALHCQKKGILGQIIDPYLQGKISLQCFMKFAETAEKCVADHSIDRPSMADVLWNLEFALQ  799

Query  265  LQDAADKRGGLS  230
            LQ++A+    L+
Sbjct  800  LQESAEDNSSLT  811



>ref|XP_007217052.1| hypothetical protein PRUPE_ppa001190mg [Prunus persica]
 gb|EMJ18251.1| hypothetical protein PRUPE_ppa001190mg [Prunus persica]
Length=885

 Score =   176 bits (446),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            H+ST VKGSFGY+DPEYYRR Q+TEKSDVYSFGVVLFEVLCAR A +    + ++SLAEW
Sbjct  683  HISTMVKGSFGYLDPEYYRRNQLTEKSDVYSFGVVLFEVLCARPAFLRTAGKKQMSLAEW  742

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             +  +  G + +I+DP+LKG+I   CL ++VE+A +C+ D GI RP+MNDVVWGLE+ALQ
Sbjct  743  AKSCHREGTLDKIIDPSLKGKIGKACLNKFVEMAISCIHDNGIQRPSMNDVVWGLEYALQ  802

Query  265  LQDAADK  245
            L   A++
Sbjct  803  LHQKAER  809



>ref|XP_008813242.1| PREDICTED: receptor-like protein kinase FERONIA [Phoenix dactylifera]
Length=894

 Score =   176 bits (447),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 110/145 (76%), Gaps = 1/145 (1%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR  +   LP+ +VSLAEW
Sbjct  697  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPPLNSALPKEQVSLAEW  756

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                 + G + +I+DP L+G+IAS+C  ++ E A  C+ D+G++RP+M DV+W LEFALQ
Sbjct  757  ALHCQKKGFLDQIIDPYLRGRIASQCFKKFAETAEKCVSDKGMERPSMGDVLWNLEFALQ  816

Query  265  LQDAADKRGGLSPPRTPERPGFPLL  191
            LQ++A++ G L    T E  G PL+
Sbjct  817  LQESAEESGSLMDGATSEE-GTPLM  840



>ref|XP_009414253.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
 ref|XP_009414254.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
Length=887

 Score =   176 bits (446),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 107/140 (76%), Gaps = 3/140 (2%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P LP+ +VSLAEW
Sbjct  692  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPTLPKEQVSLAEW  751

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                 + G + ++VDP L G+IA +C  ++ E A  C+ D GI+RP+M DV+W LEFALQ
Sbjct  752  ALHCQKKGILDQLVDPFLTGKIAPQCFKKFAETAEKCVADFGIERPSMGDVLWSLEFALQ  811

Query  265  LQDAADKRG---GLSPPRTP  215
            LQ++A++ G   G+S   TP
Sbjct  812  LQESAEESGSIIGISDDTTP  831



>ref|XP_004962493.1| PREDICTED: receptor-like protein kinase ANXUR1-like [Setaria 
italica]
Length=869

 Score =   176 bits (446),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 100/129 (78%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P+LPR +VSLA+ 
Sbjct  687  HVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPSLPREQVSLADH  746

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                   G + +I+DP LKG+IA +CL +Y E A  CL D G+DRP+M DV+W LEFALQ
Sbjct  747  AMSCQRKGTLQDIMDPLLKGKIAPDCLKKYAETAEKCLADHGVDRPSMGDVLWNLEFALQ  806

Query  265  LQDAADKRG  239
            +QD  +  G
Sbjct  807  MQDTFENGG  815



>ref|XP_009391670.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
Length=887

 Score =   176 bits (446),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 103/131 (79%), Gaps = 0/131 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P+LP+ +VSLAEW
Sbjct  692  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPSLPKEQVSLAEW  751

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                   G + +I+DP LKG+IA +C  ++ E A  C+ D G +RP+M DV+W LEFALQ
Sbjct  752  ALHCQRKGMLDQIIDPYLKGKIAPQCFKKFAETAEKCVADIGTERPSMGDVLWNLEFALQ  811

Query  265  LQDAADKRGGL  233
            LQ++A++ G +
Sbjct  812  LQESAEESGSI  822



>tpg|DAA51500.1| TPA: putative receptor-like protein kinase family protein [Zea 
mays]
Length=847

 Score =   176 bits (445),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVSTAVKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFEVLCAR A+ P LPR++V+LAEW
Sbjct  687  HVSTAVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPAINPALPRDQVNLAEW  746

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y  G++++I+DP++ GQ+  + L  + E A  CL D G+DRP+M DV+W LEFALQ
Sbjct  747  ALTWYRKGELNKIIDPHIAGQLRPDSLEMFAEAAEKCLADYGVDRPSMGDVLWKLEFALQ  806

Query  265  LQDAAD  248
            LQ+  D
Sbjct  807  LQEKGD  812



>dbj|BAK06468.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=891

 Score =   176 bits (446),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 103/134 (77%), Gaps = 2/134 (1%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+++TEKSDVYSFGVVLFEVLCAR A+ P+LPR +VSLA+ 
Sbjct  706  HVSTMVKGSFGYLDPEYFRRQKLTEKSDVYSFGVVLFEVLCARPALNPSLPREQVSLADH  765

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                   G + EI+DP L+G++A +CL ++ E A  CL DQG+DRP+M DV+W LEFALQ
Sbjct  766  ALSCQRRGTLEEIIDPVLEGKVAPDCLKKFAETAEKCLSDQGVDRPSMGDVLWNLEFALQ  825

Query  265  LQDAADKRGGLSPP  224
            +QD  D  G   PP
Sbjct  826  MQDTFDNGG--KPP  837



>ref|XP_007030540.1| Malectin/receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY11042.1| Malectin/receptor-like protein kinase family protein [Theobroma 
cacao]
Length=858

 Score =   176 bits (445),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE LCAR A+ P+LP+ +VSLA+W
Sbjct  670  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARPALNPSLPKEQVSLADW  729

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                 + G + +I+DP+LKG+I  ECL ++ + A  CL D G++RP M DV+W LEFALQ
Sbjct  730  ALHCQKKGVLEDIIDPHLKGKIDPECLKKFADTAEKCLSDHGLERPHMGDVLWNLEFALQ  789

Query  265  LQDAAD  248
            LQ+ AD
Sbjct  790  LQETAD  795



>ref|XP_004154760.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
FERONIA-like [Cucumis sativus]
Length=910

 Score =   176 bits (446),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 103/128 (80%), Gaps = 0/128 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            H+ST VKGSFGY+DPEYYRR+Q+TEKSDVYSFGVVL EVLCAR  ++    + +V LAEW
Sbjct  703  HISTVVKGSFGYLDPEYYRRQQLTEKSDVYSFGVVLCEVLCARPPLMRLTDKKQVYLAEW  762

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             RR      + +I+DPN+K +I+ ECL +++EIA  C++D GI+RP+MNDVVWGLEFA+Q
Sbjct  763  VRRCNRDNRLXQIIDPNIKNEISPECLRKFIEIAVRCIQDDGINRPSMNDVVWGLEFAVQ  822

Query  265  LQDAADKR  242
            LQ+A+ K+
Sbjct  823  LQEASKKK  830



>ref|XP_006593700.1| PREDICTED: receptor-like protein kinase FERONIA-like [Glycine 
max]
Length=819

 Score =   175 bits (444),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 101/128 (79%), Gaps = 0/128 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEYY+R ++TEKSDVYSFGVVLFE+LCAR  +I N    +VSLA W
Sbjct  675  HVSTNVKGSFGYLDPEYYKRNRLTEKSDVYSFGVVLFEILCARPPLIHNAETEQVSLANW  734

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             R  Y+ G +++IVDP+LKG IA EC  ++ EI  +CL + G+ RP++ND+VW LEFALQ
Sbjct  735  ARCCYQNGTMAQIVDPSLKGTIAPECFEKFCEIGMSCLLEDGMHRPSINDIVWLLEFALQ  794

Query  265  LQDAADKR  242
            LQ+ AD+R
Sbjct  795  LQEDADQR  802



>ref|XP_008344357.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
FERONIA [Malus domestica]
Length=492

 Score =   172 bits (436),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 102/128 (80%), Gaps = 0/128 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            H+STAVKGSFGY+DPEYYRR+Q+T KSDVYSFGVVL EVLCAR AV+      +++LAEW
Sbjct  330  HISTAVKGSFGYLDPEYYRRQQLTVKSDVYSFGVVLCEVLCARPAVVHATETRQMNLAEW  389

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             +  +  G++ +I+DPN+KG+I +ECL +YVEIA +C+ D G++RP+MNDVV GLEFALQ
Sbjct  390  TKSCHRDGELDQIIDPNMKGKIETECLNKYVEIAMSCINDSGMERPSMNDVVRGLEFALQ  449

Query  265  LQDAADKR  242
            L     +R
Sbjct  450  LHQNRGER  457



>ref|XP_008464586.1| PREDICTED: receptor-like protein kinase FERONIA [Cucumis melo]
Length=914

 Score =   176 bits (446),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 93/217 (43%), Positives = 137/217 (63%), Gaps = 25/217 (12%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            H+ST VKGSFGY+DPEYYRR+Q+TEKSDVYSFGVVL E+LCAR  ++ +  + +V LAEW
Sbjct  714  HISTVVKGSFGYLDPEYYRRQQLTEKSDVYSFGVVLCEILCARPPLVHSADKKEVYLAEW  773

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             R+ +    V++ +D N++ +I+ ECL +++EIA +C++D G+ RP+MNDVVWGLEFALQ
Sbjct  774  VRQCHRNNTVAQTIDKNIRNEISPECLRKFIEIAVSCVEDDGVKRPSMNDVVWGLEFALQ  833

Query  265  LQDAADKR------GGLSPPRTPERPGF--PLLAKGGDGEAANKSDEDYG-GAFTTSENA  113
            LQ+A+ K+      G      + ER      L +  G G    + D + G  ++ T+ N+
Sbjct  834  LQEASKKKVDEDDVGSGKRDSSEERWWLDETLFSSTGSG----RRDSELGVSSYVTTSNS  889

Query  112  EKLFRTKssatatstsddSLRGQSHTIFSELSNQLGR  2
            +    T +            +G S T+FSE+ +  GR
Sbjct  890  DDSSYTHT------------KGMSGTVFSEIKDPAGR  914



>ref|XP_008665441.1| PREDICTED: probable receptor-like protein kinase At5g61350 [Zea 
mays]
Length=837

 Score =   175 bits (444),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVSTAVKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFEVLCAR A+ P LPR++V+LAEW
Sbjct  677  HVSTAVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPAINPALPRDQVNLAEW  736

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                Y  G++++I+DP++ GQ+  + L  + E A  CL D G+DRP+M DV+W LEFALQ
Sbjct  737  ALTWYRKGELNKIIDPHIAGQLRPDSLEMFAEAAEKCLADYGVDRPSMGDVLWKLEFALQ  796

Query  265  LQDAAD  248
            LQ+  D
Sbjct  797  LQEKGD  802



>ref|XP_006840306.1| hypothetical protein AMTR_s00045p00071050 [Amborella trichopoda]
 gb|ERN01981.1| hypothetical protein AMTR_s00045p00071050 [Amborella trichopoda]
Length=857

 Score =   175 bits (444),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 118/177 (67%), Gaps = 5/177 (3%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVSTAVKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFEVLCAR A+ P LPR +V+LAEW
Sbjct  674  HVSTAVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPAINPALPREQVNLAEW  733

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
              + +  G + +I+DP++ G I +  L +YVE A  CL D G+DRP+M DV+W LE+ALQ
Sbjct  734  ALQWHRKGLLQKIIDPHVIGSINAASLKKYVEAAEKCLADYGVDRPSMGDVLWNLEYALQ  793

Query  265  LQDAADKRGGLSPPRT-----PERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAE  110
            LQ+AA    G   P        +RP   L        + + SD++ G   ++   A+
Sbjct  794  LQEAASSAVGEDDPSANHILHQQRPPTVLDTTAKGSHSRSSSDDESGPTLSSPMFAQ  850



>ref|XP_011009253.1| PREDICTED: receptor-like protein kinase FERONIA [Populus euphratica]
Length=833

 Score =   175 bits (444),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 99/129 (77%), Gaps = 3/129 (2%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST V+GS GYVDPEYYRR+ +TEKSDVYSFGVVLFEVLCAR  VIP+ P+ + SLAEW
Sbjct  695  HVSTVVRGSIGYVDPEYYRRQHLTEKSDVYSFGVVLFEVLCARPPVIPSSPKEQASLAEW  754

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             RR Y+ G + +IVD   KG++A   L ++ EIA +CL  QGI+RP M DVVWGLEFALQ
Sbjct  755  ARRCYQRGTLDQIVD---KGEVAPVSLNKFAEIANSCLHGQGIERPKMGDVVWGLEFALQ  811

Query  265  LQDAADKRG  239
            LQ  A+K  
Sbjct  812  LQQTAEKNA  820



>ref|XP_006493304.1| PREDICTED: receptor-like protein kinase FERONIA-like [Citrus 
sinensis]
Length=893

 Score =   176 bits (445),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGS GY+DPEYYR +Q+TEKSDVYSFGVVLFEVLCAR  ++    + +VSLA W
Sbjct  688  HVSTVVKGSVGYLDPEYYRLQQLTEKSDVYSFGVVLFEVLCARPPILRTADKKQVSLAVW  747

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             ++ Y+ G + +IVDP LKG+I  ECL +Y E+A +CL D+GI RP+M+DVVWGLEFALQ
Sbjct  748  AQQCYQNGTIDQIVDPFLKGKIKPECLNKYAEVAMSCLNDEGIRRPSMSDVVWGLEFALQ  807

Query  265  LQDAA  251
            LQ+++
Sbjct  808  LQESS  812



>gb|KEH24563.1| malectin/receptor-like kinase family protein [Medicago truncatula]
Length=872

 Score =   175 bits (444),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE LCAR  + PNLP+ +VSLAEW
Sbjct  685  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARPVLNPNLPKEQVSLAEW  744

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                 + G + +I+DPNLKG I  E L ++V+ A  CL D G DRP+MND++W LEFAL 
Sbjct  745  ALLCNQKGTLEDIIDPNLKGTINPESLQKFVDTAEKCLSDHGADRPSMNDLLWNLEFALN  804

Query  265  LQDAAD  248
            LQ+  D
Sbjct  805  LQENKD  810



>ref|NP_001237588.1| FERONIA receptor-like kinase [Glycine max]
 gb|ACM89471.1| FERONIA receptor-like kinase [Glycine max]
Length=708

 Score =   174 bits (440),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 102/128 (80%), Gaps = 0/128 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGS GY+DPEYY+R+++TEKSDVYSFGVVLFE+LCAR  +I    + +VSLA+W
Sbjct  505  HVSTVVKGSIGYLDPEYYKRQRLTEKSDVYSFGVVLFELLCARPPLIRTAEKKQVSLADW  564

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             R   + G + +IVDP LKG++A ECL ++ E+A +CL D G  RP+MNDVVW LEFALQ
Sbjct  565  ARHCCQNGTIGQIVDPTLKGRMAPECLRKFCEVAVSCLLDDGTLRPSMNDVVWMLEFALQ  624

Query  265  LQDAADKR  242
            LQ++A++R
Sbjct  625  LQESAEQR  632



>gb|EMS63765.1| Receptor-like protein kinase FERONIA [Triticum urartu]
Length=819

 Score =   174 bits (442),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 109/148 (74%), Gaps = 2/148 (1%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P L + +VSLAEW
Sbjct  623  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPTLAKEEVSLAEW  682

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
                 + G + +IVDP LKG+I  +C  ++ E A  C+ D GI+RP+M DV+W LEFALQ
Sbjct  683  ALHCQKKGILDQIVDPYLKGKIVPQCFKKFAETAEKCVADNGIERPSMGDVLWNLEFALQ  742

Query  265  LQDAADKRGGLSPPRTPERPGFPLLAKG  182
            +Q++A++ G +    + E  G PL+  G
Sbjct  743  MQESAEESGSIGCGMSDE--GTPLVMVG  768



>dbj|BAJ93584.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=885

 Score =   175 bits (444),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 105/132 (80%), Gaps = 0/132 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            HVST VKGSFGY+DPEY+RR+Q++EKSDVYSFGVVLFEVLCAR A+ P+LP+ ++SLA+W
Sbjct  688  HVSTVVKGSFGYLDPEYFRRQQLSEKSDVYSFGVVLFEVLCARPALSPSLPKEQISLADW  747

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
              R  + G + +I+DP L+G+IA +C +++ E A  C+ D+ +DRP+M DV+W LEFALQ
Sbjct  748  ALRCQKQGVLGQIIDPMLQGRIAPQCFVKFTETAEKCVADRSVDRPSMGDVLWNLEFALQ  807

Query  265  LQDAADKRGGLS  230
            LQ++ +    L+
Sbjct  808  LQESDEDTSSLT  819



>ref|XP_002530992.1| kinase, putative [Ricinus communis]
 gb|EEF31380.1| kinase, putative [Ricinus communis]
Length=904

 Score =   175 bits (444),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 102/128 (80%), Gaps = 0/128 (0%)
 Frame = -1

Query  625  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  446
            H+ST VKGSFGY+DPEYYR +++TEKSDVYSFGVVLFEVL AR  V  +     VSLAEW
Sbjct  699  HISTVVKGSFGYLDPEYYRLQRLTEKSDVYSFGVVLFEVLSARPPVSKSSFNKPVSLAEW  758

Query  445  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  266
             R+ Y  G + +IVDP+LKG+IA +CL ++ E+A +CL D G+DRP+M+DVVWGLEFALQ
Sbjct  759  ARQCYRKGTLDDIVDPHLKGKIAPDCLKKFFELAVSCLLDNGMDRPSMSDVVWGLEFALQ  818

Query  265  LQDAADKR  242
            LQ+ A K+
Sbjct  819  LQETAIKQ  826



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897347644380