BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS071D08

Length=613
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFK35109.1|  unknown                                                 331   3e-107   Medicago truncatula
ref|XP_003622688.1|  Pectinesterase                                     330   3e-107   Medicago truncatula
emb|CAA47810.1|  pectinesterase                                         327   8e-106   Pisum sativum [garden pea]
gb|AAC14742.1|  pectin methylesterase                                   327   8e-106   Pisum sativum [garden pea]
dbj|BAC67661.1|  pectin methylesterase                                  327   1e-105   Pisum sativum [garden pea]
gb|ACJ85768.1|  unknown                                                 326   2e-105   Medicago truncatula
ref|XP_007157172.1|  hypothetical protein PHAVU_002G048700g             324   7e-105   Phaseolus vulgaris [French bean]
ref|XP_009589961.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    323   2e-104   
gb|KHN30453.1|  Pectinesterase 2.2                                      319   6e-104   Glycine soja [wild soybean]
emb|CAD29733.1|  pectin methylesterase                                  322   7e-104   Sesbania rostrata
ref|XP_002317208.1|  pectin methylesterase family protein               321   2e-103   
dbj|BAC67662.1|  pectin methylesterase                                  321   2e-103   Pisum sativum [garden pea]
ref|XP_002518523.1|  Pectinesterase precursor, putative                 320   3e-103   Ricinus communis
ref|XP_004492227.1|  PREDICTED: pectinesterase/pectinesterase inh...    320   3e-103   Cicer arietinum [garbanzo]
ref|XP_009589755.1|  PREDICTED: pectinesterase-like                     320   4e-103   Nicotiana tomentosiformis
ref|XP_006573891.1|  PREDICTED: pectinesterase/pectinesterase inh...    320   5e-103   Glycine max [soybeans]
ref|XP_009771261.1|  PREDICTED: pectinesterase-like                     318   1e-102   Nicotiana sylvestris
ref|XP_009769268.1|  PREDICTED: pectinesterase-like                     317   4e-102   Nicotiana sylvestris
ref|XP_010267745.1|  PREDICTED: pectinesterase                          315   3e-101   Nelumbo nucifera [Indian lotus]
ref|XP_011000694.1|  PREDICTED: pectinesterase                          314   9e-101   Populus euphratica
ref|XP_010101471.1|  Pectinesterase/pectinesterase inhibitor            313   2e-100   Morus notabilis
emb|CBI23178.3|  unnamed protein product                                311   2e-100   Vitis vinifera
ref|XP_004232737.1|  PREDICTED: pectinesterase-like                     312   3e-100   Solanum lycopersicum
ref|XP_006348082.1|  PREDICTED: pectinesterase/pectinesterase inh...    310   4e-100   Solanum tuberosum [potatoes]
ref|XP_007157170.1|  hypothetical protein PHAVU_002G048500g             312   5e-100   Phaseolus vulgaris [French bean]
ref|XP_002266980.1|  PREDICTED: pectinesterase                          311   9e-100   Vitis vinifera
ref|XP_004492228.1|  PREDICTED: pectinesterase 2.1-like                 310   2e-99    Cicer arietinum [garbanzo]
gb|AFK44272.1|  unknown                                                 310   4e-99    Lotus japonicus
ref|XP_010316615.1|  PREDICTED: pectinesterase-like                     309   5e-99    Solanum lycopersicum
gb|KDP20786.1|  hypothetical protein JCGZ_21257                         308   1e-98    Jatropha curcas
emb|CDO99717.1|  unnamed protein product                                304   3e-97    Coffea canephora [robusta coffee]
ref|XP_003622699.1|  Pectinesterase                                     305   4e-97    Medicago truncatula
ref|XP_003622696.1|  Pectinesterase                                     303   1e-96    Medicago truncatula
ref|XP_007025998.1|  Pectinesterase/pectinesterase inhibitor, put...    302   3e-96    
emb|CDO99718.1|  unnamed protein product                                301   7e-96    Coffea canephora [robusta coffee]
gb|KDO75533.1|  hypothetical protein CISIN_1g008722mg                   301   1e-95    Citrus sinensis [apfelsine]
ref|XP_006449081.1|  hypothetical protein CICLE_v10014787mg             300   2e-95    Citrus clementina [clementine]
ref|XP_011095339.1|  PREDICTED: pectinesterase 2.1-like                 300   2e-95    Sesamum indicum [beniseed]
emb|CDP05792.1|  unnamed protein product                                295   1e-94    Coffea canephora [robusta coffee]
gb|KJB57711.1|  hypothetical protein B456_009G176700                    297   2e-94    Gossypium raimondii
gb|AHC69829.1|  pectin methylesterase PME2.1                            297   3e-94    Nicotiana tabacum [American tobacco]
ref|XP_009768199.1|  PREDICTED: pectinesterase 2.1-like                 297   4e-94    Nicotiana sylvestris
ref|XP_006467993.1|  PREDICTED: pectinesterase/pectinesterase inh...    296   5e-94    Citrus sinensis [apfelsine]
ref|XP_007157169.1|  hypothetical protein PHAVU_002G048400g             296   6e-94    Phaseolus vulgaris [French bean]
ref|NP_001233948.1|  pectinesterase 2.1                                 293   6e-93    Solanum lycopersicum
gb|AAB67739.1|  pectin methylesterase PME2.1                            293   7e-93    Solanum lycopersicum
gb|KHG26245.1|  Pectinesterase/pectinesterase inhibitor                 291   8e-93    Gossypium arboreum [tree cotton]
pir||S00629  pectinesterase (EC 3.1.1.11) precursor (clone PE1) -...    288   8e-93 
gb|ABK94644.1|  unknown                                                 285   1e-92    Populus trichocarpa [western balsam poplar]
ref|XP_004293266.1|  PREDICTED: pectinesterase                          292   2e-92    Fragaria vesca subsp. vesca
ref|NP_001274785.1|  pectin methyl esterase                             291   4e-92    Solanum tuberosum [potatoes]
gb|AAF23891.1|  pectin methyl esterase                                  291   4e-92    Solanum tuberosum [potatoes]
ref|XP_007157171.1|  hypothetical protein PHAVU_002G048600g             291   6e-92    Phaseolus vulgaris [French bean]
gb|KJB67143.1|  hypothetical protein B456_010G177500                    291   8e-92    Gossypium raimondii
ref|XP_008224789.1|  PREDICTED: pectinesterase                          290   1e-91    Prunus mume [ume]
emb|CAA66360.1|  pectin methylesterase                                  279   1e-91    Solanum tuberosum [potatoes]
sp|Q96575.1|PME22_SOLLC  RecName: Full=Pectinesterase 2.2; Short=...    290   2e-91    Solanum lycopersicum
ref|XP_006360082.1|  PREDICTED: pectinesterase 3-like                   289   3e-91    Solanum tuberosum [potatoes]
ref|XP_007213952.1|  hypothetical protein PRUPE_ppa003697mg             289   4e-91    Prunus persica
ref|XP_009364480.1|  PREDICTED: pectinesterase                          289   4e-91    Pyrus x bretschneideri [bai li]
ref|XP_006417343.1|  hypothetical protein EUTSA_v10007263mg             288   6e-91    Eutrema salsugineum [saltwater cress]
ref|XP_002522859.1|  Pectinesterase-2 precursor, putative               287   2e-90    Ricinus communis
gb|AAB67740.1|  PME1.9                                                  282   9e-90    Solanum lycopersicum
ref|XP_010057972.1|  PREDICTED: pectinesterase-like                     285   1e-89    Eucalyptus grandis [rose gum]
ref|XP_008371117.1|  PREDICTED: pectinesterase                          284   4e-89    
ref|XP_010493017.1|  PREDICTED: pectinesterase/pectinesterase inh...    283   8e-89    Camelina sativa [gold-of-pleasure]
ref|XP_010458561.1|  PREDICTED: pectinesterase/pectinesterase inh...    283   9e-89    Camelina sativa [gold-of-pleasure]
ref|NP_172624.1|  methylesterase PCR A                                  283   9e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010923950.1|  PREDICTED: pectinesterase-like                     283   1e-88    Elaeis guineensis
gb|AAK59760.1|  At1g11580/T23J18_33                                     283   1e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307176.1|  hypothetical protein CARUB_v10008769mg             282   2e-88    Capsella rubella
ref|NP_001234151.1|  pectinesterase 1 precursor                         281   3e-88    Solanum lycopersicum
ref|XP_010476087.1|  PREDICTED: pectinesterase/pectinesterase inh...    281   5e-88    Camelina sativa [gold-of-pleasure]
ref|XP_010324324.1|  PREDICTED: pectinesterase 3                        280   7e-88    
emb|CAA96434.1|  pectin methylesterase                                  273   7e-88    Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_010057974.1|  PREDICTED: pectinesterase-like                     280   9e-88    Eucalyptus grandis [rose gum]
ref|XP_006360083.1|  PREDICTED: pectinesterase 2.1-like                 280   1e-87    Solanum tuberosum [potatoes]
gb|AFC98398.1|  pectin methylesterase                                   280   1e-87    Lepidium sativum
ref|XP_008809854.1|  PREDICTED: pectinesterase-like                     280   1e-87    Phoenix dactylifera
ref|XP_011016647.1|  PREDICTED: pectinesterase-like                     280   1e-87    Populus euphratica
ref|XP_011030843.1|  PREDICTED: pectinesterase-like                     280   2e-87    Populus euphratica
emb|CAA64217.1|  pectinmethylesterase                                   271   3e-87    Vigna radiata var. radiata [golden gram]
emb|CAA96435.1|  pectin methylesterase                                  271   5e-87    Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|AAB38794.1|  pectin methylesterase                                   275   7e-87    Solanum lycopersicum
ref|XP_002889876.1|  At1g11580/T23J18_33                                278   8e-87    
ref|XP_010553426.1|  PREDICTED: pectinesterase/pectinesterase inh...    278   1e-86    Tarenaya hassleriana [spider flower]
emb|CDY34642.1|  BnaC08g42010D                                          274   2e-86    Brassica napus [oilseed rape]
gb|EYU19222.1|  hypothetical protein MIMGU_mgv1a003983mg                276   2e-86    Erythranthe guttata [common monkey flower]
ref|XP_006377839.1|  hypothetical protein POPTR_0011s13830g             276   3e-86    
ref|XP_004134752.1|  PREDICTED: pectinesterase/pectinesterase inh...    276   3e-86    Cucumis sativus [cucumbers]
gb|AFK41384.1|  unknown                                                 271   3e-86    Lotus japonicus
ref|XP_008439965.1|  PREDICTED: pectinesterase                          276   4e-86    Cucumis melo [Oriental melon]
ref|XP_004155595.1|  PREDICTED: pectinesterase/pectinesterase inh...    276   5e-86    
gb|KFK43434.1|  hypothetical protein AALP_AA1G125000                    276   6e-86    Arabis alpina [alpine rockcress]
ref|XP_011016743.1|  PREDICTED: pectinesterase-like                     275   1e-85    Populus euphratica
ref|XP_006646399.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    273   2e-85    
ref|XP_009118185.1|  PREDICTED: pectinesterase/pectinesterase inh...    274   2e-85    
ref|XP_009397166.1|  PREDICTED: pectinesterase-like                     274   3e-85    Musa acuminata subsp. malaccensis [pisang utan]
sp|Q96576.1|PME3_SOLLC  RecName: Full=Pectinesterase 3; Short=PE ...    273   5e-85    Solanum lycopersicum
emb|CAA48170.1|  pectinesterase                                         261   1e-84    Phaseolus vulgaris [French bean]
ref|XP_006843574.1|  hypothetical protein AMTR_s00007p00101250          270   9e-84    
ref|XP_011095338.1|  PREDICTED: pectinesterase 2.1-like                 270   3e-83    Sesamum indicum [beniseed]
emb|CAA66361.1|  pectin methylesterase                                  256   2e-82    Solanum tuberosum [potatoes]
emb|CDM84519.1|  unnamed protein product                                263   3e-82    Triticum aestivum [Canadian hard winter wheat]
sp|P83947.1|PME1_FICPW  RecName: Full=Pectinesterase/pectinestera...    265   8e-82    Ficus pumila var. awkeotsang [jelly fig]
ref|XP_010101474.1|  Pectinesterase/pectinesterase inhibitor            264   2e-81    Morus notabilis
gb|ABK24761.1|  unknown                                                 264   2e-81    Picea sitchensis
gb|EMT17767.1|  Pectinesterase/pectinesterase inhibitor 18              257   4e-81    
ref|NP_001044480.1|  Os01g0788400                                       263   5e-81    
gb|EAY76103.1|  hypothetical protein OsI_04029                          262   7e-81    Oryza sativa Indica Group [Indian rice]
gb|ACJ02103.1|  pectin methylesterase                                   260   3e-80    Oncidium hybrid cultivar
ref|XP_002456465.1|  hypothetical protein SORBIDRAFT_03g036790          261   3e-80    Sorghum bicolor [broomcorn]
ref|XP_003564371.1|  PREDICTED: pectinesterase                          259   2e-79    Brachypodium distachyon [annual false brome]
dbj|BAK05307.1|  predicted protein                                      258   3e-79    Hordeum vulgare subsp. vulgare [two-rowed barley]
pdb|1XG2|A  Chain A, Crystal Structure Of The Complex Between Pec...    249   2e-78    Actinidia chinensis
ref|XP_010088582.1|  Pectinesterase/pectinesterase inhibitor            256   2e-77    
gb|AGR44473.1|  pectin methylesterase 4                                 248   1e-76    Pyrus x bretschneideri [bai li]
ref|XP_009359674.1|  PREDICTED: pectinesterase/pectinesterase inh...    248   1e-75    Pyrus x bretschneideri [bai li]
dbj|BAF42041.1|  pectin methylesterase 4                                246   5e-75    Pyrus communis
ref|XP_008337790.1|  PREDICTED: pectinesterase/pectinesterase inh...    244   2e-74    Malus domestica [apple tree]
ref|XP_010273801.1|  PREDICTED: pectinesterase                          246   4e-74    Nelumbo nucifera [Indian lotus]
gb|EYU29495.1|  hypothetical protein MIMGU_mgv1a005211mg                242   1e-73    Erythranthe guttata [common monkey flower]
emb|CBI27741.3|  unnamed protein product                                238   1e-73    Vitis vinifera
gb|EPS63029.1|  hypothetical protein M569_11757                         241   4e-73    Genlisea aurea
gb|KDP33985.1|  hypothetical protein JCGZ_07556                         242   7e-73    Jatropha curcas
ref|XP_006841486.1|  hypothetical protein AMTR_s00003p00120050          240   2e-72    Amborella trichopoda
ref|XP_008795768.1|  PREDICTED: pectinesterase-like                     240   3e-72    Phoenix dactylifera
ref|XP_010266280.1|  PREDICTED: pectinesterase-like                     239   4e-72    Nelumbo nucifera [Indian lotus]
ref|XP_010259481.1|  PREDICTED: pectinesterase-like                     240   4e-72    Nelumbo nucifera [Indian lotus]
ref|XP_007024771.1|  Pectin methylesterase 3 isoform 2                  238   5e-72    
ref|XP_010656074.1|  PREDICTED: pectinesterase-like                     239   7e-72    Vitis vinifera
ref|XP_010273802.1|  PREDICTED: pectinesterase/pectinesterase inh...    237   1e-71    Nelumbo nucifera [Indian lotus]
ref|XP_011072691.1|  PREDICTED: pectinesterase-like                     238   2e-71    Sesamum indicum [beniseed]
ref|XP_002265171.1|  PREDICTED: pectinesterase                          239   2e-71    Vitis vinifera
ref|XP_009369733.1|  PREDICTED: pectinesterase/pectinesterase inh...    236   3e-71    Pyrus x bretschneideri [bai li]
ref|XP_004303758.1|  PREDICTED: pectinesterase-like                     237   5e-71    Fragaria vesca subsp. vesca
ref|XP_004972208.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    236   5e-71    
gb|KJB54563.1|  hypothetical protein B456_009G039100                    237   5e-71    Gossypium raimondii
ref|XP_010271268.1|  PREDICTED: pectinesterase-like                     236   6e-71    Nelumbo nucifera [Indian lotus]
ref|XP_007024770.1|  Pectin methylesterase 3 isoform 1                  237   7e-71    
ref|XP_008242144.1|  PREDICTED: pectinesterase/pectinesterase inh...    235   1e-70    Prunus mume [ume]
gb|AFW03481.1|  pectin methylesterase 2                                 234   4e-70    Gossypium hirsutum [American cotton]
gb|AFB77929.1|  pectin methylesterase                                   235   4e-70    Gossypium hirsutum [American cotton]
ref|XP_009383893.1|  PREDICTED: pectinesterase-like                     234   4e-70    Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW03476.1|  pectin methylesterase 2                                 233   4e-70    Gossypium barbadense [Egyptian cotton]
ref|XP_006828611.1|  hypothetical protein AMTR_s00129p00070300          236   5e-70    
gb|AFQ23194.1|  pectin methylesterase                                   235   5e-70    Theobroma cacao [chocolate]
ref|XP_009606552.1|  PREDICTED: pectinesterase/pectinesterase inh...    235   5e-70    Nicotiana tomentosiformis
gb|AER38243.1|  PME2                                                    233   5e-70    Gossypium barbadense [Egyptian cotton]
ref|XP_007012502.1|  Pectin methylesterase 3                            234   6e-70    
emb|CAB95025.1|  pectin methylesterase                                  234   6e-70    Nicotiana tabacum [American tobacco]
ref|XP_009762395.1|  PREDICTED: pectinesterase/pectinesterase inh...    234   7e-70    Nicotiana sylvestris
ref|XP_009767827.1|  PREDICTED: pectinesterase-like                     234   7e-70    Nicotiana sylvestris
ref|XP_011005059.1|  PREDICTED: pectinesterase 3-like                   234   8e-70    Populus euphratica
ref|XP_007133558.1|  hypothetical protein PHAVU_011G1890000g            230   9e-70    Phaseolus vulgaris [French bean]
ref|XP_008228105.1|  PREDICTED: pectinesterase                          234   9e-70    Prunus mume [ume]
ref|XP_011012638.1|  PREDICTED: pectinesterase-like                     234   1e-69    Populus euphratica
ref|XP_010271269.1|  PREDICTED: pectinesterase-like                     233   1e-69    Nelumbo nucifera [Indian lotus]
sp|Q43062.1|PME_PRUPE  RecName: Full=Pectinesterase/pectinesteras...    233   1e-69    Prunus persica
gb|AFB77928.1|  pectin methylesterase                                   233   1e-69    Gossypium hirsutum [American cotton]
ref|XP_009382521.1|  PREDICTED: pectinesterase-like                     233   1e-69    Musa acuminata subsp. malaccensis [pisang utan]
gb|KHF97383.1|  Pectinesterase/pectinesterase inhibitor U1              233   1e-69    Gossypium arboreum [tree cotton]
ref|XP_011069392.1|  PREDICTED: pectinesterase-like                     229   2e-69    Sesamum indicum [beniseed]
ref|XP_009766961.1|  PREDICTED: probable pectinesterase/pectinest...    233   2e-69    Nicotiana sylvestris
gb|AGG23325.1|  pectin methylesterase 1                                 233   2e-69    Musa acuminata AAA Group [Cavendish banana]
ref|XP_006465803.1|  PREDICTED: pectinesterase 3-like                   233   2e-69    Citrus sinensis [apfelsine]
ref|XP_004309290.2|  PREDICTED: putative pectinesterase/pectinest...    223   2e-69    Fragaria vesca subsp. vesca
gb|KDP28780.1|  hypothetical protein JCGZ_14551                         231   2e-69    Jatropha curcas
gb|ACQ85264.1|  pectin methylesterase                                   233   2e-69    Musa acuminata AAA Group [Cavendish banana]
ref|XP_007204326.1|  hypothetical protein PRUPE_ppa004300mg             231   2e-69    Prunus persica
gb|KHG08631.1|  Pectinesterase 3                                        233   3e-69    Gossypium arboreum [tree cotton]
ref|XP_010047424.1|  PREDICTED: pectinesterase-like                     233   3e-69    Eucalyptus grandis [rose gum]
ref|XP_011076284.1|  PREDICTED: probable pectinesterase/pectinest...    233   3e-69    Sesamum indicum [beniseed]
ref|XP_007217169.1|  hypothetical protein PRUPE_ppa003285mg             233   3e-69    Prunus persica
ref|XP_010520512.1|  PREDICTED: probable pectinesterase/pectinest...    231   3e-69    Tarenaya hassleriana [spider flower]
ref|XP_010258716.1|  PREDICTED: putative pectinesterase/pectinest...    233   3e-69    Nelumbo nucifera [Indian lotus]
gb|AAO85706.1|  pectin methyl-esterase                                  233   3e-69    Nicotiana benthamiana
ref|NP_001274969.1|  pectin methyl esterase                             233   3e-69    Solanum tuberosum [potatoes]
gb|AJH66132.1|  pectin methylesterase                                   233   3e-69    Malus domestica [apple tree]
ref|XP_008348472.1|  PREDICTED: pectinesterase-like                     233   3e-69    
gb|AAK69696.1|AF355057_1  putative pectin methylesterase LuPME5         232   4e-69    Linum usitatissimum
ref|XP_006828588.1|  hypothetical protein AMTR_s00129p00047530          231   4e-69    Amborella trichopoda
gb|KJB57093.1|  hypothetical protein B456_009G147900                    232   4e-69    Gossypium raimondii
ref|XP_010230835.1|  PREDICTED: pectinesterase-like                     232   4e-69    Brachypodium distachyon [annual false brome]
ref|XP_010465323.1|  PREDICTED: pectinesterase/pectinesterase inh...    233   4e-69    Camelina sativa [gold-of-pleasure]
ref|XP_011078159.1|  PREDICTED: pectinesterase-like isoform X1          232   5e-69    Sesamum indicum [beniseed]
ref|XP_006295807.1|  hypothetical protein CARUB_v10024933mg             226   5e-69    
ref|XP_009601611.1|  PREDICTED: pectinesterase-like                     232   5e-69    Nicotiana tomentosiformis
gb|EEC82670.1|  hypothetical protein OsI_27314                          232   6e-69    Oryza sativa Indica Group [Indian rice]
ref|NP_001060620.1|  Os07g0675100                                       232   6e-69    
ref|XP_010043041.1|  PREDICTED: putative pectinesterase/pectinest...    231   6e-69    Eucalyptus grandis [rose gum]
gb|AAG17110.1|AF188895_1  putative pectin methylesterase 3              231   6e-69    Linum usitatissimum
ref|XP_008653464.1|  PREDICTED: pectinesterase-like                     232   8e-69    Zea mays [maize]
ref|XP_007052106.1|  Pectinesterase 2                                   230   9e-69    
ref|XP_009612569.1|  PREDICTED: probable pectinesterase/pectinest...    231   9e-69    Nicotiana tomentosiformis
ref|XP_010271283.1|  PREDICTED: pectinesterase                          230   1e-68    
gb|KCW73020.1|  hypothetical protein EUGRSUZ_E01454                     228   1e-68    Eucalyptus grandis [rose gum]
ref|XP_010917364.1|  PREDICTED: pectinesterase                          229   1e-68    Elaeis guineensis
sp|P83948.1|PME3_CITSI  RecName: Full=Pectinesterase 3; Short=PE ...    231   2e-68    Citrus sinensis [apfelsine]
ref|XP_010271267.1|  PREDICTED: pectinesterase-like                     229   2e-68    Nelumbo nucifera [Indian lotus]
ref|XP_010534986.1|  PREDICTED: pectinesterase/pectinesterase inh...    231   2e-68    Tarenaya hassleriana [spider flower]
ref|XP_006381544.1|  hypothetical protein POPTR_0006s13700g             231   2e-68    Populus trichocarpa [western balsam poplar]
ref|XP_003627458.1|  Pectinesterase                                     231   2e-68    Medicago truncatula
ref|XP_006307088.1|  hypothetical protein CARUB_v10008673mg             231   2e-68    Capsella rubella
gb|AFW03475.1|  pectin methylesterase 1                                 231   2e-68    Gossypium barbadense [Egyptian cotton]
ref|XP_002515781.1|  Pectinesterase-3 precursor, putative               230   2e-68    Ricinus communis
gb|EYU29496.1|  hypothetical protein MIMGU_mgv1a003055mg                231   2e-68    Erythranthe guttata [common monkey flower]
ref|XP_011092101.1|  PREDICTED: putative pectinesterase/pectinest...    229   2e-68    Sesamum indicum [beniseed]
ref|XP_010047425.1|  PREDICTED: pectinesterase-like                     230   3e-68    Eucalyptus grandis [rose gum]
ref|XP_010056335.1|  PREDICTED: pectinesterase 2-like                   229   3e-68    Eucalyptus grandis [rose gum]
gb|KDP23440.1|  hypothetical protein JCGZ_23273                         229   3e-68    Jatropha curcas
ref|XP_006433467.1|  hypothetical protein CICLE_v10000816mg             229   3e-68    Citrus clementina [clementine]
ref|XP_008800482.1|  PREDICTED: pectinesterase-like isoform X1          230   3e-68    Phoenix dactylifera
ref|XP_010056339.1|  PREDICTED: pectinesterase 2-like                   228   3e-68    Eucalyptus grandis [rose gum]
ref|XP_007139063.1|  hypothetical protein PHAVU_009G261700g             229   4e-68    Phaseolus vulgaris [French bean]
ref|XP_004499740.1|  PREDICTED: putative pectinesterase/pectinest...    229   4e-68    Cicer arietinum [garbanzo]
ref|XP_010501842.1|  PREDICTED: pectinesterase/pectinesterase inh...    230   5e-68    Camelina sativa [gold-of-pleasure]
ref|XP_010546740.1|  PREDICTED: putative pectinesterase/pectinest...    229   5e-68    Tarenaya hassleriana [spider flower]
ref|XP_008803383.1|  PREDICTED: pectinesterase                          228   7e-68    Phoenix dactylifera
ref|XP_010047423.1|  PREDICTED: pectinesterase-like                     229   8e-68    Eucalyptus grandis [rose gum]
ref|XP_010067063.1|  PREDICTED: probable pectinesterase/pectinest...    229   8e-68    Eucalyptus grandis [rose gum]
gb|AFK36090.1|  unknown                                                 226   1e-67    Medicago truncatula
ref|XP_007011069.1|  Root hair specific 12                              229   1e-67    
gb|KHN26433.1|  Putative pectinesterase/pectinesterase inhibitor 24     228   1e-67    Glycine soja [wild soybean]
gb|AFW03480.1|  pectin methylesterase 1                                 229   1e-67    Gossypium hirsutum [American cotton]
ref|XP_006412775.1|  hypothetical protein EUTSA_v10026924mg             223   1e-67    
ref|XP_010056336.1|  PREDICTED: pectinesterase 2-like                   227   1e-67    Eucalyptus grandis [rose gum]
ref|XP_006828609.1|  hypothetical protein AMTR_s00129p00068690          229   1e-67    
gb|EYU21270.1|  hypothetical protein MIMGU_mgv1a003278mg                229   1e-67    Erythranthe guttata [common monkey flower]
ref|XP_008812473.1|  PREDICTED: pectinesterase-like                     227   1e-67    Phoenix dactylifera
ref|XP_007145198.1|  hypothetical protein PHAVU_007G218500g             228   1e-67    Phaseolus vulgaris [French bean]
ref|XP_003526361.1|  PREDICTED: putative pectinesterase/pectinest...    228   1e-67    Glycine max [soybeans]
gb|ABZ89800.1|  pectin methylesterase-like protein                      228   1e-67    Taiwania cryptomerioides
ref|XP_007154532.1|  hypothetical protein PHAVU_003G126500g             227   1e-67    Phaseolus vulgaris [French bean]
ref|XP_010056338.1|  PREDICTED: pectinesterase 2-like                   227   2e-67    Eucalyptus grandis [rose gum]
ref|XP_006828586.1|  hypothetical protein AMTR_s00129p00044320          228   2e-67    Amborella trichopoda
gb|KHN15840.1|  Pectinesterase/pectinesterase inhibitor U1              222   2e-67    Glycine soja [wild soybean]
ref|XP_010101977.1|  putative pectinesterase/pectinesterase inhib...    226   2e-67    
ref|XP_010932330.1|  PREDICTED: pectinesterase-like                     227   2e-67    Elaeis guineensis
emb|CDX98441.1|  BnaC05g39340D                                          228   2e-67    
ref|XP_006426799.1|  hypothetical protein CICLE_v10025232mg             228   2e-67    Citrus clementina [clementine]
ref|XP_011031815.1|  PREDICTED: pectinesterase-like                     228   2e-67    Populus euphratica
gb|KFK33850.1|  hypothetical protein AALP_AA5G068300                    226   2e-67    Arabis alpina [alpine rockcress]
ref|NP_172604.1|  putative pectinesterase 56                            219   3e-67    Arabidopsis thaliana [mouse-ear cress]
emb|CDX76371.1|  BnaA08g10290D                                          221   3e-67    
gb|KHN35618.1|  Pectinesterase 2                                        222   3e-67    Glycine soja [wild soybean]
gb|EPS74082.1|  hypothetical protein M569_00674                         226   3e-67    Genlisea aurea
ref|XP_009385286.1|  PREDICTED: putative pectinesterase/pectinest...    227   3e-67    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003608136.1|  Pectinesterase                                     226   3e-67    Medicago truncatula
ref|XP_002455538.1|  hypothetical protein SORBIDRAFT_03g012830          227   3e-67    Sorghum bicolor [broomcorn]
gb|KDO73733.1|  hypothetical protein CISIN_1g008261mg                   227   3e-67    Citrus sinensis [apfelsine]
ref|XP_010067062.1|  PREDICTED: probable pectinesterase/pectinest...    227   3e-67    Eucalyptus grandis [rose gum]
ref|XP_004297462.2|  PREDICTED: pectinesterase                          228   4e-67    Fragaria vesca subsp. vesca
ref|XP_002511679.1|  Pectinesterase-2 precursor, putative               226   4e-67    Ricinus communis
ref|XP_009604014.1|  PREDICTED: probable pectinesterase/pectinest...    227   4e-67    Nicotiana tomentosiformis
dbj|BAJ96804.1|  predicted protein                                      227   4e-67    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009338231.1|  PREDICTED: putative pectinesterase/pectinest...    226   4e-67    Pyrus x bretschneideri [bai li]
ref|XP_010261668.1|  PREDICTED: pectinesterase-like                     227   4e-67    Nelumbo nucifera [Indian lotus]
ref|XP_010503036.1|  PREDICTED: probable pectinesterase/pectinest...    226   4e-67    Camelina sativa [gold-of-pleasure]
gb|KDP40627.1|  hypothetical protein JCGZ_24626                         227   4e-67    Jatropha curcas
gb|KHN08672.1|  Putative pectinesterase/pectinesterase inhibitor 40     224   4e-67    Glycine soja [wild soybean]
ref|XP_004303759.1|  PREDICTED: pectinesterase 3                        227   5e-67    Fragaria vesca subsp. vesca
gb|KJB70037.1|  hypothetical protein B456_011G055100                    227   5e-67    Gossypium raimondii
gb|KDP33984.1|  hypothetical protein JCGZ_07555                         227   5e-67    Jatropha curcas
ref|XP_004958677.1|  PREDICTED: pectinesterase 3-like                   227   5e-67    Setaria italica
ref|XP_002463382.1|  hypothetical protein SORBIDRAFT_02g042780          227   6e-67    Sorghum bicolor [broomcorn]
emb|CDY33229.1|  BnaC01g37020D                                          226   6e-67    Brassica napus [oilseed rape]
ref|XP_010541676.1|  PREDICTED: probable pectinesterase/pectinest...    225   6e-67    Tarenaya hassleriana [spider flower]
ref|XP_010269596.1|  PREDICTED: pectinesterase-like                     226   6e-67    Nelumbo nucifera [Indian lotus]
ref|XP_008359413.1|  PREDICTED: pectinesterase-like                     226   6e-67    
ref|XP_006388348.1|  hypothetical protein POPTR_0214s00200g             226   6e-67    Populus trichocarpa [western balsam poplar]
gb|AER38244.1|  PME5                                                    225   7e-67    Gossypium barbadense [Egyptian cotton]
ref|XP_003553658.2|  PREDICTED: probable pectinesterase/pectinest...    227   7e-67    Glycine max [soybeans]
ref|XP_009146386.1|  PREDICTED: pectinesterase/pectinesterase inh...    227   7e-67    Brassica rapa
emb|CDX97564.1|  BnaA05g25150D                                          227   7e-67    
gb|AFW03484.1|  pectin methylesterase 5                                 225   7e-67    Gossypium hirsutum [American cotton]
ref|XP_007163135.1|  hypothetical protein PHAVU_001G209400g             227   8e-67    Phaseolus vulgaris [French bean]
ref|XP_007220109.1|  hypothetical protein PRUPE_ppa021446mg             224   8e-67    
gb|KHG19575.1|  Uncharacterized protein F383_07269                      225   8e-67    Gossypium arboreum [tree cotton]
ref|XP_002516186.1|  Pectinesterase-3 precursor, putative               226   8e-67    
ref|XP_007146997.1|  hypothetical protein PHAVU_006G088000g             225   8e-67    
gb|KJB41904.1|  hypothetical protein B456_007G127000                    226   8e-67    
gb|AFW03479.1|  pectin methylesterase 5                                 225   8e-67    
gb|KJB41089.1|  hypothetical protein B456_007G090100                    225   8e-67    
ref|XP_010056337.1|  PREDICTED: pectinesterase 2-like                   224   9e-67    
ref|XP_008370416.1|  PREDICTED: putative pectinesterase/pectinest...    225   9e-67    
gb|AFI23411.1|  pectin methylesterase                                   226   9e-67    
ref|XP_009768722.1|  PREDICTED: probable pectinesterase/pectinest...    226   1e-66    
ref|XP_004172115.1|  PREDICTED: pectinesterase 3-like                   226   1e-66    
ref|XP_010039612.1|  PREDICTED: probable pectinesterase/pectinest...    226   1e-66    
ref|XP_004141734.1|  PREDICTED: pectinesterase 3-like                   226   1e-66    
gb|KJB09419.1|  hypothetical protein B456_001G140500                    226   1e-66    
ref|XP_002304257.2|  pectinesterase family protein                      226   1e-66    
ref|XP_010271266.1|  PREDICTED: pectinesterase-like                     225   1e-66    
ref|XP_008391336.1|  PREDICTED: probable pectinesterase/pectinest...    222   1e-66    
gb|EAZ07184.1|  hypothetical protein OsI_29430                          225   1e-66    
gb|EYU33116.1|  hypothetical protein MIMGU_mgv1a022674mg                224   1e-66    
ref|XP_002512462.1|  Pectinesterase PPE8B precursor, putative           224   1e-66    
ref|XP_011048630.1|  PREDICTED: pectinesterase-like                     226   1e-66    
ref|XP_003519757.1|  PREDICTED: probable pectinesterase/pectinest...    225   2e-66    
ref|NP_001061940.1|  Os08g0450100                                       225   2e-66    
ref|XP_011046484.1|  PREDICTED: putative pectinesterase/pectinest...    225   2e-66    
ref|XP_011101135.1|  PREDICTED: probable pectinesterase/pectinest...    225   2e-66    
dbj|BAD95369.1|  pectin methylesterase like protein                     220   2e-66    
ref|XP_006452919.1|  hypothetical protein CICLE_v10007806mg             226   2e-66    
ref|XP_008451545.1|  PREDICTED: pectinesterase-like                     226   2e-66    
gb|AAL24278.1|  AT3g14310/MLN21_9                                       221   2e-66    
ref|XP_010049304.1|  PREDICTED: pectinesterase/pectinesterase inh...    224   2e-66    
ref|XP_009404434.1|  PREDICTED: probable pectinesterase/pectinest...    226   2e-66    
ref|XP_010479961.1|  PREDICTED: pectinesterase 2-like                   226   2e-66    
ref|XP_008462453.1|  PREDICTED: pectinesterase-like                     226   2e-66    
ref|XP_009116991.1|  PREDICTED: pectinesterase/pectinesterase inh...    225   2e-66    
ref|XP_008460358.1|  PREDICTED: pectinesterase-like                     224   2e-66    
ref|XP_002894250.1|  predicted protein                                  219   2e-66    
gb|KJB19685.1|  hypothetical protein B456_003G114300                    222   2e-66    
ref|XP_002320714.1|  putative pectin methylesterase LuPME1 family...    223   3e-66    
ref|XP_007148762.1|  hypothetical protein PHAVU_005G012000g             225   3e-66    
ref|XP_004287682.1|  PREDICTED: pectinesterase/pectinesterase inh...    223   3e-66    
ref|NP_001275846.1|  putative thermostable pectinesterase               226   3e-66    
ref|XP_008235121.1|  PREDICTED: pectinesterase-like                     224   3e-66    
ref|XP_008234391.1|  PREDICTED: pectinesterase 2-like                   223   3e-66    
emb|CDY33228.1|  BnaC01g37010D                                          225   3e-66    
ref|XP_004168887.1|  PREDICTED: pectinesterase 3-like                   224   3e-66    
ref|XP_009421439.1|  PREDICTED: putative pectinesterase/pectinest...    224   3e-66    
ref|XP_010939846.1|  PREDICTED: pectinesterase-like                     225   3e-66    
ref|XP_004136014.1|  PREDICTED: probable pectinesterase/pectinest...    224   3e-66    
ref|XP_006344555.1|  PREDICTED: pectinesterase/pectinesterase inh...    224   3e-66    
ref|XP_010264199.1|  PREDICTED: pectinesterase 2-like                   223   4e-66    
emb|CAC01624.1|  putative pectin methylesterase                         224   4e-66    
gb|AAQ21124.1|  pectinesterase                                          223   4e-66    
ref|XP_006826911.1|  hypothetical protein AMTR_s00010p00161740          223   4e-66    
ref|XP_006344697.1|  PREDICTED: putative pectinesterase/pectinest...    223   4e-66    
ref|NP_001268091.1|  pectin methylesterase PME1 precursor               223   4e-66    
ref|XP_010654104.1|  PREDICTED: pectinesterase                          223   4e-66    
emb|CAN77092.1|  hypothetical protein VITISV_026596                     223   5e-66    
ref|XP_011078160.1|  PREDICTED: pectinesterase-like isoform X2          224   5e-66    
gb|AAC50023.1|  ATPME2 precursor                                        224   5e-66    
ref|XP_002510940.1|  Pectinesterase-2 precursor, putative               221   5e-66    
emb|CAN60612.1|  hypothetical protein VITISV_003251                     223   5e-66    
emb|CBI29628.3|  unnamed protein product                                223   5e-66    
ref|XP_003634048.1|  PREDICTED: pectinesterase 2-like                   223   5e-66    
gb|KHN43496.1|  Putative pectinesterase/pectinesterase inhibitor 40     222   5e-66    
ref|XP_003598363.1|  Pectinesterase                                     224   6e-66    
ref|XP_010937249.1|  PREDICTED: pectinesterase-like                     224   6e-66    
ref|XP_011072690.1|  PREDICTED: pectinesterase 3-like                   224   6e-66    
gb|KGN44975.1|  Pectinesterase                                          224   6e-66    
ref|XP_008783207.1|  PREDICTED: probable pectinesterase/pectinest...    224   6e-66    
gb|KJB81040.1|  hypothetical protein B456_013G126800                    223   7e-66    
ref|XP_008245555.1|  PREDICTED: putative pectinesterase/pectinest...    223   7e-66    
ref|XP_010501045.1|  PREDICTED: pectinesterase 2-like                   224   7e-66    
ref|XP_009140500.1|  PREDICTED: pectinesterase/pectinesterase inh...    218   7e-66    
emb|CDY69635.1|  BnaAnng31080D                                          218   7e-66    
ref|XP_002280446.1|  PREDICTED: pectinesterase 2                        222   7e-66    
ref|XP_004230262.1|  PREDICTED: putative pectinesterase/pectinest...    223   7e-66    
ref|XP_008450601.1|  PREDICTED: putative pectinesterase/pectinest...    221   7e-66    
ref|XP_006419127.1|  hypothetical protein EUTSA_v10002482mg             223   7e-66    
ref|XP_008391160.1|  PREDICTED: pectinesterase-like                     223   8e-66    
gb|EYU24929.1|  hypothetical protein MIMGU_mgv1a025888mg                221   8e-66    
ref|XP_002316458.2|  pectinesterase family protein                      223   8e-66    
gb|EPS63648.1|  pectinesterase                                          222   8e-66    
ref|XP_010271372.1|  PREDICTED: pectinesterase-like                     223   8e-66    
ref|XP_010462289.1|  PREDICTED: pectinesterase 2                        224   9e-66    
emb|CDY12333.1|  BnaA06g20110D                                          222   9e-66    
ref|XP_006290897.1|  hypothetical protein CARUB_v10017009mg             222   1e-65    
ref|XP_004971511.1|  PREDICTED: pectinesterase 1-like                   220   1e-65    
ref|XP_006599763.1|  PREDICTED: pectinesterase/pectinesterase inh...    221   1e-65    
gb|AGJ83739.1|  pectinesterase/pectinesterase inhibitor PPE8B-lik...    221   1e-65    
ref|XP_010259035.1|  PREDICTED: pectinesterase 2-like                   222   1e-65    
ref|XP_003559807.1|  PREDICTED: pectinesterase-like                     223   1e-65    
ref|XP_008388514.1|  PREDICTED: putative pectinesterase/pectinest...    222   1e-65    
gb|KHN43320.1|  Putative pectinesterase/pectinesterase inhibitor 22     222   1e-65    
ref|XP_010915944.1|  PREDICTED: probable pectinesterase/pectinest...    223   1e-65    
pdb|1GQ8|A  Chain A, Pectin Methylesterase From Carrot                  216   1e-65    
emb|CDP16868.1|  unnamed protein product                                223   1e-65    
sp|P83218.1|PME_DAUCA  RecName: Full=Pectinesterase; Short=PE; Al...    216   1e-65    
gb|KHN35620.1|  Pectinesterase 2                                        217   1e-65    
ref|XP_004508051.1|  PREDICTED: pectinesterase/pectinesterase inh...    221   1e-65    
ref|XP_006296700.1|  hypothetical protein CARUB_v10013399mg             222   1e-65    
ref|XP_006658118.1|  PREDICTED: pectinesterase 3-like                   223   1e-65    
ref|XP_009421463.1|  PREDICTED: probable pectinesterase/pectinest...    223   2e-65    
ref|XP_006490097.1|  PREDICTED: pectinesterase 2-like                   221   2e-65    
ref|XP_009409132.1|  PREDICTED: pectinesterase-like                     223   2e-65    
ref|XP_004514851.1|  PREDICTED: pectinesterase 2-like                   221   2e-65    
ref|XP_006421695.1|  hypothetical protein CICLE_v10004742mg             221   2e-65    
ref|XP_004511148.1|  PREDICTED: probable pectinesterase/pectinest...    223   2e-65    
gb|KDO65446.1|  hypothetical protein CISIN_1g010103mg                   221   2e-65    
ref|XP_003554631.1|  PREDICTED: putative pectinesterase/pectinest...    222   2e-65    
ref|XP_011076334.1|  PREDICTED: probable pectinesterase/pectinest...    220   2e-65    
ref|XP_009385345.1|  PREDICTED: pectinesterase-like                     221   2e-65    
gb|KHN10154.1|  Putative pectinesterase/pectinesterase inhibitor 24     223   2e-65    
ref|XP_003546684.1|  PREDICTED: putative pectinesterase/pectinest...    223   2e-65    
ref|XP_004171768.1|  PREDICTED: probable pectinesterase/pectinest...    223   2e-65    
ref|NP_189913.3|  probable pectinesterase/pectinesterase inhibito...    221   2e-65    
gb|KEH21378.1|  pectinesterase                                          217   2e-65    
ref|XP_006576426.1|  PREDICTED: pectinesterase 2-like                   221   2e-65    
ref|XP_007201179.1|  hypothetical protein PRUPE_ppa003400mg             223   2e-65    
ref|XP_009614349.1|  PREDICTED: probable pectinesterase/pectinest...    223   2e-65    
gb|ABJ99595.1|  pectinesterase inhibitor                                223   2e-65    
gb|KEH24404.1|  pectinesterase/pectinesterase inhibitor                 222   2e-65    
ref|XP_003595386.1|  Pectinesterase                                     221   2e-65    
ref|XP_011093902.1|  PREDICTED: pectinesterase/pectinesterase inh...    221   2e-65    
ref|XP_004159762.1|  PREDICTED: pectinesterase/pectinesterase inh...    219   2e-65    
ref|XP_009766156.1|  PREDICTED: pectinesterase 2-like                   221   3e-65    
ref|XP_008450600.1|  PREDICTED: putative pectinesterase/pectinest...    221   3e-65    
gb|EPS67019.1|  pectinesterase                                          216   3e-65    
ref|XP_003631952.1|  PREDICTED: putative pectinesterase/pectinest...    222   3e-65    
ref|XP_010264200.1|  PREDICTED: pectinesterase 2-like                   221   3e-65    
gb|ABJ99594.1|  pectinesterase inhibitor                                222   3e-65    
ref|XP_009108562.1|  PREDICTED: probable pectinesterase 56              216   3e-65    
ref|XP_007038413.1|  Pectinesterase                                     221   3e-65    
ref|XP_002877272.1|  pectinesterase family protein                      221   3e-65    
ref|XP_009123268.1|  PREDICTED: probable pectinesterase/pectinest...    220   3e-65    
gb|KHG05999.1|  putative pectinesterase/pectinesterase inhibitor ...    222   3e-65    
ref|XP_004494389.1|  PREDICTED: probable pectinesterase/pectinest...    221   3e-65    
ref|XP_004231483.1|  PREDICTED: probable pectinesterase/pectinest...    222   3e-65    
gb|KHN35616.1|  Pectinesterase 2                                        216   4e-65    
ref|XP_008803239.1|  PREDICTED: pectinesterase                          221   4e-65    
ref|XP_009594432.1|  PREDICTED: putative pectinesterase/pectinest...    221   4e-65    
ref|XP_007012504.1|  Pectinesterase/pectinesterase inhibitor PPE8B      221   4e-65    
ref|XP_008806757.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    222   4e-65    
ref|XP_006367330.1|  PREDICTED: probable pectinesterase/pectinest...    222   4e-65    
ref|XP_007138594.1|  hypothetical protein PHAVU_009G222100g             220   5e-65    
ref|XP_002527782.1|  Pectinesterase-1 precursor, putative               221   5e-65    
ref|XP_009627969.1|  PREDICTED: probable pectinesterase/pectinest...    220   5e-65    
dbj|BAK05168.1|  predicted protein                                      221   5e-65    
dbj|BAK06768.1|  predicted protein                                      221   5e-65    
ref|NP_188048.1|  pectin methylesterase 3                               222   5e-65    
gb|EPS73427.1|  pectinesterase                                          221   5e-65    
ref|XP_010674080.1|  PREDICTED: putative pectinesterase/pectinest...    220   5e-65    
ref|XP_007141001.1|  hypothetical protein PHAVU_008G158900g             222   6e-65    
gb|EYU19492.1|  hypothetical protein MIMGU_mgv1a025514mg                221   6e-65    
ref|XP_009123267.1|  PREDICTED: probable pectinesterase/pectinest...    220   6e-65    
gb|AAC72288.1|  putative pectin methylesterase                          221   6e-65    
ref|XP_011034009.1|  PREDICTED: pectinesterase 2                        220   6e-65    
ref|XP_009391194.1|  PREDICTED: pectinesterase-like                     219   6e-65    
ref|XP_002885033.1|  ATPME3                                             221   6e-65    
ref|XP_006852649.1|  hypothetical protein AMTR_s00021p00242180          222   6e-65    
ref|XP_008389982.1|  PREDICTED: pectinesterase                          220   6e-65    
ref|XP_003546532.1|  PREDICTED: pectinesterase/pectinesterase inh...    220   7e-65    
ref|XP_004157240.1|  PREDICTED: putative pectinesterase/pectinest...    220   7e-65    
ref|XP_008386148.1|  PREDICTED: pectinesterase-like                     221   7e-65    
ref|XP_004135600.1|  PREDICTED: putative pectinesterase/pectinest...    220   7e-65    
ref|XP_011023723.1|  PREDICTED: putative pectinesterase/pectinest...    220   7e-65    
ref|XP_010101979.1|  putative pectinesterase/pectinesterase inhib...    218   7e-65    
ref|NP_001275859.1|  pectinesterase 1 precursor                         221   8e-65    
gb|KHN25547.1|  Pectinesterase 2                                        215   9e-65    
ref|XP_010685210.1|  PREDICTED: pectinesterase-like                     221   9e-65    
ref|XP_010910186.1|  PREDICTED: pectinesterase-like                     219   9e-65    
ref|XP_010325628.1|  PREDICTED: pectinesterase 2                        219   9e-65    
ref|XP_009628696.1|  PREDICTED: pectinesterase 2                        220   1e-64    
gb|KJB65434.1|  hypothetical protein B456_010G094800                    216   1e-64    
ref|XP_011036906.1|  PREDICTED: putative pectinesterase/pectinest...    220   1e-64    
ref|XP_007134831.1|  hypothetical protein PHAVU_010G079900g             219   1e-64    
ref|XP_009339900.1|  PREDICTED: probable pectinesterase/pectinest...    221   1e-64    
emb|CBI27756.3|  unnamed protein product                                220   1e-64    
ref|XP_002273396.2|  PREDICTED: probable pectinesterase/pectinest...    220   1e-64    
ref|XP_009117000.1|  PREDICTED: pectinesterase/pectinesterase inh...    221   1e-64    
gb|KEH19215.1|  pectinesterase/pectinesterase inhibitor                 221   1e-64    
ref|XP_006363205.1|  PREDICTED: probable pectinesterase/pectinest...    220   1e-64    
ref|XP_004494573.1|  PREDICTED: putative pectinesterase/pectinest...    220   1e-64    
ref|XP_010932011.1|  PREDICTED: putative pectinesterase/pectinest...    221   1e-64    
gb|KHN42841.1|  Pectinesterase/pectinesterase inhibitor PPE8B           219   1e-64    
ref|XP_011078158.1|  PREDICTED: pectinesterase/pectinesterase inh...    219   1e-64    
ref|XP_009796151.1|  PREDICTED: putative pectinesterase/pectinest...    220   1e-64    
gb|ACN40984.1|  unknown                                                 221   1e-64    
ref|XP_004242901.1|  PREDICTED: pectinesterase/pectinesterase inh...    219   1e-64    
ref|XP_006283426.1|  hypothetical protein CARUB_v10004474mg             220   1e-64    
gb|EYU40533.1|  hypothetical protein MIMGU_mgv1a019770mg                219   1e-64    
emb|CDX75340.1|  BnaA01g03620D                                          219   1e-64    
gb|KDP38089.1|  hypothetical protein JCGZ_04732                         219   1e-64    
gb|KDO87160.1|  hypothetical protein CISIN_1g015794mg                   216   1e-64    
ref|XP_003528739.1|  PREDICTED: pectinesterase/pectinesterase inh...    221   2e-64    
gb|KDP22414.1|  hypothetical protein JCGZ_26245                         219   2e-64    
emb|CDX68957.1|  BnaC01g04960D                                          219   2e-64    
ref|XP_009786179.1|  PREDICTED: probable pectinesterase/pectinest...    220   2e-64    
ref|XP_006392745.1|  hypothetical protein EUTSA_v10011343mg             220   2e-64    
ref|NP_187213.1|  putative pectinesterase/pectinesterase inhibito...    219   2e-64    
gb|KDO85751.1|  hypothetical protein CISIN_1g010441mg                   218   2e-64    
sp|O04887.1|PME2_CITSI  RecName: Full=Pectinesterase 2; Short=PE ...    218   2e-64    
ref|XP_007207382.1|  hypothetical protein PRUPE_ppa004437mg             218   2e-64    
ref|XP_008795812.1|  PREDICTED: putative pectinesterase/pectinest...    219   2e-64    
ref|XP_002277473.1|  PREDICTED: pectinesterase                          220   2e-64    
emb|CDP20891.1|  unnamed protein product                                219   2e-64    
ref|NP_001146685.1|  pectinesterase precursor                           219   2e-64    
ref|XP_010526022.1|  PREDICTED: probable pectinesterase/pectinest...    219   2e-64    
ref|XP_004146188.1|  PREDICTED: pectinesterase/pectinesterase inh...    218   2e-64    
ref|NP_001265901.1|  pectinesterase 3-like                              220   2e-64    
gb|AFI23414.1|  pectin methylesterase                                   220   2e-64    
ref|XP_009123835.1|  PREDICTED: probable pectinesterase/pectinest...    219   2e-64    
ref|NP_001275775.1|  pectinesterase 2 precursor                         218   2e-64    
emb|CDY39109.1|  BnaA01g29470D                                          219   2e-64    
ref|XP_003626198.1|  Pectinesterase                                     219   2e-64    
ref|XP_009370475.1|  PREDICTED: pectinesterase 2-like                   218   2e-64    
ref|XP_009123782.1|  PREDICTED: probable pectinesterase/pectinest...    219   2e-64    
ref|XP_006445298.1|  hypothetical protein CICLE_v10019773mg             218   2e-64    
ref|XP_010105131.1|  Putative pectinesterase/pectinesterase inhib...    219   3e-64    
ref|XP_010056340.1|  PREDICTED: pectinesterase 2-like                   218   3e-64    
ref|XP_009372890.1|  PREDICTED: pectinesterase 2-like                   218   3e-64    
ref|XP_011048628.1|  PREDICTED: pectinesterase 3                        220   3e-64    
ref|XP_002444448.1|  hypothetical protein SORBIDRAFT_07g022090          219   3e-64    



>gb|AFK35109.1| unknown [Medicago truncatula]
Length=554

 Score =   331 bits (848),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 164/207 (79%), Positives = 184/207 (89%), Gaps = 3/207 (1%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDD---LRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYK  172
            SLAVLV+V P   +D      LNG+FPSWV++ DRRLLE+S   + ANVVVA+DGSGK+K
Sbjct  194  SLAVLVSVLPPKANDGFIDEKLNGDFPSWVTSKDRRLLESSVGDIKANVVVAQDGSGKFK  253

Query  173  TVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDG  352
            TVA+AVASAPDNGKTRYVIY+KKGTYKEN+EIGKKKTNVML+GDG+ ATIITGSLN++DG
Sbjct  254  TVAQAVASAPDNGKTRYVIYVKKGTYKENIEIGKKKTNVMLVGDGMDATIITGSLNFIDG  313

Query  353  ATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYA  532
             TTF SATVAAVGDGFIAQD+R QNTAGP+KHQAVALR+GADQSVINRCKIDA+QDTLYA
Sbjct  314  TTTFKSATVAAVGDGFIAQDIRFQNTAGPQKHQAVALRVGADQSVINRCKIDAFQDTLYA  373

Query  533  HSQRQFYRDCYITGTVDFIFGNAAAVI  613
            HS RQFYRD YITGTVDFIFGNAA V 
Sbjct  374  HSNRQFYRDSYITGTVDFIFGNAAVVF  400



>ref|XP_003622688.1| Pectinesterase [Medicago truncatula]
 gb|AES78906.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=554

 Score =   330 bits (847),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 164/207 (79%), Positives = 184/207 (89%), Gaps = 3/207 (1%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDD---LRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYK  172
            SLAVLV+V P   +D      LNG+FPSWV++ DRRLLE+S   + ANVVVA+DGSGK+K
Sbjct  194  SLAVLVSVLPPKANDGFIDEKLNGDFPSWVTSKDRRLLESSVGDIKANVVVAQDGSGKFK  253

Query  173  TVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDG  352
            TVA+AVASAPDNGKTRYVIY+KKGTYKEN+EIGKKKTNVML+GDG+ ATIITGSLN++DG
Sbjct  254  TVAQAVASAPDNGKTRYVIYVKKGTYKENIEIGKKKTNVMLVGDGMDATIITGSLNFIDG  313

Query  353  ATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYA  532
             TTF SATVAAVGDGFIAQD+R QNTAGP+KHQAVALR+GADQSVINRCKIDA+QDTLYA
Sbjct  314  TTTFKSATVAAVGDGFIAQDIRFQNTAGPQKHQAVALRVGADQSVINRCKIDAFQDTLYA  373

Query  533  HSQRQFYRDCYITGTVDFIFGNAAAVI  613
            HS RQFYRD YITGTVDFIFGNAA V 
Sbjct  374  HSNRQFYRDSYITGTVDFIFGNAAVVF  400



>emb|CAA47810.1| pectinesterase [Pisum sativum]
Length=554

 Score =   327 bits (838),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 162/207 (78%), Positives = 183/207 (88%), Gaps = 3/207 (1%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDD---LRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYK  172
            SLAVLV+V P+  +D     +LNGEFPSWV++ DRRLLE++   + ANVVVAKDGSGK+K
Sbjct  194  SLAVLVSVLPAKSNDGFIDESLNGEFPSWVTSKDRRLLESTVGDIKANVVVAKDGSGKFK  253

Query  173  TVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDG  352
            TVAEAVASAPDNGK RYVIY+K+GTYKE VEIGKKKTNVML+GDG+ ATIITG+LN++DG
Sbjct  254  TVAEAVASAPDNGKARYVIYVKRGTYKEKVEIGKKKTNVMLVGDGMDATIITGNLNFIDG  313

Query  353  ATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYA  532
             TTFNSATVAAVGDGFIAQD+  QNTAGPEKHQAVALR+GADQSVINRCKIDA+QDTLYA
Sbjct  314  TTTFNSATVAAVGDGFIAQDIGFQNTAGPEKHQAVALRVGADQSVINRCKIDAFQDTLYA  373

Query  533  HSQRQFYRDCYITGTVDFIFGNAAAVI  613
            HS RQFYRD +ITGTVDFIFGNA  V 
Sbjct  374  HSNRQFYRDSFITGTVDFIFGNAGVVF  400



>gb|AAC14742.1| pectin methylesterase [Pisum sativum]
 gb|AAC32273.1| pectin methylesterase [Pisum sativum]
Length=554

 Score =   327 bits (838),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 162/207 (78%), Positives = 183/207 (88%), Gaps = 3/207 (1%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDD---LRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYK  172
            SLAVLV+V P+  +D     +LNGEFPSWV++ DRRLLE++   + ANVVVAKDGSGK+K
Sbjct  194  SLAVLVSVLPAKSNDGFIDESLNGEFPSWVTSKDRRLLESTVGDIKANVVVAKDGSGKFK  253

Query  173  TVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDG  352
            TVAEAVASAPDNGK RYVIY+K+GTYKE VEIGKKKTNVML+GDG+ ATIITG+LN++DG
Sbjct  254  TVAEAVASAPDNGKARYVIYVKRGTYKEKVEIGKKKTNVMLVGDGMDATIITGNLNFIDG  313

Query  353  ATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYA  532
             TTFNSATVAAVGDGFIAQD+  QNTAGPEKHQAVALR+GADQSVINRCKIDA+QDTLYA
Sbjct  314  TTTFNSATVAAVGDGFIAQDIGFQNTAGPEKHQAVALRVGADQSVINRCKIDAFQDTLYA  373

Query  533  HSQRQFYRDCYITGTVDFIFGNAAAVI  613
            HS RQFYRD +ITGTVDFIFGNA  V 
Sbjct  374  HSNRQFYRDSFITGTVDFIFGNAGVVF  400



>dbj|BAC67661.1| pectin methylesterase [Pisum sativum]
Length=554

 Score =   327 bits (837),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 162/207 (78%), Positives = 183/207 (88%), Gaps = 3/207 (1%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDD---LRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYK  172
            SLAVLV+V P+  +D     +LNGEFPSWV++ DRRLLE++   + ANVVVAKDGSGK+K
Sbjct  194  SLAVLVSVLPAKSNDGFIDESLNGEFPSWVTSKDRRLLESTVGDIKANVVVAKDGSGKFK  253

Query  173  TVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDG  352
            TVAEAVASAPDNGK RYVIY+K+GTYKE VEIGKKKTNVML+GDG+ ATIITG+LN++DG
Sbjct  254  TVAEAVASAPDNGKARYVIYVKRGTYKEKVEIGKKKTNVMLVGDGMDATIITGNLNFIDG  313

Query  353  ATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYA  532
             TTFNSATVAAVGDGFIAQD+  QNTAGPEKHQAVALR+GADQSVINRCKIDA+QDTLYA
Sbjct  314  TTTFNSATVAAVGDGFIAQDIGFQNTAGPEKHQAVALRVGADQSVINRCKIDAFQDTLYA  373

Query  533  HSQRQFYRDCYITGTVDFIFGNAAAVI  613
            HS RQFYRD +ITGTVDFIFGNA  V 
Sbjct  374  HSNRQFYRDSFITGTVDFIFGNAGVVF  400



>gb|ACJ85768.1| unknown [Medicago truncatula]
Length=554

 Score =   326 bits (835),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 162/207 (78%), Positives = 182/207 (88%), Gaps = 3/207 (1%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDD---LRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYK  172
            SLAVLV+V P   +D      LNG+FPSWV++ DRRLLE+S   + ANVVVA+DGSGK+K
Sbjct  194  SLAVLVSVLPPKANDGFIDEKLNGDFPSWVTSKDRRLLESSVGDIKANVVVAQDGSGKFK  253

Query  173  TVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDG  352
            TVA+AVASAPDNG+TRYVIY+KKGTYKEN+EIGKKKTNVML+GDG+ ATIITGSLN+ DG
Sbjct  254  TVAQAVASAPDNGETRYVIYVKKGTYKENIEIGKKKTNVMLVGDGMDATIITGSLNFTDG  313

Query  353  ATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYA  532
             TTF SATVAAVGDGFIAQD+R QNTAGP+KHQAVAL +GADQSVINRCKIDA+QDTLYA
Sbjct  314  TTTFKSATVAAVGDGFIAQDIRFQNTAGPQKHQAVALHVGADQSVINRCKIDAFQDTLYA  373

Query  533  HSQRQFYRDCYITGTVDFIFGNAAAVI  613
            HS RQFYRD YITGTVDFIFGNAA V 
Sbjct  374  HSNRQFYRDSYITGTVDFIFGNAAVVF  400



>ref|XP_007157172.1| hypothetical protein PHAVU_002G048700g [Phaseolus vulgaris]
 gb|ESW29166.1| hypothetical protein PHAVU_002G048700g [Phaseolus vulgaris]
Length=549

 Score =   324 bits (831),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 162/207 (78%), Positives = 180/207 (87%), Gaps = 3/207 (1%)
 Frame = +2

Query  2    SLAVLVA--VAPSTEDDL-RALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYK  172
            SLA+LV   + P  E+ +   LNGEFPSWVS+ DRRLLE+    + ANVVVAKDGSGK+K
Sbjct  189  SLAILVGSVLPPKVEEIIDEPLNGEFPSWVSSKDRRLLESGVGDIKANVVVAKDGSGKFK  248

Query  173  TVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDG  352
            TV EAVASAPDNGKTRYVIY+KKGTYKENVEIGKKK NVML+GDG+ ATIITGSLN++DG
Sbjct  249  TVTEAVASAPDNGKTRYVIYVKKGTYKENVEIGKKKKNVMLVGDGMDATIITGSLNFIDG  308

Query  353  ATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYA  532
             TTFNSATVAAVGDGFI QD+  QNTAGPEKHQAVALR+GADQSVINRC+IDA+QDTLYA
Sbjct  309  TTTFNSATVAAVGDGFIGQDIWFQNTAGPEKHQAVALRVGADQSVINRCRIDAFQDTLYA  368

Query  533  HSQRQFYRDCYITGTVDFIFGNAAAVI  613
            HS RQFYRD +ITGTVDFIFGNAA V 
Sbjct  369  HSNRQFYRDSFITGTVDFIFGNAAVVF  395



>ref|XP_009589961.1| PREDICTED: LOW QUALITY PROTEIN: pectinesterase-like [Nicotiana 
tomentosiformis]
Length=548

 Score =   323 bits (828),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            SLA++V +AP    DL ++    PSWV+++DRRLL+ SANA+ ANVVVAKDGSGK+KTV 
Sbjct  194  SLALMVKMAPVKTMDLPSVTHGLPSWVTSNDRRLLQLSANAITANVVVAKDGSGKFKTVK  253

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            EAVASAPDNGKTRYVIY+KKG YKENVEIGKKK NVML+GDG+ ATIITGSLN+VDG+TT
Sbjct  254  EAVASAPDNGKTRYVIYVKKGIYKENVEIGKKKKNVMLVGDGMDATIITGSLNFVDGSTT  313

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            F SATVAAVGDGFIAQDL+ QNTAGP KHQAVALR+GADQSVINRCKIDA+QDTLY HS 
Sbjct  314  FKSATVAAVGDGFIAQDLQFQNTAGPSKHQAVALRIGADQSVINRCKIDAFQDTLYTHSL  373

Query  542  RQFYRDCYITGTVDFIFGNAAAVI  613
            RQFYRDCYITGTVDFIFGNAA V 
Sbjct  374  RQFYRDCYITGTVDFIFGNAAVVF  397



>gb|KHN30453.1| Pectinesterase 2.2 [Glycine soja]
Length=461

 Score =   319 bits (818),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 181/206 (88%), Gaps = 2/206 (1%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDL--RALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKT  175
            SLA+ VAV P   + +    L+G+FPSWVS+ DRRLLE++   + ANVVVAKDGSGK+KT
Sbjct  102  SLAMFVAVLPPKVEQIIDEPLSGDFPSWVSSKDRRLLESTVGDIKANVVVAKDGSGKFKT  161

Query  176  VAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGA  355
            VAEAVASAPDNGKTRYVIY+KKGTYKENVEIGKKKTNVML+GDG  AT+ITG+LN++DG 
Sbjct  162  VAEAVASAPDNGKTRYVIYVKKGTYKENVEIGKKKTNVMLVGDGKDATVITGNLNFIDGT  221

Query  356  TTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAH  535
            TTF +ATVAAVGDGFIAQD+  QNTAGP+KHQAVALR+GADQSVINRC+IDA+QDTLYAH
Sbjct  222  TTFKTATVAAVGDGFIAQDIWFQNTAGPQKHQAVALRVGADQSVINRCRIDAFQDTLYAH  281

Query  536  SQRQFYRDCYITGTVDFIFGNAAAVI  613
            S RQFYRD +ITGTVDFIFGNAA V 
Sbjct  282  SNRQFYRDSFITGTVDFIFGNAAVVF  307



>emb|CAD29733.1| pectin methylesterase [Sesbania rostrata]
Length=554

 Score =   322 bits (825),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 158/207 (76%), Positives = 183/207 (88%), Gaps = 3/207 (1%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDL---RALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYK  172
            SLA+LVAV P   ++     +LNG+FPSWV++ DRRLLE+S   + ANVVVAKDGSGK+K
Sbjct  194  SLAMLVAVLPPKGNEQFIDESLNGDFPSWVTSKDRRLLESSIRDIKANVVVAKDGSGKFK  253

Query  173  TVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDG  352
            TVAEA+ASAPDNGKTRYVIY+KKGTYKENVEIGKKKTNVML+GDG+ AT+ITG+LN +DG
Sbjct  254  TVAEAIASAPDNGKTRYVIYVKKGTYKENVEIGKKKTNVMLVGDGMDATVITGNLNVIDG  313

Query  353  ATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYA  532
            +TTF SATVAAVGDGFIAQD+  QNTAGP+KHQAVALR+GADQSVINRC++DA+QDTLYA
Sbjct  314  STTFKSATVAAVGDGFIAQDIWFQNTAGPQKHQAVALRVGADQSVINRCRMDAFQDTLYA  373

Query  533  HSQRQFYRDCYITGTVDFIFGNAAAVI  613
            HS RQFYRD +ITGTVDFIFGNA  V 
Sbjct  374  HSNRQFYRDSFITGTVDFIFGNAPVVF  400



>ref|XP_002317208.1| pectin methylesterase family protein [Populus trichocarpa]
 gb|EEE97820.1| pectin methylesterase family protein [Populus trichocarpa]
Length=549

 Score =   321 bits (822),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 180/205 (88%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTED-DLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTV  178
            SLA+L A++PS E+ D+ +L  +FPSW+ + DR+LL A    + A+V VAKDGSGKYKTV
Sbjct  193  SLAILAAISPSKENNDIFSLKEDFPSWLPSMDRKLLVALPKDINADVTVAKDGSGKYKTV  252

Query  179  AEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGAT  358
             EAVASAPDNGKTRYVIY+KKGTYKENVE+GKKK NVML+GDG+ +TIITGSLN VDG+T
Sbjct  253  KEAVASAPDNGKTRYVIYVKKGTYKENVEVGKKKKNVMLVGDGMDSTIITGSLNVVDGST  312

Query  359  TFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHS  538
            TFNSATVAAVGDGFIAQD+  QNTAGPEKHQAVALR+GADQSVINRC+IDAYQDTLY HS
Sbjct  313  TFNSATVAAVGDGFIAQDIWFQNTAGPEKHQAVALRVGADQSVINRCRIDAYQDTLYTHS  372

Query  539  QRQFYRDCYITGTVDFIFGNAAAVI  613
             RQFYRD YITGTVDFIFGNAA V+
Sbjct  373  LRQFYRDSYITGTVDFIFGNAAVVL  397



>dbj|BAC67662.1| pectin methylesterase [Pisum sativum]
Length=553

 Score =   321 bits (822),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 160/207 (77%), Positives = 180/207 (87%), Gaps = 3/207 (1%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDD---LRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYK  172
            SLAVLVAV P   +D     +LNGEFPSWV++ DRRLLE+S   + ANVVVAKDGSGK+K
Sbjct  194  SLAVLVAVLPEKSNDGFIDESLNGEFPSWVTSKDRRLLESSVGDITANVVVAKDGSGKFK  253

Query  173  TVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDG  352
            TVAEAVAS P+ GKTRYVIY+KKGTYKENVEI  +KTNVML+GDG+ ATIITGSLN VDG
Sbjct  254  TVAEAVASVPNKGKTRYVIYVKKGTYKENVEISSQKTNVMLVGDGMDATIITGSLNVVDG  313

Query  353  ATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYA  532
              TF SATVAAVGDGFIAQD+  +NTAGPEKHQAVALR+G+DQSVINRC+IDA+QDTLYA
Sbjct  314  TGTFQSATVAAVGDGFIAQDIGFKNTAGPEKHQAVALRVGSDQSVINRCRIDAFQDTLYA  373

Query  533  HSQRQFYRDCYITGTVDFIFGNAAAVI  613
            HS RQFYRDC+ITGT+DFIFGNAAAV 
Sbjct  374  HSNRQFYRDCFITGTIDFIFGNAAAVF  400



>ref|XP_002518523.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF43910.1| Pectinesterase precursor, putative [Ricinus communis]
Length=547

 Score =   320 bits (820),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 181/203 (89%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            SLA++VA++P+  D +  LNG+FPSWV++ DR+LLE+S   + A+V+VAKDGSGKYKTV 
Sbjct  192  SLAMVVAISPAKNDLISPLNGDFPSWVTSKDRKLLESSGKNINADVIVAKDGSGKYKTVK  251

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            EAVA+AP+NGKTRYVIY+KKGTYKENVEIG  K N+ML+GD + +TIITGSLN VDG+TT
Sbjct  252  EAVAAAPNNGKTRYVIYVKKGTYKENVEIGNSKKNIMLVGDSMDSTIITGSLNVVDGSTT  311

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            FNSATVAAVGDGFIAQD+  QNTAGP+KHQAVALR+G+DQSVINRC+IDAYQDTLYAHS 
Sbjct  312  FNSATVAAVGDGFIAQDIWFQNTAGPQKHQAVALRVGSDQSVINRCRIDAYQDTLYAHSD  371

Query  542  RQFYRDCYITGTVDFIFGNAAAV  610
            R FYRD +ITGTVDFIFGNAAAV
Sbjct  372  RHFYRDSFITGTVDFIFGNAAAV  394



>ref|XP_004492227.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18-like [Cicer 
arietinum]
Length=557

 Score =   320 bits (821),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 161/207 (78%), Positives = 178/207 (86%), Gaps = 3/207 (1%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDD---LRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYK  172
            SLAVLVAV PS + D      LNG+FPSWV++ DR+LLE+S   + ANVVVAKDGSGK+K
Sbjct  197  SLAVLVAVFPSKDSDGFIEEKLNGDFPSWVTSKDRKLLESSIGDIKANVVVAKDGSGKFK  256

Query  173  TVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDG  352
            TV EAVASAPDNG TRYVIY+KKG YKENVEIGKKK NVML+GDG+  T ITGSLN +DG
Sbjct  257  TVVEAVASAPDNGNTRYVIYVKKGIYKENVEIGKKKKNVMLVGDGMDVTTITGSLNVIDG  316

Query  353  ATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYA  532
            +TTF SATVAAVGDGFIAQD+  QNTAGPEKHQAVALR+GADQSVINRC+IDA+QDTLYA
Sbjct  317  STTFKSATVAAVGDGFIAQDIGFQNTAGPEKHQAVALRVGADQSVINRCRIDAFQDTLYA  376

Query  533  HSQRQFYRDCYITGTVDFIFGNAAAVI  613
            HS RQFYRD YITGTVDFIFGNAA V 
Sbjct  377  HSNRQFYRDSYITGTVDFIFGNAAVVF  403



>ref|XP_009589755.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=548

 Score =   320 bits (819),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 180/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            SLA++V +APS   DL ++    PSWV+++DRRLL+ SANA+ ANVVVAKDGSGK+KTV 
Sbjct  194  SLALMVKMAPSNTMDLPSVTHGLPSWVTSNDRRLLQLSANAITANVVVAKDGSGKFKTVK  253

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            EAVASAPDNGKTRYVIY+KKG YKENVEIGKKK NVML+GDG+  TIITG+LN VDGATT
Sbjct  254  EAVASAPDNGKTRYVIYVKKGIYKENVEIGKKKKNVMLVGDGMDTTIITGNLNVVDGATT  313

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            FNSATVAAVGDGFIAQDL+ QNTAG  KHQAVALR+GADQSVINRCKIDA+QDTLY HS 
Sbjct  314  FNSATVAAVGDGFIAQDLQFQNTAGAAKHQAVALRVGADQSVINRCKIDAFQDTLYTHSL  373

Query  542  RQFYRDCYITGTVDFIFGNAAAVI  613
            RQFYRDCYITGTVDFIFGNAA V 
Sbjct  374  RQFYRDCYITGTVDFIFGNAAVVF  397



>ref|XP_006573891.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18-like [Glycine 
max]
Length=553

 Score =   320 bits (819),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 181/206 (88%), Gaps = 2/206 (1%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDL--RALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKT  175
            SLA+ VAV P   + +    L+G+FPSWVS+ DRRLLE++   + ANVVVAKDGSGK+KT
Sbjct  194  SLAMFVAVLPPKVEQIIDEPLSGDFPSWVSSKDRRLLESTVGDIKANVVVAKDGSGKFKT  253

Query  176  VAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGA  355
            VAEAVASAPDNGKTRYVIY+KKGTYKENVEIGKKKTNVML+GDG  AT+ITG+LN++DG 
Sbjct  254  VAEAVASAPDNGKTRYVIYVKKGTYKENVEIGKKKTNVMLVGDGKDATVITGNLNFIDGT  313

Query  356  TTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAH  535
            TTF +ATVAAVGDGFIAQD+  QNTAGP+KHQAVALR+GADQSVINRC+IDA+QDTLYAH
Sbjct  314  TTFKTATVAAVGDGFIAQDIWFQNTAGPQKHQAVALRVGADQSVINRCRIDAFQDTLYAH  373

Query  536  SQRQFYRDCYITGTVDFIFGNAAAVI  613
            S RQFYRD +ITGTVDFIFGNAA V 
Sbjct  374  SNRQFYRDSFITGTVDFIFGNAAVVF  399



>ref|XP_009771261.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=547

 Score =   318 bits (816),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 162/203 (80%), Positives = 179/203 (88%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            SLA++V +APS   DL ++    PSWV++ DRRLL+ SANA+ ANVVVAKDGSGK+KT+ 
Sbjct  193  SLALMVKMAPSNTMDLPSVTDGLPSWVTSYDRRLLQLSANAITANVVVAKDGSGKFKTIK  252

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            EAVASAPDN KTRYVIY+KKG YKENVEIGKKK NVML+GDG+ ATIITGSLN VDGATT
Sbjct  253  EAVASAPDNSKTRYVIYVKKGIYKENVEIGKKKKNVMLVGDGMDATIITGSLNVVDGATT  312

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            FNSATVAAVGDGFIAQDL+ QNTAG  KHQAVALR+GADQSVINRCKIDA+QDTLY HS 
Sbjct  313  FNSATVAAVGDGFIAQDLQFQNTAGAAKHQAVALRVGADQSVINRCKIDAFQDTLYTHSL  372

Query  542  RQFYRDCYITGTVDFIFGNAAAV  610
            RQFYRDCYITGTVDFIFGNAA V
Sbjct  373  RQFYRDCYITGTVDFIFGNAAVV  395



>ref|XP_009769268.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=548

 Score =   317 bits (813),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 161/203 (79%), Positives = 178/203 (88%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            SLA++V + PS   DL ++    PSWV+++DRRLL+ SANA+ ANV+VAKDGSGKYKTV 
Sbjct  194  SLALMVKMTPSNTMDLPSVTDGLPSWVTSNDRRLLQLSANAIKANVIVAKDGSGKYKTVK  253

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            EAVASAPDN KTRYVIY+KKG YKENVEIGKKK NVML+GDG+ ATIITGSLN VDG+TT
Sbjct  254  EAVASAPDNSKTRYVIYVKKGIYKENVEIGKKKKNVMLVGDGMDATIITGSLNVVDGSTT  313

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            F SATVAAVGDGFIAQDLR QNTAG  KHQAVALR+GADQSVINRCKIDA+QDTLYAHS 
Sbjct  314  FKSATVAAVGDGFIAQDLRFQNTAGAAKHQAVALRVGADQSVINRCKIDAFQDTLYAHSL  373

Query  542  RQFYRDCYITGTVDFIFGNAAAV  610
            RQFYRDCYI GTVDFIFGNAA V
Sbjct  374  RQFYRDCYIAGTVDFIFGNAAVV  396



>ref|XP_010267745.1| PREDICTED: pectinesterase [Nelumbo nucifera]
Length=553

 Score =   315 bits (808),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 178/204 (87%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            SLA+L A++ S ED LR L+G+FPSWV+ +DR+LL++    + ANVVVAKDGSG Y+TV 
Sbjct  198  SLAMLTAISSSKEDALRPLDGKFPSWVTKNDRKLLQSLPRNIKANVVVAKDGSGNYQTVQ  257

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            EAV SAPD GK+RYVIY+KKGTYKENVE+GKKK NVML+GDG+ +TIITGSLN VDG+TT
Sbjct  258  EAVNSAPDKGKSRYVIYVKKGTYKENVEVGKKKMNVMLVGDGMDSTIITGSLNVVDGSTT  317

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            F SATVAAVGDGFIAQD+  QNTAGPEKHQAVALR+GADQSVINRC+IDAYQDTLY HS 
Sbjct  318  FKSATVAAVGDGFIAQDMWFQNTAGPEKHQAVALRVGADQSVINRCRIDAYQDTLYVHSL  377

Query  542  RQFYRDCYITGTVDFIFGNAAAVI  613
            RQFYRD YITGTVDFIFG+AA V 
Sbjct  378  RQFYRDSYITGTVDFIFGDAAVVF  401



>ref|XP_011000694.1| PREDICTED: pectinesterase [Populus euphratica]
Length=557

 Score =   314 bits (805),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 177/205 (86%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTED-DLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTV  178
            SLA+L A++PS E+ D+  L  +FPSW+ + DR+LL      + A+V VAKDGSGKYKTV
Sbjct  201  SLAILAAISPSKENNDIFPLKEDFPSWLPSMDRKLLITLPKDINADVTVAKDGSGKYKTV  260

Query  179  AEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGAT  358
             EAVASAPDNGKTRYVIY+KKGTYKENVE+GKKK NVML+GDG+ +TIITG+LN VDG+T
Sbjct  261  KEAVASAPDNGKTRYVIYVKKGTYKENVEVGKKKKNVMLVGDGMDSTIITGNLNVVDGST  320

Query  359  TFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHS  538
            TF SATVAAVGDGFIAQD+  QNTAGPEKHQAVALR+GADQSVINRC+IDAYQDTLY HS
Sbjct  321  TFKSATVAAVGDGFIAQDIWFQNTAGPEKHQAVALRVGADQSVINRCRIDAYQDTLYTHS  380

Query  539  QRQFYRDCYITGTVDFIFGNAAAVI  613
             RQFYRD YITGTVDFIFGNAA V+
Sbjct  381  LRQFYRDSYITGTVDFIFGNAAVVL  405



>ref|XP_010101471.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
 gb|EXB88454.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
Length=552

 Score =   313 bits (802),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 177/204 (87%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            SLA+LV+V PS  + +  L  + P+WV+A DRRLL+AS  A+ A++VVA+DGSGKYKTV 
Sbjct  197  SLAILVSVFPSNSEAIETLTDDLPTWVTAGDRRLLQASVKAIKADIVVAEDGSGKYKTVK  256

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            EAVA+ PDN KTR+ IY+KKGTYKENVEIGKKK NVML+GDG+ +TIITGSLN +DG+TT
Sbjct  257  EAVAAVPDNSKTRFTIYVKKGTYKENVEIGKKKKNVMLVGDGMDSTIITGSLNVIDGSTT  316

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            FNSATVAAVGDGFIAQD+  QNTAGP+KHQAVALR+GADQSVINRC+IDAYQDTLYAHS 
Sbjct  317  FNSATVAAVGDGFIAQDIWFQNTAGPQKHQAVALRVGADQSVINRCRIDAYQDTLYAHSN  376

Query  542  RQFYRDCYITGTVDFIFGNAAAVI  613
            RQFYRD  +TGTVDFIFGNAA V 
Sbjct  377  RQFYRDSTVTGTVDFIFGNAAVVF  400



>emb|CBI23178.3| unnamed protein product [Vitis vinifera]
Length=503

 Score =   311 bits (798),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 149/203 (73%), Positives = 179/203 (88%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            SLA+LVAV+P+ ED L+ L+ EFP WV + DR++LE+S+  + ANVVVAKDGSG YKTV 
Sbjct  173  SLAMLVAVSPAKEDVLQPLHSEFPPWVDSRDRKILESSSKDIKANVVVAKDGSGNYKTVK  232

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            EA+AS P+N KTRYVI++KKGTYKENVEI  K+ NVM++GDG+ +T+ITGSLN +DG+TT
Sbjct  233  EAIASVPNNSKTRYVIHVKKGTYKENVEIVTKQKNVMIVGDGMDSTVITGSLNVIDGSTT  292

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            F SAT+AAVGDGFIAQD+  QNTAGP+KHQAVALR+GADQ+VINRC+IDAYQDTLYAH+ 
Sbjct  293  FKSATLAAVGDGFIAQDIWFQNTAGPQKHQAVALRVGADQAVINRCRIDAYQDTLYAHTN  352

Query  542  RQFYRDCYITGTVDFIFGNAAAV  610
            RQFYRDCYITGTVDFIFGNAA V
Sbjct  353  RQFYRDCYITGTVDFIFGNAAVV  375



>ref|XP_004232737.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=546

 Score =   312 bits (800),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 183/203 (90%), Gaps = 1/203 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            SLA++VA+AP  ++ +  ++   PSWVSA+DRRLL+ SANA+AANVVVAKDGSGKYKTV 
Sbjct  192  SLALMVAIAPQ-KNIVPTVSDGLPSWVSANDRRLLQLSANAIAANVVVAKDGSGKYKTVK  250

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            EAVASAPDN KTRYVIY+KKGTYKENVEIGKKK N+ML+GDG+ ATIITG+LN +DG+TT
Sbjct  251  EAVASAPDNSKTRYVIYVKKGTYKENVEIGKKKKNIMLVGDGMDATIITGNLNVIDGSTT  310

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            F SATVAAVGDGFIAQD++ QNTAGP+KHQAVALR+GADQSVINRCK+DA+QDTLY H+ 
Sbjct  311  FKSATVAAVGDGFIAQDIQFQNTAGPQKHQAVALRVGADQSVINRCKMDAFQDTLYTHTL  370

Query  542  RQFYRDCYITGTVDFIFGNAAAV  610
            RQFYRDCYI GTVDFIFGNAA V
Sbjct  371  RQFYRDCYIIGTVDFIFGNAAVV  393



>ref|XP_006348082.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18-like [Solanum 
tuberosum]
Length=486

 Score =   310 bits (794),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 159/209 (76%), Positives = 183/209 (88%), Gaps = 5/209 (2%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLR-----ALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGK  166
            SLA++VA+AP    +        ++   PSWVSA+DR+LL+ SANA+AANVVVAKDGSGK
Sbjct  126  SLALMVAIAPPKSTNNNNNLPPTVSDGLPSWVSANDRKLLQLSANAIAANVVVAKDGSGK  185

Query  167  YKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYV  346
            YKTV EAVASAPDNGKTR+VIY+KKGTYKENVEIGKKK N+ML+GDG+ ATIITG+LN +
Sbjct  186  YKTVKEAVASAPDNGKTRFVIYVKKGTYKENVEIGKKKKNIMLMGDGMDATIITGNLNVI  245

Query  347  DGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTL  526
            DG+TTF SATVAAVGDGFIAQDL+ QNTAGP+KHQAVALR+GADQSVINRCKIDA++DTL
Sbjct  246  DGSTTFKSATVAAVGDGFIAQDLQFQNTAGPQKHQAVALRVGADQSVINRCKIDAFRDTL  305

Query  527  YAHSQRQFYRDCYITGTVDFIFGNAAAVI  613
            Y H+ RQFYRDCYITGTVDFIFGNAA V 
Sbjct  306  YTHTLRQFYRDCYITGTVDFIFGNAAVVF  334



>ref|XP_007157170.1| hypothetical protein PHAVU_002G048500g [Phaseolus vulgaris]
 gb|ESW29164.1| hypothetical protein PHAVU_002G048500g [Phaseolus vulgaris]
Length=552

 Score =   312 bits (799),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 175/205 (85%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDL-RALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTV  178
            +LA+ V V P   + +   LNGEFPSW+S+ DRRLLE+S   + ANVVVAKDGSGK+KTV
Sbjct  194  ALAMFVTVLPPRVEPIDEPLNGEFPSWLSSKDRRLLESSVGDINANVVVAKDGSGKFKTV  253

Query  179  AEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGAT  358
            AEAVASAPDN KTRYVIY+KKGTYKENVEIGKKK NVML+GDG   T+ITGSLNY+DG  
Sbjct  254  AEAVASAPDNSKTRYVIYVKKGTYKENVEIGKKKKNVMLVGDGKDLTVITGSLNYIDGTG  313

Query  359  TFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHS  538
            TF +ATVAAVGDGFI QD+  QNTAGP+KHQAVALR+GADQSVINRC++DAYQDTLYAH+
Sbjct  314  TFQTATVAAVGDGFIGQDIWFQNTAGPQKHQAVALRVGADQSVINRCRVDAYQDTLYAHT  373

Query  539  QRQFYRDCYITGTVDFIFGNAAAVI  613
             RQFYRD +ITGTVDFIFGNAA V 
Sbjct  374  NRQFYRDSFITGTVDFIFGNAAVVF  398



>ref|XP_002266980.1| PREDICTED: pectinesterase [Vitis vinifera]
Length=528

 Score =   311 bits (796),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 149/204 (73%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            SLA+LVAV+P+ ED L+ L+ EFP WV + DR++LE+S+  + ANVVVAKDGSG YKTV 
Sbjct  173  SLAMLVAVSPAKEDVLQPLHSEFPPWVDSRDRKILESSSKDIKANVVVAKDGSGNYKTVK  232

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            EA+AS P+N KTRYVI++KKGTYKENVEI  K+ NVM++GDG+ +T+ITGSLN +DG+TT
Sbjct  233  EAIASVPNNSKTRYVIHVKKGTYKENVEIVTKQKNVMIVGDGMDSTVITGSLNVIDGSTT  292

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            F SAT+AAVGDGFIAQD+  QNTAGP+KHQAVALR+GADQ+VINRC+IDAYQDTLYAH+ 
Sbjct  293  FKSATLAAVGDGFIAQDIWFQNTAGPQKHQAVALRVGADQAVINRCRIDAYQDTLYAHTN  352

Query  542  RQFYRDCYITGTVDFIFGNAAAVI  613
            RQFYRDCYITGTVDFIFGNAA V 
Sbjct  353  RQFYRDCYITGTVDFIFGNAAVVF  376



>ref|XP_004492228.1| PREDICTED: pectinesterase 2.1-like [Cicer arietinum]
Length=555

 Score =   310 bits (795),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 155/207 (75%), Positives = 176/207 (85%), Gaps = 3/207 (1%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDL---RALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYK  172
            SLAV +AV P    D      LNG+FPSW+++ DRRLLE+S   + ANVVVAKDGSGK+K
Sbjct  195  SLAVFLAVFPQQGHDQFVDETLNGDFPSWITSKDRRLLESSVGDIKANVVVAKDGSGKFK  254

Query  173  TVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDG  352
            TVAEAVA+APDNGKTRYVIY+KKGTYKEN+EIG  K NVML+GDG+ ATIITG+LN++DG
Sbjct  255  TVAEAVATAPDNGKTRYVIYVKKGTYKENIEIGSIKKNVMLVGDGMDATIITGNLNFIDG  314

Query  353  ATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYA  532
             TTF SATVAAVGDGFIAQD+  QNTAG EKHQAVALR+GADQSVINRC+IDA+QDTLYA
Sbjct  315  TTTFKSATVAAVGDGFIAQDIGFQNTAGAEKHQAVALRVGADQSVINRCRIDAFQDTLYA  374

Query  533  HSQRQFYRDCYITGTVDFIFGNAAAVI  613
            HS RQFYRD  ITGT+DFIFGNAA V 
Sbjct  375  HSNRQFYRDSVITGTIDFIFGNAAVVF  401



>gb|AFK44272.1| unknown [Lotus japonicus]
Length=554

 Score =   310 bits (793),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 158/208 (76%), Positives = 181/208 (87%), Gaps = 4/208 (2%)
 Frame = +2

Query  2    SLAVLVAV-APSTEDDL---RALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKY  169
            SLA+LV+V AP   ++      L+G+FPSWV+  DRRLLE+S   V ANVVVAKDGSG++
Sbjct  193  SLALLVSVLAPKGGNEQIIDEPLDGDFPSWVTRKDRRLLESSVGDVNANVVVAKDGSGRF  252

Query  170  KTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVD  349
            KTVAEAVASAPD+GKTRYVIY+KKGTYKEN+EIGKKKTNVML GDG+ ATIITG+LN +D
Sbjct  253  KTVAEAVASAPDSGKTRYVIYVKKGTYKENIEIGKKKTNVMLTGDGMDATIITGNLNVID  312

Query  350  GATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLY  529
            G+TTF SATVAAVGDGFIAQD+  QNTAGPEKHQAVALR+GADQS+INRC+IDAYQDTLY
Sbjct  313  GSTTFKSATVAAVGDGFIAQDIWFQNTAGPEKHQAVALRVGADQSIINRCRIDAYQDTLY  372

Query  530  AHSQRQFYRDCYITGTVDFIFGNAAAVI  613
            AH+ RQF RD +ITGTVDFIFGNAA V 
Sbjct  373  AHTNRQFSRDSFITGTVDFIFGNAAVVF  400



>ref|XP_010316615.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=548

 Score =   309 bits (792),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 157/203 (77%), Positives = 182/203 (90%), Gaps = 1/203 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            SLA++VA+AP  ++ +  ++   PSWVSA+DRRLL+ SANA+AANVVVAKDGSGKYKTV 
Sbjct  194  SLALMVAIAPQ-KNIVPTVSDGLPSWVSANDRRLLQLSANAIAANVVVAKDGSGKYKTVK  252

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            EAVASAPDN KTRYVIY+KKG YKENVEIGK K N+ML+GDG+ ATIITG+LN +DG+TT
Sbjct  253  EAVASAPDNSKTRYVIYVKKGIYKENVEIGKTKKNLMLVGDGMDATIITGNLNVIDGSTT  312

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            F SATVAAVGDGFIAQD++ QNTAGP+KHQAVALR+GADQSVINRCK+DA+QDTLY H+ 
Sbjct  313  FKSATVAAVGDGFIAQDIQFQNTAGPQKHQAVALRVGADQSVINRCKMDAFQDTLYTHTL  372

Query  542  RQFYRDCYITGTVDFIFGNAAAV  610
            RQFYRDCYITGTVDFIFGNAA V
Sbjct  373  RQFYRDCYITGTVDFIFGNAAVV  395



>gb|KDP20786.1| hypothetical protein JCGZ_21257 [Jatropha curcas]
Length=544

 Score =   308 bits (789),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            SLA+LV ++P+ +  +  LN +FPSWV+  DR+LLEAS   + ANV+VAKDGSG YKT+ 
Sbjct  189  SLALLVGISPAKDYLISPLNRDFPSWVTTKDRKLLEASVKDIKANVIVAKDGSGNYKTIK  248

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            EAVA+AP+NGKTR+VIY+KKGTYKE VEIGK K NVML+GDG+  TIITGSLN VDG+TT
Sbjct  249  EAVAAAPNNGKTRHVIYVKKGTYKEQVEIGKSKKNVMLVGDGMDLTIITGSLNVVDGSTT  308

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            F+SATVAAVGDGFIAQD+  QNTAGPEKHQAVALR+GADQSVINRC++DAYQDTLY HS 
Sbjct  309  FDSATVAAVGDGFIAQDIWFQNTAGPEKHQAVALRVGADQSVINRCRMDAYQDTLYTHSN  368

Query  542  RQFYRDCYITGTVDFIFGNAAAVI  613
            RQFYRD  ITGTVDFIFGNAA V 
Sbjct  369  RQFYRDSLITGTVDFIFGNAAVVF  392



>emb|CDO99717.1| unnamed protein product [Coffea canephora]
Length=533

 Score =   304 bits (779),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 176/204 (86%), Gaps = 1/204 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLR-ALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTV  178
            SLA+LVA+APS E+ ++  LNG+FPSWV+  DRRLL++SA  + ANVVVA+DGSG YKTV
Sbjct  194  SLAMLVAIAPSEEEMIQEPLNGDFPSWVTHKDRRLLQSSAKNINANVVVAQDGSGNYKTV  253

Query  179  AEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGAT  358
             EAV +AP+N +TRYVIY+KKGTYKE V+IGK K N+ML+GDG+  TIITGSLN VDG T
Sbjct  254  QEAVTAAPNNPQTRYVIYVKKGTYKEKVDIGKSKKNLMLVGDGMDLTIITGSLNVVDGTT  313

Query  359  TFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHS  538
            TF SATVAAV DGFI QD+  QNTAGP+K QAVALR+GADQSVINRCKIDA+QDTLYAHS
Sbjct  314  TFQSATVAAVADGFIGQDIWFQNTAGPQKQQAVALRVGADQSVINRCKIDAFQDTLYAHS  373

Query  539  QRQFYRDCYITGTVDFIFGNAAAV  610
             RQFYRDCYITGTVD+IFG+AA V
Sbjct  374  LRQFYRDCYITGTVDYIFGDAAVV  397



>ref|XP_003622699.1| Pectinesterase [Medicago truncatula]
 gb|ABD33414.1| Pectinesterase; Pectinesterase inhibitor [Medicago truncatula]
 gb|AES78917.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=555

 Score =   305 bits (780),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 152/207 (73%), Positives = 174/207 (84%), Gaps = 3/207 (1%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDL---RALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYK  172
            SLAV + V P  + D      L GEFPSWV++ DRRLLE +   + ANVVVA+DGSGK+K
Sbjct  195  SLAVFLVVFPQKDRDQFIDETLIGEFPSWVTSKDRRLLETAVGDIKANVVVAQDGSGKFK  254

Query  173  TVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDG  352
            TVAEAVASAPDNGKT+YVIY+KKGTYKENVEIG KKTNVML+GDG+ ATIITG+LN++DG
Sbjct  255  TVAEAVASAPDNGKTKYVIYVKKGTYKENVEIGSKKTNVMLVGDGMDATIITGNLNFIDG  314

Query  353  ATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYA  532
             TTF S+TVAAVGDGFIAQD+  QN AG  KHQAVALR+G+DQSVINRC+IDA+QDTLYA
Sbjct  315  TTTFKSSTVAAVGDGFIAQDIWFQNMAGAAKHQAVALRVGSDQSVINRCRIDAFQDTLYA  374

Query  533  HSQRQFYRDCYITGTVDFIFGNAAAVI  613
            HS RQFYRD  ITGT+DFIFGNAA V 
Sbjct  375  HSNRQFYRDSVITGTIDFIFGNAAVVF  401



>ref|XP_003622696.1| Pectinesterase [Medicago truncatula]
 gb|AES78914.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=553

 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 153/207 (74%), Positives = 176/207 (85%), Gaps = 3/207 (1%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDL---RALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYK  172
            SLAVLVAV P  + D     +LNG+FPSWV++ DRRLLE+S   V ANVVVAKDGSGK+K
Sbjct  194  SLAVLVAVLPPKDHDEFIDESLNGDFPSWVTSKDRRLLESSVGDVKANVVVAKDGSGKFK  253

Query  173  TVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDG  352
            TVAEAVASAP+ G  RYVIY+KKG YKENVEI   KTNVML+GDG+ ATIITGSLNYVDG
Sbjct  254  TVAEAVASAPNKGTARYVIYVKKGIYKENVEIASSKTNVMLLGDGMDATIITGSLNYVDG  313

Query  353  ATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYA  532
              TF +ATVAAVGD FIAQD+  QNTAGP+KHQAVALR+G+D+SVINRCKIDA+QDTLYA
Sbjct  314  TGTFQTATVAAVGDWFIAQDIGFQNTAGPQKHQAVALRVGSDRSVINRCKIDAFQDTLYA  373

Query  533  HSQRQFYRDCYITGTVDFIFGNAAAVI  613
            H+ RQFYRD +ITGT+DFIFG+AA V+
Sbjct  374  HTNRQFYRDSFITGTIDFIFGDAAVVL  400



>ref|XP_007025998.1| Pectinesterase/pectinesterase inhibitor, putative [Theobroma 
cacao]
 gb|EOY28620.1| Pectinesterase/pectinesterase inhibitor, putative [Theobroma 
cacao]
Length=543

 Score =   302 bits (773),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 173/204 (85%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            SLAV V+++P     +     EFPSWVS+ DR+LL+A  N + ANVVVAKDGSG YKT+A
Sbjct  188  SLAVFVSISPGKTRFVDPSIDEFPSWVSSKDRKLLQALLNEIKANVVVAKDGSGNYKTLA  247

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            EAVA+APD  K RY+I++K GTYKENVEIGKKK N+M++GDG+++TIITGSLN+VDG TT
Sbjct  248  EAVAAAPDKSKIRYIIHVKNGTYKENVEIGKKKKNLMIVGDGMNSTIITGSLNFVDGTTT  307

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            F SATVAAVGDGFIAQD+  QNTAGPEKHQAVALR+GADQSVINRCKIDAYQDTLY HS 
Sbjct  308  FKSATVAAVGDGFIAQDIWFQNTAGPEKHQAVALRVGADQSVINRCKIDAYQDTLYTHSN  367

Query  542  RQFYRDCYITGTVDFIFGNAAAVI  613
            RQFYRD Y+TGTVDFIFGNAA V 
Sbjct  368  RQFYRDSYVTGTVDFIFGNAAVVF  391



>emb|CDO99718.1| unnamed protein product [Coffea canephora]
Length=548

 Score =   301 bits (771),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 149/204 (73%), Positives = 174/204 (85%), Gaps = 1/204 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDL-RALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTV  178
            SLA++VA+AP  E+ + + LNG+ PSWV++ DRRLLEA    V AN VVAKDGSG YKTV
Sbjct  192  SLAMVVAIAPPKEEMIEQPLNGDLPSWVTSKDRRLLEALPKDVKANSVVAKDGSGNYKTV  251

Query  179  AEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGAT  358
             EAV +AP+N ++RYVIY+K GTYKE V+IGK K N+ML+GDG+  TIITGSLN VDG+T
Sbjct  252  QEAVNAAPNNAQSRYVIYVKAGTYKEKVDIGKNKKNLMLVGDGMDKTIITGSLNVVDGST  311

Query  359  TFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHS  538
            TFNSATVAAV DGFIAQDL  QNTAGP+KHQAVALR+GAD+SVINRCKIDA+QDTLY HS
Sbjct  312  TFNSATVAAVADGFIAQDLGFQNTAGPQKHQAVALRVGADKSVINRCKIDAFQDTLYTHS  371

Query  539  QRQFYRDCYITGTVDFIFGNAAAV  610
             RQF+RDCYITGTVDFIFG+AA V
Sbjct  372  LRQFFRDCYITGTVDFIFGDAAVV  395



>gb|KDO75533.1| hypothetical protein CISIN_1g008722mg [Citrus sinensis]
Length=556

 Score =   301 bits (770),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 153/209 (73%), Positives = 173/209 (83%), Gaps = 5/209 (2%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRA--LNGE--FPSWVSASDRRLLEASanavaan-vvvaKDGSGK  166
            SLA+LVA++P   + ++   L  E  FPSWV++ DR LL  S    A   VVVAKDGSG 
Sbjct  196  SLAILVAISPYNTNVIQQYYLRKEIQFPSWVTSRDRLLLRPSQAEAAKANVVVAKDGSGN  255

Query  167  YKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYV  346
            YKTV EAVASAPDN KTRYVIY+KKGTYKENVE+GKKK N+M++GDG+  TIITGSLN V
Sbjct  256  YKTVKEAVASAPDNSKTRYVIYVKKGTYKENVEVGKKKKNLMIVGDGMDLTIITGSLNVV  315

Query  347  DGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTL  526
            DG+TTF SAT+A  GDGFIAQDL IQNTAGPEKHQAVALR+ ADQSVINRC+IDAYQDTL
Sbjct  316  DGSTTFKSATIAVGGDGFIAQDLWIQNTAGPEKHQAVALRVSADQSVINRCRIDAYQDTL  375

Query  527  YAHSQRQFYRDCYITGTVDFIFGNAAAVI  613
            YAH+ RQFYRDCYITGTVDFIFGNAA V+
Sbjct  376  YAHTNRQFYRDCYITGTVDFIFGNAAVVL  404



>ref|XP_006449081.1| hypothetical protein CICLE_v10014787mg [Citrus clementina]
 gb|ESR62321.1| hypothetical protein CICLE_v10014787mg [Citrus clementina]
Length=556

 Score =   300 bits (769),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 153/209 (73%), Positives = 173/209 (83%), Gaps = 5/209 (2%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRA--LNGE--FPSWVSASDRRLLEASanavaan-vvvaKDGSGK  166
            SLA+LVA++P   + ++   L  E  FPSWV++ DR LL  S    A   VVVAKDGSG 
Sbjct  196  SLAILVAISPYNTNVIQQYYLRKEIQFPSWVTSRDRLLLRPSQAEAAKANVVVAKDGSGN  255

Query  167  YKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYV  346
            YKTV EAVASAPDN KTRYVIY+KKGTYKENVE+GKKK N+M++GDG+  TIITGSLN V
Sbjct  256  YKTVKEAVASAPDNSKTRYVIYVKKGTYKENVEVGKKKKNLMIVGDGMDLTIITGSLNVV  315

Query  347  DGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTL  526
            DG+TTF SAT+A  GDGFIAQDL IQNTAGPEKHQAVALR+ ADQSVINRC+IDAYQDTL
Sbjct  316  DGSTTFKSATIAVGGDGFIAQDLWIQNTAGPEKHQAVALRVSADQSVINRCRIDAYQDTL  375

Query  527  YAHSQRQFYRDCYITGTVDFIFGNAAAVI  613
            YAH+ RQFYRDCYITGTVDFIFGNAA V+
Sbjct  376  YAHTNRQFYRDCYITGTVDFIFGNAAVVL  404



>ref|XP_011095339.1| PREDICTED: pectinesterase 2.1-like [Sesamum indicum]
Length=550

 Score =   300 bits (767),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            SLA+L AV+   ++ +++L G+ PSW++A DR+LL++ ANA+ A++VVAKDGSG YKTVA
Sbjct  195  SLAMLAAVSEPEKEMVQSLRGKLPSWITAVDRKLLQSRANAIDADLVVAKDGSGNYKTVA  254

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            EA+A+APD  K RYVIY+KKGTYKENVE+GK K N+M+IGDG+ +TIITG LN VDG+TT
Sbjct  255  EAIAAAPDKSKKRYVIYVKKGTYKENVEVGKNKKNLMIIGDGMDSTIITGDLNVVDGSTT  314

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            F SAT+AAVG+GF+ QD+RIQNTAGPEKHQAVALR+GAD+SVINRC+IDAYQDTLYAHS 
Sbjct  315  FKSATLAAVGEGFMLQDIRIQNTAGPEKHQAVALRVGADKSVINRCRIDAYQDTLYAHSL  374

Query  542  RQFYRDCYITGTVDFIFGNAAAVI  613
            RQFYRD YITGTVDFIFGNAA V 
Sbjct  375  RQFYRDSYITGTVDFIFGNAAVVF  398



>emb|CDP05792.1| unnamed protein product [Coffea canephora]
Length=454

 Score =   295 bits (755),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 175/206 (85%), Gaps = 2/206 (1%)
 Frame = +2

Query  2    SLAVLVAV--APSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKT  175
            SLA+L AV  AP+ E+ ++ L GE PSW++  DR+LLE SA  + A+ VVA+DG+G YKT
Sbjct  97   SLAMLAAVHTAPNEEEMMQPLKGEAPSWLTLRDRKLLEKSAEDIKADAVVARDGTGDYKT  156

Query  176  VAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGA  355
            +AEAVA+APD  K RYVIY+KKGTY ENVE+ KKK N+M++GDG+  T+++GSLN VDG+
Sbjct  157  IAEAVAAAPDKSKKRYVIYVKKGTYVENVEVTKKKKNLMIVGDGMDLTVVSGSLNVVDGS  216

Query  356  TTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAH  535
            TTF SAT+AAVGDG I QD+ IQNTAGPEKHQAVALR+GADQSVINRC+IDAYQDTLY+H
Sbjct  217  TTFKSATLAAVGDGLILQDICIQNTAGPEKHQAVALRVGADQSVINRCRIDAYQDTLYSH  276

Query  536  SQRQFYRDCYITGTVDFIFGNAAAVI  613
            S RQFYRDCY+TGT+DFIFGNAA V+
Sbjct  277  SLRQFYRDCYVTGTIDFIFGNAAVVL  302



>gb|KJB57711.1| hypothetical protein B456_009G176700 [Gossypium raimondii]
Length=547

 Score =   297 bits (761),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 177/205 (86%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    SLAVLVAVAPS-TEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTV  178
            SLA+LV+V+P+ TE D   L G FPSW+S+ DR+LL+A  N + A+VVVAKDGSG YK++
Sbjct  191  SLAILVSVSPTKTEFDDDPLTGGFPSWLSSKDRKLLQALPNEIKADVVVAKDGSGNYKSL  250

Query  179  AEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGAT  358
             EAVA+APD  KT Y+I++KKGTYKENVEIG  K N+M++GDG+++TIITGSLN +DG+T
Sbjct  251  GEAVATAPDKSKTTYIIHVKKGTYKENVEIGANKKNLMIVGDGMNSTIITGSLNVIDGST  310

Query  359  TFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHS  538
            TF SATVAAVGDGF+AQD+  QNTAGP+KHQAVA+R+GADQSVINRCKIDAYQDTLYAHS
Sbjct  311  TFKSATVAAVGDGFMAQDIWFQNTAGPQKHQAVAIRVGADQSVINRCKIDAYQDTLYAHS  370

Query  539  QRQFYRDCYITGTVDFIFGNAAAVI  613
             RQFYRD Y+TGTVDFIFGNAA V 
Sbjct  371  NRQFYRDSYVTGTVDFIFGNAAVVF  395



>gb|AHC69829.1| pectin methylesterase PME2.1 [Nicotiana tabacum]
Length=559

 Score =   297 bits (761),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 172/204 (84%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            +LA+L +V    E+    L+G  PSWV++ DR+LLE+SA  + AN VVA+DGSG Y+T+ 
Sbjct  202  ALAILASVTTPNEEVFTPLSGRMPSWVNSRDRKLLESSAKEIKANAVVAQDGSGDYQTLT  261

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            EAVA+APD  KTRYVIY+KKG YKENVE+ KKK N+M++GDG+++TIITGSLN VDG+TT
Sbjct  262  EAVAAAPDKSKTRYVIYVKKGIYKENVEVTKKKMNLMIVGDGMNSTIITGSLNVVDGSTT  321

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            F SAT+AAVG GFI QD+ IQNTAGPEKHQAVALR+GAD SVINRC+IDAYQDTLYAHS 
Sbjct  322  FRSATLAAVGQGFILQDICIQNTAGPEKHQAVALRVGADMSVINRCRIDAYQDTLYAHSL  381

Query  542  RQFYRDCYITGTVDFIFGNAAAVI  613
            RQFYRDCY+TGTVDFIFGNAA V 
Sbjct  382  RQFYRDCYVTGTVDFIFGNAAVVF  405



>ref|XP_009768199.1| PREDICTED: pectinesterase 2.1-like [Nicotiana sylvestris]
Length=559

 Score =   297 bits (760),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 172/204 (84%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            +LA+L +V    E+    L+G  PSWV++ DR+LLE+SA  + AN VVA+DGSG Y+T+ 
Sbjct  202  ALAILASVTTPNEEVFTPLSGRMPSWVNSRDRKLLESSAKEIKANAVVAQDGSGDYQTLT  261

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            EAVA+APD  KTRYVIY+KKG YKENVE+ KKK N+M++GDG+++TIITGSLN VDG+TT
Sbjct  262  EAVAAAPDKSKTRYVIYVKKGIYKENVEVTKKKMNLMIVGDGMNSTIITGSLNVVDGSTT  321

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            F SAT+AAVG GFI QD+ IQNTAGPEKHQAVALR+GAD SVINRC+IDAYQDTLYAHS 
Sbjct  322  FRSATLAAVGQGFILQDICIQNTAGPEKHQAVALRVGADMSVINRCRIDAYQDTLYAHSL  381

Query  542  RQFYRDCYITGTVDFIFGNAAAVI  613
            RQFYRDCY+TGTVDFIFGNAA V 
Sbjct  382  RQFYRDCYVTGTVDFIFGNAAVVF  405



>ref|XP_006467993.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Citrus 
sinensis]
Length=556

 Score =   296 bits (759),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 152/209 (73%), Positives = 172/209 (82%), Gaps = 5/209 (2%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRA--LNGE--FPSWVSASDRRLLEASanavaan-vvvaKDGSGK  166
            SLA+LVA++P   + ++   L  E  FPSWV++ DR LL  S    A   VVVAKDGSG 
Sbjct  196  SLAILVAISPYNTNVIQQYYLRKEIQFPSWVTSRDRLLLRPSQAEAAKANVVVAKDGSGN  255

Query  167  YKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYV  346
            YKTV EAVASAPDN KTRYVIY+KKGTYKENVE+GKKK N+M++GDG+  TIITGSLN V
Sbjct  256  YKTVKEAVASAPDNSKTRYVIYVKKGTYKENVEVGKKKKNLMIVGDGMDLTIITGSLNVV  315

Query  347  DGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTL  526
            DG+TTF SAT+A  GDGFIAQDL IQNTAGPEKHQAVALR+ ADQSVINRC+IDAYQDTL
Sbjct  316  DGSTTFKSATIAVGGDGFIAQDLWIQNTAGPEKHQAVALRVSADQSVINRCRIDAYQDTL  375

Query  527  YAHSQRQFYRDCYITGTVDFIFGNAAAVI  613
            YAH+ RQFYRDC ITGTVDFIFGNAA V+
Sbjct  376  YAHTNRQFYRDCDITGTVDFIFGNAAVVL  404



>ref|XP_007157169.1| hypothetical protein PHAVU_002G048400g [Phaseolus vulgaris]
 gb|ESW29163.1| hypothetical protein PHAVU_002G048400g [Phaseolus vulgaris]
Length=549

 Score =   296 bits (758),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 176/205 (86%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    SLAVLVAV-APSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTV  178
            SLA+LVAV  P+ + +  + NG+FPSWV + DR+LLE+ A  + ANVVVAKDGSG +KTV
Sbjct  191  SLAMLVAVLPPNPKVEEVSENGKFPSWVRSRDRKLLESWAGEITANVVVAKDGSGDFKTV  250

Query  179  AEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGAT  358
            AEAVASAP+  K RYVI++K GTYKENVEIGK+K NVML+GDG++ TIITGSLN++DG  
Sbjct  251  AEAVASAPEKSKKRYVIHVKSGTYKENVEIGKRKKNVMLVGDGMNTTIITGSLNFIDGTG  310

Query  359  TFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHS  538
            TF +ATVAAVGDGFIAQD+  QNTAGPEKHQAVALR+G+D+SVINRC++DAYQDTLYAHS
Sbjct  311  TFRTATVAAVGDGFIAQDIWFQNTAGPEKHQAVALRVGSDESVINRCRVDAYQDTLYAHS  370

Query  539  QRQFYRDCYITGTVDFIFGNAAAVI  613
             RQFYRD +I GT+DFIFGNAAAV 
Sbjct  371  NRQFYRDSFIAGTIDFIFGNAAAVF  395



>ref|NP_001233948.1| pectinesterase 2.1 [Solanum lycopersicum]
 sp|P09607.2|PME21_SOLLC RecName: Full=Pectinesterase 2.1; Short=PE 2.1; AltName: Full=Pectin 
methylesterase 2.1; Flags: Precursor [Solanum lycopersicum]
 emb|CAA52704.1| pectin esterase [Solanum lycopersicum]
Length=550

 Score =   293 bits (751),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            +LA+L +V    ++ LR   G+ PSWVS+ DR+L+E+S   + AN VVAKDG+GKY+T+A
Sbjct  193  ALAMLASVTTPNDEVLRPGLGKMPSWVSSRDRKLMESSGKDIGANAVVAKDGTGKYRTLA  252

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            EAVA+APD  KTRYVIY+K+GTYKENVE+  +K N+M+IGDG+ ATIITGSLN VDG+TT
Sbjct  253  EAVAAAPDKSKTRYVIYVKRGTYKENVEVSSRKMNLMIIGDGMYATIITGSLNVVDGSTT  312

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            F+SAT+AAVG GFI QD+ IQNTAGP KHQAVALR+GAD+SVINRC+IDAYQDTLYAHSQ
Sbjct  313  FHSATLAAVGKGFILQDICIQNTAGPAKHQAVALRVGADKSVINRCRIDAYQDTLYAHSQ  372

Query  542  RQFYRDCYITGTVDFIFGNAAAVI  613
            RQFYRD Y+TGT+DFIFGNAA V 
Sbjct  373  RQFYRDSYVTGTIDFIFGNAAVVF  396



>gb|AAB67739.1| pectin methylesterase PME2.1 [Solanum lycopersicum]
Length=550

 Score =   293 bits (751),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            +LA+L +V    ++ LR   G+ PSWVS+ DR+L+E+S   + AN VVAKDG+GKY+T+A
Sbjct  193  ALAMLASVTTPNDEVLRPGLGKMPSWVSSRDRKLMESSGKDIGANAVVAKDGTGKYRTLA  252

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            EAVA+APD  KTRYVIY+K+GTYKENVE+  +K N+M+IGDG+ ATIITGSLN VDG+TT
Sbjct  253  EAVAAAPDKSKTRYVIYVKRGTYKENVEVSSRKMNLMIIGDGMYATIITGSLNVVDGSTT  312

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            F+SAT+AAVG GFI QD+ IQNTAGP KHQAVALR+GAD+SVINRC+IDAYQDTLYAHSQ
Sbjct  313  FHSATLAAVGKGFILQDICIQNTAGPAKHQAVALRVGADKSVINRCRIDAYQDTLYAHSQ  372

Query  542  RQFYRDCYITGTVDFIFGNAAAVI  613
            RQFYRD Y+TGT+DFIFGNAA V 
Sbjct  373  RQFYRDSYVTGTIDFIFGNAAVVF  396



>gb|KHG26245.1| Pectinesterase/pectinesterase inhibitor [Gossypium arboreum]
Length=477

 Score =   291 bits (745),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            SLA+ V+ +P     +  L   FPSWVS+ DR+LL++  N + ANVVVAKDGSGKYKT+ 
Sbjct  122  SLAIFVSFSPRKTKLIDPLIDGFPSWVSSKDRKLLQSLPNEIKANVVVAKDGSGKYKTLG  181

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            EAVA+APD  KTRY+IY+KKGTYKENVEIGK K N+M++GDG+ +TIITGSLN +DG+TT
Sbjct  182  EAVAAAPDKSKTRYIIYVKKGTYKENVEIGKNKKNLMIVGDGMKSTIITGSLNVIDGSTT  241

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            F SATVAAVGDGF+AQD+  QNTAGP+KHQAVALR+GADQSVINRC+ID YQDTLY HS 
Sbjct  242  FRSATVAAVGDGFMAQDIWFQNTAGPQKHQAVALRVGADQSVINRCQIDGYQDTLYTHSN  301

Query  542  RQFYRDCYITGTVDFIFGNAAAVI  613
            RQFYRD  ITGTVDFIFG+AA V 
Sbjct  302  RQFYRDSEITGTVDFIFGDAAVVF  325



>pir||S00629 pectinesterase (EC 3.1.1.11) precursor (clone PE1) - tomato
 emb|CAA30746.1| unnamed protein product [Solanum lycopersicum]
Length=389

 Score =   288 bits (738),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 173/204 (85%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            +LA+L +V    ++ LR   G+ PSWVS+ DR+L+E+S   + AN VVAKDG+GKY+T+A
Sbjct  17   ALAMLASVTTPNDEVLRPGLGKMPSWVSSRDRKLMESSGKDIGANAVVAKDGTGKYRTLA  76

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            EAVA+APD  KTRYVIY+K+GTYKENVE+  +K N+M+IGDG+ ATIITGSLN VDG+TT
Sbjct  77   EAVAAAPDKSKTRYVIYVKRGTYKENVEVSSRKMNLMIIGDGMYATIITGSLNVVDGSTT  136

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            F+SAT+AAVG GFI QD+ IQNTAGP KHQAVALR+GAD+SVINRC+IDAYQDTLYAHSQ
Sbjct  137  FHSATLAAVGKGFILQDICIQNTAGPAKHQAVALRVGADKSVINRCRIDAYQDTLYAHSQ  196

Query  542  RQFYRDCYITGTVDFIFGNAAAVI  613
            RQFY+  Y+TGT+DFIFGNAA V 
Sbjct  197  RQFYQSSYVTGTIDFIFGNAAVVF  220



>gb|ABK94644.1| unknown [Populus trichocarpa]
Length=327

 Score =   285 bits (730),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = +2

Query  92   DRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIG  271
            DR+LL A    + A+V VAKDGSGKYKTV EAVASAPDNGKTRYVIY+KKGTYKENVE+G
Sbjct  2    DRKLLVALPKDINADVTVAKDGSGKYKTVKEAVASAPDNGKTRYVIYVKKGTYKENVEVG  61

Query  272  KKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQ  451
            KKK NVML+GDG+ +TIITGSLN VDG+TTFNSATVAAVGDGFIAQD+  QNTAGPEKHQ
Sbjct  62   KKKKNVMLVGDGMDSTIITGSLNVVDGSTTFNSATVAAVGDGFIAQDIWFQNTAGPEKHQ  121

Query  452  AVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVI  613
            AVALR+GADQSVINR +IDAYQDTLY HS RQFYRD YITGTVDFIFGNAA V+
Sbjct  122  AVALRVGADQSVINRSRIDAYQDTLYTHSLRQFYRDSYITGTVDFIFGNAAVVL  175



>ref|XP_004293266.1| PREDICTED: pectinesterase [Fragaria vesca subsp. vesca]
Length=528

 Score =   292 bits (747),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 150/207 (72%), Positives = 169/207 (82%), Gaps = 4/207 (2%)
 Frame = +2

Query  5    LAVLVAVAPSTED---DLRALNGEFPSWVSASDRRLLEASana-vaanvvvaKDGSGKYK  172
            LA LV ++PS E    D     G+FP+WV   DRRL+       V ANVVVA DGSGKYK
Sbjct  170  LAKLVEISPSKEKVIGDQPLEIGDFPTWVKRRDRRLMSRDFQKGVEANVVVANDGSGKYK  229

Query  173  TVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDG  352
            TV EAVA+APD   TRYVIY+KKGTYKENVE+ K K N+M++GDG+  TIITGSLN VDG
Sbjct  230  TVKEAVAAAPDKSTTRYVIYVKKGTYKENVEVVKNKKNLMIVGDGMDKTIITGSLNVVDG  289

Query  353  ATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYA  532
            +TTFNSAT+AAVGDGFIAQD+  QNTAGP+KHQAVALR+GADQSVINRC+IDAYQDTLYA
Sbjct  290  STTFNSATLAAVGDGFIAQDIWFQNTAGPDKHQAVALRVGADQSVINRCRIDAYQDTLYA  349

Query  533  HSQRQFYRDCYITGTVDFIFGNAAAVI  613
            HS RQFYRDCYITGTVDFIFGNAA V+
Sbjct  350  HSNRQFYRDCYITGTVDFIFGNAAVVL  376



>ref|NP_001274785.1| pectin methyl esterase [Solanum tuberosum]
 emb|CBY44654.1| pectin methyl esterase [Solanum tuberosum]
Length=545

 Score =   291 bits (746),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            +LA+L +V    ED  R + G+ PSWVS+ DR+L+E+S   + AN VVA+DG+G Y+T+A
Sbjct  188  ALAMLASVTTQNEDVFRTVLGKMPSWVSSRDRKLMESSGKDIKANAVVAQDGTGDYQTLA  247

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            EAVA+APD  KTRYVIY+K G YKENVE+  +K N+M++GDG++ATIITGSLNYVDG TT
Sbjct  248  EAVAAAPDKSKTRYVIYVKMGIYKENVEVTSRKMNLMIVGDGMNATIITGSLNYVDGTTT  307

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            F SAT+AAVG GFI QD+ IQNTAGPEKHQAVALR+G D SVINRC IDAYQDTLYAHSQ
Sbjct  308  FRSATLAAVGQGFILQDICIQNTAGPEKHQAVALRVGGDMSVINRCPIDAYQDTLYAHSQ  367

Query  542  RQFYRDCYITGTVDFIFGNAAAVI  613
            RQFYRD Y++GT+DFIFGNAA V 
Sbjct  368  RQFYRDSYVSGTIDFIFGNAAVVF  391



>gb|AAF23891.1| pectin methyl esterase [Solanum tuberosum]
Length=530

 Score =   291 bits (744),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            +LA+L +V    ED  R + G+ PSWVS+ DR+L+E+S   + AN VVA+DG+G Y+T+A
Sbjct  173  ALAMLASVTTQNEDVFRTVLGKMPSWVSSRDRKLMESSGKDIKANAVVAQDGTGDYQTLA  232

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            EAVA+APD  KTRYVIY+K G YKENVE+  +K N+M++GDG++ATIITGSLNYVDG TT
Sbjct  233  EAVAAAPDKSKTRYVIYVKMGIYKENVEVTSRKMNLMIVGDGMNATIITGSLNYVDGTTT  292

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            F SAT+AAVG GFI QD+ IQNTAGPEKHQAVALR+G D SVINRC IDAYQDTLYAHSQ
Sbjct  293  FRSATLAAVGQGFILQDICIQNTAGPEKHQAVALRVGGDMSVINRCPIDAYQDTLYAHSQ  352

Query  542  RQFYRDCYITGTVDFIFGNAAAVI  613
            RQFYRD Y++GT+DFIFGNAA V 
Sbjct  353  RQFYRDSYVSGTIDFIFGNAAVVF  376



>ref|XP_007157171.1| hypothetical protein PHAVU_002G048600g [Phaseolus vulgaris]
 gb|ESW29165.1| hypothetical protein PHAVU_002G048600g [Phaseolus vulgaris]
Length=553

 Score =   291 bits (745),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDL--RALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKT  175
            +LA+ V V P   + +    LNGEFPSW+ + DRRLLE+S   + ANVVVAKDGS K+KT
Sbjct  194  TLAMFVTVLPPRVEPIVDEPLNGEFPSWLRSKDRRLLESSVGDINANVVVAKDGSDKFKT  253

Query  176  VAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGA  355
            VAEAV SAP N KTRYVIY+KKGTYKENVEI + K NVML+GDG   T+ITGSLNYVDG 
Sbjct  254  VAEAVKSAPVNSKTRYVIYVKKGTYKENVEICQTKKNVMLVGDGKDLTVITGSLNYVDGT  313

Query  356  TTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAH  535
             TF +ATVAAVGDGFI QD+  QNTAGP+K QAVALR+GAD+SVINRC+IDA+QDTLYAH
Sbjct  314  GTFQTATVAAVGDGFIGQDIWFQNTAGPQKQQAVALRVGADKSVINRCRIDAFQDTLYAH  373

Query  536  SQRQFYRDCYITGTVDFIFGNAAAVI  613
            S RQFYRD +ITGTVDFIFGNAA V 
Sbjct  374  SNRQFYRDSFITGTVDFIFGNAAVVF  399



>gb|KJB67143.1| hypothetical protein B456_010G177500 [Gossypium raimondii]
Length=547

 Score =   291 bits (744),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            SLA+ V+ +P     +  L   FPSWVS  DR+LL++  N + ANVVVAKDGSGKYKT+ 
Sbjct  192  SLAIFVSFSPRKTKLIDPLIDRFPSWVSNKDRKLLQSLPNEIKANVVVAKDGSGKYKTLG  251

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            EAVA+APD  KTRY+IY+KKGTYKENVEIGK K N+M++GDG+ +TIITGSLN +DG+TT
Sbjct  252  EAVAAAPDKSKTRYIIYVKKGTYKENVEIGKNKKNLMIVGDGMKSTIITGSLNVIDGSTT  311

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            F SATVAAVGDGF+AQD+  QNTAGP+KHQAVALR+GADQSV+NRC+ID YQDTLY HS 
Sbjct  312  FRSATVAAVGDGFMAQDIWFQNTAGPQKHQAVALRVGADQSVLNRCQIDGYQDTLYTHSN  371

Query  542  RQFYRDCYITGTVDFIFGNAAAVI  613
            RQFYRD  ITGTVDFIFG+AA V 
Sbjct  372  RQFYRDSEITGTVDFIFGDAAVVF  395



>ref|XP_008224789.1| PREDICTED: pectinesterase [Prunus mume]
Length=555

 Score =   290 bits (743),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 151/210 (72%), Positives = 174/210 (83%), Gaps = 9/210 (4%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRA-----LNGEFPSWVSASDRRLLE--ASanavaanvvvaKDGS  160
            SLA++VA+  S    L+A     LNGEFPSWV++ DRRLL+    A  V AN+VVAKDGS
Sbjct  195  SLAIMVAI--SNLSKLKAEIHEPLNGEFPSWVTSRDRRLLQDYNLAKEVKANIVVAKDGS  252

Query  161  GKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLN  340
            G YKTV EAVA+AP+N KTRY+IY+KKGTYKENVE+GK K N+M++GDG+  T+ITGSLN
Sbjct  253  GNYKTVKEAVAAAPNNSKTRYIIYVKKGTYKENVEVGKNKKNLMIVGDGMDNTVITGSLN  312

Query  341  YVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQD  520
             VDG+TTF SAT+AAVGDGFIAQD+  QNTAG  KHQAVALR+GADQSVINRC+IDAYQD
Sbjct  313  VVDGSTTFKSATLAAVGDGFIAQDMWFQNTAGAVKHQAVALRVGADQSVINRCRIDAYQD  372

Query  521  TLYAHSQRQFYRDCYITGTVDFIFGNAAAV  610
            TLY HS RQFYRD YITGTVDFIFGNAA V
Sbjct  373  TLYTHSNRQFYRDSYITGTVDFIFGNAAVV  402



>emb|CAA66360.1| pectin methylesterase [Solanum tuberosum]
Length=217

 Score =   279 bits (714),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +2

Query  149  KDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIIT  328
            KDGSGKYKT+ EAVASAPDN KTR+VIY+KKGTYKENVEIGKKK N+ML+GDG+ ATIIT
Sbjct  2    KDGSGKYKTLLEAVASAPDNSKTRFVIYVKKGTYKENVEIGKKKKNIMLVGDGMDATIIT  61

Query  329  GSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKID  508
            G+LN +DG+TTF SATVAAVGDGFIAQDL+ QNTAGP+KHQAVALR+GADQSVINRCKID
Sbjct  62   GNLNVIDGSTTFKSATVAAVGDGFIAQDLQFQNTAGPQKHQAVALRVGADQSVINRCKID  121

Query  509  AYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVI  613
            A+QDTLY H+ RQFYRDCYITGTVDFIFGNAA V 
Sbjct  122  AFQDTLYTHTLRQFYRDCYITGTVDFIFGNAAVVF  156



>sp|Q96575.1|PME22_SOLLC RecName: Full=Pectinesterase 2.2; Short=PE 2.2; AltName: Full=Pectin 
methylesterase 2.2; Flags: Precursor [Solanum lycopersicum]
 gb|AAB38792.1| pectin methylesterase [Solanum lycopersicum]
Length=550

 Score =   290 bits (741),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 172/204 (84%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            +LA+L +V    +D LR   G+ PSWVS+ DR+L+E+S   + AN VVAKDG+GKY+T+A
Sbjct  193  ALAMLASVTTPNDDVLRPGLGKMPSWVSSRDRKLMESSGKDIGANAVVAKDGTGKYRTLA  252

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            EAVA+APD  KTRYVIY+K+G YKENVE+  +K  +M++GDG+ ATIITG+LN VDG+TT
Sbjct  253  EAVAAAPDKSKTRYVIYVKRGIYKENVEVSSRKMKLMIVGDGMHATIITGNLNVVDGSTT  312

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            F+SAT+AAVG GFI QD+ IQNTAGP KHQAVALR+GAD+SVINRC+IDAYQDTLYAHSQ
Sbjct  313  FHSATLAAVGKGFILQDICIQNTAGPAKHQAVALRVGADKSVINRCRIDAYQDTLYAHSQ  372

Query  542  RQFYRDCYITGTVDFIFGNAAAVI  613
            RQFYRD Y+TGT+DFIFGNAA V 
Sbjct  373  RQFYRDSYVTGTIDFIFGNAAVVF  396



>ref|XP_006360082.1| PREDICTED: pectinesterase 3-like [Solanum tuberosum]
Length=540

 Score =   289 bits (739),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            +LA+L +V    ED  R + G+ PSWVS  DR+L+E+S   + AN VVA+DG+G Y+T+A
Sbjct  183  ALAMLASVTTQNEDVFRTVLGKMPSWVSLRDRKLMESSGKDIIANAVVAQDGTGDYQTLA  242

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            EAVA+APD  KTRYVIY+K G YKENVE+ KKK N+M++GDG++ATIITGSLN VDG+TT
Sbjct  243  EAVAAAPDKNKTRYVIYVKMGIYKENVEVTKKKMNLMIVGDGMNATIITGSLNVVDGSTT  302

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            F SAT+AAVG GFI QDL IQNTAGPEK QAVALR+GAD SVINRC+IDAYQDTLYAHS 
Sbjct  303  FRSATLAAVGQGFILQDLCIQNTAGPEKGQAVALRVGADMSVINRCRIDAYQDTLYAHSL  362

Query  542  RQFYRDCYITGTVDFIFGNAAAVI  613
            RQFYRD Y+TGTVDFIFGNAA V 
Sbjct  363  RQFYRDSYVTGTVDFIFGNAAVVF  386



>ref|XP_007213952.1| hypothetical protein PRUPE_ppa003697mg [Prunus persica]
 gb|EMJ15151.1| hypothetical protein PRUPE_ppa003697mg [Prunus persica]
Length=555

 Score =   289 bits (740),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 174/208 (84%), Gaps = 5/208 (2%)
 Frame = +2

Query  2    SLAVLVAVA-PSTE--DDLRALNGEFPSWVSASDRRLLE--ASanavaanvvvaKDGSGK  166
            SLA++VA++ PS    +    LNGEFPSWV++ DRRLL+    A  V AN+VVAKDGSG 
Sbjct  195  SLAIMVAISNPSKPKAEIHEPLNGEFPSWVTSRDRRLLQDYNLAKEVKANIVVAKDGSGN  254

Query  167  YKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYV  346
            YKT+ EAVA+AP+N KTRY+IY+KKGTYKENVE+GK K N+M++GDG+  T+ITGSLN V
Sbjct  255  YKTLKEAVAAAPNNSKTRYIIYVKKGTYKENVEVGKDKKNLMIVGDGMDDTVITGSLNVV  314

Query  347  DGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTL  526
            DG+TTF SAT+AAVGDGFIAQD+  QNTAG  KHQAVALR+GADQSVINRC+IDAYQDTL
Sbjct  315  DGSTTFKSATLAAVGDGFIAQDMWFQNTAGAVKHQAVALRVGADQSVINRCRIDAYQDTL  374

Query  527  YAHSQRQFYRDCYITGTVDFIFGNAAAV  610
            Y HS RQFYRD YITGTVDFIFGNAA V
Sbjct  375  YTHSNRQFYRDSYITGTVDFIFGNAAVV  402



>ref|XP_009364480.1| PREDICTED: pectinesterase [Pyrus x bretschneideri]
Length=558

 Score =   289 bits (739),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 150/208 (72%), Positives = 172/208 (83%), Gaps = 4/208 (2%)
 Frame = +2

Query  2    SLAVLVAVA-PSTEDDLRA-LNGEFPSWVSASDRRLLEAS--anavaanvvvaKDGSGKY  169
            SLA++VA++ PS  + ++  L+G FP+WV++ DRRLL  S  A    AN VVAKDGSG Y
Sbjct  199  SLAIVVAISDPSKSNTIKERLDGNFPTWVTSKDRRLLLDSNLAKESNANAVVAKDGSGNY  258

Query  170  KTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVD  349
            KTV EAVA+APDN KTRY I++KKGTYKEN E+GKKK N+M+ GDG+  TIITGSLN VD
Sbjct  259  KTVKEAVAAAPDNSKTRYTIHVKKGTYKENFEVGKKKKNLMITGDGMHNTIITGSLNVVD  318

Query  350  GATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLY  529
            GATTFNSAT+AAVGDGFIAQD+  QNTAG  KHQAVALR+GADQSVINRC+IDAYQDTLY
Sbjct  319  GATTFNSATLAAVGDGFIAQDIWFQNTAGAAKHQAVALRVGADQSVINRCRIDAYQDTLY  378

Query  530  AHSQRQFYRDCYITGTVDFIFGNAAAVI  613
            AHS RQFYRD  ITGTVDFIFGNAA V 
Sbjct  379  AHSNRQFYRDSNITGTVDFIFGNAAVVF  406



>ref|XP_006417343.1| hypothetical protein EUTSA_v10007263mg [Eutrema salsugineum]
 gb|ESQ35696.1| hypothetical protein EUTSA_v10007263mg [Eutrema salsugineum]
Length=557

 Score =   288 bits (738),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanv--vvaKDGSGKYKT  175
            +LA+ V+V PS ++        FPSW+SA DR+LLE++   +  N   VVAKDG+GKYKT
Sbjct  200  ALAIFVSVLPSRDEHEMFFPIHFPSWLSALDRKLLESAPKTLEVNANVVVAKDGTGKYKT  259

Query  176  VAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGA  355
            V EAVA+AP+N KTRYVIY+KKG YKE V+IGKKKTN+ML+GDG   TIITGSLN +DG+
Sbjct  260  VNEAVAAAPENSKTRYVIYVKKGVYKETVDIGKKKTNLMLVGDGKDTTIITGSLNVIDGS  319

Query  356  TTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAH  535
            TTF SATVAA GDGF+AQD+  QNTAGP KHQAVALR+ ADQ+VINRC+IDAYQDTLY H
Sbjct  320  TTFRSATVAANGDGFMAQDIWFQNTAGPAKHQAVALRVSADQTVINRCRIDAYQDTLYTH  379

Query  536  SQRQFYRDCYITGTVDFIFGNAAAVI  613
            + RQFYRDCYITGTVDFIFGN+A V 
Sbjct  380  TLRQFYRDCYITGTVDFIFGNSAVVF  405



>ref|XP_002522859.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF39557.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=553

 Score =   287 bits (735),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            SLAVL +++ S + +LR L+G FP W+   DR++L +S+  + ANVVVA+DGSG Y T+ 
Sbjct  198  SLAVLASLSASNKGNLRPLSGGFPWWIRVKDRKILGSSSENIQANVVVAQDGSGDYSTIQ  257

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            EAVASAPD  KTRYVIY+KKGTY ENVEI KKK N+M+ GDG++ TIITGSLN  DG+TT
Sbjct  258  EAVASAPDKSKTRYVIYVKKGTYIENVEIAKKKKNLMIFGDGMNLTIITGSLNVADGSTT  317

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            F SAT+A  GDGFI QD+ +QNTAGPEKHQAVALR+ ADQ+VINRC+IDA+QDTLYAHS 
Sbjct  318  FRSATLAVAGDGFILQDVWVQNTAGPEKHQAVALRVSADQAVINRCQIDAFQDTLYAHSY  377

Query  542  RQFYRDCYITGTVDFIFGNAAAVI  613
            RQFYRDCYI GT+DFIFGNAA V+
Sbjct  378  RQFYRDCYILGTIDFIFGNAAVVL  401



>gb|AAB67740.1| PME1.9 [Solanum lycopersicum]
Length=430

 Score =   282 bits (721),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            +LA+L ++    ED L  + G+ PSWVS+ DR+L+E+S   + AN VVA+DG+G Y+T+A
Sbjct  73   ALAMLASLTTQDEDVLMTVLGKMPSWVSSMDRKLMESSGKDIIANAVVAQDGTGDYQTLA  132

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            EAVA+APD  KTRYVIY+K+GTYKENVE+   K N+M++GDG+ AT ITGSLN VDG+TT
Sbjct  133  EAVAAAPDKSKTRYVIYVKRGTYKENVEVSSNKMNLMIVGDGMYATTITGSLNVVDGSTT  192

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            F SAT+AAVG GFI QD+ IQNTAGP K QAVALR+GAD SVINRC+IDAYQDTLYAHSQ
Sbjct  193  FRSATLAAVGQGFILQDICIQNTAGPAKDQAVALRVGADMSVINRCRIDAYQDTLYAHSQ  252

Query  542  RQFYRDCYITGTVDFIFGNAAAVI  613
            RQFYRD Y+TGTVDFIFGNAA V 
Sbjct  253  RQFYRDSYVTGTVDFIFGNAAVVF  276



>ref|XP_010057972.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=549

 Score =   285 bits (729),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 142/207 (69%), Positives = 170/207 (82%), Gaps = 3/207 (1%)
 Frame = +2

Query  2    SLAVLVAVAPST---EDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYK  172
            SLA+ V+ +       D L +L G+FPSWV+  D RLL++  NAV A+VVVAKDG+GK+K
Sbjct  191  SLAIFVSTSSPEGRRPDVLESLIGDFPSWVTRKDHRLLQSLVNAVNADVVVAKDGTGKFK  250

Query  173  TVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDG  352
            TV EA+A+AP   +TRYVIY+KKGTYKENVE+ K KTN+ML+GDG+ +T+ITGSLN +DG
Sbjct  251  TVKEAIAAAPSKAQTRYVIYVKKGTYKENVEVAKTKTNIMLVGDGMDSTVITGSLNVIDG  310

Query  353  ATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYA  532
            ATTFNSATVA  GDGFIAQD+  QNTAGP+KHQAVALR+ AD+SVINRC+IDAYQDTLY 
Sbjct  311  ATTFNSATVAVNGDGFIAQDIWFQNTAGPQKHQAVALRVSADKSVINRCRIDAYQDTLYT  370

Query  533  HSQRQFYRDCYITGTVDFIFGNAAAVI  613
            H+ RQFYRD YITGTVDFIFGNA  V 
Sbjct  371  HTSRQFYRDSYITGTVDFIFGNAGVVF  397



>ref|XP_008371117.1| PREDICTED: pectinesterase [Malus domestica]
Length=558

 Score =   284 bits (726),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 170/208 (82%), Gaps = 4/208 (2%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDL--RALNGEFPSWVSASDRRLLEAS--anavaanvvvaKDGSGKY  169
            SLA++VA++  ++ +     L+G FP+WV++ DRRLL  S  A    AN VVAKDGSG Y
Sbjct  199  SLAIVVAISDRSKSNPIKERLDGIFPTWVTSKDRRLLLDSNLAKESNANAVVAKDGSGNY  258

Query  170  KTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVD  349
            KTV EAVA+APDN KTRY I++KKGTYKENVE+GKKK N+M  GDG+  TIITGSLN VD
Sbjct  259  KTVKEAVAAAPDNSKTRYXIHVKKGTYKENVEVGKKKKNLMXTGDGMHNTIITGSLNVVD  318

Query  350  GATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLY  529
            GATTFNSAT+AAVGDGFIAQD+  QNTAG  KHQAVALR+GAD+SVINRC+IDAYQDTLY
Sbjct  319  GATTFNSATLAAVGDGFIAQDIWFQNTAGAAKHQAVALRVGADRSVINRCRIDAYQDTLY  378

Query  530  AHSQRQFYRDCYITGTVDFIFGNAAAVI  613
            AHS RQFYRD  ITGTVDFIFGNAA V 
Sbjct  379  AHSNRQFYRDSXITGTVDFIFGNAAVVF  406



>ref|XP_010493017.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18-like [Camelina 
sativa]
Length=547

 Score =   283 bits (723),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEA--SanavaanvvvaKDGSGKYKT  175
            +LA+ V+V P+ +D    L   FPSW++A DR LLE+      V ANVVVAKDGSGKYKT
Sbjct  190  ALAIFVSVLPARDDLKMVLFDHFPSWLTALDRELLESDPKTLKVNANVVVAKDGSGKYKT  249

Query  176  VAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGA  355
            V EAVA+AP+N  +RYVIY+KKG YKE ++IGKKK N+ML+GDG  AT+ITGSLN VDG+
Sbjct  250  VNEAVAAAPENSNSRYVIYVKKGVYKETIDIGKKKKNLMLVGDGKDATVITGSLNVVDGS  309

Query  356  TTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAH  535
            TTF SAT+AA GDGF+AQDL IQNTAGP KHQAVALR+ ADQ+VINRC+IDAYQDTLY H
Sbjct  310  TTFRSATIAANGDGFMAQDLWIQNTAGPAKHQAVALRVSADQTVINRCRIDAYQDTLYTH  369

Query  536  SQRQFYRDCYITGTVDFIFGNAAAVI  613
            + RQFYRD YITGTVDFIFGN+A V 
Sbjct  370  TLRQFYRDSYITGTVDFIFGNSAVVF  395



>ref|XP_010458561.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18-like [Camelina 
sativa]
Length=547

 Score =   283 bits (723),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 167/206 (81%), Gaps = 2/206 (1%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanv--vvaKDGSGKYKT  175
            +LA+ V+V P+ +D    L   FPSW++A DR LLE++   +  N   VVAKDGSGKYKT
Sbjct  190  ALAIFVSVLPARDDLKMVLFDHFPSWLTALDRELLESAPKTLKVNANVVVAKDGSGKYKT  249

Query  176  VAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGA  355
            V EAVA+AP+N  +RYVIY+KKG YKE ++IGKKK N+ML+GDG  ATIITGSLN VDG+
Sbjct  250  VNEAVAAAPENSNSRYVIYVKKGVYKETIDIGKKKKNLMLVGDGKDATIITGSLNVVDGS  309

Query  356  TTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAH  535
            TTF SAT+AA GDGF+AQDL IQNTAGP KHQAVALR+ ADQ+VINRC+IDAYQDTLY H
Sbjct  310  TTFRSATIAANGDGFMAQDLWIQNTAGPAKHQAVALRVSADQTVINRCRIDAYQDTLYTH  369

Query  536  SQRQFYRDCYITGTVDFIFGNAAAVI  613
            + RQFYRD +ITGTVDFIFGN+A V 
Sbjct  370  TLRQFYRDSFITGTVDFIFGNSAVVF  395



>ref|NP_172624.1| methylesterase PCR A [Arabidopsis thaliana]
 sp|Q1JPL7.3|PME18_ARATH RecName: Full=Pectinesterase/pectinesterase inhibitor 18; AltName: 
Full=AtPMEpcrA; Contains: RecName: Full=Pectinesterase 
inhibitor 18; AltName: Full=Pectin methylesterase inhibitor 
18; Contains: RecName: Full=Bifunctional pectinesterase 18/rRNA 
N-glycosylase; Short=PE 18; AltName: Full=Pectin methylesterase 
18; AltName: Full=Pectin methylesterase 4; Short=AtPME4; 
AltName: Full=Ribosome-inactivating protein; Flags: Precursor 
[Arabidopsis thaliana]
 gb|ABF57292.1| At1g11580 [Arabidopsis thaliana]
 gb|AEE28755.1| methylesterase PCR A [Arabidopsis thaliana]
Length=557

 Score =   283 bits (724),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 170/206 (83%), Gaps = 2/206 (1%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEAS--anavaanvvvaKDGSGKYKT  175
            +LA+ V+V P+ +D    ++  FPSW++A DR+LLE+S     V ANVVVAKDG+GK+KT
Sbjct  200  ALAIFVSVLPARDDLKMIISNRFPSWLTALDRKLLESSPKTLKVTANVVVAKDGTGKFKT  259

Query  176  VAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGA  355
            V EAVA+AP+N  TRYVIY+KKG YKE ++IGKKK N+ML+GDG  ATIITGSLN +DG+
Sbjct  260  VNEAVAAAPENSNTRYVIYVKKGVYKETIDIGKKKKNLMLVGDGKDATIITGSLNVIDGS  319

Query  356  TTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAH  535
            TTF SATVAA GDGF+AQD+  QNTAGP KHQAVALR+ ADQ+VINRC+IDAYQDTLY H
Sbjct  320  TTFRSATVAANGDGFMAQDIWFQNTAGPAKHQAVALRVSADQTVINRCRIDAYQDTLYTH  379

Query  536  SQRQFYRDCYITGTVDFIFGNAAAVI  613
            + RQFYRD YITGTVDFIFGN+A V 
Sbjct  380  TLRQFYRDSYITGTVDFIFGNSAVVF  405



>ref|XP_010923950.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=547

 Score =   283 bits (723),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 174/205 (85%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASana-vaanvvvaKDGSGKYKTV  178
            +LAVL AV+PS  D +  ++  FPSW++  DR+LLE+S++  VA NV VA DGSG YKTV
Sbjct  192  TLAVLSAVSPSDGDAIERVS-RFPSWLTVKDRKLLESSSSDGVAVNVTVAADGSGDYKTV  250

Query  179  AEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGAT  358
             EAV SAPD GK RYVIY+K+GTYKENV +GKKKTNVM++GDG+++T+ITGSLN VDG+T
Sbjct  251  QEAVDSAPDKGKVRYVIYVKEGTYKENVIVGKKKTNVMIVGDGMNSTVITGSLNVVDGST  310

Query  359  TFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHS  538
            TFNSAT+AAVG+GFI QD+ I+NTAGPEKHQAVALR+GAD+SVINRC++D YQDTLYAHS
Sbjct  311  TFNSATLAAVGEGFILQDICIENTAGPEKHQAVALRVGADRSVINRCRVDGYQDTLYAHS  370

Query  539  QRQFYRDCYITGTVDFIFGNAAAVI  613
             RQFY D  I+GTVDFIFGNAA V 
Sbjct  371  LRQFYGDSIISGTVDFIFGNAAVVF  395



>gb|AAK59760.1| At1g11580/T23J18_33 [Arabidopsis thaliana]
Length=557

 Score =   283 bits (723),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 170/206 (83%), Gaps = 2/206 (1%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEAS--anavaanvvvaKDGSGKYKT  175
            +LA+ V+V P+ +D    ++  FPSW++A DR+LLE+S     V ANVVVAKDG+GK+KT
Sbjct  200  ALAIFVSVLPARDDLKMIISNRFPSWLTALDRKLLESSPKTLKVTANVVVAKDGTGKFKT  259

Query  176  VAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGA  355
            V EAVA+AP+N  TRYVIY+KKG YKE ++IGKKK N+ML+GDG  ATIITGSLN +DG+
Sbjct  260  VNEAVAAAPENSNTRYVIYVKKGVYKETIDIGKKKKNLMLVGDGKDATIITGSLNVIDGS  319

Query  356  TTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAH  535
            TTF SATVAA GDGF+AQD+  QNTAGP KHQAVALR+ ADQ+VINRC+IDAYQDTLY H
Sbjct  320  TTFRSATVAANGDGFMAQDIWFQNTAGPAKHQAVALRVSADQTVINRCRIDAYQDTLYTH  379

Query  536  SQRQFYRDCYITGTVDFIFGNAAAVI  613
            + RQFYRD YITGTVDFIFGN+A V 
Sbjct  380  TLRQFYRDSYITGTVDFIFGNSAVVF  405



>ref|XP_006307176.1| hypothetical protein CARUB_v10008769mg [Capsella rubella]
 gb|EOA40074.1| hypothetical protein CARUB_v10008769mg [Capsella rubella]
Length=547

 Score =   282 bits (721),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 167/206 (81%), Gaps = 2/206 (1%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanv--vvaKDGSGKYKT  175
            +LA+ V+V P+ +D    L   FPSW++  DR LLE++  A+  N   VVAKDGSGKYKT
Sbjct  190  ALAIFVSVLPARDDLKMILFDHFPSWLTTLDRELLESAPKALKVNANVVVAKDGSGKYKT  249

Query  176  VAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGA  355
            V EAVA+AP+N  +RYVIY+KKG YKE ++IGKKK N+ML+GDG  ATIITGSLN VDG+
Sbjct  250  VNEAVAAAPENSNSRYVIYVKKGVYKETIDIGKKKKNLMLVGDGKDATIITGSLNVVDGS  309

Query  356  TTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAH  535
            TTF SAT+AA GDGF+AQDL IQNTAGP KHQAVALR+ ADQ+VINRC+IDAYQDTLY H
Sbjct  310  TTFRSATIAANGDGFMAQDLWIQNTAGPAKHQAVALRVSADQTVINRCRIDAYQDTLYTH  369

Query  536  SQRQFYRDCYITGTVDFIFGNAAAVI  613
            + RQFYRD YITGTVDFIFGN+A V 
Sbjct  370  TLRQFYRDSYITGTVDFIFGNSAVVF  395



>ref|NP_001234151.1| pectinesterase 1 precursor [Solanum lycopersicum]
 sp|P14280.5|PME1_SOLLC RecName: Full=Pectinesterase 1; Short=PE 1; AltName: Full=Pectin 
methylesterase 1; Flags: Precursor [Solanum lycopersicum]
 emb|CAA52703.1| pectin esterase [Solanum lycopersicum]
Length=546

 Score =   281 bits (720),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 167/204 (82%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            +LA+L ++    ED    + G+ PSWVS+ DR+L+E+S   + AN VVA+DG+G Y+T+A
Sbjct  189  ALAMLASLTTQDEDVFMTVLGKMPSWVSSMDRKLMESSGKDIIANAVVAQDGTGDYQTLA  248

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            EAVA+APD  KTRYVIY+K+GTYKENVE+   K N+M++GDG+ AT ITGSLN VDG+TT
Sbjct  249  EAVAAAPDKSKTRYVIYVKRGTYKENVEVASNKMNLMIVGDGMYATTITGSLNVVDGSTT  308

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            F SAT+AAVG GFI QD+ IQNTAGP K QAVALR+GAD SVINRC+IDAYQDTLYAHSQ
Sbjct  309  FRSATLAAVGQGFILQDICIQNTAGPAKDQAVALRVGADMSVINRCRIDAYQDTLYAHSQ  368

Query  542  RQFYRDCYITGTVDFIFGNAAAVI  613
            RQFYRD Y+TGTVDFIFGNAA V 
Sbjct  369  RQFYRDSYVTGTVDFIFGNAAVVF  392



>ref|XP_010476087.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18 [Camelina 
sativa]
Length=550

 Score =   281 bits (718),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEA--SanavaanvvvaKDGSGKYKT  175
            +LA+ V+V P+ +D    L   FPSW++A DR LLE+      V ANVVVAKDGSGK+KT
Sbjct  193  ALAIFVSVLPARDDLKMVLFDHFPSWLTALDRELLESDPKTIKVNANVVVAKDGSGKFKT  252

Query  176  VAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGA  355
            V EAVA+AP+N  +RYVIY+KKG YKE ++IGKKK N+ML+GDG  ATIITGSLN VDG+
Sbjct  253  VNEAVAAAPENSNSRYVIYVKKGVYKETIDIGKKKKNLMLVGDGKDATIITGSLNVVDGS  312

Query  356  TTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAH  535
            TTF SAT+AA GDGF+AQDL IQNTAGP KHQAVALR+ ADQ+VINRC+IDAYQDTLY H
Sbjct  313  TTFRSATIAANGDGFMAQDLWIQNTAGPAKHQAVALRVSADQTVINRCRIDAYQDTLYTH  372

Query  536  SQRQFYRDCYITGTVDFIFGNAAAVI  613
            + RQFYRD +ITGTVDFIFGN+A V 
Sbjct  373  TLRQFYRDSFITGTVDFIFGNSAVVF  398



>ref|XP_010324324.1| PREDICTED: pectinesterase 3 [Solanum lycopersicum]
Length=543

 Score =   280 bits (717),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            +LA+L +V    ++ LR   G+ P WVS+ DR+L+E+S   + AN VVA+DG+G Y+T+A
Sbjct  186  ALAMLASVTTPNDEVLRQGLGKMPYWVSSRDRKLMESSGKDIIANAVVAQDGTGDYQTLA  245

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            EAV +APD  KTRYVIY+K G YKENV + KKK N+M++GDG++ATIITGSLN VDG+TT
Sbjct  246  EAVDAAPDKNKTRYVIYVKMGIYKENVVVTKKKMNLMIVGDGMNATIITGSLNVVDGSTT  305

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            F SAT+AAVG GFI QDL IQNTAGPEK QAVALR+GAD SVINRC+IDAYQDTLYAHSQ
Sbjct  306  FRSATLAAVGQGFILQDLCIQNTAGPEKGQAVALRVGADMSVINRCRIDAYQDTLYAHSQ  365

Query  542  RQFYRDCYITGTVDFIFGNAAAVI  613
            RQFYRD Y+TGTVDFIFGNAA V 
Sbjct  366  RQFYRDSYVTGTVDFIFGNAAVVF  389



>emb|CAA96434.1| pectin methylesterase [Nicotiana plumbaginifolia]
Length=315

 Score =   273 bits (698),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  149  KDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIIT  328
            KDGSGKYKTV EAVAS PDN  +RYVIY+KKG YKENVEIGKKK NVML+GDG+ ATIIT
Sbjct  10   KDGSGKYKTVKEAVASVPDNSNSRYVIYVKKGIYKENVEIGKKKKNVMLVGDGMDATIIT  69

Query  329  GSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKID  508
            G+LN VDGATTFNSATVAAVGDGFIAQD++ QNTAG  KHQAVALR+GADQSVINRCKID
Sbjct  70   GNLNVVDGATTFNSATVAAVGDGFIAQDVQFQNTAGAAKHQAVALRVGADQSVINRCKID  129

Query  509  AYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVI  613
            A+QDTLY HS RQFYRDCYITGTVDFIFGNAA V 
Sbjct  130  AFQDTLYTHSLRQFYRDCYITGTVDFIFGNAAVVF  164



>ref|XP_010057974.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=549

 Score =   280 bits (717),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 141/207 (68%), Positives = 170/207 (82%), Gaps = 3/207 (1%)
 Frame = +2

Query  2    SLAVLVAVAPS---TEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYK  172
            SLA+ V+ +       D L +L G+FPSWV+  DRRLL++ ANAV A+VVVAKDGSGKYK
Sbjct  191  SLAIFVSTSSPEGRKPDVLESLIGDFPSWVTGKDRRLLQSPANAVNADVVVAKDGSGKYK  250

Query  173  TVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDG  352
            TV +A+A+AP   +TRYVI++KKGTYKENVE+ K K N+ML+GDG++ T+ITGSLN +DG
Sbjct  251  TVKQAIAAAPSKAQTRYVIHVKKGTYKENVEVAKTKKNIMLVGDGMNLTVITGSLNVIDG  310

Query  353  ATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYA  532
            ATTF SATVA  GDGFIAQD+  QNTAGP+KHQAVALR+ AD+SVINRC+IDAYQDTLY 
Sbjct  311  ATTFKSATVAVNGDGFIAQDIWFQNTAGPQKHQAVALRVSADKSVINRCRIDAYQDTLYT  370

Query  533  HSQRQFYRDCYITGTVDFIFGNAAAVI  613
            H+ RQFYRD YITGTVDFIFG+A  V 
Sbjct  371  HTNRQFYRDSYITGTVDFIFGDAGVVF  397



>ref|XP_006360083.1| PREDICTED: pectinesterase 2.1-like [Solanum tuberosum]
Length=550

 Score =   280 bits (716),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 164/204 (80%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            +LA+L +V    ED  R + G  PSWVS+ DR+L+E+    +  N VVA+DG+G Y+T+A
Sbjct  193  ALAMLASVTTHNEDVFRTVLGRMPSWVSSRDRKLMESLGKDIKTNAVVAQDGTGDYQTLA  252

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            EAVA+APDN K RYVIY+K G YKENVE+   K N+M++GDG++ATIITGSLN VDG+TT
Sbjct  253  EAVAAAPDNSKKRYVIYVKMGIYKENVEVTNNKMNLMIVGDGMNATIITGSLNVVDGSTT  312

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            F SAT+AAVG GFI QD+ IQNTAGP+KHQAVALR+GAD SVINRC IDAYQDTLYA S 
Sbjct  313  FRSATLAAVGQGFILQDICIQNTAGPDKHQAVALRVGADMSVINRCHIDAYQDTLYAFSL  372

Query  542  RQFYRDCYITGTVDFIFGNAAAVI  613
            RQFYRD Y+TGTVDFIFGNAA V 
Sbjct  373  RQFYRDSYVTGTVDFIFGNAAVVF  396



>gb|AFC98398.1| pectin methylesterase [Lepidium sativum]
Length=556

 Score =   280 bits (716),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/206 (66%), Positives = 167/206 (81%), Gaps = 2/206 (1%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanv--vvaKDGSGKYKT  175
            +LA+ V+V P  +D    ++  FPSW++  DR+LLE++  ++  N   VVAKDG+GK+KT
Sbjct  199  ALAIFVSVTPVKDDLQMIVSNHFPSWLTTFDRKLLESAPKSLEVNANVVVAKDGTGKFKT  258

Query  176  VAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGA  355
            V EAV +AP+N  +RYV+Y+KKG YKE ++IGKKK N+ML+GDG   TIITGSLN VDG+
Sbjct  259  VNEAVTAAPENSNSRYVVYVKKGVYKETIDIGKKKKNLMLVGDGKDLTIITGSLNVVDGS  318

Query  356  TTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAH  535
            TTF SATVAA GDGF+AQD+ IQNTAGP KHQAVALR+ ADQSVINRC+IDAYQDTLY H
Sbjct  319  TTFRSATVAANGDGFMAQDIWIQNTAGPAKHQAVALRVSADQSVINRCRIDAYQDTLYTH  378

Query  536  SQRQFYRDCYITGTVDFIFGNAAAVI  613
            + RQFYRDC+ITGTVDFIFGN+A V 
Sbjct  379  TLRQFYRDCFITGTVDFIFGNSAVVF  404



>ref|XP_008809854.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=550

 Score =   280 bits (715),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 172/205 (84%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASana-vaanvvvaKDGSGKYKTV  178
            SLAVL AV+PS  D +  +   FPSW++  DR+LLE+S++  +AANV VA +GSG YKTV
Sbjct  195  SLAVLSAVSPSDGDAIERVR-RFPSWLTVKDRKLLESSSSDGIAANVTVAAEGSGDYKTV  253

Query  179  AEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGAT  358
             EAV SAPD GK RYVIY+K+GTYKENV +GKKKTNV ++GDG+++T+ITGSLN VDG+T
Sbjct  254  QEAVDSAPDKGKVRYVIYVKEGTYKENVVVGKKKTNVTIVGDGMNSTVITGSLNVVDGST  313

Query  359  TFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHS  538
            TFNSAT AAVG+GFI QD+ I+NTAGPEKHQAVALR+GAD+S INRC++D YQDTLYAHS
Sbjct  314  TFNSATFAAVGEGFILQDICIENTAGPEKHQAVALRVGADRSAINRCRLDGYQDTLYAHS  373

Query  539  QRQFYRDCYITGTVDFIFGNAAAVI  613
             RQFYRD  I+GTVDFIFGNAA V 
Sbjct  374  LRQFYRDSVISGTVDFIFGNAAVVF  398



>ref|XP_011016647.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=550

 Score =   280 bits (715),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 165/204 (81%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            SLA + +++ S  D ++ LNG FPSW+   DR+LLE+S + V ANV+VA+DGSG Y T+ 
Sbjct  195  SLATVSSLSASDTDLVQPLNGGFPSWILGRDRKLLESSVSNVEANVIVAQDGSGDYTTIQ  254

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            EAV S PD  K+RYVI++K G YKENVE+GKKK NVM++GDG+  TI+TG+LN VDG+TT
Sbjct  255  EAVNSVPDKSKSRYVIHVKSGIYKENVEVGKKKKNVMIVGDGMDFTILTGNLNVVDGSTT  314

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            F SAT+A  GDGFI QD+ IQNTAGPEKHQAVALR+ ADQSVINRC+IDAYQDTLY H+ 
Sbjct  315  FRSATLAVAGDGFILQDIWIQNTAGPEKHQAVALRVSADQSVINRCRIDAYQDTLYTHNY  374

Query  542  RQFYRDCYITGTVDFIFGNAAAVI  613
            RQFYRDC I GT+DFIFGN A V+
Sbjct  375  RQFYRDCSIIGTIDFIFGNGAVVL  398



>ref|XP_011030843.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=550

 Score =   280 bits (715),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 165/204 (81%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            SLA + +++ S  D ++ LNG FPSW+   DR+LLE+S + V ANV+VA+DGSG Y T+ 
Sbjct  195  SLATVSSLSASDTDLVQPLNGGFPSWILGRDRKLLESSVSNVEANVIVAQDGSGDYTTIQ  254

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            EAV S PD  K+RYVI++K G YKENVE+GKKK NVM++GDG+  TI+TG+LN VDG+TT
Sbjct  255  EAVNSVPDKSKSRYVIHVKSGIYKENVEVGKKKKNVMIVGDGMDFTILTGNLNVVDGSTT  314

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            F SAT+A  GDGFI QD+ IQNTAGPEKHQAVALR+ ADQSVINRC+IDAYQDTLY H+ 
Sbjct  315  FRSATLAVAGDGFILQDIWIQNTAGPEKHQAVALRVSADQSVINRCRIDAYQDTLYTHNY  374

Query  542  RQFYRDCYITGTVDFIFGNAAAVI  613
            RQFYRDC I GT+DFIFGN A V+
Sbjct  375  RQFYRDCSIIGTIDFIFGNGAVVL  398



>emb|CAA64217.1| pectinmethylesterase [Vigna radiata var. radiata]
Length=320

 Score =   271 bits (694),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  149  KDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIIT  328
            +DGSGK+KTV EAVASAPDNGKTRYVIY+KKGTYKE+VEIGKKK N+ML+GDG+ ATIIT
Sbjct  12   QDGSGKFKTVTEAVASAPDNGKTRYVIYVKKGTYKEHVEIGKKKKNIMLVGDGMDATIIT  71

Query  329  GSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKID  508
            GSLN++DG TTFNSATVAAVGDGFI QD+  QNTAG  KHQAVALR+GADQSVINRC+ID
Sbjct  72   GSLNFIDGTTTFNSATVAAVGDGFIGQDIWFQNTAGAAKHQAVALRVGADQSVINRCRID  131

Query  509  AYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVI  613
            A+QDTLYAHS RQFYRD  ITGT+DFIFGNAA V 
Sbjct  132  AFQDTLYAHSNRQFYRDSVITGTIDFIFGNAAVVF  166



>emb|CAA96435.1| pectin methylesterase [Nicotiana plumbaginifolia]
Length=315

 Score =   271 bits (693),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +2

Query  152  DGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITG  331
            DGSGKYKT+ EAVAS PDN  +RYVIY+KKG YKENVEIGKKK NVML+GDG+ ATIITG
Sbjct  11   DGSGKYKTIKEAVASVPDNSNSRYVIYVKKGIYKENVEIGKKKKNVMLVGDGMDATIITG  70

Query  332  SLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDA  511
            +LN VDGATTFNSATVAAVGDGFIAQD++ QNTAG  KHQAVALR+GADQSVINRCKIDA
Sbjct  71   NLNVVDGATTFNSATVAAVGDGFIAQDVQFQNTAGAAKHQAVALRVGADQSVINRCKIDA  130

Query  512  YQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVI  613
            +QDTLY HS RQFYRDCYITGTVDFIFGNAA V 
Sbjct  131  FQDTLYTHSLRQFYRDCYITGTVDFIFGNAAVVF  164



>gb|AAB38794.1| pectin methylesterase, partial [Solanum lycopersicum]
Length=439

 Score =   275 bits (702),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 165/204 (81%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            +LA+L ++    ED      G+ PSWVS+ DR+L+E+S   + AN VVA+DG+GKY+T+A
Sbjct  82   ALAMLASLTTQDEDVFMTGLGKMPSWVSSMDRKLMESSGKDIIANRVVAQDGTGKYRTLA  141

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            EAVA+AP+  K RYVIY+K+G YKENVE+   K N+M++GDG+ AT ITGSLN VDG+TT
Sbjct  142  EAVAAAPNRSKKRYVIYVKRGIYKENVEVSSNKMNLMIVGDGMYATTITGSLNVVDGSTT  201

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            F SAT+AAVG GFI QD+ IQNTAGP K QAVALR+GAD SVINRC+IDAYQDTLYAHSQ
Sbjct  202  FRSATLAAVGQGFILQDICIQNTAGPAKDQAVALRVGADMSVINRCRIDAYQDTLYAHSQ  261

Query  542  RQFYRDCYITGTVDFIFGNAAAVI  613
            RQFYRD Y+TGTVDFIFGNAA V 
Sbjct  262  RQFYRDSYVTGTVDFIFGNAAVVF  285



>ref|XP_002889876.1| At1g11580/T23J18_33 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66135.1| At1g11580/T23J18_33 [Arabidopsis lyrata subsp. lyrata]
Length=556

 Score =   278 bits (711),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 133/206 (65%), Positives = 166/206 (81%), Gaps = 2/206 (1%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanv--vvaKDGSGKYKT  175
            +LA+ V+V P+ +D    ++  FPSW++A DR+LLE++   +      VVAKDG+GK+KT
Sbjct  199  ALAIFVSVLPARDDLKMIISNSFPSWLTALDRKLLESAPKTLKVTANVVVAKDGTGKFKT  258

Query  176  VAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGA  355
            V EAVA+AP+N  +RYVIY+KKG YKE ++IGKKK N+ML+GDG   T+ITGSLN +DG+
Sbjct  259  VNEAVAAAPENSNSRYVIYVKKGVYKETIDIGKKKKNLMLVGDGKDVTVITGSLNVIDGS  318

Query  356  TTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAH  535
            TTF SATVAA GDGF+AQD+  QNTAGP KHQAVALR+ ADQ+VINRC+IDAYQDTLY H
Sbjct  319  TTFRSATVAANGDGFMAQDIWFQNTAGPAKHQAVALRVSADQTVINRCRIDAYQDTLYTH  378

Query  536  SQRQFYRDCYITGTVDFIFGNAAAVI  613
            + RQFYRD YITGTVDFIFGN+A V 
Sbjct  379  TLRQFYRDSYITGTVDFIFGNSAVVF  404



>ref|XP_010553426.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18 [Tarenaya 
hassleriana]
Length=555

 Score =   278 bits (710),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 167/205 (81%), Gaps = 2/205 (1%)
 Frame = +2

Query  5    LAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanv--vvaKDGSGKYKTV  178
            LA+ V+++PS  D ++ ++GEFP W++A  R+LLE+    V AN   VVA DGSGKYKTV
Sbjct  199  LALFVSISPSETDMIKTVSGEFPRWLTAXXRKLLESEPVKVQANADVVVATDGSGKYKTV  258

Query  179  AEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGAT  358
             EAVA+AP N + RYVI++KKG YKENV+I K K N+M++G+G  ATIITGSLN VDG+T
Sbjct  259  NEAVAAAPANSQKRYVIFVKKGVYKENVDIAKNKKNLMIVGEGQDATIITGSLNVVDGST  318

Query  359  TFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHS  538
            TF SAT+AA GDGF+AQD+  QNTAGP+KHQAVALR+ ADQ+VINRC+IDAYQDTLY H+
Sbjct  319  TFRSATLAANGDGFMAQDIWFQNTAGPQKHQAVALRVSADQAVINRCRIDAYQDTLYTHT  378

Query  539  QRQFYRDCYITGTVDFIFGNAAAVI  613
             RQFYRD YITGTVDFIFGNAA V 
Sbjct  379  LRQFYRDSYITGTVDFIFGNAAVVF  403



>emb|CDY34642.1| BnaC08g42010D [Brassica napus]
Length=451

 Score =   274 bits (701),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 134/206 (65%), Positives = 164/206 (80%), Gaps = 2/206 (1%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvv--aKDGSGKYKT  175
            +L++ V+V+PS +     L   FPSW+++ DR+LLE++   +     V  AKDG+GKYKT
Sbjct  94   ALSIFVSVSPSKDYLEMILPIHFPSWLNSLDRKLLESAPKTLEVKANVVVAKDGTGKYKT  153

Query  176  VAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGA  355
            V EAVA+AP+N  +RYVIY+KKG YKE ++IGKKK N+ML+GDG   TIITGSLN VDG+
Sbjct  154  VNEAVAAAPENSNSRYVIYVKKGVYKETIDIGKKKKNLMLVGDGKDVTIITGSLNVVDGS  213

Query  356  TTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAH  535
            TTF SATVAA GDGF+AQD+  QNTAGP KHQAVALR+ ADQSVINRC+IDAYQDTLY H
Sbjct  214  TTFRSATVAANGDGFMAQDIWFQNTAGPAKHQAVALRVSADQSVINRCRIDAYQDTLYTH  273

Query  536  SQRQFYRDCYITGTVDFIFGNAAAVI  613
            + RQFYRD +ITGTVDFIFGN+A V 
Sbjct  274  TLRQFYRDSFITGTVDFIFGNSAVVF  299



>gb|EYU19222.1| hypothetical protein MIMGU_mgv1a003983mg [Erythranthe guttata]
Length=551

 Score =   276 bits (707),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 169/204 (83%), Gaps = 1/204 (0%)
 Frame = +2

Query  5    LAVLVAVAPSTEDDLRALNGEF-PSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
             AV V+     E D+ +    + PSW++  +R+LL+++A+AVAA++ VA DGSG YKTVA
Sbjct  196  FAVAVSKLDHNEVDIPSFGQNYMPSWITKVERQLLQSTADAVAADLTVAADGSGNYKTVA  255

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            EAVA+APD  K RYVIY+KKGTYKENVE+GK K N+M+IGDG++ TIITG LN  DGATT
Sbjct  256  EAVAAAPDKSKKRYVIYVKKGTYKENVEVGKNKKNLMIIGDGMNNTIITGDLNVADGATT  315

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            FNSAT+AAVG+GFI QD+ IQNTAGPEKHQAVALR+GAD+SVINRC+IDAYQDTLY HS 
Sbjct  316  FNSATLAAVGEGFIMQDICIQNTAGPEKHQAVALRVGADKSVINRCRIDAYQDTLYTHSL  375

Query  542  RQFYRDCYITGTVDFIFGNAAAVI  613
            RQFYR+ Y+TGTVDFIFGNAA V 
Sbjct  376  RQFYRESYVTGTVDFIFGNAAVVF  399



>ref|XP_006377839.1| hypothetical protein POPTR_0011s13830g [Populus trichocarpa]
 gb|ERP55636.1| hypothetical protein POPTR_0011s13830g [Populus trichocarpa]
Length=550

 Score =   276 bits (707),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 165/204 (81%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            SLA + +++ S  D ++ LNG FPSW+   DR+LLE+S + V ANVVVA+DGSG   T+ 
Sbjct  195  SLAAVSSLSASDTDLVQPLNGGFPSWILGRDRKLLESSVSTVEANVVVAQDGSGDNTTIQ  254

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            E+V S PD  K+RYVI +K G YKENVE+GKKK NVM++GDG+ +TI+TG+LN VDG+TT
Sbjct  255  ESVNSVPDKSKSRYVICVKSGIYKENVEVGKKKKNVMIVGDGMDSTILTGNLNVVDGSTT  314

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            F SAT+A  GDGF+ QD+ IQNTAGPEKHQAVALR+ ADQSVINRC+IDAYQDTLY H+ 
Sbjct  315  FRSATLAVAGDGFVLQDIWIQNTAGPEKHQAVALRVSADQSVINRCRIDAYQDTLYTHNY  374

Query  542  RQFYRDCYITGTVDFIFGNAAAVI  613
            RQFYRDC+I GT+DFIFGN A V+
Sbjct  375  RQFYRDCFIIGTIDFIFGNGAVVL  398



>ref|XP_004134752.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Cucumis 
sativus]
 gb|KGN49128.1| Pectinesterase [Cucumis sativus]
Length=555

 Score =   276 bits (706),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 164/208 (79%), Gaps = 5/208 (2%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRAL----NGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKY  169
            SL +LV++      +L  L    NG +PSW+   DRRLL      +  N+VVAKDGSG +
Sbjct  197  SLGMLVSIWGLDIKNLGELEKKGNG-YPSWLKKGDRRLLGVLGREMEPNIVVAKDGSGNF  255

Query  170  KTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVD  349
            KTV EAV S PD  K R VIY+K+GTY+ENVE+GKKK NVM++GDG+ +TIITGSLN VD
Sbjct  256  KTVKEAVESVPDKSKNRIVIYVKRGTYEENVEVGKKKKNVMIVGDGMDSTIITGSLNVVD  315

Query  350  GATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLY  529
            G+TTF SATVAAVGDGFIAQD+  QNTAGPEKHQAVALR+GADQSVINRC+IDAYQDTLY
Sbjct  316  GSTTFKSATVAAVGDGFIAQDIWFQNTAGPEKHQAVALRVGADQSVINRCRIDAYQDTLY  375

Query  530  AHSQRQFYRDCYITGTVDFIFGNAAAVI  613
             HS RQFYRD  ITGTVDFIFGNAA V+
Sbjct  376  THSNRQFYRDSTITGTVDFIFGNAAVVL  403



>gb|AFK41384.1| unknown [Lotus japonicus]
Length=381

 Score =   271 bits (693),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 162/187 (87%), Gaps = 4/187 (2%)
 Frame = +2

Query  2    SLAVLVAV-APSTEDDL---RALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKY  169
            SLA+LV+V AP+   +      LNG+FPSWV+  DRRLLE+S   V ANVVVAKDGSG++
Sbjct  194  SLALLVSVLAPNGGHEQFIDEPLNGDFPSWVTRKDRRLLESSVGDVNANVVVAKDGSGRF  253

Query  170  KTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVD  349
            KTVAEAVASAPD+GKTRYVIY+KKGTYKEN+EIGKKKTNVML GDG+ ATIITG+LN +D
Sbjct  254  KTVAEAVASAPDSGKTRYVIYVKKGTYKENIEIGKKKTNVMLTGDGMGATIITGNLNVID  313

Query  350  GATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLY  529
            G+TTF SATVAAVGDGFIAQD+  QNTAGP+K QAVALR+GADQS+INRC+IDAYQD+LY
Sbjct  314  GSTTFKSATVAAVGDGFIAQDIWFQNTAGPQKEQAVALRVGADQSIINRCRIDAYQDSLY  373

Query  530  AHSQRQF  550
             H+ RQF
Sbjct  374  THTNRQF  380



>ref|XP_008439965.1| PREDICTED: pectinesterase [Cucumis melo]
Length=555

 Score =   276 bits (706),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 163/208 (78%), Gaps = 5/208 (2%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRAL----NGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKY  169
            SL +LV++      +L  L    NG +PSW+   DRRLL      +  N+VVAKDGSG +
Sbjct  197  SLGMLVSIWGLEIKNLGELGKRGNG-YPSWLKKGDRRLLGVLGREMEPNIVVAKDGSGNF  255

Query  170  KTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVD  349
            KTV EAV S PD  K R VIY+KKGTYKENVE+GKKK NVM++GDG+ +TIITGSLN VD
Sbjct  256  KTVQEAVESVPDKSKNRIVIYVKKGTYKENVEVGKKKKNVMIVGDGMDSTIITGSLNVVD  315

Query  350  GATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLY  529
            G+TTF SATVAAVGDGFIAQD+  QNTAGP KHQAVALR+GADQSVINRC+IDAYQDTLY
Sbjct  316  GSTTFKSATVAAVGDGFIAQDIWFQNTAGPAKHQAVALRVGADQSVINRCRIDAYQDTLY  375

Query  530  AHSQRQFYRDCYITGTVDFIFGNAAAVI  613
             HS RQFYRD  ITGTVDFIFGNAA V+
Sbjct  376  THSNRQFYRDSTITGTVDFIFGNAAVVL  403



>ref|XP_004155595.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Cucumis 
sativus]
Length=555

 Score =   276 bits (705),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 164/208 (79%), Gaps = 5/208 (2%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRAL----NGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKY  169
            SL +LV++      +L  L    NG +PSW+   DRRLL      +  N+VVAKDGSG +
Sbjct  197  SLGMLVSIWGLDIKNLGELEKKGNG-YPSWLKKGDRRLLGVLGRDMEPNIVVAKDGSGNF  255

Query  170  KTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVD  349
            KTV EAV S PD  K R VIY+K+GTY+ENVE+GKKK NVM++GDG+ +TIITGSLN VD
Sbjct  256  KTVKEAVESVPDKSKNRIVIYVKRGTYEENVEVGKKKKNVMIVGDGMDSTIITGSLNVVD  315

Query  350  GATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLY  529
            G+TTF SATVAAVGDGFIAQD+  QNTAGPEKHQAVALR+GADQSVINRC+IDAYQDTLY
Sbjct  316  GSTTFKSATVAAVGDGFIAQDIWFQNTAGPEKHQAVALRVGADQSVINRCRIDAYQDTLY  375

Query  530  AHSQRQFYRDCYITGTVDFIFGNAAAVI  613
             HS RQFYRD  ITGTVDFIFGNAA V+
Sbjct  376  THSNRQFYRDSTITGTVDFIFGNAAVVL  403



>gb|KFK43434.1| hypothetical protein AALP_AA1G125000 [Arabis alpina]
Length=556

 Score =   276 bits (705),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 134/206 (65%), Positives = 162/206 (79%), Gaps = 2/206 (1%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvv--aKDGSGKYKT  175
            +LA+ V+V PS ++        FP W++A DR+LLE++   +     V  AKDG+GKYKT
Sbjct  199  ALAIFVSVLPSRDELDMIFPIHFPYWLTALDRKLLESTPKTLEVTANVIVAKDGTGKYKT  258

Query  176  VAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGA  355
            V EAV +AP+N  TRYVIY+KKG YKE ++IGKKK N+ML+GDG   TIITGSLN +DG+
Sbjct  259  VNEAVTAAPENSNTRYVIYVKKGVYKETIDIGKKKKNLMLVGDGKDLTIITGSLNVIDGS  318

Query  356  TTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAH  535
            TTF SATVAA GDGF+AQD+  QNTAGP+KHQAVALR+ ADQ+VINRC+IDAYQDTLY H
Sbjct  319  TTFRSATVAANGDGFMAQDIWFQNTAGPDKHQAVALRVSADQTVINRCRIDAYQDTLYTH  378

Query  536  SQRQFYRDCYITGTVDFIFGNAAAVI  613
            S RQFYRD YITGTVDFIFGN+A V 
Sbjct  379  SLRQFYRDSYITGTVDFIFGNSAVVF  404



>ref|XP_011016743.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=550

 Score =   275 bits (703),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 163/204 (80%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            SLA + +++    D ++ LNG  PSW+   DR+LLE+S + V ANVVVA+DGSG Y T+ 
Sbjct  195  SLATVSSLSAPDTDLVQPLNGGVPSWILGRDRKLLESSVSNVEANVVVAQDGSGDYTTIQ  254

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            EAV S PD  K+RYVI++K G YKENVE+GKKK NVM++GDG+  TI+TG+LN VDG+TT
Sbjct  255  EAVNSVPDKSKSRYVIHVKSGIYKENVEVGKKKKNVMIVGDGMDFTILTGNLNVVDGSTT  314

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            F SAT+A  GDGFI QD+ IQNTAGPEKHQAVALR+ ADQSVINRC+IDAYQDTLY H+ 
Sbjct  315  FRSATLAVAGDGFILQDIWIQNTAGPEKHQAVALRVSADQSVINRCRIDAYQDTLYTHNY  374

Query  542  RQFYRDCYITGTVDFIFGNAAAVI  613
            RQFYRDC I GT+DFIFGN A V+
Sbjct  375  RQFYRDCSIIGTIDFIFGNGAVVL  398



>ref|XP_006646399.1| PREDICTED: LOW QUALITY PROTEIN: pectinesterase 2.2-like [Oryza 
brachyantha]
Length=523

 Score =   273 bits (699),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 164/204 (80%), Gaps = 1/204 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            SLAVL AV     D L  +   FPSWV A DR LLEA A AV A+VVVA+DGSGKYKT+ 
Sbjct  167  SLAVLNAVG-GARDVLAEVVDRFPSWVPARDRALLEAGAGAVQADVVVAQDGSGKYKTIK  225

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            EAV +APD GK+RYVIY+KKG YKEN+E+GKKK  VM++GDG+  T+ITGS N VDGATT
Sbjct  226  EAVDAAPDGGKSRYVIYVKKGVYKENLEVGKKKREVMIVGDGMDQTVITGSRNVVDGATT  285

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            FNSAT+A  GDG I QDLR++NTAGPEKHQA ALR  AD++VINRC +D YQDTLYAH  
Sbjct  286  FNSATLALSGDGIILQDLRVENTAGPEKHQAGALRASADRAVINRCSLDGYQDTLYAHQL  345

Query  542  RQFYRDCYITGTVDFIFGNAAAVI  613
            RQFYRDC ++GTVDF+FGNAAAV+
Sbjct  346  RQFYRDCAVSGTVDFVFGNAAAVL  369



>ref|XP_009118185.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18 [Brassica 
rapa]
Length=556

 Score =   274 bits (701),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 167/206 (81%), Gaps = 2/206 (1%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASana--vaanvvvaKDGSGKYKT  175
            +L++ V+V PS +     L   FPSW+++ DR+LLE++     V ANVVVAKDG+GKYKT
Sbjct  199  ALSIFVSVLPSKDYLEMILPIHFPSWLNSLDRKLLESAPKTFEVKANVVVAKDGTGKYKT  258

Query  176  VAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGA  355
            V EAVA+AP+N  +RYVIY+KKG YKE ++IGKKK N+ML+GDG   TIITGSLN VDG+
Sbjct  259  VNEAVAAAPENSNSRYVIYVKKGVYKETIDIGKKKKNLMLVGDGKDVTIITGSLNVVDGS  318

Query  356  TTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAH  535
            TTF SATVAA GDGF+AQD+  QNTAGP KHQAVALR+ ADQSVINRC+IDAYQDTLY H
Sbjct  319  TTFRSATVAANGDGFMAQDIWFQNTAGPAKHQAVALRVSADQSVINRCRIDAYQDTLYTH  378

Query  536  SQRQFYRDCYITGTVDFIFGNAAAVI  613
            + RQFYRD +ITGTVDFIFGN+A V 
Sbjct  379  TLRQFYRDSFITGTVDFIFGNSAVVF  404



>ref|XP_009397166.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=553

 Score =   274 bits (700),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 170/209 (81%), Gaps = 6/209 (3%)
 Frame = +2

Query  2    SLAVLVAVAPSTE----DDLRALNGEFPSWVSASDRRLLE-ASanavaanvvvaKDGSGK  166
            SLAVL AV PS+E    DD+      FPSW+S  DR+LL+  S NAV AN VVAKDGSG 
Sbjct  194  SLAVLHAV-PSSEHDNDDDIVKPVATFPSWLSHRDRKLLQMTSPNAVQANAVVAKDGSGT  252

Query  167  YKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYV  346
            +KTV  AV S P+  K RYVIY+KKG YKENV +GKK TNVM++GDG+ AT+ITGSLN V
Sbjct  253  FKTVQAAVDSVPNGNKNRYVIYVKKGVYKENVSLGKKTTNVMIVGDGMDATVITGSLNVV  312

Query  347  DGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTL  526
            DG+TTF+SAT+AAVGDG I QDL+I+NTAGP+KHQAVALR+GAD+SVINRC++D YQDTL
Sbjct  313  DGSTTFDSATLAAVGDGLILQDLKIENTAGPQKHQAVALRVGADRSVINRCRLDGYQDTL  372

Query  527  YAHSQRQFYRDCYITGTVDFIFGNAAAVI  613
            YAH+ RQFYRD +I+GTVDF+FGNAA V 
Sbjct  373  YAHTLRQFYRDSFISGTVDFVFGNAAVVF  401



>sp|Q96576.1|PME3_SOLLC RecName: Full=Pectinesterase 3; Short=PE 3; AltName: Full=Pectin 
methylesterase 3; Flags: Precursor [Solanum lycopersicum]
 gb|AAB38793.1| pectin methylesterase [Solanum lycopersicum]
Length=544

 Score =   273 bits (698),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 167/204 (82%), Gaps = 1/204 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            +LA+L +V    ++ LR   G+ P WVS+ DR+L+E+S   + AN VVA+DG+G Y+T+A
Sbjct  188  ALAMLASVTTPNDEVLRQGLGKMPYWVSSRDRKLMESSGKDIIANRVVAQDGTGDYQTLA  247

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            EAVA+APD  KTRYVIY+K G YKENV + KKK N+M++GDG++ATIITGSLN VDG+T 
Sbjct  248  EAVAAAPDKNKTRYVIYVKMGIYKENVVVTKKKMNLMIVGDGMNATIITGSLNVVDGST-  306

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            F S T+AAVG GFI QD+ IQNTAGPEK QAVALR+GAD SVINRC+IDAYQDTLYAHSQ
Sbjct  307  FPSNTLAAVGQGFILQDICIQNTAGPEKDQAVALRVGADMSVINRCRIDAYQDTLYAHSQ  366

Query  542  RQFYRDCYITGTVDFIFGNAAAVI  613
            RQFYRD Y+TGTVDFIFGNAA V 
Sbjct  367  RQFYRDSYVTGTVDFIFGNAAVVF  390



>emb|CAA48170.1| pectinesterase [Phaseolus vulgaris]
Length=218

 Score =   261 bits (668),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 138/155 (89%), Gaps = 2/155 (1%)
 Frame = +2

Query  149  KDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIIT  328
            KDGSGK+KTVAEAVASAPDN   RYVIY+KKGTYKENVEIGKKK NVML+GDG   T+IT
Sbjct  5    KDGSGKFKTVAEAVASAPDN--RRYVIYVKKGTYKENVEIGKKKKNVMLVGDGKDLTVIT  62

Query  329  GSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKID  508
            GSLNY+DG  TF +ATVAAVGDGFI QD+  QNTAGP+KHQAVALR+GADQSVINRC++D
Sbjct  63   GSLNYIDGTGTFQTATVAAVGDGFIGQDIWFQNTAGPQKHQAVALRVGADQSVINRCRVD  122

Query  509  AYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVI  613
            AYQDTLYAH+ RQFYRD +ITGTVDFIFGNAA V 
Sbjct  123  AYQDTLYAHTNRQFYRDSFITGTVDFIFGNAAVVF  157



>ref|XP_006843574.1| hypothetical protein AMTR_s00007p00101250 [Amborella trichopoda]
 gb|ERN05249.1| hypothetical protein AMTR_s00007p00101250 [Amborella trichopoda]
Length=553

 Score =   270 bits (690),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 156/182 (86%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
             P+WV   + RLLE+  + + A+VVVAKDGSG YKTV+EAVA+APD  K RYVIY+KKGT
Sbjct  220  LPAWVRDIETRLLESKVSEIKADVVVAKDGSGNYKTVSEAVAAAPDKSKKRYVIYVKKGT  279

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            Y+E VEIGK K N+ML+GDG+  T+ITGSLN++DG TTFNSAT+A VG+GFIAQD+  QN
Sbjct  280  YEEKVEIGKNKKNLMLVGDGMDFTVITGSLNFIDGTTTFNSATLAVVGEGFIAQDMCFQN  339

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
            TAGP+KHQAVALR+GAD+S+INRC+I+ YQDTLYAHSQRQFYRD  I+GT+DFIFGNAA 
Sbjct  340  TAGPKKHQAVALRVGADKSIINRCRIEGYQDTLYAHSQRQFYRDSVISGTIDFIFGNAAV  399

Query  608  VI  613
            V+
Sbjct  400  VL  401



>ref|XP_011095338.1| PREDICTED: pectinesterase 2.1-like [Sesamum indicum]
Length=587

 Score =   270 bits (689),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            SLAVL AV+   ++ +++L G  PSW+  +DR+LL+ +ANA+ A++VVAKDGSG +KTVA
Sbjct  233  SLAVLAAVSEQDKEMMQSLRGRLPSWIRPADRKLLQKTANAIEADLVVAKDGSGDFKTVA  292

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            EAVA+AP N + RYVIY+KKGTYKENVE+G ++ N+M+IGDG+++TIITG     +  TT
Sbjct  293  EAVAAAPSNSERRYVIYVKKGTYKENVEVGSRQRNLMIIGDGMNSTIITGDRYNSENFTT  352

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            F +AT+AAVG GFI QD+ IQNTAGPE  QAVALR+GAD+S+INRC +DAYQDTLY HSQ
Sbjct  353  FRTATLAAVGKGFILQDICIQNTAGPENGQAVALRIGADESIINRCYMDAYQDTLYTHSQ  412

Query  542  RQFYRDCYITGTVDFIFGNAAAVI  613
            RQFYRDCYITGTVDFIFG A AV+
Sbjct  413  RQFYRDCYITGTVDFIFGFAPAVL  436



>emb|CAA66361.1| pectin methylesterase [Solanum tuberosum]
Length=220

 Score =   256 bits (653),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = +2

Query  149  KDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIIT  328
            KDG+G Y+T+AEAVA+APD  KTRYVIY+K G YKENVE+  +K N+M++GDG++ATIIT
Sbjct  5    KDGTGDYQTLAEAVAAAPDRSKTRYVIYVKMGIYKENVEVTSRKMNLMIVGDGMNATIIT  64

Query  329  GSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKID  508
            GSLN+VDG TTF SAT+AAVG GFI QD+ IQNTAGPEKHQAVALR+G D SVINRC+ID
Sbjct  65   GSLNFVDGTTTFRSATLAAVGQGFILQDICIQNTAGPEKHQAVALRIGGDMSVINRCRID  124

Query  509  AYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVI  613
            AYQDTLYAHSQRQFYRD Y++GT+DFIFGNAA V 
Sbjct  125  AYQDTLYAHSQRQFYRDSYVSGTIDFIFGNAAVVF  159



>emb|CDM84519.1| unnamed protein product [Triticum aestivum]
Length=441

 Score =   263 bits (672),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 136/211 (64%), Positives = 159/211 (75%), Gaps = 8/211 (4%)
 Frame = +2

Query  2    SLAVLVAVAPSTE-DDL------RALNGEFPSWVSASDRRLLEASanavaanvvvaKDGS  160
            SLAVL AV   T  DD+       A   E PSWV ++DR LLE S    A  VV  KDGS
Sbjct  80   SLAVLNAVGSCTAADDIARDVLAEAAADELPSWVPSADRALLEGSGAVQADVVVA-KDGS  138

Query  161  GKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLN  340
            GKY TV  AV +APD GK RYVIY+KKG YKEN+ + KKK  +M++GDG+ AT+ITGS N
Sbjct  139  GKYNTVQAAVDAAPDRGKRRYVIYVKKGVYKENLAVWKKKRELMIVGDGMDATVITGSRN  198

Query  341  YVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQD  520
             VDGATTFNSAT+A   DG I QDLRI NTAGPEKHQAVALR+ AD++VINRC++D YQD
Sbjct  199  VVDGATTFNSATLAVAADGVILQDLRIDNTAGPEKHQAVALRVSADRAVINRCRVDGYQD  258

Query  521  TLYAHSQRQFYRDCYITGTVDFIFGNAAAVI  613
            TLYAH  RQFYRDC+++GTVDF+FGNAAAV+
Sbjct  259  TLYAHQLRQFYRDCFVSGTVDFVFGNAAAVL  289



>sp|P83947.1|PME1_FICPW RecName: Full=Pectinesterase/pectinesterase inhibitor; Includes: 
RecName: Full=Pectinesterase inhibitor; AltName: Full=Pectin 
methylesterase inhibitor; Includes: RecName: Full=Pectinesterase; 
Short=PE; AltName: Full=Pectin methylesterase; Flags: 
Precursor [Ficus pumila var. awkeotsang]
Length=545

 Score =   265 bits (676),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 162/204 (79%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            SLA+ V + P+  + +  + G FP+WV+A DRRLL+     +  ++VVAKDGSG Y+T+ 
Sbjct  188  SLAIFVTLFPAKSNVIEPVTGNFPTWVTAGDRRLLQTLGKDIEPDIVVAKDGSGDYETLN  247

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            EAVA+ PDN K R ++ ++ G Y+ENV+ G +K NVML+G+G+  TIITGS N VDG+TT
Sbjct  248  EAVAAIPDNSKKRVIVLVRTGIYEENVDFGYQKKNVMLVGEGMDYTIITGSRNVVDGSTT  307

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            F+SATVAAVGDGFIAQD+  QNTAGPEK+QAVALR+GAD++VINRC+IDAYQDTLY H+ 
Sbjct  308  FDSATVAAVGDGFIAQDICFQNTAGPEKYQAVALRIGADETVINRCRIDAYQDTLYPHNY  367

Query  542  RQFYRDCYITGTVDFIFGNAAAVI  613
            RQFYRD  ITGTVDFIFGNAA V 
Sbjct  368  RQFYRDRNITGTVDFIFGNAAVVF  391



>ref|XP_010101474.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
 gb|EXB88457.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
Length=556

 Score =   264 bits (674),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 156/204 (76%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            SLA+LV+ + S  + L  L  +FP+WV+  DRRLL +    +  ++VVAKDGSG Y TV 
Sbjct  199  SLAILVSFSQSKCEALEPLTKDFPTWVTPGDRRLLRSLEKEITPDIVVAKDGSGDYTTVN  258

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            EAVA+ P N K R+VIY+  G Y ENVE+ K K NVML+GDG+  TIIT SLN  DG+TT
Sbjct  259  EAVAAVPKNSKKRFVIYVTTGVYYENVELAKNKKNVMLLGDGMDYTIITASLNVDDGSTT  318

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            + SATVA  GDGFIAQD+  QNTAGP+KHQAVALR+ AD+SVINRC+IDAYQDTLY HS 
Sbjct  319  YKSATVAVNGDGFIAQDMWFQNTAGPQKHQAVALRVSADKSVINRCRIDAYQDTLYTHSH  378

Query  542  RQFYRDCYITGTVDFIFGNAAAVI  613
            RQFYRD  +TGTVDFIFGNAA V+
Sbjct  379  RQFYRDSTVTGTVDFIFGNAAVVL  402



>gb|ABK24761.1| unknown [Picea sitchensis]
Length=557

 Score =   264 bits (674),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 157/187 (84%), Gaps = 0/187 (0%)
 Frame = +2

Query  53   ALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIY  232
            ++  +FPSW+S  DRRLL  SAN V  NV+VA+DGSG +KT+ +A+A+AP+    RYVI 
Sbjct  217  SIKDDFPSWLSPGDRRLLRTSANDVVPNVIVAQDGSGNFKTITQAIAAAPEKSPKRYVIK  276

Query  233  IKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQD  412
            +KKGTYKENV++GK KTN+MLIG+G+ ATI+TGS N +DG+TTFNSAT AAVG+GF+AQD
Sbjct  277  VKKGTYKENVQVGKTKTNIMLIGEGMEATIVTGSRNVIDGSTTFNSATFAAVGNGFMAQD  336

Query  413  LRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIF  592
            +   NTAGP+KHQAVALR+G+DQSV+ RCKI AYQDTLYAHS RQFYR+C I+GTVDFIF
Sbjct  337  MAFVNTAGPQKHQAVALRVGSDQSVLYRCKIAAYQDTLYAHSLRQFYRECKISGTVDFIF  396

Query  593  GNAAAVI  613
            GNAA V 
Sbjct  397  GNAAVVF  403



>gb|EMT17767.1| Pectinesterase/pectinesterase inhibitor 18 [Aegilops tauschii]
Length=363

 Score =   257 bits (657),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 124/183 (68%), Positives = 147/183 (80%), Gaps = 1/183 (1%)
 Frame = +2

Query  65   EFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKG  244
            E PSWV ++DR LLE S    A  VV  KDGSGKY TV  AV +APD GK RYVIY+KKG
Sbjct  88   ELPSWVPSADRALLEGSRAVQADVVVA-KDGSGKYNTVQAAVDAAPDRGKRRYVIYVKKG  146

Query  245  TYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQ  424
             YKEN+ + KKK  +M++GDG+ AT+ITGS N VDGATTFNSAT+A   DG I QDLRI+
Sbjct  147  VYKENLAVWKKKRELMIVGDGMDATVITGSRNVVDGATTFNSATLAVAADGVILQDLRIE  206

Query  425  NTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAA  604
            NTAGPEKHQAVALR+ A ++VINRC++D YQDTLYAH  RQFYRDC+++GTVDF+FGNAA
Sbjct  207  NTAGPEKHQAVALRVSAARAVINRCRVDGYQDTLYAHQLRQFYRDCFVSGTVDFVFGNAA  266

Query  605  AVI  613
            AV+
Sbjct  267  AVL  269



>ref|NP_001044480.1| Os01g0788400 [Oryza sativa Japonica Group]
 dbj|BAD53265.1| putative pectin esterase [Oryza sativa Japonica Group]
 dbj|BAF06394.1| Os01g0788400 [Oryza sativa Japonica Group]
 dbj|BAH00252.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55512.1| hypothetical protein OsJ_03720 [Oryza sativa Japonica Group]
Length=546

 Score =   263 bits (671),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 162/204 (79%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            SLAVL A      D L      FPSW++A DR LL+A A AV A+VVVAKDGSGKY T+ 
Sbjct  190  SLAVLSAAGRGARDVLAEAVDRFPSWLTARDRTLLDAGAGAVQADVVVAKDGSGKYTTIK  249

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            EAV +APD GK+RYVIY+KKG YKEN+E+GK K  +M++GDG+  T+ITGS N VDG+TT
Sbjct  250  EAVDAAPDGGKSRYVIYVKKGVYKENLEVGKTKRVLMIVGDGMDQTVITGSRNVVDGSTT  309

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            FNSAT+A  GDG I QDL+++NTAG EK QAVALR+ AD++VINRC++D YQDTLYAH  
Sbjct  310  FNSATLALSGDGIILQDLKVENTAGAEKQQAVALRVSADRAVINRCRLDGYQDTLYAHQL  369

Query  542  RQFYRDCYITGTVDFIFGNAAAVI  613
            RQFYRDC ++GTVDF+FGNAAAV+
Sbjct  370  RQFYRDCAVSGTVDFVFGNAAAVL  393



>gb|EAY76103.1| hypothetical protein OsI_04029 [Oryza sativa Indica Group]
Length=546

 Score =   262 bits (670),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 162/204 (79%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            SLAVL A      D L      FPSW++A DR LL+A A AV A+VVVAKDGSGKY T+ 
Sbjct  190  SLAVLSAAGRGARDVLAEAVDRFPSWLTARDRTLLDAGAGAVQADVVVAKDGSGKYTTIK  249

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            EAV +APD GK+RYVIY+KKG YKEN+E+GK K  +M++GDG+  T+ITGS N VDG+TT
Sbjct  250  EAVDAAPDGGKSRYVIYVKKGVYKENLEVGKTKRVLMIVGDGMDQTVITGSRNVVDGSTT  309

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            FNSAT+A  GDG I QDL+++NTAG EK QAVALR+ AD++VINRC++D YQDTLYAH  
Sbjct  310  FNSATLALSGDGIILQDLKVENTAGAEKQQAVALRVSADRAVINRCRLDGYQDTLYAHQL  369

Query  542  RQFYRDCYITGTVDFIFGNAAAVI  613
            RQFYRDC ++GTVDF+FGNAAAV+
Sbjct  370  RQFYRDCAVSGTVDFVFGNAAAVL  393



>gb|ACJ02103.1| pectin methylesterase [Oncidium hybrid cultivar]
Length=529

 Score =   260 bits (665),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 136/207 (66%), Positives = 165/207 (80%), Gaps = 6/207 (3%)
 Frame = +2

Query  2    SLAVLVAVAPSTED--DLRALNGEFPSWVSASDRRLLEA-SanavaanvvvaKDGSGKYK  172
            +LAVL AV   T D  +L  L  E P WVS +DR+LLEA S  AV A+V V+ +G G YK
Sbjct  174  ALAVLRAV---TVDGGELMELVTELPKWVSPADRKLLEATSLAAVTADVTVSANGGGNYK  230

Query  173  TVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDG  352
            TV  AV +AP+ G +RYVIY+KKGTYKENV +GKKK N+M++GDG S TIITGSLN+VDG
Sbjct  231  TVQAAVDAAPEKGNSRYVIYVKKGTYKENVIVGKKKKNLMIVGDGQSNTIITGSLNFVDG  290

Query  353  ATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYA  532
             TT+NSAT+A++GDGFI QDL ++NTAGP+KHQAVALR+ ADQ+V+NRC+I AYQDTLY 
Sbjct  291  TTTYNSATLASMGDGFILQDLCVENTAGPQKHQAVALRINADQAVVNRCQIRAYQDTLYT  350

Query  533  HSQRQFYRDCYITGTVDFIFGNAAAVI  613
            HS RQFYR+  I+GTVDFIFGNAA V 
Sbjct  351  HSLRQFYRESLISGTVDFIFGNAAVVF  377



>ref|XP_002456465.1| hypothetical protein SORBIDRAFT_03g036790 [Sorghum bicolor]
 gb|EES01585.1| hypothetical protein SORBIDRAFT_03g036790 [Sorghum bicolor]
Length=552

 Score =   261 bits (666),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 132/207 (64%), Positives = 161/207 (78%), Gaps = 4/207 (2%)
 Frame = +2

Query  2    SLAVLVAV---APSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYK  172
            SLAVL AV   + S +  L      FPSWV A DR LLEA A   A  VV  +DGSGK++
Sbjct  194  SLAVLSAVVDDSGSRDAGLADTTYTFPSWVPARDRALLEAGAAIEADVVVA-QDGSGKFR  252

Query  173  TVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDG  352
            TV EAV +APD GK+RYVIY+KKG YKENVE+GKKK  +M++GDG+ AT+ITGS N VDG
Sbjct  253  TVKEAVDAAPDGGKSRYVIYVKKGVYKENVEVGKKKRELMIVGDGMDATVITGSRNVVDG  312

Query  353  ATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYA  532
            ATTFNSAT+A  GDG I QDLR++NTAGP KHQAVALR+ AD++V  RC++D YQDTLYA
Sbjct  313  ATTFNSATLAVAGDGIILQDLRVENTAGPAKHQAVALRVSADRAVAYRCRVDGYQDTLYA  372

Query  533  HSQRQFYRDCYITGTVDFIFGNAAAVI  613
            H+ R  YR+C+++GTVDF+FGNAAAV+
Sbjct  373  HALRHLYRECFVSGTVDFVFGNAAAVL  399



>ref|XP_003564371.1| PREDICTED: pectinesterase [Brachypodium distachyon]
Length=549

 Score =   259 bits (661),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 135/209 (65%), Positives = 165/209 (79%), Gaps = 6/209 (3%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDL----RALNGEFPSWVSASDRRLLEAS-anavaanvvvaKDGSGK  166
            SLAVL  V+     D+     A++G FPSWV   DR LLE     AV A+VVVAKDGSG+
Sbjct  190  SLAVLNTVSSDDARDVLQLAEAVDG-FPSWVPTRDRALLEGGGERAVEADVVVAKDGSGR  248

Query  167  YKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYV  346
            YKTV EAV +AP+N   RYVI +KKG YKENVE+G+KK  +M++GDG+ AT+ITGS N V
Sbjct  249  YKTVKEAVDAAPENKGRRYVIRVKKGVYKENVEVGRKKRELMIVGDGMDATVITGSRNVV  308

Query  347  DGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTL  526
            DGATTFNSAT+A  GDG I QDL+I+NTAGPEKHQAVALR+ AD++VI+RC++D YQDTL
Sbjct  309  DGATTFNSATLAVAGDGIILQDLKIENTAGPEKHQAVALRVSADRAVISRCRVDGYQDTL  368

Query  527  YAHSQRQFYRDCYITGTVDFIFGNAAAVI  613
            YAH  RQFYR C+++GTVDF+FGNAAAV+
Sbjct  369  YAHQLRQFYRGCFVSGTVDFVFGNAAAVL  397



>dbj|BAK05307.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=548

 Score =   258 bits (659),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 137/209 (66%), Positives = 162/209 (78%), Gaps = 5/209 (2%)
 Frame = +2

Query  2    SLAVLVAVAPSTE---DDLRALNG-EFPSWVSASDRRLLEAS-anavaanvvvaKDGSGK  166
            SLAVL AV   T    D  R +   E PSW+  +DR LLE   A AV  +VVVAKDGSGK
Sbjct  188  SLAVLNAVGSGTAAAADIARDVAADELPSWLPTADRALLELEGARAVQPDVVVAKDGSGK  247

Query  167  YKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYV  346
            Y TV  AV +APD GK+RYVIY+KKG YKEN+E+GKKK  +M++ DG+ AT+ITGS N V
Sbjct  248  YTTVQAAVDAAPDGGKSRYVIYVKKGVYKENLEVGKKKRKLMIVRDGMDATVITGSRNVV  307

Query  347  DGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTL  526
            DGATTFNSAT+A   DG I QDLRI+NTAGPEKHQAVALR+ AD++VINRC++D YQDTL
Sbjct  308  DGATTFNSATLAVAADGVILQDLRIENTAGPEKHQAVALRVSADRAVINRCRVDGYQDTL  367

Query  527  YAHSQRQFYRDCYITGTVDFIFGNAAAVI  613
            YAH  R FYRDC ++GTVDF+FGNAAAV+
Sbjct  368  YAHQLRHFYRDCAVSGTVDFVFGNAAAVL  396



>pdb|1XG2|A Chain A, Crystal Structure Of The Complex Between Pectin Methylesterase 
And Its Inhibitor Protein
Length=317

 Score =   249 bits (636),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = +2

Query  149  KDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIIT  328
            +DG+G Y+T+AEAVA+APD  KTRYVIY+K+GTYKENVE+   K N+M++GDG+ AT IT
Sbjct  9    QDGTGDYQTLAEAVAAAPDKSKTRYVIYVKRGTYKENVEVASNKMNLMIVGDGMYATTIT  68

Query  329  GSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKID  508
            GSLN VDG+TTF SAT+AAVG GFI QD+ IQNTAGP K QAVALR+GAD SVINRC+ID
Sbjct  69   GSLNVVDGSTTFRSATLAAVGQGFILQDICIQNTAGPAKDQAVALRVGADMSVINRCRID  128

Query  509  AYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVI  613
            AYQDTLYAHSQRQFYRD Y+TGTVDFIFGNAA V 
Sbjct  129  AYQDTLYAHSQRQFYRDSYVTGTVDFIFGNAAVVF  163



>ref|XP_010088582.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
 gb|EXB36723.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
Length=658

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 153/204 (75%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            SLA+LV+ + S  + L  L  +FP+WV+  DRRLL +    + A++VVAKDGSG Y TV 
Sbjct  301  SLAILVSFSQSKFEALEPLTKDFPTWVTPGDRRLLRSLGKEITADIVVAKDGSGDYTTVN  360

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            EAVA+ P N K R VIY+  G Y EN E+ K K NVML+GDG+  T+IT SLN  DG+TT
Sbjct  361  EAVAAVPKNSKKRLVIYVTTGVYYENFELAKNKKNVMLLGDGMDYTLITASLNADDGSTT  420

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            F SATVA  GDGFIAQD+  QNTAGP+KHQAVALR+ AD+SVINRC IDAY+DTLY HS 
Sbjct  421  FKSATVAVNGDGFIAQDIWFQNTAGPQKHQAVALRVSADKSVINRCHIDAYEDTLYTHSH  480

Query  542  RQFYRDCYITGTVDFIFGNAAAVI  613
            RQFYRD  +TGTVDFIFGNAA  +
Sbjct  481  RQFYRDSTVTGTVDFIFGNAAVAL  504



>gb|AGR44473.1| pectin methylesterase 4, partial [Pyrus x bretschneideri]
Length=427

 Score =   248 bits (633),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 126/201 (63%), Positives = 148/201 (74%), Gaps = 4/201 (2%)
 Frame = +2

Query  11   VLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAV  190
            +L  V P+T  D    NGE PSWV A DR+LL+A    V A V   +DG+G +  V +AV
Sbjct  129  LLTQVQPNT--DHHGPNGEIPSWVKAEDRKLLQAGGVNVDAVVA--QDGTGNFTNVTDAV  184

Query  191  ASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNS  370
             +APD   TRYVIYIK+GTYKENVEI KKK N+M+IGDG+ ATII+GS N+VDG TTF S
Sbjct  185  LAAPDESMTRYVIYIKRGTYKENVEIKKKKWNLMMIGDGMDATIISGSRNFVDGWTTFRS  244

Query  371  ATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQF  550
            AT A  G GFIA+DL  +NTAGPEKHQAVALR  +D SV  RC+I  YQDTLYAH+ RQF
Sbjct  245  ATFAVSGRGFIARDLTFENTAGPEKHQAVALRSDSDLSVFYRCQIRGYQDTLYAHAMRQF  304

Query  551  YRDCYITGTVDFIFGNAAAVI  613
            YRDC I+GTVDFIFG+A  V 
Sbjct  305  YRDCKISGTVDFIFGDATVVF  325



>ref|XP_009359674.1| PREDICTED: pectinesterase/pectinesterase inhibitor PPE8B-like 
[Pyrus x bretschneideri]
Length=509

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 126/201 (63%), Positives = 148/201 (74%), Gaps = 4/201 (2%)
 Frame = +2

Query  11   VLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAV  190
            +L  V P+T  D    NGE PSWV A DR+LL+A    V A V   +DG+G +  V +AV
Sbjct  159  LLTQVQPNT--DHHGPNGEIPSWVKAEDRKLLQAGGVNVDAVVA--QDGTGNFTNVTDAV  214

Query  191  ASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNS  370
             +APD   TRYVIYIK+GTYKENVEI KKK N+M+IGDG+ ATII+GS N+VDG TTF S
Sbjct  215  LAAPDESMTRYVIYIKRGTYKENVEIKKKKWNLMMIGDGMDATIISGSRNFVDGWTTFRS  274

Query  371  ATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQF  550
            AT A  G GFIA+DL  +NTAGPEKHQAVALR  +D SV  RC+I  YQDTLYAH+ RQF
Sbjct  275  ATFAVSGRGFIARDLTFENTAGPEKHQAVALRSDSDLSVFYRCQIRGYQDTLYAHAMRQF  334

Query  551  YRDCYITGTVDFIFGNAAAVI  613
            YRDC I+GTVDFIFG+A  V 
Sbjct  335  YRDCKISGTVDFIFGDATVVF  355



>dbj|BAF42041.1| pectin methylesterase 4 [Pyrus communis]
Length=509

 Score =   246 bits (628),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 126/201 (63%), Positives = 147/201 (73%), Gaps = 4/201 (2%)
 Frame = +2

Query  11   VLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAV  190
            +L  V P+T  D    NGE PSWV A DR+LL+A    V A V   +DG+G +  V +AV
Sbjct  159  LLTQVQPNT--DHHGPNGEIPSWVKAEDRKLLQAGGVNVDAVVA--QDGTGNFTNVTDAV  214

Query  191  ASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNS  370
             +APD   TRYVIYIK GTYKENVEI KKK N+M+IGDG+ ATII+GS N+VDG TTF S
Sbjct  215  LAAPDESMTRYVIYIKGGTYKENVEIKKKKWNLMMIGDGMDATIISGSRNFVDGWTTFRS  274

Query  371  ATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQF  550
            AT A  G GFIA+DL  +NTAGPEKHQAVALR  +D SV  RC+I  YQDTLYAH+ RQF
Sbjct  275  ATFAVSGRGFIARDLTFENTAGPEKHQAVALRSDSDLSVFYRCQIRGYQDTLYAHAMRQF  334

Query  551  YRDCYITGTVDFIFGNAAAVI  613
            YRDC I+GTVDFIFG+A  V 
Sbjct  335  YRDCKISGTVDFIFGDATVVF  355



>ref|XP_008337790.1| PREDICTED: pectinesterase/pectinesterase inhibitor PPE8B [Malus 
domestica]
Length=509

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 125/201 (62%), Positives = 147/201 (73%), Gaps = 4/201 (2%)
 Frame = +2

Query  11   VLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAV  190
            +L  V P+T  D    NGE PSWV   DR+LL+A    V A V   +DG+G +  V +AV
Sbjct  159  LLTQVHPNT--DHHGPNGEIPSWVKTEDRKLLQAGGVNVDAVVA--QDGTGNFTNVMDAV  214

Query  191  ASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNS  370
             +APD   TRYVIYIKKGTYKENVEI KKK N+M+IGDG+ ATII+G+ N+VDG TTF S
Sbjct  215  LAAPDERMTRYVIYIKKGTYKENVEIKKKKWNLMMIGDGMDATIISGNRNFVDGWTTFRS  274

Query  371  ATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQF  550
            AT A  G GFIA+DL  +NTAGPEKHQAVALR  +D SV  RC+I  YQDTLYAH+ RQF
Sbjct  275  ATFAVSGRGFIARDLTFENTAGPEKHQAVALRSDSDLSVFYRCQIRGYQDTLYAHAMRQF  334

Query  551  YRDCYITGTVDFIFGNAAAVI  613
            YRDC I+GTVDFIFG+A  V 
Sbjct  335  YRDCKISGTVDFIFGDATVVF  355



>ref|XP_010273801.1| PREDICTED: pectinesterase [Nelumbo nucifera]
Length=580

 Score =   246 bits (627),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 139/182 (76%), Gaps = 2/182 (1%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
            FP W+SA DRRLL+AS       V    DGSG YKTV+EAVA+AP N   RY+I IK G 
Sbjct  249  FPGWLSAGDRRLLQASTVTPDVTVAS--DGSGNYKTVSEAVAAAPINSNKRYIIRIKAGV  306

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            YKENV++ KKK N+M +GDG   TIITGS N VDG+TTF+SATVAAVG+GF+A+D+  QN
Sbjct  307  YKENVDVSKKKKNIMFVGDGRKNTIITGSRNVVDGSTTFHSATVAAVGEGFLARDITFQN  366

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
            TAGP KHQAVALR+G+D+S   RC + AYQDTLY HS RQFY DC I GTVDFIFGNAAA
Sbjct  367  TAGPSKHQAVALRVGSDKSAFYRCDMLAYQDTLYVHSLRQFYVDCLIVGTVDFIFGNAAA  426

Query  608  VI  613
            V 
Sbjct  427  VF  428



>gb|EYU29495.1| hypothetical protein MIMGU_mgv1a005211mg [Erythranthe guttata]
Length=493

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 139/184 (76%), Gaps = 2/184 (1%)
 Frame = +2

Query  62   GEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKK  241
            GE+P W+S  DRRLL+AS       V    DGSG Y+TV+ AVA+AP+    RYVI IK 
Sbjct  160  GEWPDWLSFGDRRLLQASTVKPDVTVAA--DGSGNYRTVSAAVAAAPERSSRRYVIRIKA  217

Query  242  GTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRI  421
            G Y+ENVEI K KTN+M +GDG + TIITGS N VDG+TTFNSATVA VGDGF+A+DL  
Sbjct  218  GVYRENVEIPKSKTNLMFVGDGQATTIITGSRNVVDGSTTFNSATVAVVGDGFLARDLTF  277

Query  422  QNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNA  601
            QN+AGP KHQAVALR+ AD S  +RC + AYQDTLY HS RQFY  CY+ GTVDFIFGNA
Sbjct  278  QNSAGPSKHQAVALRVNADLSAFHRCGMIAYQDTLYVHSLRQFYTGCYVAGTVDFIFGNA  337

Query  602  AAVI  613
            AAV+
Sbjct  338  AAVL  341



>emb|CBI27741.3| unnamed protein product [Vitis vinifera]
Length=366

 Score =   238 bits (608),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 137/182 (75%), Gaps = 2/182 (1%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
            +P W+SA DRRLL+AS       V    DGSG YKTV EAVASAP+    RY+I IK G 
Sbjct  35   WPEWLSAGDRRLLQASTVTADVTVAA--DGSGNYKTVGEAVASAPERSSKRYIIRIKAGV  92

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            YKENVE+ KKKTN+M +GDG + TIIT S N VDG+TTF+SATVA VGDGF+A+D+  QN
Sbjct  93   YKENVEVPKKKTNIMFVGDGRTNTIITASRNVVDGSTTFHSATVAVVGDGFLARDITFQN  152

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
            TAGP KHQAVALR+G+D S   RC + AYQDTLY HS RQF+  C + GTVDFIFGNAAA
Sbjct  153  TAGPSKHQAVALRVGSDLSAFYRCDVLAYQDTLYVHSLRQFFVGCLVAGTVDFIFGNAAA  212

Query  608  VI  613
            V+
Sbjct  213  VL  214



>gb|EPS63029.1| hypothetical protein M569_11757, partial [Genlisea aurea]
Length=526

 Score =   241 bits (616),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 125/206 (61%), Positives = 164/206 (80%), Gaps = 2/206 (1%)
 Frame = +2

Query  2    SLAVLVAVA-PSTEDDLRAL-NGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKT  175
            SLAVL +V  P  E  +R + +G  P+W++  DR+LL+ +A+ V A++VVA+DGSG ++T
Sbjct  169  SLAVLASVTLPEDEITIRPVTSGMDPTWLTPMDRKLLQVTADRVKADLVVARDGSGDFRT  228

Query  176  VAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGA  355
            V+ AV +AP+N + R+VI +KKGTY+ENV +GK K N+M+IGDG   T IT  LN VDG+
Sbjct  229  VSGAVDAAPENSEKRFVIRVKKGTYRENVVVGKNKKNLMIIGDGKGKTTITAHLNVVDGS  288

Query  356  TTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAH  535
            TT+NSAT+AAVG+GFI QD+RI+NTAG EK QAVALR+G+D+S INRCKI+ YQDTLYAH
Sbjct  289  TTYNSATLAAVGEGFILQDIRIRNTAGREKAQAVALRIGSDKSAINRCKIEGYQDTLYAH  348

Query  536  SQRQFYRDCYITGTVDFIFGNAAAVI  613
            S RQFYRD  I GT+DFIFG+AA V+
Sbjct  349  SLRQFYRDSTIKGTIDFIFGDAAVVL  374



>gb|KDP33985.1| hypothetical protein JCGZ_07556 [Jatropha curcas]
Length=583

 Score =   242 bits (618),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 121/197 (61%), Positives = 147/197 (75%), Gaps = 3/197 (2%)
 Frame = +2

Query  26   APSTEDDLRALNG-EFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAP  202
            + S+E  L   N  E+P W+SA DRRLL+A +      V    DGSG ++TV EAV +AP
Sbjct  237  SSSSERKLEEENELEWPKWMSAGDRRLLQAGSVTPNVVVAA--DGSGNFRTVKEAVDAAP  294

Query  203  DNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVA  382
            +   TRY+I IK G Y+ENVE+ KKKTN+M +GDG + TIITGS N VDG+TTFNSATVA
Sbjct  295  EGLTTRYIIKIKAGVYRENVEVPKKKTNIMFLGDGRTNTIITGSRNVVDGSTTFNSATVA  354

Query  383  AVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDC  562
            AVGDGF+A+D+  QNTAGP KHQAVALR+G+DQS   RC + AYQDTLY HS RQFY  C
Sbjct  355  AVGDGFLARDITFQNTAGPSKHQAVALRVGSDQSAFYRCDMIAYQDTLYVHSLRQFYVSC  414

Query  563  YITGTVDFIFGNAAAVI  613
             + G+VDFIFGNAAAV+
Sbjct  415  IVIGSVDFIFGNAAAVL  431



>ref|XP_006841486.1| hypothetical protein AMTR_s00003p00120050 [Amborella trichopoda]
 gb|ERN03161.1| hypothetical protein AMTR_s00003p00120050 [Amborella trichopoda]
Length=540

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 143/186 (77%), Gaps = 0/186 (0%)
 Frame = +2

Query  56   LNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYI  235
            ++G FP+W+   DRRLL+ASAN   A++VVAKDGSG + T++EA+A  PDNGKTR+VIYI
Sbjct  202  VDGGFPAWIPPKDRRLLQASANQTNADLVVAKDGSGDFTTISEAIAKVPDNGKTRFVIYI  261

Query  236  KKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDL  415
            K G Y ENV++G+KKTN+MLIGDG+  T++  S N VDG TTF SAT A VG  FIA+D+
Sbjct  262  KTGEYLENVDVGEKKTNLMLIGDGIEKTVVKASRNVVDGWTTFRSATFAVVGSNFIARDM  321

Query  416  RIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFG  595
              +N+AGP KHQAVALR GAD S   RC    YQDTLY HS RQFYR+C + GTVDFIFG
Sbjct  322  SFENSAGPSKHQAVALRSGADLSAFYRCSFVGYQDTLYVHSLRQFYRECDVYGTVDFIFG  381

Query  596  NAAAVI  613
            NAA V+
Sbjct  382  NAAVVL  387



>ref|XP_008795768.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=557

 Score =   240 bits (613),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 146/186 (78%), Gaps = 0/186 (0%)
 Frame = +2

Query  56   LNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYI  235
            ++G FP+WV+  DRRLL+A+ANA + ++VVAKDGSG + T+ EAVA+AP+N  TR+VIYI
Sbjct  220  MSGGFPTWVTRKDRRLLQAAANATSPDLVVAKDGSGNFTTIGEAVAAAPNNSATRFVIYI  279

Query  236  KKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDL  415
            K G Y ENV++ K K N+M IGDG+  T++  S N VDG TTF SATVA VGDGF+A+D+
Sbjct  280  KAGAYFENVDVAKNKKNLMFIGDGIGKTVVKASRNVVDGWTTFRSATVAVVGDGFLARDI  339

Query  416  RIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFG  595
             I+N+AGP KHQAVALR+GAD S   RC   AYQDTLY HS RQFYRDC + GTVDFIFG
Sbjct  340  TIENSAGPSKHQAVALRVGADLSAFYRCSFVAYQDTLYVHSLRQFYRDCDVYGTVDFIFG  399

Query  596  NAAAVI  613
            NAA V+
Sbjct  400  NAAVVL  405



>ref|XP_010266280.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=529

 Score =   239 bits (610),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 151/191 (79%), Gaps = 2/191 (1%)
 Frame = +2

Query  41   DDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTR  220
            ++ R L+  FP+WVSA+DR+LL++S  A  A+VVVA DGSG YKT++EAVA++     +R
Sbjct  190  NNRRLLSDGFPTWVSAADRKLLQSSGAASQADVVVAADGSGNYKTISEAVAASSKRSGSR  249

Query  221  YVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGF  400
            +VIY+K+G YKENVEI  K +N+MLIGDG+ ATI+TGS N  DG+TTF SATVA  G GF
Sbjct  250  FVIYVKRGVYKENVEI--KASNIMLIGDGIDATIVTGSRNVQDGSTTFRSATVAVTGGGF  307

Query  401  IAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTV  580
            IA+D+  +NTAGP+KHQAVALR G+D SV  RC +  YQDTLY +SQRQFYRDC I GTV
Sbjct  308  IARDMTFENTAGPQKHQAVALRSGSDLSVFYRCSLKGYQDTLYVYSQRQFYRDCDIYGTV  367

Query  581  DFIFGNAAAVI  613
            DFIFG+A AVI
Sbjct  368  DFIFGDAVAVI  378



>ref|XP_010259481.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=583

 Score =   240 bits (613),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 152/212 (72%), Gaps = 9/212 (4%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLR--------ALNGEFPSWVSASDRRLLEASanavaanvvvaKDG  157
            SLA+L  + P   D L+         + G FP WVS  DR+LL+AS N +  ++VVAKDG
Sbjct  220  SLAMLTKM-PKAADTLKDEVFPEYGKMAGRFPGWVSPKDRKLLQASTNTMKFDLVVAKDG  278

Query  158  SGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSL  337
            SG ++T+ EAVA+AP++  TR+VIYIK GTY ENV++GKKKT +M +GDG+  T++  S 
Sbjct  279  SGNFRTIGEAVAAAPNSSATRFVIYIKAGTYFENVDVGKKKTMLMFVGDGIGKTVVKASR  338

Query  338  NYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQ  517
            N VDG TTF SATVA VG+GFIA+D+ I+N AGP KHQAVALR G+D S   RC    YQ
Sbjct  339  NVVDGWTTFRSATVAVVGNGFIARDMTIENAAGPSKHQAVALRSGSDLSAFYRCSFVGYQ  398

Query  518  DTLYAHSQRQFYRDCYITGTVDFIFGNAAAVI  613
            DTLY HS RQFYR+C I GTVDFIFGNAA V 
Sbjct  399  DTLYVHSLRQFYRECDIYGTVDFIFGNAAVVF  430



>ref|XP_007024771.1| Pectin methylesterase 3 isoform 2, partial [Theobroma cacao]
 gb|EOY27393.1| Pectin methylesterase 3 isoform 2, partial [Theobroma cacao]
Length=500

 Score =   238 bits (607),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 137/182 (75%), Gaps = 2/182 (1%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
            +P W+SA DRRLL++S+      V    DGSG YKTV+EAVA AP     RYVI IK G 
Sbjct  251  WPEWLSAGDRRLLQSSSVTPDVVVAA--DGSGNYKTVSEAVAKAPQRSSKRYVIKIKAGV  308

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            Y+ENVE+ KKKTN+M +GDG + TIITGS N VDG+TTF+SATVA VG+ F+A+D+  QN
Sbjct  309  YRENVEVPKKKTNIMFLGDGRTETIITGSRNVVDGSTTFHSATVAVVGERFLARDITFQN  368

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
            TAGP KHQAVALR+GAD S    C + AYQDTLYAHS RQFY +C I GTVDFIFGNAAA
Sbjct  369  TAGPSKHQAVALRVGADLSAFYECDMLAYQDTLYAHSNRQFYVNCIIAGTVDFIFGNAAA  428

Query  608  VI  613
            V 
Sbjct  429  VF  430



>ref|XP_010656074.1| PREDICTED: pectinesterase-like [Vitis vinifera]
Length=578

 Score =   239 bits (611),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 137/182 (75%), Gaps = 2/182 (1%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
            +P W+SA DRRLL+AS       V    DGSG YKTV EAVASAP+    RY+I IK G 
Sbjct  247  WPEWLSAGDRRLLQASTVTADVTVAA--DGSGNYKTVGEAVASAPERSSKRYIIRIKAGV  304

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            YKENVE+ KKKTN+M +GDG + TIIT S N VDG+TTF+SATVA VGDGF+A+D+  QN
Sbjct  305  YKENVEVPKKKTNIMFVGDGRTNTIITASRNVVDGSTTFHSATVAVVGDGFLARDITFQN  364

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
            TAGP KHQAVALR+G+D S   RC + AYQDTLY HS RQF+  C + GTVDFIFGNAAA
Sbjct  365  TAGPSKHQAVALRVGSDLSAFYRCDVLAYQDTLYVHSLRQFFVGCLVAGTVDFIFGNAAA  424

Query  608  VI  613
            V+
Sbjct  425  VL  426



>ref|XP_010273802.1| PREDICTED: pectinesterase/pectinesterase inhibitor PPE8B [Nelumbo 
nucifera]
Length=502

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 144/184 (78%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   GEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKK  241
            G FP+W+  SDRRLL+A A  V+A+ VVA+DG+G++ +V +AV +APD  + RYVIY+K+
Sbjct  165  GGFPAWMKGSDRRLLQAPAGGVSADAVVAQDGTGQFTSVMDAVLAAPDYSERRYVIYVKR  224

Query  242  GTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRI  421
            G YKENVEI KKK N+M++GDG+  TII+GS N+VDG TTF SAT A  G GFIA+D+  
Sbjct  225  GVYKENVEIKKKKWNLMIVGDGMDVTIISGSRNFVDGWTTFRSATFAVSGKGFIARDITF  284

Query  422  QNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNA  601
            +NTAGPEKHQAVALR  +D S   RC I  YQDTLYAHS RQFYR+C I+GTVDFIFGN 
Sbjct  285  ENTAGPEKHQAVALRSDSDLSAYYRCAIKGYQDTLYAHSLRQFYRECRISGTVDFIFGNG  344

Query  602  AAVI  613
            A VI
Sbjct  345  AVVI  348



>ref|XP_011072691.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=551

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/215 (57%), Positives = 150/215 (70%), Gaps = 13/215 (6%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDLRALNGE-----------FPSWVSASDRRLLEASanavaanvvva  148
            SLA+L  +  +  ++ R LNG            +P W+SA DRRLL++S+      V   
Sbjct  200  SLAMLTNMTDTDMENERKLNGGRKLVAAEDGSGWPEWLSAGDRRLLQSSSVRPDVVVAA-  258

Query  149  KDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIIT  328
             DGSG Y+TV  AVA+AP+    RYVI IK G Y+ENVE+ KKKTN+M +GDG S TIIT
Sbjct  259  -DGSGNYRTVGAAVAAAPERSSRRYVIRIKAGVYRENVEVPKKKTNIMFMGDGRSNTIIT  317

Query  329  GSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKID  508
            GS N  DG+TTFNSATVAAVG+ F+A+D+  QNTAGP KHQAVALR+G+D S   RC + 
Sbjct  318  GSTNVRDGSTTFNSATVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDLSAFYRCDML  377

Query  509  AYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVI  613
            AYQDTLY HS RQF+  C I+GTVDFIFGNAAAV 
Sbjct  378  AYQDTLYVHSNRQFFVQCLISGTVDFIFGNAAAVF  412



>ref|XP_002265171.1| PREDICTED: pectinesterase [Vitis vinifera]
Length=611

 Score =   239 bits (610),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 139/182 (76%), Gaps = 2/182 (1%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
            +P W+SA DRRLL++S+      V    DGSG YKTV+ AVA+AP+    RY+I IK G 
Sbjct  280  WPKWLSAGDRRLLQSSSVTPDVVVAA--DGSGDYKTVSAAVAAAPEKSSKRYIIGIKAGV  337

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            YKENVE+GKKKTN+M +GDG S TIITGS N VDG+TTFNSATVA VG+ FIA+D+  QN
Sbjct  338  YKENVEVGKKKTNIMFLGDGRSNTIITGSKNVVDGSTTFNSATVAVVGEKFIARDITFQN  397

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
            TAGP KHQAVALR+G+D S   +C + AYQDTLY HS RQFY +C + GTVDFIFGNAAA
Sbjct  398  TAGPSKHQAVALRVGSDLSAFYKCDMLAYQDTLYVHSNRQFYINCLVAGTVDFIFGNAAA  457

Query  608  VI  613
            V 
Sbjct  458  VF  459



>ref|XP_009369733.1| PREDICTED: pectinesterase/pectinesterase inhibitor PPE8B [Pyrus 
x bretschneideri]
Length=509

 Score =   236 bits (602),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 148/201 (74%), Gaps = 4/201 (2%)
 Frame = +2

Query  11   VLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAV  190
            +L  V P++  D +  NG+ P+WV   DR+LL+A    V A V   +DG+G +  V +AV
Sbjct  159  LLTQVHPNS--DHQGPNGQIPTWVKTEDRKLLQADGVNVDAVVA--QDGTGNFTNVMDAV  214

Query  191  ASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNS  370
             +APD   +RYVIYIKKGTYKENVEI KKK N+M+IGDG+ ATII+G+ +Y+DG TTF S
Sbjct  215  LAAPDYSMSRYVIYIKKGTYKENVEIKKKKWNLMMIGDGMDATIISGNRSYIDGWTTFRS  274

Query  371  ATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQF  550
            AT A  G GFIA+D+  +NTAGP+KHQAVALR  +D SV  RC+I  YQDTLYAH+ RQF
Sbjct  275  ATFAVSGRGFIARDITFENTAGPQKHQAVALRSDSDLSVFYRCEIRGYQDTLYAHTMRQF  334

Query  551  YRDCYITGTVDFIFGNAAAVI  613
            YRDC I+GTVDFIFG+A  V 
Sbjct  335  YRDCKISGTVDFIFGDATVVF  355



>ref|XP_004303758.1| PREDICTED: pectinesterase-like [Fragaria vesca subsp. vesca]
Length=578

 Score =   237 bits (605),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 146/201 (73%), Gaps = 3/201 (1%)
 Frame = +2

Query  14   LVAVAPSTEDDLRALNGE-FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAV  190
            + A++ +T   L+    E +P W+SA+DR LL++S       V    DGSG YKTV+EAV
Sbjct  228  MKAMSSTTNRKLKEERSEGWPEWLSAADRHLLQSSTVTPNVIVAA--DGSGNYKTVSEAV  285

Query  191  ASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNS  370
            A+AP    +RYVI IK G Y+ENV++ K KTN+M +GDG + TIITGS N VDG TTFNS
Sbjct  286  AAAPSKSTSRYVIRIKAGVYRENVDVPKAKTNIMFLGDGRTTTIITGSRNVVDGDTTFNS  345

Query  371  ATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQF  550
            ATVAAVG GF+A+D+  QNTAGP KHQAVALR+G+D S   RC I AYQD+LY HS RQF
Sbjct  346  ATVAAVGAGFLARDITFQNTAGPSKHQAVALRVGSDLSAFYRCDILAYQDSLYVHSNRQF  405

Query  551  YRDCYITGTVDFIFGNAAAVI  613
            +  C+I GTVDFIFGNAA V+
Sbjct  406  FEGCFIAGTVDFIFGNAAVVL  426



>ref|XP_004972208.1| PREDICTED: LOW QUALITY PROTEIN: pectinesterase 2.1-like, partial 
[Setaria italica]
Length=525

 Score =   236 bits (602),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 131/216 (61%), Positives = 164/216 (76%), Gaps = 12/216 (6%)
 Frame = +2

Query  2    SLAVLVAVAPSTE----DDLRALN--GEFPSWVSASDRRLLE-ASanavaanvvvaKDGS  160
            SLAVL AV         DD+ A +    FPSW++A D  L+E  +   + A+VVVA+DGS
Sbjct  160  SLAVLNAVGGGGSGSRGDDVLAEDVVDAFPSWMTARDPALMEQGAGVDIKADVVVAQDGS  219

Query  161  GKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTN-VMLIGDGLSATIITGSL  337
            GKY+TV EAV +APD GK RYVIY+KKG YKENVE+GKKK   +M++GDG+ AT+ITGS 
Sbjct  220  GKYRTVKEAVDAAPDGGKIRYVIYVKKGVYKENVEVGKKKKKKLMIVGDGVDATVITGSR  279

Query  338  NYVDGATTFNSATVA----AVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKI  505
            N VDGATTFNSAT+A      GDG I QDLR++NTAGP KHQAVALR+ AD +V +RC++
Sbjct  280  NVVDGATTFNSATLARXXSVAGDGIILQDLRVENTAGPAKHQAVALRVSADHAVAHRCRV  339

Query  506  DAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVI  613
            D +QDTLYAH+ R FYR+C ++GTVDF+FGNAAAV+
Sbjct  340  DGHQDTLYAHALRHFYRECSVSGTVDFVFGNAAAVL  375



>gb|KJB54563.1| hypothetical protein B456_009G039100 [Gossypium raimondii]
Length=567

 Score =   237 bits (604),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 138/183 (75%), Gaps = 2/183 (1%)
 Frame = +2

Query  65   EFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKG  244
            E+P W+SA DRRLL+A+       V    DGSG + TV+EAVA+AP+   TRY+I IK G
Sbjct  235  EWPKWLSAGDRRLLQATTVIPNVTVAA--DGSGDFLTVSEAVAAAPERSTTRYIIKIKAG  292

Query  245  TYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQ  424
             Y ENV++ +KKTN+M +GDG   TIIT S N VDG+TTF+SATVAAVGDGF+A+D+  Q
Sbjct  293  VYSENVDVPRKKTNLMFVGDGRVNTIITASRNVVDGSTTFHSATVAAVGDGFLARDITFQ  352

Query  425  NTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAA  604
            NTAGP KHQAVALR+G+D S   RC I AYQDTLY HS RQFY  C + GTVDFIFGNAA
Sbjct  353  NTAGPSKHQAVALRVGSDLSAFYRCDILAYQDTLYVHSLRQFYSQCLVAGTVDFIFGNAA  412

Query  605  AVI  613
            AV+
Sbjct  413  AVL  415



>ref|XP_010271268.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=529

 Score =   236 bits (602),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 148/188 (79%), Gaps = 2/188 (1%)
 Frame = +2

Query  50   RALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVI  229
            R L+  FP+WVSA+DR+LL++S+ A  A+VVVA DGSG Y+T+++AVA++      R+VI
Sbjct  193  RLLSDGFPTWVSAADRKLLQSSSAASQADVVVAADGSGNYRTISQAVAASSKRSGKRFVI  252

Query  230  YIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQ  409
            Y+K+G YKENVEI  K +N+MLIGDG+ ATI+TGS N  DG+TTF SATVA  G GFIA+
Sbjct  253  YVKRGVYKENVEI--KASNIMLIGDGIDATIVTGSKNVQDGSTTFRSATVAVTGGGFIAR  310

Query  410  DLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFI  589
            D+  QNTAGP+KHQAVALR G+D SV  RC    YQDTLY +SQRQFYRDC I GTVDFI
Sbjct  311  DMTFQNTAGPQKHQAVALRSGSDLSVFYRCSFKGYQDTLYVYSQRQFYRDCDIYGTVDFI  370

Query  590  FGNAAAVI  613
            FG+A AV+
Sbjct  371  FGDAVAVL  378



>ref|XP_007024770.1| Pectin methylesterase 3 isoform 1 [Theobroma cacao]
 gb|EOY27392.1| Pectin methylesterase 3 isoform 1 [Theobroma cacao]
Length=582

 Score =   237 bits (605),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 137/182 (75%), Gaps = 2/182 (1%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
            +P W+SA DRRLL++S+      V    DGSG YKTV+EAVA AP     RYVI IK G 
Sbjct  251  WPEWLSAGDRRLLQSSSVTPDVVVAA--DGSGNYKTVSEAVAKAPQRSSKRYVIKIKAGV  308

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            Y+ENVE+ KKKTN+M +GDG + TIITGS N VDG+TTF+SATVA VG+ F+A+D+  QN
Sbjct  309  YRENVEVPKKKTNIMFLGDGRTETIITGSRNVVDGSTTFHSATVAVVGERFLARDITFQN  368

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
            TAGP KHQAVALR+GAD S    C + AYQDTLYAHS RQFY +C I GTVDFIFGNAAA
Sbjct  369  TAGPSKHQAVALRVGADLSAFYECDMLAYQDTLYAHSNRQFYVNCIIAGTVDFIFGNAAA  428

Query  608  VI  613
            V 
Sbjct  429  VF  430



>ref|XP_008242144.1| PREDICTED: pectinesterase/pectinesterase inhibitor PPE8B [Prunus 
mume]
Length=517

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 145/201 (72%), Gaps = 4/201 (2%)
 Frame = +2

Query  11   VLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAV  190
            +L  V P++    +  NG+ PSWV   DR+LL+A   +V A V   +DG+G +  V +AV
Sbjct  166  LLTQVHPNSNQ--QGPNGQIPSWVKTEDRKLLQADGVSVDAIVA--QDGTGNFTNVTDAV  221

Query  191  ASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNS  370
             +APD    RYVIYIK+GTYKENVEI KKK N+M+IGDG+ ATII+G+ N+VDG TTF S
Sbjct  222  LAAPDYSMRRYVIYIKRGTYKENVEIKKKKWNLMMIGDGMDATIISGNRNFVDGWTTFRS  281

Query  371  ATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQF  550
            AT A  G GFIA+D+  +NTAGPEKHQAVALR  +D SV  RC I  YQDTLY H+ RQF
Sbjct  282  ATFAVSGRGFIARDITFENTAGPEKHQAVALRSDSDLSVFYRCNIRGYQDTLYTHTMRQF  341

Query  551  YRDCYITGTVDFIFGNAAAVI  613
            YRDC I+GTVDFIFG+A  V 
Sbjct  342  YRDCKISGTVDFIFGDATVVF  362



>gb|AFW03481.1| pectin methylesterase 2, partial [Gossypium hirsutum]
Length=521

 Score =   234 bits (596),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 113/183 (62%), Positives = 137/183 (75%), Gaps = 2/183 (1%)
 Frame = +2

Query  65   EFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKG  244
            E+P W+S  DRRLL+A+       V    DGSG + TV+EAVA+AP+   TRY+I IK G
Sbjct  235  EWPKWLSEGDRRLLQATTVIPNVTVAA--DGSGDFLTVSEAVAAAPERSTTRYIIKIKAG  292

Query  245  TYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQ  424
             Y+ENV++  KKTN+M +GDG   TIIT S N VDG+TTF+SATVAAVGDGF+A+D+  Q
Sbjct  293  VYRENVDVPSKKTNLMFVGDGRVNTIITASRNVVDGSTTFHSATVAAVGDGFLARDITFQ  352

Query  425  NTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAA  604
            NTAGP KHQAVALR+G+D S   RC I AYQDTLY HS RQFY  C + G+VDFIFGNAA
Sbjct  353  NTAGPSKHQAVALRVGSDLSAFYRCGILAYQDTLYVHSLRQFYSQCLVAGSVDFIFGNAA  412

Query  605  AVI  613
            AV+
Sbjct  413  AVL  415



>gb|AFB77929.1| pectin methylesterase [Gossypium hirsutum]
Length=582

 Score =   235 bits (600),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 138/182 (76%), Gaps = 2/182 (1%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
            +P W+SA DRRLL++S+      V    DGSG +KTV+EAVA AP+    RY+I IK G 
Sbjct  251  WPEWLSAGDRRLLQSSSVTPNVVVAA--DGSGNFKTVSEAVAKAPEKSSKRYIIRIKAGV  308

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            Y+ENVE+ KKK+N+M IGDG + TIITGS N VDG+TTF+SATVAAVG+ F+A+D+  QN
Sbjct  309  YRENVEVPKKKSNIMFIGDGRTKTIITGSRNVVDGSTTFHSATVAAVGEKFLARDITFQN  368

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
            TAGP KHQAVALR+G+D S    C + AYQDTLY HS RQFY +C + GTVDFIFGNAAA
Sbjct  369  TAGPSKHQAVALRVGSDLSAFYNCDMLAYQDTLYVHSNRQFYVNCLVAGTVDFIFGNAAA  428

Query  608  VI  613
            V 
Sbjct  429  VF  430



>ref|XP_009383893.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=567

 Score =   234 bits (598),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 141/182 (77%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
            FP+WVSA DR+LL+A  NA   ++ VAKDGSG + T+++AVA+AP+N  TR+VIY+K G 
Sbjct  233  FPAWVSAKDRKLLQAPTNATIPDLEVAKDGSGNFTTISDAVAAAPNNTDTRFVIYVKAGA  292

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            Y ENVE+GK KTN++LIGDG+  T++  S + VDG TTF SATVA VGDGF+ +D+ I+N
Sbjct  293  YFENVEVGKSKTNLLLIGDGIGKTVVKASRSVVDGWTTFRSATVAVVGDGFLMRDITIEN  352

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
             AGP KHQAVALR+GAD S   RC    YQDTLY HS RQFYR+C + GTVDFIFGNAA 
Sbjct  353  AAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFYRECNVYGTVDFIFGNAAV  412

Query  608  VI  613
            V+
Sbjct  413  VL  414



>gb|AFW03476.1| pectin methylesterase 2 [Gossypium barbadense]
Length=521

 Score =   233 bits (595),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 113/183 (62%), Positives = 137/183 (75%), Gaps = 2/183 (1%)
 Frame = +2

Query  65   EFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKG  244
            E+P W+S  DRRLL+A+       V    DGSG + TV+EAVA+AP+   TRY+I IK G
Sbjct  235  EWPKWLSEGDRRLLQATTVIPNVTVAA--DGSGDFLTVSEAVAAAPERSTTRYIIKIKAG  292

Query  245  TYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQ  424
             Y+ENV++  KKTN+M +GDG   TIIT S N VDG+TTF+SATVAAVGDGF+A+D+  Q
Sbjct  293  VYRENVDVPSKKTNLMFVGDGRVNTIITASRNVVDGSTTFHSATVAAVGDGFLARDITFQ  352

Query  425  NTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAA  604
            NTAGP KHQAVALR+G+D S   RC I AYQDTLY HS RQFY  C + G+VDFIFGNAA
Sbjct  353  NTAGPSKHQAVALRVGSDLSAFYRCGILAYQDTLYVHSLRQFYSQCLVAGSVDFIFGNAA  412

Query  605  AVI  613
            AV+
Sbjct  413  AVL  415



>ref|XP_006828611.1| hypothetical protein AMTR_s00129p00070300 [Amborella trichopoda]
 gb|ERM96027.1| hypothetical protein AMTR_s00129p00070300 [Amborella trichopoda]
Length=659

 Score =   236 bits (603),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 113/193 (59%), Positives = 146/193 (76%), Gaps = 3/193 (2%)
 Frame = +2

Query  44   DLRALN---GEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGK  214
            DL A N   G+FP W+SA DRR L+ +    +A+ VVA+DGSGK+ T+  A+ S P   +
Sbjct  285  DLAANNKVPGDFPEWISAKDRRFLQGTDPRSSADAVVAQDGSGKFTTIQSAIDSVPKKNE  344

Query  215  TRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGD  394
             R+VIY+KKG Y ENV + K K N+MLIGDG   T+++GS N+VDG  TF++AT AAVG 
Sbjct  345  GRFVIYVKKGRYLENVVVDKSKWNIMLIGDGKDVTVVSGSRNFVDGTPTFSTATFAAVGR  404

Query  395  GFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITG  574
            GFIAQD+  +NTAGP+KHQAVA+R+G+D+S   RCK   +QDTLYAHSQRQFYR+C+I+G
Sbjct  405  GFIAQDMGFENTAGPQKHQAVAIRVGSDRSAFLRCKFIGFQDTLYAHSQRQFYRECFISG  464

Query  575  TVDFIFGNAAAVI  613
            TVDFIFGN+A V 
Sbjct  465  TVDFIFGNSAVVF  477



>gb|AFQ23194.1| pectin methylesterase [Theobroma cacao]
Length=582

 Score =   235 bits (599),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 136/182 (75%), Gaps = 2/182 (1%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
            +P W+SA DRRLL++S+      V    DGSG YKTV+EAVA AP     RYVI IK G 
Sbjct  251  WPEWLSAGDRRLLQSSSVTPDVVVAA--DGSGNYKTVSEAVAKAPQRSSKRYVIKIKAGV  308

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            Y+ENVE+ KKKTN+M +GDG + TIITGS N VDG+TTF+SATVA VG+ F+A+ +  QN
Sbjct  309  YRENVEVPKKKTNIMFLGDGRTETIITGSRNVVDGSTTFHSATVAVVGERFLARSITFQN  368

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
            TAGP KHQAVALR+GAD S    C + AYQDTLYAHS RQFY +C I GTVDFIFGNAAA
Sbjct  369  TAGPSKHQAVALRVGADLSAFYECDMLAYQDTLYAHSNRQFYVNCIIAGTVDFIFGNAAA  428

Query  608  VI  613
            V 
Sbjct  429  VF  430



>ref|XP_009606552.1| PREDICTED: pectinesterase/pectinesterase inhibitor U1 [Nicotiana 
tomentosiformis]
Length=589

 Score =   235 bits (599),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 143/194 (74%), Gaps = 2/194 (1%)
 Frame = +2

Query  32   STEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNG  211
            +T   LR  N E+P W+SA DRR+L++S  +    V    DGSG ++TV+EAVA AP+  
Sbjct  246  TTNRKLREDNSEWPEWLSAGDRRMLQSSTVSPDVVVAA--DGSGNFRTVSEAVAKAPEKS  303

Query  212  KTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVG  391
              RYVI IK G Y+ENV++ KKKTN+M +GDG S TIITGS N  DG+TTFNSATVAAVG
Sbjct  304  SKRYVIRIKAGVYRENVDVPKKKTNIMFMGDGRSNTIITGSRNVKDGSTTFNSATVAAVG  363

Query  392  DGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYIT  571
            + F+A+D+  QNTAG  KHQAVALR+G+D S   RC I AYQD+LY HS RQ++  C I 
Sbjct  364  EKFLARDITFQNTAGAAKHQAVALRVGSDLSAFYRCDILAYQDSLYVHSNRQYFVQCLIA  423

Query  572  GTVDFIFGNAAAVI  613
            GTVDFIFGNAAAV+
Sbjct  424  GTVDFIFGNAAAVL  437



>gb|AER38243.1| PME2 [Gossypium barbadense]
Length=521

 Score =   233 bits (595),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 113/183 (62%), Positives = 137/183 (75%), Gaps = 2/183 (1%)
 Frame = +2

Query  65   EFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKG  244
            E+P W+S  DRRLL+A+       V    DGSG + TV+EAVA+AP+   TRY+I IK G
Sbjct  235  EWPKWLSEGDRRLLQATTVIPNVTVAA--DGSGDFLTVSEAVAAAPERSTTRYIIKIKAG  292

Query  245  TYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQ  424
             Y+ENV++  KKTN+M +GDG   TIIT S N VDG+TTF+SATVAAVGDGF+A+D+  Q
Sbjct  293  VYRENVDVPSKKTNLMFVGDGRVNTIITASRNVVDGSTTFHSATVAAVGDGFLARDITFQ  352

Query  425  NTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAA  604
            NTAGP KHQAVALR+G+D S   RC I AYQDTLY HS RQFY  C + G+VDFIFGNAA
Sbjct  353  NTAGPSKHQAVALRVGSDLSAFYRCGILAYQDTLYVHSLRQFYSQCLVAGSVDFIFGNAA  412

Query  605  AVI  613
            AV+
Sbjct  413  AVL  415



>ref|XP_007012502.1| Pectin methylesterase 3 [Theobroma cacao]
 gb|EOY30121.1| Pectin methylesterase 3 [Theobroma cacao]
Length=573

 Score =   234 bits (597),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 136/183 (74%), Gaps = 2/183 (1%)
 Frame = +2

Query  65   EFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKG  244
            E+P W+SA DRRLL+A        V    DGSG ++TV+EAVA+AP+    RY+I IK G
Sbjct  241  EWPEWLSAGDRRLLQAPTVTPDVTVAA--DGSGDFRTVSEAVAAAPERSTRRYIIKIKAG  298

Query  245  TYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQ  424
             YKENV++ + KTN+M +GDG   TIIT S N VDG+TTFNSATVAAVGDGF+A+D+  Q
Sbjct  299  VYKENVDVPRGKTNLMFVGDGRVNTIITASRNVVDGSTTFNSATVAAVGDGFLARDITFQ  358

Query  425  NTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAA  604
            NTAGP KHQAVALR+G+D S   RC + AYQDTLY HS RQFY  C + GTVDFIFGNAA
Sbjct  359  NTAGPSKHQAVALRVGSDLSAFYRCDMLAYQDTLYVHSLRQFYVQCLVAGTVDFIFGNAA  418

Query  605  AVI  613
            AV 
Sbjct  419  AVF  421



>emb|CAB95025.1| pectin methylesterase [Nicotiana tabacum]
Length=579

 Score =   234 bits (598),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 117/194 (60%), Positives = 142/194 (73%), Gaps = 2/194 (1%)
 Frame = +2

Query  32   STEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNG  211
            +T   LR  N E+P W+SA DRRLL++S       V    DGSG +KTV+EAVA AP+  
Sbjct  236  TTNRKLREDNSEWPEWLSAGDRRLLQSSTVRPDVVVAA--DGSGNFKTVSEAVAKAPEKS  293

Query  212  KTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVG  391
              RYVI IK G Y+ENV++ KKKTN+M +GDG S TIITGS N  DG+TTF+SATVAAVG
Sbjct  294  SKRYVIRIKAGVYRENVDVPKKKTNIMFMGDGRSNTIITGSRNVKDGSTTFHSATVAAVG  353

Query  392  DGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYIT  571
            + F+A+D+  QNTAG  KHQAVALR+G+D S   RC I AYQD+LY HS RQ++  C I 
Sbjct  354  EKFLARDITFQNTAGAAKHQAVALRVGSDLSAFYRCDILAYQDSLYVHSNRQYFVQCLIA  413

Query  572  GTVDFIFGNAAAVI  613
            GTVDFIFGNAAAV+
Sbjct  414  GTVDFIFGNAAAVL  427



>ref|XP_009762395.1| PREDICTED: pectinesterase/pectinesterase inhibitor U1 [Nicotiana 
sylvestris]
Length=589

 Score =   234 bits (598),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 117/194 (60%), Positives = 142/194 (73%), Gaps = 2/194 (1%)
 Frame = +2

Query  32   STEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNG  211
            +T   LR  N E+P W+SA DRRLL++S       V    DGSG +KTV+EAVA AP+  
Sbjct  246  TTNRKLREDNSEWPEWLSAGDRRLLQSSTVRPDVVVAA--DGSGNFKTVSEAVAKAPEKS  303

Query  212  KTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVG  391
              RYVI IK G Y+ENV++ KKKTN+M +GDG S TIITGS N  DG+TTF+SATVAAVG
Sbjct  304  SKRYVIRIKAGVYRENVDVPKKKTNIMFMGDGRSNTIITGSRNVKDGSTTFHSATVAAVG  363

Query  392  DGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYIT  571
            + F+A+D+  QNTAG  KHQAVALR+G+D S   RC I AYQD+LY HS RQ++  C I 
Sbjct  364  EKFLARDITFQNTAGAAKHQAVALRVGSDLSAFYRCDILAYQDSLYVHSNRQYFVQCLIA  423

Query  572  GTVDFIFGNAAAVI  613
            GTVDFIFGNAAAV+
Sbjct  424  GTVDFIFGNAAAVL  437



>ref|XP_009767827.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=593

 Score =   234 bits (598),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 117/192 (61%), Positives = 141/192 (73%), Gaps = 6/192 (3%)
 Frame = +2

Query  50   RALN----GEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKT  217
            R LN    G +P W+S  DRRLL++ +      V    DGSG YKTVAEAVA+AP+    
Sbjct  252  RKLNEESSGTWPEWLSTGDRRLLQSPSVTADVVVAA--DGSGDYKTVAEAVANAPEKSSK  309

Query  218  RYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDG  397
            RYVI IK G YKENVE+ KKK N+M +GDG   TIITGS N  DG+TTF+SATVAAVG+G
Sbjct  310  RYVIRIKAGVYKENVEVSKKKKNIMFMGDGRENTIITGSRNVKDGSTTFHSATVAAVGEG  369

Query  398  FIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGT  577
            F+A+D+  +NTAG EKHQAVALR+GAD S   +C +  YQDTLY HS RQF+  C+I+GT
Sbjct  370  FLARDITFENTAGHEKHQAVALRVGADLSAFYKCDMLGYQDTLYVHSNRQFFVQCFISGT  429

Query  578  VDFIFGNAAAVI  613
            VDFIFGNAAAV+
Sbjct  430  VDFIFGNAAAVL  441



>ref|XP_011005059.1| PREDICTED: pectinesterase 3-like [Populus euphratica]
Length=595

 Score =   234 bits (598),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 139/186 (75%), Gaps = 2/186 (1%)
 Frame = +2

Query  56   LNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYI  235
            L+  FPSWV+ SDRRLL+         V   KDGSG +KT+ EAV S P N K+R+VIY+
Sbjct  264  LDMGFPSWVNKSDRRLLQQENPEPNLTVA--KDGSGAFKTIREAVDSIPKNSKSRFVIYV  321

Query  236  KKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDL  415
            K+G Y ENV+I K++ NVM+ GDG++ TII+GSLN VDG TTF S T+ A G GFIA+D+
Sbjct  322  KEGIYVENVKIEKQQWNVMMYGDGMNKTIISGSLNNVDGVTTFLSGTLIAEGRGFIAKDM  381

Query  416  RIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFG  595
              +NTAGP+K QAVALR  +DQS+ +RC  DAYQDTLY HS RQFYR+C I GT+DFIFG
Sbjct  382  GFKNTAGPQKEQAVALRSSSDQSIFHRCSFDAYQDTLYTHSNRQFYRECQIIGTIDFIFG  441

Query  596  NAAAVI  613
            NAAA+ 
Sbjct  442  NAAAIF  447



>ref|XP_007133558.1| hypothetical protein PHAVU_011G1890000g, partial [Phaseolus vulgaris]
 gb|ESW05552.1| hypothetical protein PHAVU_011G1890000g, partial [Phaseolus vulgaris]
Length=436

 Score =   230 bits (587),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 138/183 (75%), Gaps = 0/183 (0%)
 Frame = +2

Query  65   EFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKG  244
            E P W+ + DR++LEA      A++VVAKDGSGKYKT+  A+   P+    R VIY+KKG
Sbjct  242  EEPKWLHSKDRKMLEADNLKKKADIVVAKDGSGKYKTITAALKHVPEKSDKRTVIYVKKG  301

Query  245  TYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQ  424
             Y ENV + K K NVM+IGDG++ TI++GSLN+VDG  TF+SAT A  G  FIA+D+  +
Sbjct  302  IYNENVRVEKTKWNVMIIGDGMNTTIVSGSLNFVDGTPTFSSATFAVFGKNFIARDMGFR  361

Query  425  NTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAA  604
            NTAGP+KHQAVAL   ADQ+V  RC+IDA+QD+LYAHS RQFYR+C I GTVDFIFGN+A
Sbjct  362  NTAGPQKHQAVALMTSADQAVFYRCQIDAFQDSLYAHSNRQFYRECNIYGTVDFIFGNSA  421

Query  605  AVI  613
             V+
Sbjct  422  VVL  424



>ref|XP_008228105.1| PREDICTED: pectinesterase [Prunus mume]
Length=587

 Score =   234 bits (597),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 138/182 (76%), Gaps = 2/182 (1%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
            +P W+S +DRRLL++S       V    DGSG YKTV+EAVA+AP+   TRYVI IK G 
Sbjct  256  WPEWLSVADRRLLQSSTVTPNVVVAA--DGSGNYKTVSEAVAAAPEKSSTRYVIRIKAGV  313

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            Y+ENV++ KKKTN+M +GDG ++TIIT S N VDG+TTFNSATVAAVG+ FIA+D+  QN
Sbjct  314  YRENVDVPKKKTNIMFLGDGRTSTIITASRNVVDGSTTFNSATVAAVGEKFIARDITFQN  373

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
            TAGP KHQAVALR+G+D S   R  I AYQD+LY HS RQF+  C + GTVDFIFGNAA 
Sbjct  374  TAGPSKHQAVALRVGSDLSAFYRVDILAYQDSLYVHSNRQFFEGCLVAGTVDFIFGNAAV  433

Query  608  VI  613
            V+
Sbjct  434  VL  435



>ref|XP_011012638.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=573

 Score =   234 bits (596),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 142/190 (75%), Gaps = 3/190 (2%)
 Frame = +2

Query  47   LRALNG-EFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRY  223
            L   NG E+P W+SA DRRLL+A+       V    DGSG Y+TV+EAVA+AP++  +RY
Sbjct  234  LEEENGTEWPEWLSAGDRRLLQATTVTPNVVVAA--DGSGNYRTVSEAVAAAPESSSSRY  291

Query  224  VIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFI  403
            +I IK G Y+ENV++  +KTN+M +GDG + TIIT S N VDG+TTFNSATVAAVG GF+
Sbjct  292  IIRIKAGVYRENVDVPSRKTNIMFMGDGRTTTIITASRNVVDGSTTFNSATVAAVGGGFL  351

Query  404  AQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVD  583
            A+D+  QN+AGP KHQAVA+R+G+D S   RC + AYQDTLY HS RQFY  C I G+VD
Sbjct  352  ARDITFQNSAGPSKHQAVAIRVGSDLSAFYRCGMIAYQDTLYVHSLRQFYVSCIIIGSVD  411

Query  584  FIFGNAAAVI  613
            FIFGNAAAV 
Sbjct  412  FIFGNAAAVF  421



>ref|XP_010271269.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=529

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 147/188 (78%), Gaps = 2/188 (1%)
 Frame = +2

Query  50   RALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVI  229
            R L+  FP+WVSA+DR+LL++ + A  A+VVVA DGSG YKT+++AVA++P     R+VI
Sbjct  193  RLLSDGFPTWVSAADRKLLQSPSAASQADVVVAADGSGNYKTISQAVAASPKRSGKRFVI  252

Query  230  YIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQ  409
            Y+K+G Y+ENVEI    +N+MLIGDG+ AT +TGS N  DG+TTF +ATVA  GDGFIA+
Sbjct  253  YVKRGVYRENVEI--TASNIMLIGDGIDATTVTGSKNVQDGSTTFRTATVAVTGDGFIAR  310

Query  410  DLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFI  589
            D+  +NTAGP+KHQAV+LR G+D SV  RC    YQDTLY +SQRQFYRDC I GTVDFI
Sbjct  311  DMTFENTAGPQKHQAVSLRSGSDLSVFYRCSFKGYQDTLYVYSQRQFYRDCDIYGTVDFI  370

Query  590  FGNAAAVI  613
            FG+A AV+
Sbjct  371  FGDAVAVL  378



>sp|Q43062.1|PME_PRUPE RecName: Full=Pectinesterase/pectinesterase inhibitor PPE8B; 
Includes: RecName: Full=Pectinesterase inhibitor PPE8B; AltName: 
Full=Pectin methylesterase inhibitor PPE8B; Includes: RecName: 
Full=Pectinesterase PPE8B; Short=PE PPE8B; AltName: 
Full=Pectin methylesterase PPE8B; Flags: Precursor [Prunus persica]
 emb|CAA65237.1| pectinesterase [Prunus persica]
Length=522

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/201 (58%), Positives = 145/201 (72%), Gaps = 4/201 (2%)
 Frame = +2

Query  11   VLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAV  190
            +L  V P++    +  NG+ PSWV   DR+LL+A   +V A V   +DG+G +  V +AV
Sbjct  171  LLTQVHPNSNQ--QGPNGQIPSWVKTKDRKLLQADGVSVDAIVA--QDGTGNFTNVTDAV  226

Query  191  ASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNS  370
             +APD    RYVIYIK+GTYKENVEI KKK N+M+IGDG+ ATII+G+ ++VDG TTF S
Sbjct  227  LAAPDYSMRRYVIYIKRGTYKENVEIKKKKWNLMMIGDGMDATIISGNRSFVDGWTTFRS  286

Query  371  ATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQF  550
            AT A  G GFIA+D+  +NTAGPEKHQAVALR  +D SV  RC I  YQDTLY H+ RQF
Sbjct  287  ATFAVSGRGFIARDITFENTAGPEKHQAVALRSDSDLSVFYRCNIRGYQDTLYTHTMRQF  346

Query  551  YRDCYITGTVDFIFGNAAAVI  613
            YRDC I+GTVDFIFG+A  V 
Sbjct  347  YRDCKISGTVDFIFGDATVVF  367



>gb|AFB77928.1| pectin methylesterase [Gossypium hirsutum]
Length=567

 Score =   233 bits (595),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/183 (62%), Positives = 137/183 (75%), Gaps = 2/183 (1%)
 Frame = +2

Query  65   EFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKG  244
            E+P W+S  DRRLL+A+       V    DGSG + TV+EAVA+AP+   TRY+I IK G
Sbjct  235  EWPKWLSEGDRRLLQATTVIPNVTVAA--DGSGDFLTVSEAVAAAPERSTTRYIIKIKAG  292

Query  245  TYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQ  424
             Y+ENV++  KKTN+M +GDG   TIIT S N VDG+TTF+SATVAAVGDGF+A+D+  Q
Sbjct  293  VYRENVDVPSKKTNLMFVGDGRVNTIITASRNVVDGSTTFHSATVAAVGDGFLARDITFQ  352

Query  425  NTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAA  604
            NTAGP KHQAVALR+G+D S   RC I AYQDTLY HS RQFY  C + G+VDFIFGNAA
Sbjct  353  NTAGPSKHQAVALRVGSDLSAFYRCGILAYQDTLYVHSLRQFYSQCLVAGSVDFIFGNAA  412

Query  605  AVI  613
            AV+
Sbjct  413  AVL  415



>ref|XP_009382521.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=566

 Score =   233 bits (595),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 140/182 (77%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
            FP WVS  DRRLL+A+AN    N++VAKDGSG + T++EAVA+AP   +TR+VIYIK G 
Sbjct  232  FPVWVSGKDRRLLQAAANTTTPNLIVAKDGSGNFTTISEAVAAAPSKSETRFVIYIKAGA  291

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            Y ENVE+GK +TN+M +GDG+  T++  S N VDG TTF SATVA VG+GF+ +D+ I+N
Sbjct  292  YLENVEVGKSQTNLMFMGDGIGKTVVKASRNVVDGWTTFRSATVAIVGNGFLMRDMTIEN  351

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
            +AGP KHQAVALR+GAD S   RC    YQDTLYAHS RQFYR+C + GT+DFIFGNA  
Sbjct  352  SAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYAHSLRQFYRECDVYGTIDFIFGNAGV  411

Query  608  VI  613
            V+
Sbjct  412  VL  413



>gb|KHF97383.1| Pectinesterase/pectinesterase inhibitor U1 [Gossypium arboreum]
Length=567

 Score =   233 bits (595),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/183 (62%), Positives = 137/183 (75%), Gaps = 2/183 (1%)
 Frame = +2

Query  65   EFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKG  244
            E+P W+S  DRRLL+A+       V    DGSG + TV+EAVA+AP+   TRY+I IK G
Sbjct  235  EWPKWLSEGDRRLLQATTVIPNVTVAA--DGSGDFLTVSEAVAAAPERSTTRYIIKIKAG  292

Query  245  TYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQ  424
             Y+ENV++  KKTN+M +GDG   TIIT S N VDG+TTF+SATVAAVGDGF+A+D+  Q
Sbjct  293  VYRENVDVPSKKTNLMFVGDGRVNTIITASRNVVDGSTTFHSATVAAVGDGFLARDITFQ  352

Query  425  NTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAA  604
            NTAGP KHQAVALR+G+D S   RC I AYQDTLY HS RQFY  C + G+VDFIFGNAA
Sbjct  353  NTAGPSKHQAVALRVGSDLSAFYRCGILAYQDTLYVHSLRQFYSQCLVAGSVDFIFGNAA  412

Query  605  AVI  613
            AV+
Sbjct  413  AVL  415



>ref|XP_011069392.1| PREDICTED: pectinesterase-like, partial [Sesamum indicum]
Length=398

 Score =   229 bits (583),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/185 (61%), Positives = 135/185 (73%), Gaps = 2/185 (1%)
 Frame = +2

Query  59   NGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIK  238
            N E+P W+SA DRRLL+AS       V    DGSG ++TV+ AVA+AP+    RYVI IK
Sbjct  64   NSEWPEWLSAGDRRLLQASKVTPDVTVAA--DGSGNFRTVSAAVAAAPEGRSRRYVIRIK  121

Query  239  KGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLR  418
             G Y+ENVEI ++KTN+M +GDG   TIITG+ N VDG+TTFNSATVA VGD F+A+D+ 
Sbjct  122  AGVYRENVEIPRRKTNLMFVGDGRMTTIITGNRNVVDGSTTFNSATVAVVGDRFLARDIT  181

Query  419  IQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGN  598
             QN+AGP KHQAVALR+ AD     RC + AYQDTLY HS RQFY  C I GT+DFIFGN
Sbjct  182  FQNSAGPSKHQAVALRVNADLCAFYRCNMLAYQDTLYVHSLRQFYTGCNIVGTIDFIFGN  241

Query  599  AAAVI  613
            AA V+
Sbjct  242  AAVVL  246



>ref|XP_009766961.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 46 
[Nicotiana sylvestris]
Length=574

 Score =   233 bits (595),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 142/183 (78%), Gaps = 0/183 (0%)
 Frame = +2

Query  65   EFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKG  244
            E+PSW+S++DR+LL+ SA  +  N VVAKDGSGKYK++  A+ +AP+  K RYVIY+KKG
Sbjct  245  EYPSWLSSNDRKLLQKSAPKIKVNAVVAKDGSGKYKSIKAALKAAPEKSKKRYVIYVKKG  304

Query  245  TYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQ  424
             YKENV I K K N+M+IGDG  ATI++G+ N++DG  TF SAT A  G GF+A+D+   
Sbjct  305  IYKENVRIEKTKWNIMIIGDGKDATIVSGNRNFIDGTPTFQSATFAVFGKGFMARDMGFV  364

Query  425  NTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAA  604
            NTAG  KHQAVAL   AD+SV  RCK+DA+QDTLY+HS RQFYRDC + GTVDFIFGN+A
Sbjct  365  NTAGAAKHQAVALMSTADESVFYRCKMDAFQDTLYSHSNRQFYRDCNVYGTVDFIFGNSA  424

Query  605  AVI  613
             V+
Sbjct  425  VVL  427



>gb|AGG23325.1| pectin methylesterase 1 [Musa acuminata AAA Group]
Length=566

 Score =   233 bits (594),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 140/182 (77%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
            FP WVS  DRRLL+A+AN    N++VAKDGSG + T+++AVA+AP   +TR+VIYIK G 
Sbjct  232  FPVWVSGKDRRLLQAAANTTTPNLIVAKDGSGNFTTISDAVAAAPSKSETRFVIYIKAGA  291

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            Y ENVE+GK KTN+M +GDG+  T++  S N VDG TTF SATVA VG+GF+ +D+ I+N
Sbjct  292  YLENVEVGKSKTNLMFMGDGIGKTVVKASRNVVDGWTTFRSATVAIVGNGFLMRDMTIEN  351

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
            +AGP KHQAVALR+GAD S   RC    YQDTLYAHS RQFYR+C + GT+DFIFGNA  
Sbjct  352  SAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYAHSLRQFYRECDVYGTIDFIFGNAGV  411

Query  608  VI  613
            V+
Sbjct  412  VL  413



>ref|XP_006465803.1| PREDICTED: pectinesterase 3-like [Citrus sinensis]
Length=588

 Score =   233 bits (595),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 135/182 (74%), Gaps = 2/182 (1%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
            FP+WV A DRRLL+ +     + V   +DGSG Y T+  AVA+ P    TR+VIY+KKGT
Sbjct  260  FPNWVGAGDRRLLQEANPKPDSTVA--QDGSGDYHTIEAAVAALPKKSPTRFVIYVKKGT  317

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            Y+ENV + K K NVM+ GDG + T+++GSLN+VDG  TF +ATVA  G GFIA+D+   N
Sbjct  318  YRENVILDKSKWNVMMYGDGKTVTVVSGSLNFVDGTPTFATATVAVAGRGFIAKDMTFIN  377

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
            TAGPEKHQAVA R G+D+SV  RC  +AYQDTLYAHS RQFYRDC ITGT+DFIFGNAA 
Sbjct  378  TAGPEKHQAVAFRSGSDRSVFYRCSFNAYQDTLYAHSNRQFYRDCDITGTIDFIFGNAAV  437

Query  608  VI  613
            V 
Sbjct  438  VF  439



>ref|XP_004309290.2| PREDICTED: putative pectinesterase/pectinesterase inhibitor 24, 
partial [Fragaria vesca subsp. vesca]
Length=240

 Score =   223 bits (569),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 138/181 (76%), Gaps = 0/181 (0%)
 Frame = +2

Query  71   PSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTY  250
            P W+  +DRRL+E+S     A++VVAKDGSGKYKT+ +A+ + PD  K R VIY+KKG Y
Sbjct  52   PEWLHQTDRRLIESSDLRKKASIVVAKDGSGKYKTIGDALKAVPDKSKKRTVIYVKKGVY  111

Query  251  KENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNT  430
             ENV + K K NV+++GDG++ATI++ SLN VDG  TF+SAT A  G GF+A+D+  +NT
Sbjct  112  FENVRVEKSKWNVVVVGDGMTATIVSASLNVVDGTPTFSSATFAVFGKGFVARDIGFRNT  171

Query  431  AGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAV  610
            AG  KHQAVAL   ADQ+V  RC+IDA+QD+LY H+ RQFYR+C I GTVDFIFGN+A V
Sbjct  172  AGAAKHQAVALMSSADQTVFYRCRIDAFQDSLYVHANRQFYRECDIYGTVDFIFGNSAVV  231

Query  611  I  613
            +
Sbjct  232  L  232



>gb|KDP28780.1| hypothetical protein JCGZ_14551 [Jatropha curcas]
Length=514

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 143/183 (78%), Gaps = 1/183 (1%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPD-NGKTRYVIYIKKG  244
            FP+W+   DR+LL++++ A  AN+VVA+DGSG YKT+ EAVA+A   +G  RY+IY+K G
Sbjct  181  FPTWLKPGDRKLLQSTSPASQANIVVAQDGSGNYKTINEAVAAASKRSGTGRYIIYVKSG  240

Query  245  TYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQ  424
            TYKENV+IGK   N+M +GDG+  TI+TGS +   GATTFNSAT A VGDGFIA+D+  +
Sbjct  241  TYKENVQIGKSLKNIMFVGDGIGKTIVTGSKSVGGGATTFNSATFAVVGDGFIARDMTFR  300

Query  425  NTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAA  604
            NTAGP+ HQAVALR GAD SV  +C  + YQDTLY HSQRQFYR+C I GTVDFIFGNAA
Sbjct  301  NTAGPQNHQAVALRSGADLSVFYKCSFEGYQDTLYVHSQRQFYRECDIYGTVDFIFGNAA  360

Query  605  AVI  613
             V+
Sbjct  361  VVL  363



>gb|ACQ85264.1| pectin methylesterase [Musa acuminata AAA Group]
Length=565

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 140/182 (77%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
            FP WVS  DRRLL+A+AN    N++VAKDGSG + T+++AVA+AP   +TR+VIYIK G 
Sbjct  231  FPVWVSGKDRRLLQAAANTTTPNLIVAKDGSGNFTTISDAVAAAPSKSETRFVIYIKAGA  290

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            Y ENVE+GK KTN+M +GDG+  T++  S N VDG TTF SATVA VG+GF+ +D+ I+N
Sbjct  291  YLENVEVGKSKTNLMFMGDGIGKTVVKASRNVVDGWTTFRSATVAIVGNGFLMRDMTIEN  350

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
            +AGP KHQAVALR+GAD S   RC    YQDTLYAHS RQFYR+C + GT+DFIFGNA  
Sbjct  351  SAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYAHSLRQFYRECDVYGTIDFIFGNAGV  410

Query  608  VI  613
            V+
Sbjct  411  VL  412



>ref|XP_007204326.1| hypothetical protein PRUPE_ppa004300mg [Prunus persica]
 gb|EMJ05525.1| hypothetical protein PRUPE_ppa004300mg [Prunus persica]
Length=517

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/201 (58%), Positives = 145/201 (72%), Gaps = 4/201 (2%)
 Frame = +2

Query  11   VLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAV  190
            +L  V P++    +  NG+ PSWV   DR+LL+A   +V A V   +DG+G +  V +AV
Sbjct  166  LLTQVHPNSNQ--QGPNGQIPSWVKTKDRKLLQADGVSVDAIVA--QDGTGNFTNVTDAV  221

Query  191  ASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNS  370
             +APD    RYVIYIK+GTY+ENVEI KKK N+M+IGDG+ ATII+G+ ++VDG TTF S
Sbjct  222  LAAPDYSMRRYVIYIKRGTYRENVEIKKKKWNLMMIGDGMDATIISGNRSFVDGWTTFRS  281

Query  371  ATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQF  550
            AT A  G GFIA+D+  +NTAGPEKHQAVALR  +D SV  RC I  YQDTLY H+ RQF
Sbjct  282  ATFAVSGRGFIARDITFENTAGPEKHQAVALRSDSDLSVFYRCNIRGYQDTLYTHTMRQF  341

Query  551  YRDCYITGTVDFIFGNAAAVI  613
            YRDC I+GTVDFIFG+A  V 
Sbjct  342  YRDCKISGTVDFIFGDATVVF  362



>gb|KHG08631.1| Pectinesterase 3 [Gossypium arboreum]
Length=582

 Score =   233 bits (594),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 137/182 (75%), Gaps = 2/182 (1%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
            +P W+SA DRRLL++S+      V    DGSG +KTV+EAVA AP+    RY+I IK G 
Sbjct  251  WPEWLSAGDRRLLQSSSVTPNVVVAA--DGSGNFKTVSEAVAKAPEKSSKRYIIRIKAGV  308

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            Y ENVE+ KKK+N+M IGDG + TIITGS N VDG+TTF+SATVAAVG+ F+A+D+  QN
Sbjct  309  YIENVEVPKKKSNIMFIGDGRTKTIITGSRNVVDGSTTFHSATVAAVGEKFLARDITFQN  368

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
            TAGP KHQAVALR+G+D S    C + AYQDTLY HS RQFY +C + GTVDFIFGNAAA
Sbjct  369  TAGPSKHQAVALRVGSDLSAFYNCDMLAYQDTLYVHSNRQFYVNCLVAGTVDFIFGNAAA  428

Query  608  VI  613
            V 
Sbjct  429  VF  430



>ref|XP_010047424.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=564

 Score =   233 bits (593),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 139/183 (76%), Gaps = 2/183 (1%)
 Frame = +2

Query  65   EFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKG  244
            ++P W+SA DRRLL+++       V    DGSG Y+TV+EAV +AP+  + RYVI IK G
Sbjct  233  QWPQWLSAGDRRLLQSTTVTPDVTVAA--DGSGDYRTVSEAVEAAPERSERRYVIKIKAG  290

Query  245  TYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQ  424
             Y+ENVE+  +KTN+M +GDG + TIITGS N VDG+TTFNSATVA VG+GF+A+D+  +
Sbjct  291  VYRENVEVTSRKTNLMFVGDGRTTTIITGSRNVVDGSTTFNSATVAVVGEGFLARDITFE  350

Query  425  NTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAA  604
            NTAGP KHQAVALR+ +D S   RC + AYQDTLY HS RQFY  C+I GTVDFIFGNAA
Sbjct  351  NTAGPSKHQAVALRVNSDFSAFYRCCMLAYQDTLYVHSLRQFYFGCFIAGTVDFIFGNAA  410

Query  605  AVI  613
            AV+
Sbjct  411  AVL  413



>ref|XP_011076284.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 46 
[Sesamum indicum]
Length=573

 Score =   233 bits (593),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 138/184 (75%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   GEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKK  241
            G+ P WVS  DRRLL+  ++ + A+ VVAKDGSGKYKT+  A+ + P+  K R+VIY+KK
Sbjct  242  GDAPEWVSFKDRRLLQTPSSRIKADAVVAKDGSGKYKTIKAALKAVPEKSKKRFVIYVKK  301

Query  242  GTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRI  421
            G Y ENV + K K NVM++GDG  ATI++GSLN+VDG  TF +AT A  G GFIA+D+  
Sbjct  302  GVYVENVRVEKTKWNVMMVGDGKDATIVSGSLNFVDGTPTFKTATFAVAGQGFIARDMGF  361

Query  422  QNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNA  601
            +NTAGP KHQAVAL   AD SV  RC +DAYQDTLYAHS RQFYR+C I GTVDFIFGN+
Sbjct  362  RNTAGPAKHQAVALMSTADHSVFYRCTMDAYQDTLYAHSNRQFYRECNIYGTVDFIFGNS  421

Query  602  AAVI  613
            A V 
Sbjct  422  AVVF  425



>ref|XP_007217169.1| hypothetical protein PRUPE_ppa003285mg [Prunus persica]
 gb|EMJ18368.1| hypothetical protein PRUPE_ppa003285mg [Prunus persica]
Length=587

 Score =   233 bits (594),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 138/182 (76%), Gaps = 2/182 (1%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
            +P W+S +DRRLL++S       V    DGSG YKTV+EAVA+AP+   TRYVI IK G 
Sbjct  256  WPEWLSVADRRLLQSSTVTPNVVVAA--DGSGNYKTVSEAVAAAPEKSSTRYVIRIKAGV  313

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            Y+ENV++ KKKTN+M +GDG ++TIIT S N VDG+TTFNSATVAAVG+ F+A+D+  QN
Sbjct  314  YRENVDVPKKKTNIMFLGDGRTSTIITASRNVVDGSTTFNSATVAAVGEKFLARDITFQN  373

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
            TAGP KHQAVALR+G+D S   R  I AYQD+LY HS RQF+  C + GTVDFIFGNAA 
Sbjct  374  TAGPSKHQAVALRVGSDLSAFYRVDILAYQDSLYVHSNRQFFEGCLVAGTVDFIFGNAAV  433

Query  608  VI  613
            V+
Sbjct  434  VL  435



>ref|XP_010520512.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 32 
[Tarenaya hassleriana]
Length=525

 Score =   231 bits (590),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = +2

Query  62   GEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKK  241
            G+FPSWV   DR+LL+ S +  AA+ VVA DG+G + T+ EAV +APD  + RYVIY+KK
Sbjct  189  GKFPSWVKPDDRKLLQ-SEDIPAADSVVAADGTGDFTTIMEAVMAAPDKSENRYVIYVKK  247

Query  242  GTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRI  421
            G Y ENVEI KKK N+M+IGDG+ +T+ITG  N++DG TTF SAT A  G GFIA+D+  
Sbjct  248  GIYSENVEINKKKWNIMMIGDGIDSTVITGDRNFIDGWTTFRSATFAVSGRGFIARDITF  307

Query  422  QNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNA  601
            +NTAGPEKHQAVALR  +D SV  RC +  YQDTLYAH+ RQF+R+C ITGTVDFIFG+A
Sbjct  308  ENTAGPEKHQAVALRSDSDLSVFFRCAMRGYQDTLYAHTMRQFFRECIITGTVDFIFGDA  367

Query  602  AAVI  613
             +V 
Sbjct  368  TSVF  371



>ref|XP_010258716.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Nelumbo nucifera]
Length=580

 Score =   233 bits (593),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 142/187 (76%), Gaps = 0/187 (0%)
 Frame = +2

Query  53   ALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIY  232
            A+  EFP+W SA+ RRLL AS   +  N+ VAKDGSGKYKT++EA+   P N    +VI+
Sbjct  238  AMEDEFPTWTSAAKRRLLAASRANIKPNITVAKDGSGKYKTISEALRHVPKNSNETFVIH  297

Query  233  IKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQD  412
            IK G Y E V+I +  T++M+IGDG + T ITG+ N+VDG  TF +ATVA +GDGF+A+D
Sbjct  298  IKAGVYHEQVQINRSMTHLMIIGDGPTKTKITGNKNFVDGTPTFKTATVAVIGDGFMAKD  357

Query  413  LRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIF  592
            +  +N+AGPEKHQAVALR+ +D S+   C+ID YQDTLYAH+ RQFYR+C I+GT+DFIF
Sbjct  358  IGFENSAGPEKHQAVALRVQSDMSIFYNCQIDGYQDTLYAHTHRQFYRNCTISGTIDFIF  417

Query  593  GNAAAVI  613
            GN+A V+
Sbjct  418  GNSAVVL  424



>gb|AAO85706.1| pectin methyl-esterase [Nicotiana benthamiana]
Length=579

 Score =   233 bits (593),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 141/194 (73%), Gaps = 2/194 (1%)
 Frame = +2

Query  32   STEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNG  211
            +T   LR  N E+P W+ A DRRLL++S       V    DGSG +KTV+EAVA AP+  
Sbjct  236  TTNRKLREDNSEWPEWLPAGDRRLLQSSTVRPDVVVAA--DGSGNFKTVSEAVAKAPEKS  293

Query  212  KTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVG  391
              RYVI IK G Y+ENV++ KKKTN+M +GDG S TIITGS N  DG+TTF+SATVAAVG
Sbjct  294  SKRYVIRIKAGVYRENVDVPKKKTNIMFMGDGRSNTIITGSRNVKDGSTTFHSATVAAVG  353

Query  392  DGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYIT  571
            + F+A+D+  QNTAG  KHQAVALR+G+D S   RC I AYQD+LY HS RQ++  C I 
Sbjct  354  EKFLARDITFQNTAGAAKHQAVALRVGSDLSAFYRCDILAYQDSLYVHSNRQYFVQCLIA  413

Query  572  GTVDFIFGNAAAVI  613
            GTVDFIFGNAAAV+
Sbjct  414  GTVDFIFGNAAAVL  427



>ref|NP_001274969.1| pectin methyl esterase [Solanum tuberosum]
 gb|AAF23892.1|AF152172_1 pectin methyl esterase [Solanum tuberosum]
Length=576

 Score =   233 bits (593),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 114/185 (62%), Positives = 137/185 (74%), Gaps = 2/185 (1%)
 Frame = +2

Query  59   NGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIK  238
            NGE+P W+SA DRRLL++S       V    DGSG YKTV+EAVA AP+    RYVI IK
Sbjct  242  NGEWPEWLSAGDRRLLQSSTVTPDVVVAA--DGSGDYKTVSEAVAKAPEKSSKRYVIRIK  299

Query  239  KGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLR  418
             G Y+ENV++ KKKTN+M +GDG S TIIT S N  DG+TTF+SATVAAVG+ F+A+D+ 
Sbjct  300  AGVYRENVDVPKKKTNIMFMGDGRSNTIITASRNVQDGSTTFHSATVAAVGEKFLARDIT  359

Query  419  IQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGN  598
             QNTAG  KHQAVALR+G+D S   +C I AYQDTLY HS RQF+  C + GTVDFIFGN
Sbjct  360  FQNTAGASKHQAVALRVGSDLSAFYKCDILAYQDTLYVHSNRQFFVQCLVAGTVDFIFGN  419

Query  599  AAAVI  613
             AAV+
Sbjct  420  GAAVL  424



>gb|AJH66132.1| pectin methylesterase [Malus domestica]
Length=585

 Score =   233 bits (593),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 138/182 (76%), Gaps = 2/182 (1%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
            +P W+S +DRRLL++S+      V    DG+G YKTV+EAVA+AP+   +RYVI IK G 
Sbjct  254  WPEWLSVADRRLLQSSSVTPNVVVAA--DGTGNYKTVSEAVAAAPEKSSSRYVIKIKAGI  311

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            Y+ENV++ KKKTN+M +GDG   TIIT S N VDG+TTFNSATVAAVG+ F+A+D+  QN
Sbjct  312  YRENVDVPKKKTNIMFLGDGRVNTIITASRNVVDGSTTFNSATVAAVGEKFLARDITFQN  371

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
            TAGP KHQAVALR+G+D S   RC I AYQD+LY HS RQF+  C + GTVDFIFGNAA 
Sbjct  372  TAGPSKHQAVALRVGSDLSAFYRCDILAYQDSLYVHSNRQFFEGCLVAGTVDFIFGNAAV  431

Query  608  VI  613
            V+
Sbjct  432  VL  433



>ref|XP_008348472.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=585

 Score =   233 bits (593),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 138/182 (76%), Gaps = 2/182 (1%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
            +P W+S +DRRLL++S+      V    DG+G YKTV+EAVA+AP+   +RYVI IK G 
Sbjct  254  WPEWLSVADRRLLQSSSVTPNVVVAA--DGTGNYKTVSEAVAAAPEKSSSRYVIKIKAGI  311

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            Y+ENV++ KKKTN+M +GDG   TIIT S N VDG+TTFNSATVAAVG+ F+A+D+  QN
Sbjct  312  YRENVDVPKKKTNIMFLGDGRVNTIITASRNVVDGSTTFNSATVAAVGEKFLARDITFQN  371

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
            TAGP KHQAVALR+G+D S   RC I AYQD+LY HS RQF+  C + GTVDFIFGNAA 
Sbjct  372  TAGPSKHQAVALRVGSDLSAFYRCDILAYQDSLYVHSNRQFFEGCLVAGTVDFIFGNAAV  431

Query  608  VI  613
            V+
Sbjct  432  VL  433



>gb|AAK69696.1|AF355057_1 putative pectin methylesterase LuPME5 [Linum usitatissimum]
Length=553

 Score =   232 bits (591),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 137/182 (75%), Gaps = 2/182 (1%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
            +P W+SA DRRLL+A        V    DGSG ++TV++AVA+AP+   +RYVI IK G 
Sbjct  222  WPRWISAGDRRLLQAGTVTPNVVVAA--DGSGNFRTVSQAVAAAPEGSTSRYVIRIKAGV  279

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            Y+E + + KKKTN+M +GDG ++TIITGS+N VDG+TTFNSATVA VGD F+A+DL  QN
Sbjct  280  YRETLVVPKKKTNLMFVGDGRTSTIITGSMNVVDGSTTFNSATVAVVGDRFMARDLTFQN  339

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
            TAGP KHQAVALR+ AD +   RC + AYQDTLY HS RQFY  C+I GTVDFIFGNAA 
Sbjct  340  TAGPSKHQAVALRVNADFTAFYRCDMLAYQDTLYVHSLRQFYVSCFIAGTVDFIFGNAAV  399

Query  608  VI  613
            V+
Sbjct  400  VL  401



>ref|XP_006828588.1| hypothetical protein AMTR_s00129p00047530 [Amborella trichopoda]
 gb|ERM96004.1| hypothetical protein AMTR_s00129p00047530 [Amborella trichopoda]
Length=535

 Score =   231 bits (590),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 138/188 (73%), Gaps = 0/188 (0%)
 Frame = +2

Query  50   RALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVI  229
            R L G FPSW  + DRRLL+     VA N  VA DG+G Y TV +A+ +APD+ + RYVI
Sbjct  195  RRLMGGFPSWFPSKDRRLLQIPVGGVAVNATVAADGTGNYTTVTDAITAAPDHSEQRYVI  254

Query  230  YIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQ  409
            Y+KKG Y ENVE+ KKKTN+ML+GDG   T+ITG+ N+VDG TTF SAT A  G+GFIA+
Sbjct  255  YVKKGVYNENVEVKKKKTNIMLLGDGKDVTVITGNRNFVDGWTTFRSATFAVSGNGFIAR  314

Query  410  DLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFI  589
             +  +N+AGPEKHQAVA R+ +D S   +C    +QDTLYAHS RQFYRDC I GTVDFI
Sbjct  315  GITFENSAGPEKHQAVAARVDSDLSAFYQCSFKGFQDTLYAHSLRQFYRDCDIFGTVDFI  374

Query  590  FGNAAAVI  613
            FGNAAA+ 
Sbjct  375  FGNAAAIF  382



>gb|KJB57093.1| hypothetical protein B456_009G147900 [Gossypium raimondii]
Length=582

 Score =   232 bits (592),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 137/182 (75%), Gaps = 2/182 (1%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
            +P W+SA DRRLL++S+      V    DGSG +KT++EAVA AP+    RY+I IK G 
Sbjct  251  WPEWLSAGDRRLLQSSSVTPNVVVAA--DGSGNFKTLSEAVAKAPEKSSKRYIIRIKAGV  308

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            Y+ENVE+ KKK+N+M IGDG + TIITGS N VDG+TTF+SATVA VG+ F+A+D+  QN
Sbjct  309  YRENVEVPKKKSNIMFIGDGRTKTIITGSRNVVDGSTTFHSATVAVVGEKFLARDITFQN  368

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
            TAGP KHQAVALR+G+D S    C + AYQDTLY HS RQFY +C + GTVDFIFGNAAA
Sbjct  369  TAGPSKHQAVALRVGSDLSAFYNCDMLAYQDTLYVHSNRQFYVNCLVAGTVDFIFGNAAA  428

Query  608  VI  613
            V 
Sbjct  429  VF  430



>ref|XP_010230835.1| PREDICTED: pectinesterase-like [Brachypodium distachyon]
Length=561

 Score =   232 bits (591),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 138/182 (76%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
            FP WV   DRRLL+A+A+ + AN VVAKDGSG Y TV+ AV +AP N K+RYVIYIK G 
Sbjct  228  FPRWVRPGDRRLLQAAASGITANAVVAKDGSGGYTTVSAAVTAAPANSKSRYVIYIKAGA  287

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            Y ENVE+GK + N+M IGDG+  T+I  S N VDG TTF SATVA VG+ FIA+DL I+N
Sbjct  288  YLENVEVGKNQKNLMFIGDGIGKTVIKASRNVVDGYTTFRSATVAVVGNNFIARDLTIEN  347

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
            +AGP KHQAVALR+GAD S   RC    YQDTLY HS RQF+RDC + GTVDF+FGN+A 
Sbjct  348  SAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFFRDCDVYGTVDFVFGNSAV  407

Query  608  VI  613
            V+
Sbjct  408  VL  409



>ref|XP_010465323.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3 [Camelina 
sativa]
Length=592

 Score =   233 bits (593),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 139/182 (76%), Gaps = 2/182 (1%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
            +P+W+SA DRRLL+ S     A V    DGSGK+KTVA AVA+AP+N   RYVI+IK G 
Sbjct  261  WPTWLSAGDRRLLQGSGVRADATVAA--DGSGKFKTVASAVAAAPENSNKRYVIHIKAGV  318

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            Y+ENV++ KKK N+M +GDG + TIITG+ N VDG+TTF+SATVAAVG+ F+A+D+  QN
Sbjct  319  YRENVDVSKKKKNIMFMGDGRTRTIITGNRNVVDGSTTFHSATVAAVGERFLARDITFQN  378

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
            TAGP KHQAVALR+G+D S    C + AYQDTLY HS RQF+  C I GTVDFIFGNAA 
Sbjct  379  TAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCLIAGTVDFIFGNAAV  438

Query  608  VI  613
            V+
Sbjct  439  VL  440



>ref|XP_011078159.1| PREDICTED: pectinesterase-like isoform X1 [Sesamum indicum]
Length=567

 Score =   232 bits (591),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 135/185 (73%), Gaps = 2/185 (1%)
 Frame = +2

Query  59   NGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIK  238
            N E+P W+SA DRRLL+AS       V    DGSG ++TV+ AVA+AP     RYVI IK
Sbjct  233  NSEWPEWLSAGDRRLLQASTVTPDVTVAA--DGSGNFRTVSAAVAAAPGGSSRRYVIRIK  290

Query  239  KGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLR  418
             G Y+ENVEI + KTN+M +GDG + TIITG+ N VDG+TTFNSATVA VGD F+A+D+ 
Sbjct  291  AGVYRENVEIPRSKTNLMFVGDGRTTTIITGNRNVVDGSTTFNSATVAVVGDRFLARDIT  350

Query  419  IQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGN  598
             QNTAGP KHQAVALR+ AD     RC + AYQDTLY HS RQFY  C I GTVDFIFGN
Sbjct  351  FQNTAGPSKHQAVALRVNADLCAFYRCDMLAYQDTLYVHSLRQFYTGCIIAGTVDFIFGN  410

Query  599  AAAVI  613
            AAAV+
Sbjct  411  AAAVL  415



>ref|XP_006295807.1| hypothetical protein CARUB_v10024933mg, partial [Capsella rubella]
 gb|EOA28705.1| hypothetical protein CARUB_v10024933mg, partial [Capsella rubella]
Length=355

 Score =   226 bits (576),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 111/193 (58%), Positives = 143/193 (74%), Gaps = 2/193 (1%)
 Frame = +2

Query  41   DDLRALNGEFPSWVSASDRRLLEASanavaanv--vvaKDGSGKYKTVAEAVASAPDNGK  214
            D+L+     FP W++  D++++ A+   +  N   VVAKDG+G Y T+ EAV + PDN K
Sbjct  10   DELQTARDGFPLWMNNVDKKIIGATPKVLKMNADIVVAKDGTGNYTTLKEAVDAVPDNNK  69

Query  215  TRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGD  394
             R++IY+K+G YKE +EIG+ KTN+MLIGDG   +++TGSLN+ DG T   SAT+A   +
Sbjct  70   KRFIIYLKRGVYKETIEIGEMKTNLMLIGDGRDISLLTGSLNFKDGYTILKSATLATCAN  129

Query  395  GFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITG  574
            GFIA DL  QNTAGP K+QAVALR+ AD SVI RC+ID YQDTL+A   RQFYRDCYITG
Sbjct  130  GFIALDLWFQNTAGPTKNQAVALRVNADLSVIYRCRIDGYQDTLFAEQHRQFYRDCYITG  189

Query  575  TVDFIFGNAAAVI  613
            T+DFIFG+AAAV 
Sbjct  190  TIDFIFGDAAAVF  202



>ref|XP_009601611.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=592

 Score =   232 bits (592),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 116/192 (60%), Positives = 141/192 (73%), Gaps = 6/192 (3%)
 Frame = +2

Query  50   RALN----GEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKT  217
            R LN    G +P W+S  DRRLL++ +      V    DGSG YKTVAEAVA+AP+    
Sbjct  251  RKLNEESSGTWPEWLSTGDRRLLQSPSVTADVVVAA--DGSGDYKTVAEAVANAPEKSSK  308

Query  218  RYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDG  397
            RYVI IK G YKE+VE+ KKK N+M +GDG   TIITGS N  DG+TTF+SATVAAVG+G
Sbjct  309  RYVIRIKAGVYKESVEVSKKKKNIMFMGDGRENTIITGSRNVKDGSTTFHSATVAAVGEG  368

Query  398  FIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGT  577
            F+A+D+  +NTAG EKHQAVALR+GAD S   +C +  YQDTLY HS RQF+  C+I+GT
Sbjct  369  FLARDITFENTAGHEKHQAVALRVGADLSAFYKCDMLGYQDTLYVHSNRQFFVQCFISGT  428

Query  578  VDFIFGNAAAVI  613
            VDFIFGNAAAV+
Sbjct  429  VDFIFGNAAAVL  440



>gb|EEC82670.1| hypothetical protein OsI_27314 [Oryza sativa Indica Group]
Length=579

 Score =   232 bits (591),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 135/182 (74%), Gaps = 3/182 (2%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
            FPSWVSASDRR L+    A        KDGSGK+ TV+EAVA+AP+N +TRYVIYIK G 
Sbjct  248  FPSWVSASDRRRLQQQVAADVVVA---KDGSGKFTTVSEAVAAAPNNSETRYVIYIKAGG  304

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            Y ENVE+G +KTN+M +GDG   T+I  S N VD +TTF SAT+A VG GF+A+D+ ++N
Sbjct  305  YFENVEVGSEKTNIMFVGDGTWKTVIKASRNVVDNSTTFRSATLAVVGTGFLARDITVEN  364

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
             AGP KHQAVALR+ AD S   RC    YQDTLYAHS RQFYRDC I GTVDFIFG+AA 
Sbjct  365  AAGPSKHQAVALRVNADLSAFYRCSFAGYQDTLYAHSLRQFYRDCDIYGTVDFIFGDAAV  424

Query  608  VI  613
            V+
Sbjct  425  VL  426



>ref|NP_001060620.1| Os07g0675100 [Oryza sativa Japonica Group]
 dbj|BAC83543.1| putative pectinesterase [Oryza sativa Japonica Group]
 dbj|BAD31979.1| putative pectinesterase [Oryza sativa Japonica Group]
 dbj|BAF22534.1| Os07g0675100 [Oryza sativa Japonica Group]
 dbj|BAG94978.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67808.1| hypothetical protein OsJ_25560 [Oryza sativa Japonica Group]
Length=579

 Score =   232 bits (591),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 135/182 (74%), Gaps = 3/182 (2%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
            FPSWVSASDRR L+    A        KDGSGK+ TV+EAVA+AP+N +TRYVIYIK G 
Sbjct  248  FPSWVSASDRRRLQQQVAADVVVA---KDGSGKFTTVSEAVAAAPNNSETRYVIYIKAGG  304

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            Y ENVE+G +KTN+M +GDG   T+I  S N VD +TTF SAT+A VG GF+A+D+ ++N
Sbjct  305  YFENVEVGSEKTNIMFVGDGTWKTVIKASRNVVDNSTTFRSATLAVVGTGFLARDITVEN  364

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
             AGP KHQAVALR+ AD S   RC    YQDTLYAHS RQFYRDC I GTVDFIFG+AA 
Sbjct  365  AAGPSKHQAVALRVNADLSAFYRCSFAGYQDTLYAHSLRQFYRDCDIYGTVDFIFGDAAV  424

Query  608  VI  613
            V+
Sbjct  425  VL  426



>ref|XP_010043041.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 22 
[Eucalyptus grandis]
Length=535

 Score =   231 bits (588),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 140/183 (77%), Gaps = 0/183 (0%)
 Frame = +2

Query  65   EFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKG  244
            EFP+W++  D+ LL+AS   +  + VVA DGSG+Y+T++EAV  AP     RYVIYIKKG
Sbjct  208  EFPAWMTEGDQELLKASPVGMHVDAVVASDGSGRYRTISEAVIDAPSYSNRRYVIYIKKG  267

Query  245  TYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQ  424
             Y EN+++ +KKTN+M +GDG+ ATIITG+ +++ G TTF +ATVA  G GFIA+D+  +
Sbjct  268  VYSENIDLKRKKTNIMFVGDGIGATIITGNRHFMQGWTTFRTATVAVSGKGFIARDMTFR  327

Query  425  NTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAA  604
            NTAGP  HQAVALR+ +DQS   RC ++ YQDTLYAHS RQFYR+C + GT+DFIFGN A
Sbjct  328  NTAGPRNHQAVALRVDSDQSAFYRCSMEGYQDTLYAHSLRQFYRECDVHGTIDFIFGNGA  387

Query  605  AVI  613
            AV+
Sbjct  388  AVL  390



>gb|AAG17110.1|AF188895_1 putative pectin methylesterase 3 [Linum usitatissimum]
Length=555

 Score =   231 bits (589),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 114/185 (62%), Positives = 136/185 (74%), Gaps = 1/185 (1%)
 Frame = +2

Query  59   NGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIK  238
            +G +P W+   DRRLL+A        VV A DGSGKY+ V+EAVA+AP     RYVI IK
Sbjct  220  SGSWPIWMKGGDRRLLQAGTTVTPNVVVAA-DGSGKYRRVSEAVAAAPSKSSKRYVIRIK  278

Query  239  KGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLR  418
             G Y+ENVE+ K KTN+M +GDG S TIITG+ N VDG+TTFNSATVA VG GF+A+D+ 
Sbjct  279  AGIYRENVEVPKDKTNIMFVGDGRSNTIITGNKNVVDGSTTFNSATVAVVGQGFLARDIT  338

Query  419  IQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGN  598
             QNTAGP KHQAVALR+GAD +   RC   AYQDTLY HS RQF+ +C + GTVDFIFGN
Sbjct  339  FQNTAGPSKHQAVALRVGADLAAFYRCDFLAYQDTLYVHSNRQFFINCLVVGTVDFIFGN  398

Query  599  AAAVI  613
            +AAV 
Sbjct  399  SAAVF  403



>ref|XP_008653464.1| PREDICTED: pectinesterase-like [Zea mays]
 tpg|DAA64103.1| TPA: hypothetical protein ZEAMMB73_876271 [Zea mays]
Length=605

 Score =   232 bits (592),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 138/182 (76%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
            FPSWVS +DRR L+        ++VVAKDGSG + TV EAVA+AP+N +TR+VIYIK G 
Sbjct  271  FPSWVSGADRRRLQQQQVVPGPDLVVAKDGSGNFTTVGEAVAAAPNNSETRFVIYIKAGG  330

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            Y ENVE+G +KTN+M +GDG+  T+I  S N VD +TTF SAT+A VG GF+A+DL ++N
Sbjct  331  YFENVEVGSEKTNLMFVGDGMWRTVIKASRNVVDNSTTFRSATLAVVGTGFLARDLTVEN  390

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
             AGP KHQAVALR+ AD S   RC    YQDTLYAHS RQFYRDC + GTVDF+FG+AAA
Sbjct  391  AAGPSKHQAVALRVNADLSAFYRCAFAGYQDTLYAHSLRQFYRDCDVYGTVDFVFGDAAA  450

Query  608  VI  613
            V+
Sbjct  451  VL  452



>ref|XP_007052106.1| Pectinesterase 2 [Theobroma cacao]
 gb|EOX96263.1| Pectinesterase 2 [Theobroma cacao]
Length=517

 Score =   230 bits (586),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 145/183 (79%), Gaps = 1/183 (1%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPD-NGKTRYVIYIKKG  244
            FP+WV   DR+LL++S+ A  AN+VVA+DGSG YKT+ +A+++A   +G  RYVIY+K G
Sbjct  184  FPTWVKPGDRKLLQSSSPASRANIVVAQDGSGNYKTIKDAISAASKRSGSGRYVIYVKAG  243

Query  245  TYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQ  424
            TYKENVEI  K  N+ML+GDG+  TIITGS +   G+TTFNSATVAAVGDGFIA+D+ I+
Sbjct  244  TYKENVEIRSKLKNIMLVGDGIGKTIITGSKSVGQGSTTFNSATVAAVGDGFIARDITIR  303

Query  425  NTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAA  604
            NTAGP+ HQAV+LR G+D SV  RC  + YQDTLY HS+RQFYR+C I GTVD IFGNAA
Sbjct  304  NTAGPQNHQAVSLRSGSDLSVFYRCSFEGYQDTLYVHSERQFYRECDIYGTVDVIFGNAA  363

Query  605  AVI  613
             V+
Sbjct  364  VVL  366



>ref|XP_009612569.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 46 
[Nicotiana tomentosiformis]
Length=575

 Score =   231 bits (590),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 142/183 (78%), Gaps = 0/183 (0%)
 Frame = +2

Query  65   EFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKG  244
            E+PSW+S++DR+LL+ SA  +  N VVAKDGSGKYK++  A+ +AP+  K RYVIY+K+G
Sbjct  245  EYPSWLSSNDRKLLQKSAPKIKVNAVVAKDGSGKYKSIKAALKAAPEKSKKRYVIYVKQG  304

Query  245  TYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQ  424
             YKENV I K K N+M+IGDG  ATI++G+ N++DG  TF SAT A  G GF+A+D+   
Sbjct  305  IYKENVRIEKTKWNIMIIGDGKDATIVSGNRNFIDGTPTFKSATFAVFGKGFMARDMGFV  364

Query  425  NTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAA  604
            NTAG  KHQAVAL   AD+SV  RCK+DA+QDTLY+HS RQFYRDC + GTVDFIFGN+A
Sbjct  365  NTAGAAKHQAVALMSTADESVFYRCKMDAFQDTLYSHSNRQFYRDCDVYGTVDFIFGNSA  424

Query  605  AVI  613
             V+
Sbjct  425  VVL  427



>ref|XP_010271283.1| PREDICTED: pectinesterase [Nelumbo nucifera]
Length=531

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 147/188 (78%), Gaps = 2/188 (1%)
 Frame = +2

Query  50   RALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVI  229
            R L+  FP+WVSA+DR+LL++S+ A  A+VVVA DGSG Y+T+++AVA++      R+VI
Sbjct  195  RLLSDGFPTWVSAADRKLLQSSSAASQADVVVAADGSGNYRTISQAVAASSKRSGKRFVI  254

Query  230  YIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQ  409
            Y+K+G YKENVEI  K +N+MLIGDG+ ATI+TGS N  DG+TTF SATVA   D F+A+
Sbjct  255  YVKRGVYKENVEI--KASNIMLIGDGIDATIVTGSKNVQDGSTTFRSATVAVTRDRFMAR  312

Query  410  DLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFI  589
            D+  +NTAGP+KHQAVALR G+D SV  RC    YQDTLY +SQRQFYRDC I GTVDFI
Sbjct  313  DMTFENTAGPQKHQAVALRSGSDLSVFYRCSFKGYQDTLYVYSQRQFYRDCDIYGTVDFI  372

Query  590  FGNAAAVI  613
            FG+A AV+
Sbjct  373  FGDAVAVL  380



>gb|KCW73020.1| hypothetical protein EUGRSUZ_E01454 [Eucalyptus grandis]
Length=480

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 142/184 (77%), Gaps = 1/184 (1%)
 Frame = +2

Query  65   EFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAV-ASAPDNGKTRYVIYIKK  241
            +FP+WV   DR+LL++S+    AN++VA+DGSG YKT++EA+ A++  +G  RY+IYIK 
Sbjct  146  KFPTWVRPGDRKLLQSSSAVSKANIIVAQDGSGNYKTISEAITAASKRSGTARYIIYIKA  205

Query  242  GTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRI  421
            GTY ENVE+G K  N+M +GDG+  TIITGS +   G+TTFNSATVA VGDGFIAQD+  
Sbjct  206  GTYSENVEVGSKLENIMFVGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDGFIAQDITF  265

Query  422  QNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNA  601
            +NTAG   HQAVALR G+D SV  RC  + YQDTLY HS+RQFYR+C I GTVDFIFGNA
Sbjct  266  RNTAGAANHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSERQFYRECDIYGTVDFIFGNA  325

Query  602  AAVI  613
            A V+
Sbjct  326  AVVL  329



>ref|XP_010917364.1| PREDICTED: pectinesterase [Elaeis guineensis]
Length=520

 Score =   229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 134/182 (74%), Gaps = 1/182 (1%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
            FP WVSA DRRLL+A     A  VV  +DGSG+Y TV  AV +AP     RYVIY+K+G 
Sbjct  186  FPKWVSAGDRRLLQAPGAVAADAVVA-QDGSGQYTTVGAAVEAAPTESTKRYVIYVKRGV  244

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            Y ENV+I KK  N+ML+GDG+  TII+GS N+VDG TT+ SAT A  G GFIA+DL I+N
Sbjct  245  YNENVDIKKKWWNIMLVGDGMGQTIISGSRNFVDGWTTYRSATFAVSGKGFIARDLTIEN  304

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
            TAGP KHQAVALR  +D SV  RC    YQDTLYAH+ RQFYR+C ITGTVDF+FGNAAA
Sbjct  305  TAGPSKHQAVALRSDSDLSVYYRCSFLGYQDTLYAHALRQFYRECLITGTVDFVFGNAAA  364

Query  608  VI  613
            V 
Sbjct  365  VF  366



>sp|P83948.1|PME3_CITSI RecName: Full=Pectinesterase 3; Short=PE 3; AltName: Full=Pectin 
methylesterase 3; Flags: Precursor [Citrus sinensis]
Length=584

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 136/182 (75%), Gaps = 2/182 (1%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
            +P+W+S  DRRLL++S+      V    DGSG +KTVA +VA+AP  G  RY+I IK G 
Sbjct  253  WPAWLSTGDRRLLQSSSVTPNVVVAA--DGSGNFKTVAASVAAAPQGGTKRYIIRIKAGV  310

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            Y+ENVE+ KK  N+M IGDG + TIITGS N VDG+TTF SATVA VG+GF+A+D+  QN
Sbjct  311  YRENVEVTKKHKNIMFIGDGRTRTIITGSRNVVDGSTTFKSATVAVVGEGFLARDITFQN  370

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
            TAGP KHQAVALR+GAD S    C + AYQDTLY HS RQF+ +C I GTVDFIFGNAAA
Sbjct  371  TAGPSKHQAVALRVGADLSAFYNCDMLAYQDTLYVHSNRQFFVNCLIAGTVDFIFGNAAA  430

Query  608  VI  613
            V+
Sbjct  431  VL  432



>ref|XP_010271267.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=526

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 145/188 (77%), Gaps = 2/188 (1%)
 Frame = +2

Query  50   RALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVI  229
            R L+  FP+WVSA+DR+LL++ + A  A+VVVA DGSG YKT++EAVA++      R+VI
Sbjct  190  RLLSDGFPTWVSAADRKLLQSPSAASQADVVVAADGSGNYKTISEAVAASSKRSGKRFVI  249

Query  230  YIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQ  409
            Y+KKG YKENVEI  K +N+MLIGDG+ ATI+T S N  DG+TTF +ATV   GDGF+A+
Sbjct  250  YVKKGVYKENVEI--KASNIMLIGDGIDATIVTDSKNAQDGSTTFRTATVGVTGDGFMAR  307

Query  410  DLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFI  589
            D+  +NTAGP+KHQAVALR G+D SV   C    YQDTLY +SQRQFYRDC I GTVDFI
Sbjct  308  DMTFENTAGPQKHQAVALRSGSDLSVFYSCSFKGYQDTLYVYSQRQFYRDCDIYGTVDFI  367

Query  590  FGNAAAVI  613
            FG+A AV+
Sbjct  368  FGDAVAVL  375



>ref|XP_010534986.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Tarenaya 
hassleriana]
 ref|XP_010534987.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Tarenaya 
hassleriana]
Length=587

 Score =   231 bits (588),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 139/182 (76%), Gaps = 2/182 (1%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
            +P W+SA DRRLL+++     A V    DGSG ++TVA  VA+AP+N   RYVI+IK G 
Sbjct  256  WPKWLSAGDRRLLQSTTVKADATVAA--DGSGNFRTVAAGVAAAPENSNKRYVIHIKAGV  313

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            Y+ENVE+ KKK N+M +GDG + TIITGS N VDG+TTF+SATVAAVG+ F+A+D+  QN
Sbjct  314  YRENVEVAKKKKNIMFMGDGRTRTIITGSRNVVDGSTTFHSATVAAVGERFLARDITFQN  373

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
            TAGP KHQAVALR+G+D S   +C I AYQD+LY HS RQF+  C +TGTVDFIFGNAA 
Sbjct  374  TAGPSKHQAVALRVGSDFSAFYQCDILAYQDSLYVHSNRQFFVKCLVTGTVDFIFGNAAV  433

Query  608  VI  613
            V+
Sbjct  434  VL  435



>ref|XP_006381544.1| hypothetical protein POPTR_0006s13700g [Populus trichocarpa]
 gb|ERP59341.1| hypothetical protein POPTR_0006s13700g [Populus trichocarpa]
Length=596

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 138/186 (74%), Gaps = 2/186 (1%)
 Frame = +2

Query  56   LNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYI  235
            L+  FPSWV+ SDRRLL+         V   KDGSG +KT+ EAV S P N K+R+VIY+
Sbjct  265  LDMGFPSWVNKSDRRLLQQENPEPNLTVA--KDGSGAFKTIREAVDSIPKNSKSRFVIYV  322

Query  236  KKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDL  415
            K+G Y ENV+I K++ N M+ GDG++ TII+GSLN VDG TTF S T+ A G GFIA+D+
Sbjct  323  KEGIYVENVKIEKQQWNFMMYGDGMNKTIISGSLNNVDGVTTFLSGTLIAEGRGFIAKDM  382

Query  416  RIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFG  595
              +NTAGP+K QAVA+R  +DQS+ +RC  DAYQDTLY HS RQFYR+C I GT+DFIFG
Sbjct  383  GFKNTAGPQKEQAVAVRSSSDQSIFHRCSFDAYQDTLYTHSNRQFYRECRIIGTIDFIFG  442

Query  596  NAAAVI  613
            NAAA+ 
Sbjct  443  NAAAIF  448



>ref|XP_003627458.1| Pectinesterase [Medicago truncatula]
 gb|AET01934.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=589

 Score =   231 bits (588),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 135/182 (74%), Gaps = 2/182 (1%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
            +P W+SA DRRLL+ S       V    DGSG +KTV+EAVA+AP     RYVI IK G 
Sbjct  258  WPEWISAGDRRLLQGSTVKADVVVAA--DGSGNFKTVSEAVAAAPLKSSKRYVIKIKAGV  315

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            YKENVE+ KKKTN+M +GDG + TIITGS N VDG+TTF+SATVA VG  F+A+D+  QN
Sbjct  316  YKENVEVPKKKTNIMFLGDGRTNTIITGSRNVVDGSTTFHSATVAIVGGNFLARDITFQN  375

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
            TAGP KHQAVALR+GAD S    C I AYQDTLY H+ RQF+ +C+I+GTVDFIFGN+A 
Sbjct  376  TAGPAKHQAVALRVGADLSAFYNCDIIAYQDTLYVHNNRQFFVNCFISGTVDFIFGNSAV  435

Query  608  VI  613
            V 
Sbjct  436  VF  437



>ref|XP_006307088.1| hypothetical protein CARUB_v10008673mg [Capsella rubella]
 gb|EOA39986.1| hypothetical protein CARUB_v10008673mg [Capsella rubella]
Length=584

 Score =   231 bits (588),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 139/187 (74%), Gaps = 3/187 (2%)
 Frame = +2

Query  56   LNGE-FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIY  232
            L+GE +P W+S  DRRLL+ S     A V    DGSG +KT+  AVA+AP+    R+VI+
Sbjct  248  LDGEGWPHWLSVGDRRLLQGSTVKADATVAA--DGSGDFKTIVAAVAAAPEKSSKRFVIH  305

Query  233  IKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQD  412
            IK G Y+ENVE+ KKK N+M +GDG   TIIT S N VDG+TTF+SATVAAVG+GF+A+D
Sbjct  306  IKAGVYRENVEVSKKKKNIMFLGDGRGKTIITASRNVVDGSTTFHSATVAAVGEGFLARD  365

Query  413  LRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIF  592
            +  QNTAGP KHQAVALR+G+D S    C + AYQDTLY HS RQF+  C+I GTVDFIF
Sbjct  366  ITFQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCHIVGTVDFIF  425

Query  593  GNAAAVI  613
            GNAAAV+
Sbjct  426  GNAAAVL  432



>gb|AFW03475.1| pectin methylesterase 1 [Gossypium barbadense]
Length=582

 Score =   231 bits (588),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 136/182 (75%), Gaps = 2/182 (1%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
            +P W+SA DRRLL++S+      V    DGSG +KTV+EAVA AP+    RY+I IK G 
Sbjct  251  WPEWLSAGDRRLLQSSSVTPNVVVAA--DGSGNFKTVSEAVAKAPEKSSKRYIIRIKAGV  308

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            Y+ENVE+ KKK+N+M IGDG + TIITGS N VDG+TTF+SATVA VG+ F+A+D+  QN
Sbjct  309  YRENVEVPKKKSNIMFIGDGRTKTIITGSRNVVDGSTTFHSATVAVVGEKFLARDITFQN  368

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
            TAGP KHQAVALR+G+D S    C + AYQDTLY HS RQFY +C + GTVDFIF NAAA
Sbjct  369  TAGPSKHQAVALRVGSDLSAFYNCDMLAYQDTLYVHSNRQFYVNCLVAGTVDFIFENAAA  428

Query  608  VI  613
            V 
Sbjct  429  VF  430



>ref|XP_002515781.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF46620.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=573

 Score =   230 bits (587),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 140/183 (77%), Gaps = 0/183 (0%)
 Frame = +2

Query  65   EFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKG  244
              P W+  +DR+LL+++     AN VVAKDGSGKYKT+++A+ + PD  K R++IY+KKG
Sbjct  244  NLPRWLHQNDRKLLQSNDLKKKANAVVAKDGSGKYKTISDALKAVPDKSKKRFIIYVKKG  303

Query  245  TYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQ  424
             Y ENV + K K NV+++GDG++ATI++GSLN+VDG  TF++AT A  G GFIA+D+  +
Sbjct  304  IYTENVRVEKPKWNVVIVGDGMNATIVSGSLNFVDGTPTFSTATFAVFGKGFIARDMGFR  363

Query  425  NTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAA  604
            NTAGP KHQAVAL   AD SV  RC  DA+QDTLYAHS RQFYR+C I GTVDFIFGN+A
Sbjct  364  NTAGPIKHQAVALMSTADMSVFYRCSFDAFQDTLYAHSNRQFYRECNIYGTVDFIFGNSA  423

Query  605  AVI  613
             VI
Sbjct  424  VVI  426



>gb|EYU29496.1| hypothetical protein MIMGU_mgv1a003055mg [Erythranthe guttata]
Length=611

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 139/185 (75%), Gaps = 2/185 (1%)
 Frame = +2

Query  59   NGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIK  238
            +GE+P W+SA DRRLL++S       V    DGSG ++T+A AVA+AP+    RYVI IK
Sbjct  277  SGEWPEWMSAGDRRLLQSSTVTPDVTVAA--DGSGNFRTIAAAVAAAPERSTRRYVIRIK  334

Query  239  KGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLR  418
             G Y+ENVEI ++KTN+M +GDG S TIITGS N VDG+TTFNSATVA +GDGF+A+D+ 
Sbjct  335  AGVYRENVEISRRKTNLMFVGDGRSTTIITGSRNVVDGSTTFNSATVAVIGDGFLARDIT  394

Query  419  IQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGN  598
             QNTAGP KHQAVALR+ AD     RC + AYQDTLY HS RQFY  C I GTVDFIFGN
Sbjct  395  FQNTAGPSKHQAVALRVNADLCAFYRCDMLAYQDTLYVHSLRQFYTGCLIAGTVDFIFGN  454

Query  599  AAAVI  613
            AAAV+
Sbjct  455  AAAVL  459



>ref|XP_011092101.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 22 
[Sesamum indicum]
Length=537

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 144/194 (74%), Gaps = 0/194 (0%)
 Frame = +2

Query  32   STEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNG  211
            ST  D    N  FP W++  D+ LL +S N +  + VVA DGSG+Y+++A+A+  AP   
Sbjct  199  STAADNENRNKGFPQWMTEGDKELLVSSQNGMHVDAVVAVDGSGQYRSIAQAIYEAPSYS  258

Query  212  KTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVG  391
              RYVIY+KKG YKEN+++ KKKTN+ML+GDG+  TI+TG+ N++ G TTF +ATVA  G
Sbjct  259  NRRYVIYVKKGVYKENIDMKKKKTNIMLVGDGIGQTIVTGNRNFMQGWTTFRTATVAVSG  318

Query  392  DGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYIT  571
             GF+A+D+  +NTAGPE HQ VALR+ +DQS   RC ++ YQDTLYAHS RQFYR+C I+
Sbjct  319  KGFLARDITFRNTAGPESHQGVALRVDSDQSAFYRCSMEGYQDTLYAHSLRQFYRECSIS  378

Query  572  GTVDFIFGNAAAVI  613
            GT+DFIFGN AAV+
Sbjct  379  GTIDFIFGNGAAVL  392



>ref|XP_010047425.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=585

 Score =   230 bits (587),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 135/183 (74%), Gaps = 2/183 (1%)
 Frame = +2

Query  65   EFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKG  244
             +P W+SA DRRLL+++       V    DG+G Y+TV+ AVA+AP+    RYVI IK G
Sbjct  254  RWPEWLSAGDRRLLQSTTVTPDVTVAA--DGTGNYRTVSAAVAAAPEGSARRYVIKIKAG  311

Query  245  TYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQ  424
             Y+ENVE+ KKK N+M +GD    TIITGS N VDG+TTF SATVA VGDGF+A+D+  Q
Sbjct  312  VYRENVEVPKKKVNLMFMGDDRKTTIITGSRNVVDGSTTFKSATVAVVGDGFLARDITFQ  371

Query  425  NTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAA  604
            NTAGP KHQAVALR+GAD S  +RC + AYQDTLY HS RQFY  C + GTVDFIFGNAA
Sbjct  372  NTAGPSKHQAVALRVGADFSAFHRCDMLAYQDTLYVHSLRQFYVGCLVAGTVDFIFGNAA  431

Query  605  AVI  613
            AV+
Sbjct  432  AVL  434



>ref|XP_010056335.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   229 bits (583),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 142/184 (77%), Gaps = 1/184 (1%)
 Frame = +2

Query  65   EFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAV-ASAPDNGKTRYVIYIKK  241
            +FP+WV   DR+LL++S+    AN++VA+DGSG YKT++EA+ A++  +G  RY+IYIK 
Sbjct  181  KFPTWVRPGDRKLLQSSSAVSKANIIVAQDGSGNYKTISEAITAASKRSGTARYIIYIKA  240

Query  242  GTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRI  421
            GTY ENVE+G K  N+M +GDG+  TIITGS +   G+TTFNSATVA VGDGFIAQD+  
Sbjct  241  GTYSENVEVGSKLENIMFVGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDGFIAQDITF  300

Query  422  QNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNA  601
            +NTAG   HQAVALR G+D SV  RC  + YQDTLY HS+RQFYR+C I GTVDFIFGNA
Sbjct  301  RNTAGAANHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSERQFYRECDIYGTVDFIFGNA  360

Query  602  AAVI  613
            A V+
Sbjct  361  AVVL  364



>gb|KDP23440.1| hypothetical protein JCGZ_23273 [Jatropha curcas]
Length=538

 Score =   229 bits (584),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 102/199 (51%), Positives = 145/199 (73%), Gaps = 0/199 (0%)
 Frame = +2

Query  17   VAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVAS  196
            +   PS    +   + EFP W++  D+ LL+AS+  +  + +V+ DGSG Y+T+ EA+  
Sbjct  195  MPFKPSRNGTVTNRSPEFPEWMTEGDQELLKASSVGIHIDAIVSLDGSGHYRTITEAINE  254

Query  197  APDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSAT  376
            AP +   RY+IY+K+G Y+EN+++ KKKTN+ML+GDG+  T++TG+ N++ G TTF +AT
Sbjct  255  APSHSNRRYIIYVKQGVYRENIDMKKKKTNIMLVGDGIGKTVVTGNRNFLQGWTTFRTAT  314

Query  377  VAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYR  556
            VA  G GFIA+D+  +NTAGP+ HQAVALR+ +DQS   RC ++ YQDTLYAHS RQFYR
Sbjct  315  VAVSGRGFIARDMTFRNTAGPQNHQAVALRVDSDQSAFYRCSMEGYQDTLYAHSLRQFYR  374

Query  557  DCYITGTVDFIFGNAAAVI  613
            +C I GT+D+IFGN AAV 
Sbjct  375  ECNIYGTIDYIFGNGAAVF  393



>ref|XP_006433467.1| hypothetical protein CICLE_v10000816mg [Citrus clementina]
 ref|XP_006472137.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 22-like 
[Citrus sinensis]
 gb|ESR46707.1| hypothetical protein CICLE_v10000816mg [Citrus clementina]
Length=536

 Score =   229 bits (584),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/199 (53%), Positives = 147/199 (74%), Gaps = 0/199 (0%)
 Frame = +2

Query  17   VAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVAS  196
            +   P   +D ++ + +FP W++  D+  ++     + A+ VVA DG+G Y+T+ EA+ +
Sbjct  193  LPFKPPRINDTQSESPKFPKWMTEGDKGHMDMKPTRMHADAVVALDGTGHYRTITEAINA  252

Query  197  APDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSAT  376
            AP   K RYVIY+KKG Y+ENV++ KKKTN+ML+GDG+ AT++TG+ N++ G TTF +AT
Sbjct  253  APSYSKRRYVIYVKKGVYRENVDMKKKKTNIMLVGDGIGATVVTGNRNFMQGWTTFRTAT  312

Query  377  VAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYR  556
            VA  G GFIA+D+  +NTAGP+ HQAVALR+ +DQS   RC ++ YQDTLYAHS RQFYR
Sbjct  313  VAVSGKGFIARDMTFRNTAGPQNHQAVALRVDSDQSAFFRCSVEGYQDTLYAHSLRQFYR  372

Query  557  DCYITGTVDFIFGNAAAVI  613
            +C I GT+DFIFGN AAV+
Sbjct  373  ECNIYGTIDFIFGNGAAVL  391



>ref|XP_008800482.1| PREDICTED: pectinesterase-like isoform X1 [Phoenix dactylifera]
Length=585

 Score =   230 bits (587),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 135/182 (74%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
            FP W+   DRR L  +   V AN VVA DGSG YKTV EAVA+AP   KTR+VI I  GT
Sbjct  250  FPDWMEKKDRRRLLQATGEVKANAVVAPDGSGDYKTVGEAVAAAPAKSKTRWVIQITAGT  309

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            Y+ENVE+ KKKTN+M IG+G   TIITGS N VDG+TTF SAT+A VG+GF+A+ LRIQN
Sbjct  310  YEENVEVPKKKTNLMFIGEGRKTTIITGSRNVVDGSTTFRSATLAVVGEGFLARGLRIQN  369

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
            TAGP KHQAVALR+G+D S    C I  YQDTLY HS R F+R C I GTVDFIFGNAA 
Sbjct  370  TAGPSKHQAVALRVGSDLSAFYDCDIIGYQDTLYLHSLRHFFRSCLIQGTVDFIFGNAAT  429

Query  608  VI  613
            V+
Sbjct  430  VL  431



>ref|XP_010056339.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
 gb|KCW73022.1| hypothetical protein EUGRSUZ_E01463 [Eucalyptus grandis]
Length=515

 Score =   228 bits (582),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 142/184 (77%), Gaps = 1/184 (1%)
 Frame = +2

Query  65   EFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAV-ASAPDNGKTRYVIYIKK  241
            +FP+WV   DR+LL++S+    AN++VA+DGSG YKT++EA+ A++  +G  RY+IYIK 
Sbjct  181  KFPTWVRPGDRKLLQSSSAVSKANIIVAQDGSGNYKTISEAITAASKRSGTARYIIYIKA  240

Query  242  GTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRI  421
            GTY ENVE+G K  N+M +GDG+  TIITGS +   G+TTFNSATVA VGDGFIAQD+  
Sbjct  241  GTYSENVEVGSKLENIMFVGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDGFIAQDITF  300

Query  422  QNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNA  601
            +NTAG   HQAVALR G+D SV  RC  + YQDTLY HS+RQFYR+C I GTVDFIFGNA
Sbjct  301  RNTAGAANHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSERQFYRECDIYGTVDFIFGNA  360

Query  602  AAVI  613
            A V+
Sbjct  361  AVVL  364



>ref|XP_007139063.1| hypothetical protein PHAVU_009G261700g [Phaseolus vulgaris]
 gb|ESW11057.1| hypothetical protein PHAVU_009G261700g [Phaseolus vulgaris]
Length=580

 Score =   229 bits (585),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 109/182 (60%), Positives = 134/182 (74%), Gaps = 2/182 (1%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
            +P W+SA+DRRLL+         V    DGSG ++TV+ AVA+AP+    RYVI IK G 
Sbjct  249  WPHWISAADRRLLQTGTVKPDVVVAA--DGSGNFRTVSAAVAAAPEKSSKRYVIRIKAGV  306

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            Y+ENV++ KKKTN+M +GDG + TIIT S N VDG+TTFNSATV  VG+ F+ +D+  QN
Sbjct  307  YRENVDVSKKKTNIMFLGDGRTNTIITASRNVVDGSTTFNSATVVVVGERFLGRDITFQN  366

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
            TAGP KHQAVALR+GAD S   RC   AYQDTLY HS RQF+ +CYI G+VDFIFGN+AA
Sbjct  367  TAGPSKHQAVALRVGADLSAFYRCDFLAYQDTLYVHSNRQFFSNCYIAGSVDFIFGNSAA  426

Query  608  VI  613
            VI
Sbjct  427  VI  428



>ref|XP_004499740.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 24-like 
[Cicer arietinum]
Length=575

 Score =   229 bits (585),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 116/210 (55%), Positives = 149/210 (71%), Gaps = 6/210 (3%)
 Frame = +2

Query  2    SLAVLVAVAPSTED-DLRAL-----NGEFPSWVSASDRRLLEASanavaanvvvaKDGSG  163
            SLA++  +  +T   +LR L     + + P W+ + DR+LL        AN+VVAKDGSG
Sbjct  219  SLAIITWINKATNTLNLRRLLSLHQHNKLPKWLHSKDRKLLGTQDLRSKANIVVAKDGSG  278

Query  164  KYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNY  343
            KYKT++EA+   P+  K R +IY+KKG Y ENV + K K NVM+IGDG+SA+I++G LN+
Sbjct  279  KYKTISEALKHVPNKSKKRTLIYVKKGIYYENVRVEKTKWNVMIIGDGMSASIVSGRLNF  338

Query  344  VDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDT  523
            VDG  TF+SAT A  G  FIA+D+  +NTAGP+KHQAVAL   ADQ+V  +C ID YQDT
Sbjct  339  VDGTPTFSSATFAVFGKNFIAKDMGFRNTAGPQKHQAVALMTSADQAVYYKCYIDGYQDT  398

Query  524  LYAHSQRQFYRDCYITGTVDFIFGNAAAVI  613
            LY HS RQFYR+C I GTVDFIFGN+A VI
Sbjct  399  LYVHSNRQFYRECNIYGTVDFIFGNSAVVI  428



>ref|XP_010501842.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Camelina 
sativa]
Length=592

 Score =   230 bits (586),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 138/182 (76%), Gaps = 2/182 (1%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
            +P+W+SA DRRLL+ S     A V    DGSG +KTVA AVA+AP+N   RYVI+IK G 
Sbjct  261  WPTWLSAGDRRLLQGSGVRADATVAA--DGSGTFKTVASAVAAAPENSNKRYVIHIKAGV  318

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            Y+ENV++ KKK N+M +GDG + TIITG+ N VDG+TTF+SATVAAVG+ F+A+D+  QN
Sbjct  319  YRENVDVSKKKKNIMFMGDGRTRTIITGNRNVVDGSTTFHSATVAAVGERFLARDITFQN  378

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
            TAGP KHQAVALR+G+D S    C + AYQDTLY HS RQF+  C I GTVDFIFGNAA 
Sbjct  379  TAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCLIAGTVDFIFGNAAV  438

Query  608  VI  613
            V+
Sbjct  439  VL  440



>ref|XP_010546740.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 22 
[Tarenaya hassleriana]
Length=570

 Score =   229 bits (584),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 138/181 (76%), Gaps = 0/181 (0%)
 Frame = +2

Query  71   PSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTY  250
            P W+S  D  L++A    +  N VVA+DGSGKY+T+ EA+  AP++  TRYVIY+KKG Y
Sbjct  246  PEWLSELDESLVQADPRGMNMNAVVAQDGSGKYRTITEAIDEAPNHSNTRYVIYVKKGVY  305

Query  251  KENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNT  430
            KEN+++ KKKTN+M++GDG+  TIITG  N++ G TTF +ATVA  G GFIA+D+  +N 
Sbjct  306  KENIDMKKKKTNIMMVGDGIGQTIITGDRNFLQGLTTFRTATVAVSGKGFIARDITFRNM  365

Query  431  AGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAV  610
            AGP+ HQAVALR+ +DQS   RC ++ YQDTLYAHS RQFYR+C I GT+DFIFGN AAV
Sbjct  366  AGPKNHQAVALRVDSDQSAFFRCSMEGYQDTLYAHSLRQFYRECEIYGTIDFIFGNGAAV  425

Query  611  I  613
            +
Sbjct  426  L  426



>ref|XP_008803383.1| PREDICTED: pectinesterase [Phoenix dactylifera]
Length=532

 Score =   228 bits (581),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 136/182 (75%), Gaps = 1/182 (1%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
            FP+W+SA DRRLL+A A   A  VV  +DGSG+Y TV  AV +AP     RYVI++K+G 
Sbjct  198  FPAWLSAGDRRLLQAPAGVAADAVVA-QDGSGQYTTVGAAVEAAPTESTKRYVIHVKRGV  256

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            YKENVEI KKK N+ML+GDG+  +II+ S N+VDG TT+ SAT A  G GFIA+DL I+N
Sbjct  257  YKENVEIKKKKWNIMLVGDGMGQSIISASRNFVDGWTTYRSATFAVSGKGFIARDLTIEN  316

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
            TAGP KHQAVALR  +D SV  R     YQDTLYAHS RQFYRDC ITGTVDF+FGNAAA
Sbjct  317  TAGPSKHQAVALRSDSDLSVYYRSSFLGYQDTLYAHSLRQFYRDCLITGTVDFVFGNAAA  376

Query  608  VI  613
            V 
Sbjct  377  VF  378



>ref|XP_010047423.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=578

 Score =   229 bits (583),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 136/183 (74%), Gaps = 2/183 (1%)
 Frame = +2

Query  65   EFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKG  244
             +P W+S  DRRLL+++       V    DG+G Y+TV+ AVA+AP+    RYVI IK G
Sbjct  247  RWPEWLSVGDRRLLQSTTVTPDVTVAA--DGTGDYRTVSAAVAAAPEGSARRYVIKIKAG  304

Query  245  TYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQ  424
             YKENVE+ KKK N+M +GD  + TIITGS N VDG+TTF+SATVA VG+GF+A+D+  Q
Sbjct  305  VYKENVEVPKKKVNLMFVGDDRTTTIITGSRNVVDGSTTFHSATVAVVGEGFLARDITFQ  364

Query  425  NTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAA  604
            NTAGP KHQAVALR+GAD S  +RC + AYQDTLY HS RQFY  C + GTVDFIFGNAA
Sbjct  365  NTAGPSKHQAVALRVGADFSAFHRCDMLAYQDTLYVHSLRQFYVGCLVAGTVDFIFGNAA  424

Query  605  AVI  613
            AV+
Sbjct  425  AVL  427



>ref|XP_010067063.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 46 
[Eucalyptus grandis]
Length=582

 Score =   229 bits (584),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 134/181 (74%), Gaps = 0/181 (0%)
 Frame = +2

Query  71   PSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTY  250
            P WV   DR LL++S     AN VVAKDGSGKYKT+  A+ + PD  K  ++IY+KKG Y
Sbjct  254  PKWVHRKDRELLQSSDLRKKANAVVAKDGSGKYKTIGAALKAVPDKSKKTFIIYVKKGVY  313

Query  251  KENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNT  430
             ENV + K K NV+++GDG+ AT++TGSLN VDG  TF SAT A  G GF+A+++  +NT
Sbjct  314  SENVRVEKSKWNVVMVGDGMDATVVTGSLNVVDGTPTFQSATFAVFGKGFVAREMGFRNT  373

Query  431  AGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAV  610
            AGP KHQAVAL   ADQS+  RC++DA+QDTLYAHS RQFYRDC I GTVDFIFGN+A V
Sbjct  374  AGPAKHQAVALMSTADQSIFYRCRMDAFQDTLYAHSNRQFYRDCNIYGTVDFIFGNSAVV  433

Query  611  I  613
             
Sbjct  434  F  434



>gb|AFK36090.1| unknown [Medicago truncatula]
Length=451

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/204 (58%), Positives = 143/204 (70%), Gaps = 3/204 (1%)
 Frame = +2

Query  5    LAVLVAVAPSTEDDLRALNGE-FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            +A L+    S  DD  A N + FPSW+   D +LL+A+     A V    DGSG Y  V 
Sbjct  163  VANLLGEVVSGNDDQLATNKDRFPSWIRDEDTKLLQANGVTADAVVAA--DGSGDYAKVM  220

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            +AV++AP+    RYVIY+KKG Y ENVEI KKK N+MLIG+G+ ATII+GS NYVDG+TT
Sbjct  221  DAVSAAPEGSMKRYVIYVKKGVYVENVEIKKKKWNIMLIGEGMDATIISGSRNYVDGSTT  280

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            F SAT A  G GFIA+D+  QNTAG EKHQAVALR  +D SV  RC I  YQD+LY H+ 
Sbjct  281  FRSATFAVSGRGFIARDISFQNTAGAEKHQAVALRSDSDLSVFYRCGIFGYQDSLYTHTM  340

Query  542  RQFYRDCYITGTVDFIFGNAAAVI  613
            RQFYR+C I+GTVDFIFG+A AV 
Sbjct  341  RQFYRECKISGTVDFIFGDATAVF  364



>ref|XP_007011069.1| Root hair specific 12 [Theobroma cacao]
 gb|EOY19879.1| Root hair specific 12 [Theobroma cacao]
Length=603

 Score =   229 bits (584),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/211 (55%), Positives = 150/211 (71%), Gaps = 7/211 (3%)
 Frame = +2

Query  2    SLAVLVAVAP-STEDDLRAL-----NGEFPSWVSASDRRLLEASanavaan-vvvaKDGS  160
            SLA++  ++  ++  +LR L     N E P W    DR+LL++S        ++VAKDGS
Sbjct  245  SLAIITWISKVASVLNLRRLMSSSPNHEEPEWFHVKDRKLLQSSDLLKKKADIIVAKDGS  304

Query  161  GKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLN  340
            GKYKT++ A+ + PD  K R VIY+KKG Y ENV + KKK NV +IGDG+ +T+++GSLN
Sbjct  305  GKYKTISAALKAVPDKSKKRIVIYVKKGVYSENVSVEKKKWNVTMIGDGMESTVVSGSLN  364

Query  341  YVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQD  520
            YVDG  TF++AT A  G GF+A+D+   NTAGP+KHQAVAL   ADQSV  RC+ +A+QD
Sbjct  365  YVDGTPTFSTATFAVFGKGFVARDIGFVNTAGPQKHQAVALMSTADQSVFYRCRFEAFQD  424

Query  521  TLYAHSQRQFYRDCYITGTVDFIFGNAAAVI  613
            TLYAHS RQFYR+C I GTVDFIFGN+A V 
Sbjct  425  TLYAHSNRQFYRECNIIGTVDFIFGNSAVVF  455



>gb|KHN26433.1| Putative pectinesterase/pectinesterase inhibitor 24 [Glycine 
soja]
Length=560

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/210 (55%), Positives = 150/210 (71%), Gaps = 6/210 (3%)
 Frame = +2

Query  2    SLAVLVAVAPS-TEDDLRAL-----NGEFPSWVSASDRRLLEASanavaanvvvaKDGSG  163
            SLA++  ++ + T  +LR L       E P W+ + DR+LL        A++VVAKDGSG
Sbjct  204  SLAIITWISKAATTLNLRRLLSLPHQNEAPEWLHSKDRKLLLTEDLREKAHIVVAKDGSG  263

Query  164  KYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNY  343
            KYK +++A+   P+N   R VIY+K+G Y ENV + K K NVM+IGDG+++TI++GS N+
Sbjct  264  KYKKISDALKHVPNNSNKRTVIYVKRGVYYENVRVEKTKWNVMIIGDGMTSTIVSGSRNF  323

Query  344  VDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDT  523
            VDG  TF++AT A  G  FIA+D+  +NTAGP+KHQAVAL   ADQ+V  RC IDAYQDT
Sbjct  324  VDGTPTFSTATFAVFGRNFIARDMGFRNTAGPQKHQAVALMTSADQAVYYRCHIDAYQDT  383

Query  524  LYAHSQRQFYRDCYITGTVDFIFGNAAAVI  613
            LYAHS RQFYR+C I GTVDFIFGN+A VI
Sbjct  384  LYAHSNRQFYRECNIYGTVDFIFGNSAVVI  413



>gb|AFW03480.1| pectin methylesterase 1 [Gossypium hirsutum]
Length=582

 Score =   229 bits (583),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 136/182 (75%), Gaps = 2/182 (1%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
            +P W+SA DRRLL++S+      V    DGSG +KTV+EAVA AP+    RY I IK G 
Sbjct  251  WPEWLSAGDRRLLQSSSVTPNVVVAA--DGSGNFKTVSEAVAKAPEKSSKRYTIRIKAGV  308

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            Y+ENVE+ KKK+++M IGDG + TIITGS N VDG+TTF+SATVA VG+ F+A+++  QN
Sbjct  309  YRENVEVPKKKSSIMFIGDGRTKTIITGSRNVVDGSTTFHSATVAVVGEKFLAREITFQN  368

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
            TAGP KHQAVALR+G+D S    C + AYQDTLY HS RQFY +C + GTVDFIFGNAAA
Sbjct  369  TAGPSKHQAVALRVGSDLSAFYNCDMLAYQDTLYVHSNRQFYVNCLVAGTVDFIFGNAAA  428

Query  608  VI  613
            V 
Sbjct  429  VF  430



>ref|XP_006412775.1| hypothetical protein EUTSA_v10026924mg, partial [Eutrema salsugineum]
 gb|ESQ54228.1| hypothetical protein EUTSA_v10026924mg, partial [Eutrema salsugineum]
Length=370

 Score =   223 bits (568),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 150/199 (75%), Gaps = 2/199 (1%)
 Frame = +2

Query  23   VAPSTEDDLRALNGEFPSWVSASDRRLL--EASanavaanvvvaKDGSGKYKTVAEAVAS  196
            V PS+   L+ +  +FP+W+S  D++LL    S     A+V+VAKDG+GK+KTV EAVA+
Sbjct  17   VLPSSTSMLKMVVDDFPTWLSDVDKKLLLDSTSELKKNADVIVAKDGTGKFKTVKEAVAA  76

Query  197  APDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSAT  376
            AP+N KTRYVIY+K G Y E V I K+KTN+ ++GDG  +T++TGSLN  DG TT  SAT
Sbjct  77   APENSKTRYVIYVKLGIYDEVVNITKEKTNLTIVGDGRDSTVLTGSLNAKDGYTTLASAT  136

Query  377  VAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYR  556
            +A    GF+AQDL I+NTAGP K QAVALR+ AD  VI+RC+I+A+QDTLYA+  RQ+YR
Sbjct  137  LAVDAIGFLAQDLCIRNTAGPAKGQAVALRVSADLVVIHRCRIEAFQDTLYAYKYRQYYR  196

Query  557  DCYITGTVDFIFGNAAAVI  613
            +CYITGTVDFI G+A AV 
Sbjct  197  ECYITGTVDFICGDATAVF  215



>ref|XP_010056336.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = +2

Query  65   EFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAV-ASAPDNGKTRYVIYIKK  241
            +FP+WV  SDR+LL++S+    AN+VVA+D SG YKT++EA+ A++   G  RY+IYIK 
Sbjct  181  KFPTWVRPSDRKLLQSSSAVSKANIVVARDSSGNYKTISEAITAASKRTGTARYIIYIKA  240

Query  242  GTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRI  421
            GTY EN+E+G K  N+M IGDG+  TIITGS +   G+TTFNSATVA VGDGFIAQD+  
Sbjct  241  GTYNENIEVGSKLDNIMFIGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDGFIAQDITF  300

Query  422  QNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNA  601
            +NTAG   HQAVALR G+D SV  RC  + YQDTLY HS+RQFYR+C I GTVDFIFGNA
Sbjct  301  RNTAGAANHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSERQFYRECDIYGTVDFIFGNA  360

Query  602  AAVI  613
            A V 
Sbjct  361  AVVF  364



>ref|XP_006828609.1| hypothetical protein AMTR_s00129p00068690 [Amborella trichopoda]
 gb|ERM96025.1| hypothetical protein AMTR_s00129p00068690 [Amborella trichopoda]
Length=583

 Score =   229 bits (583),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/212 (53%), Positives = 146/212 (69%), Gaps = 8/212 (4%)
 Frame = +2

Query  2    SLAVLVAVA--------PSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDG  157
            SLA+L  +         P+    L   +G+FPSW+++ DRRLL++     AA+ VV KDG
Sbjct  225  SLAILAGITNVLGSLNIPTHRRLLGHFSGDFPSWITSKDRRLLQSFDPRDAADFVVVKDG  284

Query  158  SGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSL  337
            SGKYK ++ A+ + P   K R VIY+K+G Y ENV + K K NVM++GDG+++TI+TG L
Sbjct  285  SGKYKNISAAIKAVPKQSKKRIVIYVKQGRYVENVVLDKDKWNVMIVGDGMNSTIVTGGL  344

Query  338  NYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQ  517
            N +DG  TFN+AT+A  G GFI  D+  QN AGPEKHQAVAL + ADQ+V  RC  D YQ
Sbjct  345  NVIDGTPTFNTATLAVFGKGFIGMDIGFQNIAGPEKHQAVALMVSADQTVCYRCLADGYQ  404

Query  518  DTLYAHSQRQFYRDCYITGTVDFIFGNAAAVI  613
            DTLY H  RQFY++C I+GTVDFIFGN+A V 
Sbjct  405  DTLYVHKLRQFYKNCTISGTVDFIFGNSAVVF  436



>gb|EYU21270.1| hypothetical protein MIMGU_mgv1a003278mg [Erythranthe guttata]
Length=594

 Score =   229 bits (583),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 135/184 (73%), Gaps = 2/184 (1%)
 Frame = +2

Query  62   GEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKK  241
            G +P W+S+ DRRLL++S       V    DGSG ++TV+ AVA+AP+    RYVI IK 
Sbjct  261  GGWPEWLSSGDRRLLQSSTVTPDVVVAA--DGSGDHRTVSAAVAAAPEKSNRRYVIRIKA  318

Query  242  GTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRI  421
            G Y+ENV++GKKKTN+M +GDG S TIITGS N  DG+TTFNSATVA VG+ F+A+D+  
Sbjct  319  GVYRENVDVGKKKTNIMFVGDGRSTTIITGSKNVQDGSTTFNSATVAVVGEKFLARDITF  378

Query  422  QNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNA  601
            QNTAGP KHQAVALR+G+D S   RC I AYQDTLY HS R F+  C I GTVDFIFGN 
Sbjct  379  QNTAGPTKHQAVALRVGSDLSAFYRCDILAYQDTLYVHSNRHFFVQCLIAGTVDFIFGNG  438

Query  602  AAVI  613
            A V+
Sbjct  439  ATVL  442



>ref|XP_008812473.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=515

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 143/190 (75%), Gaps = 6/190 (3%)
 Frame = +2

Query  50   RALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAP--DNGKTRY  223
            R L+G FP+W+SA+DR+LL +S       V   KDGSG YKT++EA+A+A    NG++R+
Sbjct  178  RLLSGGFPNWLSAADRKLLHSSTINADLVVA--KDGSGNYKTISEAIAAATKQSNGRSRF  235

Query  224  VIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFI  403
            VI++K G Y ENV+   K  N+M++GDG++AT++TGS N  DG+TTF SAT A  GDGFI
Sbjct  236  VIHVKAGVYNENVQTPMK--NLMIVGDGMNATVVTGSRNVQDGSTTFRSATFAVTGDGFI  293

Query  404  AQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVD  583
            A+D+  QNTAGP KHQAVALR G+D SV  RC  + YQDTLY +SQRQFYR+C + GTVD
Sbjct  294  ARDMTFQNTAGPHKHQAVALRSGSDLSVFYRCSFEGYQDTLYIYSQRQFYRNCDVYGTVD  353

Query  584  FIFGNAAAVI  613
            FIFG+AA V+
Sbjct  354  FIFGDAAVVL  363



>ref|XP_007145198.1| hypothetical protein PHAVU_007G218500g [Phaseolus vulgaris]
 gb|ESW17192.1| hypothetical protein PHAVU_007G218500g [Phaseolus vulgaris]
Length=553

 Score =   228 bits (580),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 138/182 (76%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
            FP WVS  DR+LL+AS N    ++VVAKDG+G + T+ EA+A AP++  TR+VI+IK+G 
Sbjct  219  FPLWVSPKDRKLLQASVNESKFDLVVAKDGTGNFTTIGEALALAPNSSTTRFVIHIKEGA  278

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            Y ENVE+ +KKTN+M +GDG+  T++ GS N VDG TTF SATVA +G+GFIA+ +  +N
Sbjct  279  YFENVEVIRKKTNLMFVGDGIGKTVVKGSRNVVDGWTTFQSATVAVLGEGFIAKGITFEN  338

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
            +AGPEKHQAVALR GAD S   RC    YQDTLY HS RQFYR+C I GTVDFIFGNAA 
Sbjct  339  SAGPEKHQAVALRSGADFSAFFRCSFVGYQDTLYVHSLRQFYRECDIYGTVDFIFGNAAV  398

Query  608  VI  613
            V 
Sbjct  399  VF  400



>ref|XP_003526361.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 24-like 
[Glycine max]
Length=575

 Score =   228 bits (582),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/210 (55%), Positives = 150/210 (71%), Gaps = 6/210 (3%)
 Frame = +2

Query  2    SLAVLVAVAPS-TEDDLRAL-----NGEFPSWVSASDRRLLEASanavaanvvvaKDGSG  163
            SLA++  ++ + T  +LR L       E P W+ + DR+LL        A++VVAKDGSG
Sbjct  219  SLAIITWISKAATTLNLRRLLSLPHQNEAPEWLHSKDRKLLLTEDLREKAHIVVAKDGSG  278

Query  164  KYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNY  343
            KYK +++A+   P+N   R VIY+K+G Y ENV + K K NVM+IGDG+++TI++GS N+
Sbjct  279  KYKKISDALKHVPNNSNKRTVIYVKRGVYYENVRVEKTKWNVMIIGDGMTSTIVSGSRNF  338

Query  344  VDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDT  523
            VDG  TF++AT A  G  FIA+D+  +NTAGP+KHQAVAL   ADQ+V  RC IDAYQDT
Sbjct  339  VDGTPTFSTATFAVFGRNFIARDMGFRNTAGPQKHQAVALMTSADQAVYYRCHIDAYQDT  398

Query  524  LYAHSQRQFYRDCYITGTVDFIFGNAAAVI  613
            LYAHS RQFYR+C I GTVDFIFGN+A VI
Sbjct  399  LYAHSNRQFYRECNIYGTVDFIFGNSAVVI  428



>gb|ABZ89800.1| pectin methylesterase-like protein [Taiwania cryptomerioides]
Length=584

 Score =   228 bits (582),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 138/182 (76%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
            FPSW+SA DRRLL+  A  + AN VVAKDGSG Y T++ AVA+AP+   +RYVI+IKKG 
Sbjct  250  FPSWMSAGDRRLLQTPAQNINANAVVAKDGSGSYTTISAAVAAAPEKSTSRYVIHIKKGV  309

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            Y+ENV+I K K N+M IGDG   T++T + N VDG TTF+SAT A  G GF+A+D+  +N
Sbjct  310  YQENVDIPKNKHNLMFIGDGKDVTVVTANRNVVDGYTTFHSATAAVTGKGFVARDMTFKN  369

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
            TAGP KHQAVALR+G+D S   RC  + YQDTLY HS RQFYR+C + GTVDF+FGNAA 
Sbjct  370  TAGPTKHQAVALRVGSDLSAFLRCTFEGYQDTLYVHSLRQFYRECDVYGTVDFVFGNAAV  429

Query  608  VI  613
            V+
Sbjct  430  VL  431



>ref|XP_007154532.1| hypothetical protein PHAVU_003G126500g [Phaseolus vulgaris]
 gb|ESW26526.1| hypothetical protein PHAVU_003G126500g [Phaseolus vulgaris]
Length=513

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 145/201 (72%), Gaps = 3/201 (1%)
 Frame = +2

Query  11   VLVAVAPSTEDDLRALNGEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAV  190
            +L  V P  +D+  A  G+ PSWV   +R+LL++S  +  A V +  DGSG Y T+ +AV
Sbjct  162  LLAQVVP-VDDEFDASKGQIPSWVKPRERKLLQSSGVSPDAVVAL--DGSGNYGTIMDAV  218

Query  191  ASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNS  370
             +APD    R+VIYIKKG Y ENVEI KKK N+M++GDG+ AT+I+G+ +Y+DG TTF S
Sbjct  219  LAAPDYSMKRFVIYIKKGVYVENVEIKKKKWNIMMVGDGMDATVISGNRSYIDGWTTFRS  278

Query  371  ATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQF  550
            +T A  G GFIA+D+  QNTAGPEKHQAVALR  +D SV  RC I  +QD+LY H+ RQF
Sbjct  279  STFAVSGRGFIARDISFQNTAGPEKHQAVALRSDSDLSVFYRCGILGFQDSLYTHTMRQF  338

Query  551  YRDCYITGTVDFIFGNAAAVI  613
            +R+C ITGTVDFIFG+A A+ 
Sbjct  339  FRECRITGTVDFIFGDATAMF  359



>ref|XP_010056338.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   227 bits (578),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = +2

Query  65   EFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAV-ASAPDNGKTRYVIYIKK  241
            +FP+WV  SDR+LL++S+    AN+VVA+DGSG YKT++EA+ A++   G  RY+IYIK 
Sbjct  181  KFPTWVRPSDRKLLQSSSAVSKANIVVARDGSGNYKTISEAITAASKQTGAARYIIYIKA  240

Query  242  GTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRI  421
            GTY EN+E+G K  N+M +GDG+  TIITGS +   G+TTF SATVA VGDGF+AQD+  
Sbjct  241  GTYNENIEVGSKLDNIMFVGDGIGKTIITGSKSVGGGSTTFKSATVAVVGDGFVAQDITF  300

Query  422  QNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNA  601
            +NTAG   HQAVALR G+D SV  RC  + YQDTLY HS+RQFYR+C I GTVDFIFGNA
Sbjct  301  RNTAGAANHQAVALRSGSDLSVFYRCSFEGYQDTLYVHSERQFYRECDIYGTVDFIFGNA  360

Query  602  AAVI  613
            A V 
Sbjct  361  AVVF  364



>ref|XP_006828586.1| hypothetical protein AMTR_s00129p00044320 [Amborella trichopoda]
 gb|ERM96002.1| hypothetical protein AMTR_s00129p00044320 [Amborella trichopoda]
Length=564

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 140/182 (77%), Gaps = 2/182 (1%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
            FP+W+SA DRRLL++S+      V    DGSG +KTVA AVA+AP+    RYVI IK G 
Sbjct  233  FPAWMSAGDRRLLQSSSVTPNVVVAA--DGSGDFKTVAAAVAAAPEKSSKRYVIRIKAGV  290

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            Y+ENVE+ KKKTN+M +GDG   TIITGS N  DG+TTF SATVAAVG+ F+A+D+  QN
Sbjct  291  YRENVEVPKKKTNIMFLGDGRMKTIITGSKNVKDGSTTFRSATVAAVGERFLARDITFQN  350

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
            TAGP KHQAVALR+G+D S   RC + AYQDTLY HS RQFYR+C+I GTVDFIFGNAAA
Sbjct  351  TAGPSKHQAVALRVGSDFSAFYRCDMIAYQDTLYVHSLRQFYRECFIYGTVDFIFGNAAA  410

Query  608  VI  613
            V+
Sbjct  411  VL  412



>gb|KHN15840.1| Pectinesterase/pectinesterase inhibitor U1 [Glycine soja]
Length=362

 Score =   222 bits (566),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/183 (60%), Positives = 131/183 (72%), Gaps = 2/183 (1%)
 Frame = +2

Query  65   EFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKG  244
            E+P W+SA+DRRLLEA+       V    DGSG +KTV EAV +AP     RYVI IK G
Sbjct  30   EWPEWISAADRRLLEAATVKADVTVAA--DGSGDFKTVTEAVKAAPLKSSKRYVIRIKGG  87

Query  245  TYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQ  424
             Y+ENVE+ KKKTN+M +GDG + TIIT S N VDG+TTF+SATVA VG  F+A+D+  Q
Sbjct  88   VYRENVEVDKKKTNIMFLGDGRTNTIITASRNVVDGSTTFHSATVAVVGANFLARDITFQ  147

Query  425  NTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAA  604
            NTAGP KHQAVALR+G D S    C   A+QDTLY H+ RQF+  C ITGTVDFIFGN+A
Sbjct  148  NTAGPSKHQAVALRVGGDLSAFFNCDFLAFQDTLYVHNNRQFFVKCLITGTVDFIFGNSA  207

Query  605  AVI  613
             V 
Sbjct  208  VVF  210



>ref|XP_010101977.1| putative pectinesterase/pectinesterase inhibitor 6 [Morus notabilis]
 gb|EXB90901.1| putative pectinesterase/pectinesterase inhibitor 6 [Morus notabilis]
Length=514

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/213 (55%), Positives = 149/213 (70%), Gaps = 9/213 (4%)
 Frame = +2

Query  2    SLAVLVAVAPSTEDDL-------RALNGEFPSWVSASDRRLLEASanavaanvvvaKDGS  160
            SLA+  A  PST           R L+  FP WVSA+DR+LL++   A  A++VVA+DGS
Sbjct  150  SLAINKATIPSTATSFSKQVRSRRLLSDGFPEWVSAADRKLLQSGGAAAKADIVVAQDGS  209

Query  161  GKYKTVAEAVASAPD--NGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGS  334
            G +KT++EAV +A +   G  R V+Y+K G YKENVEI     N+M +GDG+ ATI+TG+
Sbjct  210  GGFKTISEAVEAAKNLGGGSKRIVVYVKAGVYKENVEIKNDIKNLMFVGDGIDATIVTGN  269

Query  335  LNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAY  514
             N VDG+TTF SAT    GDGFIAQD+  +NTAGP KHQAVALR G+D SV +RC    Y
Sbjct  270  RNNVDGSTTFQSATFGVSGDGFIAQDMTFENTAGPAKHQAVALRSGSDHSVFHRCSFKGY  329

Query  515  QDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVI  613
            QDTLY +SQRQFYRDC + GTVDFI G+A A++
Sbjct  330  QDTLYVYSQRQFYRDCNVYGTVDFICGDAVAIL  362



>ref|XP_010932330.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=537

 Score =   227 bits (578),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 134/182 (74%), Gaps = 1/182 (1%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
            FP WVS  DRRLL+A A   A  VV  KDGSGKY TV  AVA+AP     RYVIY+KKG 
Sbjct  203  FPGWVSLGDRRLLQAPAGTAADAVVA-KDGSGKYTTVGAAVAAAPTESTKRYVIYVKKGA  261

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            YKENVEI KK  N+ML+GDGL  TII+GS N+VDG TT+ SAT A  G GFI +DL I+N
Sbjct  262  YKENVEIKKKTWNIMLVGDGLGQTIISGSRNFVDGWTTYRSATFAVSGKGFIVRDLTIEN  321

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
            TAGP KHQAVALR  +D SV  RC    YQDTLYAHS RQFYR+C I GTVDF+FG+AAA
Sbjct  322  TAGPSKHQAVALRSDSDLSVYYRCSFLGYQDTLYAHSLRQFYRECRIAGTVDFVFGDAAA  381

Query  608  VI  613
            V 
Sbjct  382  VF  383



>emb|CDX98441.1| BnaC05g39340D [Brassica napus]
Length=572

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 137/182 (75%), Gaps = 2/182 (1%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
            +P+W+SA DRRLL+ S     A V    DGSG + T++ AVA+AP+N   RYVI+IK G 
Sbjct  241  WPTWLSAGDRRLLQGSTVKADATVAA--DGSGTFTTISAAVAAAPENSNKRYVIHIKAGV  298

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            Y+ENV++ KKK N+M +GDG + TIIT S N VDG+TTF+SATVAAVG+ F+A+D+  QN
Sbjct  299  YRENVDVAKKKKNIMFMGDGRTTTIITASRNVVDGSTTFHSATVAAVGERFLARDITFQN  358

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
            TAGP KHQAVALR+G+D S   +C + AYQDTLY HS RQF+  C I GTVDFIFGNAA 
Sbjct  359  TAGPSKHQAVALRVGSDFSAFYQCDMLAYQDTLYVHSNRQFFVKCLIAGTVDFIFGNAAV  418

Query  608  VI  613
            VI
Sbjct  419  VI  420



>ref|XP_006426799.1| hypothetical protein CICLE_v10025232mg [Citrus clementina]
 gb|ESR40039.1| hypothetical protein CICLE_v10025232mg [Citrus clementina]
 gb|KDO53766.1| hypothetical protein CISIN_1g007830mg [Citrus sinensis]
Length=588

 Score =   228 bits (581),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 134/182 (74%), Gaps = 2/182 (1%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
            FP+WV A DRRLL+ +     A V   +DGSG Y T+  AVA+      TR+VIY+KKGT
Sbjct  260  FPNWVGAGDRRLLQEANPKPDATVA--QDGSGDYDTIKAAVAAVRKKSPTRFVIYVKKGT  317

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            Y+ENV + K + NVM+ GDG + TI++GSLN+VDG  TF +ATVA  G GFIA+D+   N
Sbjct  318  YRENVILDKSRWNVMMYGDGKTMTIVSGSLNFVDGTPTFATATVAVAGRGFIAKDMTFIN  377

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
            TAGPEKHQAVA R G+D+SV  RC  +AYQDTLYAHS RQFYRDC ITGT+DFIFGNAA 
Sbjct  378  TAGPEKHQAVAFRSGSDRSVFYRCSFNAYQDTLYAHSNRQFYRDCDITGTIDFIFGNAAV  437

Query  608  VI  613
            V 
Sbjct  438  VF  439



>ref|XP_011031815.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=580

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/183 (60%), Positives = 135/183 (74%), Gaps = 2/183 (1%)
 Frame = +2

Query  65   EFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKG  244
            E+P W+S +DRRLL++S+      V    DGSG YKTV+ AVA+AP     RY+I IK G
Sbjct  248  EWPEWMSVADRRLLQSSSVTPDVVVAA--DGSGNYKTVSAAVAAAPKKSSKRYIIRIKAG  305

Query  245  TYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQ  424
             Y+ENV++ K KTN+M +GDG   TIIT S N VDG+TTFNSATVAAVG GF+A+ +  Q
Sbjct  306  VYRENVDVPKDKTNIMFMGDGRKTTIITASRNVVDGSTTFNSATVAAVGQGFLARGITFQ  365

Query  425  NTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAA  604
            NTAGP KHQAVALR+G+D S    C + AYQDTLY HS RQF+ +C+I GTVDFIFGNAA
Sbjct  366  NTAGPSKHQAVALRVGSDLSAFYDCDMLAYQDTLYVHSNRQFFINCFIAGTVDFIFGNAA  425

Query  605  AVI  613
             V+
Sbjct  426  VVL  428



>gb|KFK33850.1| hypothetical protein AALP_AA5G068300 [Arabis alpina]
Length=527

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 137/183 (75%), Gaps = 0/183 (0%)
 Frame = +2

Query  65   EFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKG  244
            +FPSWV   DR+LL+       A+ VVA DG+G + T++EAV +APD    RYVI++KKG
Sbjct  191  KFPSWVRPGDRKLLQTDGLPTPADAVVAADGTGNFMTISEAVLAAPDYSTKRYVIHVKKG  250

Query  245  TYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQ  424
             Y ENVEI KKK N+M++GDG+ AT+ITG+ +++DG TTF SAT A  G GFIA+D+  Q
Sbjct  251  VYVENVEIKKKKWNIMMVGDGIDATVITGNRSFIDGWTTFRSATFAVSGRGFIARDITFQ  310

Query  425  NTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAA  604
            NTAGPEKHQAVA+R  +D  V  RC +  YQDTLYAH+ RQF+R+C ITGTVDFIFG+A 
Sbjct  311  NTAGPEKHQAVAIRSDSDLGVFYRCAMRGYQDTLYAHTMRQFFRECIITGTVDFIFGDAT  370

Query  605  AVI  613
            AV 
Sbjct  371  AVF  373



>ref|NP_172604.1| putative pectinesterase 56 [Arabidopsis thaliana]
 sp|Q4PT34.1|PME56_ARATH RecName: Full=Probable pectinesterase 56; Short=PE 56; AltName: 
Full=Pectin methylesterase 56; Short=AtPME56; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAY78609.1| pectinesterase family protein [Arabidopsis thaliana]
 gb|AEE28727.1| putative pectinesterase 56 [Arabidopsis thaliana]
Length=288

 Score =   219 bits (559),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = +2

Query  149  KDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIIT  328
            KDGSG + TV EAVA+AP+NG   +VIYIK+G YKE + IGKKKTN+ L+GDG   T+++
Sbjct  50   KDGSGNFTTVNEAVAAAPENGVKPFVIYIKEGLYKEVIRIGKKKTNLTLVGDGRDLTVLS  109

Query  329  GSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKID  508
            G LN VDG  TF+SAT+A    GF+AQDL I+NTAGPEK QAVALR+  D ++I RC+ID
Sbjct  110  GDLNGVDGIKTFDSATLAVDESGFMAQDLCIRNTAGPEKRQAVALRISTDMTIIYRCRID  169

Query  509  AYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVI  613
            AYQDTLYA+S RQFYRDCYITGTVDFIFG AAAV 
Sbjct  170  AYQDTLYAYSGRQFYRDCYITGTVDFIFGRAAAVF  204



>emb|CDX76371.1| BnaA08g10290D [Brassica napus]
Length=339

 Score =   221 bits (563),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = +2

Query  149  KDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIIT  328
            KDGSGK+ TV EAVASAP+N KTRY I +K+GTY ENV IGK KTN+ ++G+G + T IT
Sbjct  32   KDGSGKFTTVKEAVASAPENSKTRYTILVKRGTYLENVIIGKNKTNLTILGEGSNLTTIT  91

Query  329  GSLNYVDGATTFNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKID  508
            GS N+VDG  T++SAT+A  G+GF+AQD+ I+NTAGP K QAVALR+ AD++VI RC+ID
Sbjct  92   GSWNHVDGKGTYDSATLAVDGEGFMAQDICIENTAGPTKEQAVALRVSADKAVIYRCRID  151

Query  509  AYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAAVI  613
            AYQDTLYAH +RQFYR+CYITGTVDFI G A AV 
Sbjct  152  AYQDTLYAHIERQFYRECYITGTVDFICGEATAVF  186



>gb|KHN35618.1| Pectinesterase 2 [Glycine soja]
Length=359

 Score =   222 bits (565),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 136/182 (75%), Gaps = 2/182 (1%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
            FP WV   DR+LL++S+ A  ANVVVAKDGSGKY TV+ AV SAP N + RYVIY+K G 
Sbjct  29   FPKWVKPGDRKLLQSSSPASRANVVVAKDGSGKYTTVSAAVNSAPKNSRGRYVIYVKGGI  88

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            Y E VE+  K  N+ML+GDG+  TIITGS +   G TTF SATVA VGDGFIAQ +  +N
Sbjct  89   YNEQVEV--KSKNIMLVGDGIGKTIITGSKSVGGGTTTFRSATVAVVGDGFIAQGITFRN  146

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
            TAG + HQAVALR G+D SV  +C  + YQDTLY HS+RQFYR+C I GTVDFIFGNAA 
Sbjct  147  TAGAKNHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECNIYGTVDFIFGNAAV  206

Query  608  VI  613
            V+
Sbjct  207  VL  208



>gb|EPS74082.1| hypothetical protein M569_00674, partial [Genlisea aurea]
Length=502

 Score =   226 bits (575),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 134/183 (73%), Gaps = 2/183 (1%)
 Frame = +2

Query  65   EFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKG  244
             +P W+S +DR LL+A +      V    DGSG Y+T++EAV++AP N KTR+VI IK G
Sbjct  170  RWPGWLSQADRMLLQAPSVTADVTVAA--DGSGNYRTISEAVSAAPSNSKTRFVIRIKAG  227

Query  245  TYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQ  424
            TYKE V I   K N+M +GD  + TI+TG  NY+DG+TTFNSATVA VG GF+A+D+  Q
Sbjct  228  TYKEYVTIPASKQNLMFVGDSYTTTIVTGDRNYIDGSTTFNSATVAVVGTGFLARDITFQ  287

Query  425  NTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAA  604
            NTAG  KHQAVALR+ AD +   RC I AYQDTLY HS RQFY +CYI+GTVDFIFGN+A
Sbjct  288  NTAGAAKHQAVALRVNADLTAFYRCGIYAYQDTLYTHSLRQFYTNCYISGTVDFIFGNSA  347

Query  605  AVI  613
             VI
Sbjct  348  VVI  350



>ref|XP_009385286.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=576

 Score =   227 bits (579),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 140/184 (76%), Gaps = 0/184 (0%)
 Frame = +2

Query  62   GEFPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKK  241
            GEFPSWV    R+LL  S   +  +V VA+DGSGKYKT+ +A+++ P  G   +VIYIK+
Sbjct  241  GEFPSWVGNDKRKLLALSTKDIKPDVTVAQDGSGKYKTITQALSAVPKKGNATFVIYIKE  300

Query  242  GTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRI  421
            G YKENV + +  TNVM+ GDG + T ITGSLNYVDG +TF +AT+A VGDGFI ++L +
Sbjct  301  GVYKENVMVDRSMTNVMMFGDGPTKTKITGSLNYVDGTSTFKTATLAVVGDGFIGKNLGV  360

Query  422  QNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNA  601
            +NTAG  KHQAVALR+ +D+SV   C++D YQDTLY H++RQFYR+C I+GT+DF+FG+A
Sbjct  361  ENTAGAAKHQAVALRVQSDKSVFYLCQMDGYQDTLYTHTKRQFYRECTISGTIDFLFGDA  420

Query  602  AAVI  613
            A V 
Sbjct  421  AVVF  424



>ref|XP_003608136.1| Pectinesterase [Medicago truncatula]
 ref|XP_003609931.1| Pectinesterase [Medicago truncatula]
 gb|AES90333.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=518

 Score =   226 bits (576),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 118/204 (58%), Positives = 144/204 (71%), Gaps = 3/204 (1%)
 Frame = +2

Query  5    LAVLVAVAPSTEDDLRALNGE-FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVA  181
            +A L+    S  DD  A N + FPSW+   D +LL+A+     A V    DGSG Y  V 
Sbjct  163  VANLLGEVVSGNDDQLATNKDRFPSWIRDEDTKLLQANGVTADAVVAA--DGSGDYAKVM  220

Query  182  EAVASAPDNGKTRYVIYIKKGTYKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATT  361
            +AV++AP++   RYVIY+KKG Y ENVEI KKK N+MLIG+G+ ATII+GS NYVDG+TT
Sbjct  221  DAVSAAPESSMKRYVIYVKKGVYVENVEIKKKKWNIMLIGEGMDATIISGSRNYVDGSTT  280

Query  362  FNSATVAAVGDGFIAQDLRIQNTAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQ  541
            F SAT A  G GFIA+D+  QNTAG EKHQAVALR  +D SV  RC I  YQD+LY H+ 
Sbjct  281  FRSATFAVSGRGFIARDISFQNTAGAEKHQAVALRSDSDLSVFYRCGIFGYQDSLYTHTM  340

Query  542  RQFYRDCYITGTVDFIFGNAAAVI  613
            RQFYR+C I+GTVDFIFG+A AV 
Sbjct  341  RQFYRECKISGTVDFIFGDATAVF  364



>ref|XP_002455538.1| hypothetical protein SORBIDRAFT_03g012830 [Sorghum bicolor]
 gb|EES00658.1| hypothetical protein SORBIDRAFT_03g012830 [Sorghum bicolor]
Length=576

 Score =   227 bits (579),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 137/182 (75%), Gaps = 0/182 (0%)
 Frame = +2

Query  68   FPSWVSASDRRLLEASanavaanvvvaKDGSGKYKTVAEAVASAPDNGKTRYVIYIKKGT  247
            FP WV   DRRLL+A A A+ A+ VVAKDGSG Y TV+ AVA+AP N K RYVIYIK G 
Sbjct  243  FPRWVRPGDRRLLQAPATAITADAVVAKDGSGGYTTVSAAVAAAPTNSKKRYVIYIKAGA  302

Query  248  YKENVEIGKKKTNVMLIGDGLSATIITGSLNYVDGATTFNSATVAAVGDGFIAQDLRIQN  427
            Y ENVE+GKK  N+M +GDG+  T+I  S N VDG TTF SATVA VG+ F+A+DL I+N
Sbjct  303  YMENVEVGKKHVNLMFVGDGIGKTVIKASRNVVDGYTTFRSATVAVVGNNFLARDLTIEN  362

Query  428  TAGPEKHQAVALRLGADQSVINRCKIDAYQDTLYAHSQRQFYRDCYITGTVDFIFGNAAA  607
            +AGP KHQAVALR+GAD S   RC    YQDTLY HS RQF+RDC I GT+DF+FGNAA 
Sbjct  363  SAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFFRDCDIYGTIDFVFGNAAV  422

Query  608  VI  613
            V+
Sbjct  423  VL  424



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 842962938660