BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS070H12

Length=416
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAC84142.3|  14-3-3 protein                                         103   5e-24   Nicotiana tabacum [American tobacco]
ref|XP_009623182.1|  PREDICTED: 14-3-3-like protein 16R                 103   6e-24   Nicotiana tomentosiformis
gb|AGJ98234.1|  PIB67 14-3-3 protein                                    103   6e-24   Petunia x hybrida [garden petunia]
emb|CDP01506.1|  unnamed protein product                                103   8e-24   Coffea canephora [robusta coffee]
emb|CDP01098.1|  unnamed protein product                                100   8e-24   Coffea canephora [robusta coffee]
gb|AIJ04691.1|  14-3-3b                                                 102   2e-23   Morus alba var. atropurpurea
ref|XP_010098629.1|  14-3-3-like protein                                102   2e-23   Morus notabilis
gb|KDO81026.1|  hypothetical protein CISIN_1g024620mg                   102   3e-23   Citrus sinensis [apfelsine]
ref|XP_006472571.1|  PREDICTED: 14-3-3-like protein-like                102   3e-23   Citrus sinensis [apfelsine]
gb|EPS73301.1|  14-3-3 h-1 protein                                      101   5e-23   Genlisea aurea
gb|AAR98782.1|  14-3-3 protein isoform 20R                              100   6e-23   Solanum tuberosum [potatoes]
gb|KDP41413.1|  hypothetical protein JCGZ_15820                         100   9e-23   Jatropha curcas
emb|CBI19195.3|  unnamed protein product                              97.8    1e-22   Vitis vinifera
ref|XP_004299669.1|  PREDICTED: 14-3-3-like protein                   99.8    2e-22   Fragaria vesca subsp. vesca
gb|EYU34581.1|  hypothetical protein MIMGU_mgv1a012286mg              99.8    2e-22   Erythranthe guttata [common monkey flower]
gb|EYU36484.1|  hypothetical protein MIMGU_mgv1a011964mg              99.8    2e-22   Erythranthe guttata [common monkey flower]
ref|NP_001275217.1|  14-3-3 protein 2-like                            99.4    3e-22   Solanum tuberosum [potatoes]
ref|XP_011097537.1|  PREDICTED: 14-3-3-like protein 16R               99.0    3e-22   Sesamum indicum [beniseed]
gb|ACD69679.1|  14-3-3                                                99.4    3e-22   Mangifera indica
gb|AAS78777.1|  14-3-3 protein                                        99.0    3e-22   Solanum chacoense
gb|EPS60562.1|  14-3-3 h-1 protein                                    99.0    3e-22   Genlisea aurea
sp|P93210.1|14335_SOLLC  RecName: Full=14-3-3 protein 5               99.0    3e-22   Solanum lycopersicum
ref|NP_001234107.1|  14-3-3 family protein                            99.0    3e-22   
gb|KHN08951.1|  14-3-3-like protein                                   98.2    4e-22   Glycine soja [wild soybean]
ref|XP_009345790.1|  PREDICTED: 14-3-3-like protein 16R               98.6    5e-22   Pyrus x bretschneideri [bai li]
gb|ABY65003.1|  14-3-3d protein                                       98.6    5e-22   Gossypium hirsutum [American cotton]
sp|Q43643.1|14332_SOLTU  RecName: Full=14-3-3-like protein RA215      98.2    6e-22   Solanum tuberosum [potatoes]
emb|CBI33141.3|  unnamed protein product                              96.3    7e-22   Vitis vinifera
gb|EYU30984.1|  hypothetical protein MIMGU_mgv1a012292mg              97.8    8e-22   Erythranthe guttata [common monkey flower]
dbj|BAD12178.1|  14-3-3 f-1 protein                                   97.8    9e-22   Nicotiana tabacum [American tobacco]
ref|XP_009589383.1|  PREDICTED: 14-3-3-like protein F                 97.8    9e-22   Nicotiana tomentosiformis
gb|ACQ45021.1|  14-3-3                                                97.8    9e-22   Cicer arietinum [garbanzo]
ref|XP_009799312.1|  PREDICTED: 14-3-3-like protein F                 97.8    1e-21   Nicotiana sylvestris
ref|XP_009380873.1|  PREDICTED: 14-3-3 protein 6-like                 97.4    1e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009757667.1|  PREDICTED: 14-3-3-like protein C                 97.4    1e-21   Nicotiana sylvestris
ref|XP_009619695.1|  PREDICTED: 14-3-3-like protein C                 97.4    1e-21   Nicotiana tomentosiformis
ref|NP_001275062.1|  14-3-3-like protein 16R                          97.4    1e-21   Solanum tuberosum [potatoes]
gb|AAT35546.1|  14-3-3 protein                                        97.4    1e-21   Tropaeolum majus
gb|KHG29578.1|  Uncharacterized protein F383_10830                    97.4    1e-21   Gossypium arboreum [tree cotton]
ref|XP_010917299.1|  PREDICTED: 14-3-3-like protein                   97.4    1e-21   Elaeis guineensis
ref|NP_001274876.1|  14-3-3-like protein RA215                        97.4    1e-21   Solanum tuberosum [potatoes]
ref|XP_003526571.1|  PREDICTED: 14-3-3-like protein-like              97.4    1e-21   
ref|XP_008782168.1|  PREDICTED: 14-3-3 protein 6-like                 97.1    2e-21   Phoenix dactylifera
ref|XP_011098686.1|  PREDICTED: 14-3-3-like protein C                 97.1    2e-21   Sesamum indicum [beniseed]
gb|KHG29579.1|  Uncharacterized protein F383_10830                    97.1    2e-21   Gossypium arboreum [tree cotton]
gb|ABR25623.1|  14-3-3-like protein a                                 93.2    2e-21   Oryza sativa Indica Group [Indian rice]
gb|AES73074.2|  general regulatory factor 2                           96.7    2e-21   Medicago truncatula
ref|XP_008387340.1|  PREDICTED: 14-3-3-like protein 16R               96.7    2e-21   
ref|XP_002262802.1|  PREDICTED: 14-3-3-like protein                   96.7    2e-21   Vitis vinifera
ref|XP_009375314.1|  PREDICTED: 14-3-3-like protein 16R               96.7    2e-21   Pyrus x bretschneideri [bai li]
ref|XP_009350360.1|  PREDICTED: 14-3-3-like protein 16R               96.7    2e-21   Pyrus x bretschneideri [bai li]
gb|KJB12306.1|  hypothetical protein B456_002G012500                  96.7    3e-21   Gossypium raimondii
gb|AEH50082.1|  14-3-3-like protein 2                                 96.7    3e-21   Gossypium hirsutum [American cotton]
gb|KHG12828.1|  Uncharacterized protein F383_00373                    96.7    3e-21   Gossypium arboreum [tree cotton]
ref|XP_003602823.1|  14-3-3-like protein                              97.1    3e-21   
ref|XP_002513956.1|  14-3-3 protein, putative                         96.3    3e-21   Ricinus communis
ref|XP_002444843.1|  hypothetical protein SORBIDRAFT_07g029110        96.3    3e-21   Sorghum bicolor [broomcorn]
ref|XP_010676024.1|  PREDICTED: 14-3-3-like protein                   96.3    3e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001234677.1|  14-3-3 protein 3                                 95.9    3e-21   
gb|AAD27823.2|  14-3-3 protein                                        96.3    3e-21   Populus tremula x Populus alba [gray poplar]
ref|NP_001275270.1|  14-3-3-like protein C-like                       96.3    4e-21   Solanum tuberosum [potatoes]
ref|XP_006423811.1|  hypothetical protein CICLE_v10029087mg           96.3    4e-21   Citrus clementina [clementine]
ref|XP_002301071.1|  14-3-3 protein 32kDa endonuclease                96.3    4e-21   Populus trichocarpa [western balsam poplar]
ref|XP_006659506.1|  PREDICTED: LOW QUALITY PROTEIN: 14-3-3-like ...  96.3    4e-21   Oryza brachyantha
ref|XP_008346360.1|  PREDICTED: 14-3-3-like protein                   96.3    4e-21   
ref|NP_001267852.1|  14-3-3 protein                                   95.9    4e-21   Vitis vinifera
ref|XP_011016779.1|  PREDICTED: 14-3-3-like protein                   95.9    4e-21   Populus euphratica
gb|KHN26095.1|  14-3-3-like protein                                   93.2    4e-21   Glycine soja [wild soybean]
sp|P93209.1|14333_SOLLC  RecName: Full=14-3-3 protein 3; AltName:...  95.9    4e-21   Solanum lycopersicum
gb|ABA81882.1|  14-3-3 protein-like                                   95.9    4e-21   Solanum tuberosum [potatoes]
ref|XP_008805904.1|  PREDICTED: 14-3-3 protein 6-like                 95.9    4e-21   Phoenix dactylifera
ref|XP_011074203.1|  PREDICTED: 14-3-3-like protein B                 95.9    4e-21   Sesamum indicum [beniseed]
gb|AFK34151.1|  unknown                                               95.9    4e-21   Medicago truncatula
ref|XP_010060042.1|  PREDICTED: 14-3-3-like protein                   95.9    5e-21   Eucalyptus grandis [rose gum]
ref|XP_007018723.1|  General regulatory factor 2, OMEGA               95.9    5e-21   Theobroma cacao [chocolate]
ref|XP_009632004.1|  PREDICTED: 14-3-3-like protein B                 95.9    5e-21   Nicotiana tomentosiformis
ref|XP_004973733.1|  PREDICTED: 14-3-3-like protein GF14-A-like       95.9    5e-21   Setaria italica
ref|XP_010937379.1|  PREDICTED: 14-3-3-like protein B                 95.9    5e-21   Elaeis guineensis
ref|XP_008219335.1|  PREDICTED: 14-3-3-like protein                   95.9    5e-21   Prunus mume [ume]
ref|XP_007223394.1|  hypothetical protein PRUPE_ppa010148mg           95.5    5e-21   Prunus persica
ref|XP_009777542.1|  PREDICTED: 14-3-3-like protein B                 95.5    6e-21   Nicotiana sylvestris
ref|XP_009381498.1|  PREDICTED: 14-3-3 protein 6-like                 95.5    6e-21   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABQ95992.1|  14-3-3-like protein                                   95.5    6e-21   Cicer arietinum [garbanzo]
sp|P42653.1|1433A_VICFA  RecName: Full=14-3-3-like protein A; Alt...  95.5    6e-21   Vicia faba [broad bean]
emb|CAB42547.1|  14-3-3-like protein                                  95.5    6e-21   Pisum sativum [garden pea]
ref|XP_008804781.1|  PREDICTED: 14-3-3 protein 6                      95.5    7e-21   Phoenix dactylifera
ref|XP_008778192.1|  PREDICTED: 14-3-3 protein 6-like                 95.5    7e-21   Phoenix dactylifera
gb|KJB58994.1|  hypothetical protein B456_009G234600                  95.5    7e-21   Gossypium raimondii
gb|ABY65001.1|  14-3-3b protein                                       95.5    7e-21   Gossypium hirsutum [American cotton]
emb|CDO97418.1|  unnamed protein product                              92.8    7e-21   Coffea canephora [robusta coffee]
gb|KHG20751.1|  Uncharacterized protein F383_04220                    95.5    7e-21   Gossypium arboreum [tree cotton]
ref|XP_008790917.1|  PREDICTED: 14-3-3 protein 6                      95.5    7e-21   Phoenix dactylifera
gb|AFK35595.1|  unknown                                               95.1    8e-21   Lotus japonicus
gb|KCW66571.1|  hypothetical protein EUGRSUZ_F00370                   95.9    8e-21   Eucalyptus grandis [rose gum]
gb|KHG14081.1|  Uncharacterized protein F383_17151                    95.1    8e-21   Gossypium arboreum [tree cotton]
ref|XP_004252529.1|  PREDICTED: 14-3-3 protein 2                      95.1    8e-21   
gb|ACF23046.1|  ST73-2                                                90.5    8e-21   Eutrema halophilum
ref|XP_010428953.1|  PREDICTED: 14-3-3-like protein GF14 omega        95.1    8e-21   Camelina sativa [gold-of-pleasure]
ref|XP_006302543.1|  hypothetical protein CARUB_v10020644mg           95.5    9e-21   
ref|NP_001234097.1|  14-3-3 protein 6                                 95.1    9e-21   Solanum lycopersicum
ref|XP_002887733.1|  GF14 omega                                       95.1    1e-20   
ref|XP_010939692.1|  PREDICTED: 14-3-3 protein 6-like                 94.7    1e-20   Elaeis guineensis
gb|EAZ43101.1|  hypothetical protein OsJ_27692                        95.1    1e-20   Oryza sativa Japonica Group [Japonica rice]
ref|NP_565176.1|  14-3-3-like protein GF14 omega                      94.7    1e-20   Arabidopsis thaliana [mouse-ear cress]
gb|AAA96253.1|  GF14omega isoform                                     94.7    1e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007141044.1|  hypothetical protein PHAVU_008G162500g           94.7    1e-20   Phaseolus vulgaris [French bean]
ref|XP_010025879.1|  PREDICTED: 14-3-3-like protein                   94.7    1e-20   Eucalyptus grandis [rose gum]
ref|XP_008386122.1|  PREDICTED: 14-3-3-like protein                   94.7    1e-20   Malus domestica [apple tree]
gb|ADP24188.1|  14-3-3-like protein                                   94.7    1e-20   Galega orientalis
ref|NP_001062060.1|  Os08g0480800                                     94.7    1e-20   
ref|XP_009373053.1|  PREDICTED: 14-3-3-like protein                   95.1    1e-20   Pyrus x bretschneideri [bai li]
gb|AFK37964.1|  unknown                                               94.4    1e-20   Medicago truncatula
ref|XP_003615160.1|  14-3-3 protein                                   94.4    2e-20   Medicago truncatula
ref|XP_007200586.1|  hypothetical protein PRUPE_ppa010141mg           94.4    2e-20   Prunus persica
ref|XP_010272995.1|  PREDICTED: LOW QUALITY PROTEIN: 14-3-3-like ...  94.7    2e-20   
emb|CDX79255.1|  BnaC06g20480D                                        94.4    2e-20   
ref|XP_009104576.1|  PREDICTED: 14-3-3-like protein GF14 omega        94.4    2e-20   Brassica rapa
sp|P46266.1|1433_PEA  RecName: Full=14-3-3-like protein               94.4    2e-20   Pisum sativum [garden pea]
gb|ACR33862.1|  unknown                                               91.7    2e-20   Zea mays [maize]
emb|CAB42546.2|  14-3-3-like protein                                  94.4    2e-20   Pisum sativum [garden pea]
ref|NP_001238389.1|  14-3-3 protein SGF14h                            94.4    2e-20   Glycine max [soybeans]
ref|XP_003544808.1|  PREDICTED: 14-3-3-like protein-like              94.4    2e-20   
ref|NP_001239690.1|  uncharacterized protein LOC100798989             94.4    2e-20   Glycine max [soybeans]
dbj|BAB47119.1|  14-3-3 protein                                       94.4    2e-20   Vigna angularis [azuki bean]
gb|ACN28697.1|  unknown                                               92.0    2e-20   Zea mays [maize]
ref|XP_007136271.1|  hypothetical protein PHAVU_009G032500g           94.4    2e-20   Phaseolus vulgaris [French bean]
ref|XP_008444853.1|  PREDICTED: 14-3-3-like protein                   94.4    2e-20   Cucumis melo [Oriental melon]
ref|XP_004152627.1|  PREDICTED: 14-3-3-like protein-like              94.4    2e-20   Cucumis sativus [cucumbers]
ref|XP_009404035.1|  PREDICTED: 14-3-3 protein 6                      94.0    2e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001265880.1|  14-3-3-like protein A-like                       94.0    2e-20   Cicer arietinum [garbanzo]
sp|O65352.1|1433_HELAN  RecName: Full=14-3-3-like protein             94.0    2e-20   Helianthus annuus
ref|XP_010543865.1|  PREDICTED: 14-3-3-like protein GF14 omega        94.0    3e-20   Tarenaya hassleriana [spider flower]
ref|XP_009380212.1|  PREDICTED: 14-3-3-like protein                   93.6    3e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010521176.1|  PREDICTED: 14-3-3-like protein GF14 omega        93.6    3e-20   Tarenaya hassleriana [spider flower]
gb|AGG10561.1|  14-3-3                                                93.6    3e-20   Elaeis guineensis
ref|XP_009609727.1|  PREDICTED: 14-3-3-like protein A                 93.6    3e-20   Nicotiana tomentosiformis
ref|XP_010535331.1|  PREDICTED: 14-3-3-like protein GF14 omega        93.6    3e-20   Tarenaya hassleriana [spider flower]
ref|XP_009786458.1|  PREDICTED: 14-3-3-like protein A                 93.6    3e-20   Nicotiana sylvestris
gb|ACG37387.1|  14-3-3-like protein A                                 92.8    3e-20   Zea mays [maize]
ref|XP_010534083.1|  PREDICTED: 14-3-3-like protein GF14 omega        93.6    3e-20   Tarenaya hassleriana [spider flower]
gb|ADO95303.1|  14-3-3-like protein GF14 Psi                          93.6    3e-20   Eutrema salsugineum [saltwater cress]
gb|AGV54291.1|  14-3-3 protein                                        93.6    4e-20   Phaseolus vulgaris [French bean]
ref|XP_006405765.1|  hypothetical protein EUTSA_v10027892mg           93.2    4e-20   Eutrema salsugineum [saltwater cress]
ref|XP_009139790.1|  PREDICTED: 14-3-3-like protein GF14 psi          93.2    4e-20   Brassica rapa
emb|CDY01659.1|  BnaC04g30930D                                        93.2    4e-20   
emb|CDX74521.1|  BnaA04g08680D                                        93.2    4e-20   
gb|KJB32075.1|  hypothetical protein B456_005G222600                  93.2    5e-20   Gossypium raimondii
ref|NP_568557.1|  14-3-3-like protein GF14 psi                        92.8    5e-20   Arabidopsis thaliana [mouse-ear cress]
gb|AAA32799.1|  GF14 psi chain                                        92.8    5e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003560774.1|  PREDICTED: 14-3-3-like protein A                 92.8    6e-20   Brachypodium distachyon [annual false brome]
gb|KJB12045.1|  hypothetical protein B456_002G141000                  92.8    7e-20   Gossypium raimondii
ref|NP_001149589.1|  14-3-3-like protein A                            92.4    8e-20   
gb|KFK24544.1|  hypothetical protein AALP_AAs41798U000400             92.4    8e-20   Arabis alpina [alpine rockcress]
ref|XP_006397430.1|  hypothetical protein EUTSA_v10001833mg           92.4    9e-20   Eutrema salsugineum [saltwater cress]
ref|XP_006303273.1|  hypothetical protein CARUB_v10010011mg           92.4    1e-19   Capsella rubella
gb|KDP40925.1|  hypothetical protein JCGZ_24924                       92.0    1e-19   Jatropha curcas
ref|XP_007042905.1|  General regulatory factor 2, OMEGA               92.0    1e-19   Theobroma cacao [chocolate]
ref|XP_011009578.1|  PREDICTED: 14-3-3-like protein isoform X2        92.0    1e-19   Populus euphratica
ref|XP_002307363.1|  14-3-3 protein 32kDa endonuclease                92.0    1e-19   Populus trichocarpa [western balsam poplar]
ref|XP_010455312.1|  PREDICTED: 14-3-3-like protein GF14 chi          92.0    1e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010421819.1|  PREDICTED: 14-3-3-like protein GF14 chi          91.7    1e-19   Camelina sativa [gold-of-pleasure]
gb|AAK26634.1|AF342780_1  GF14 omega                                  91.7    1e-19   Brassica napus [oilseed rape]
ref|XP_010680998.1|  PREDICTED: 14-3-3 protein 2-like isoform X1      91.7    2e-19   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002870838.1|  hypothetical protein ARALYDRAFT_494127           91.7    2e-19   
ref|XP_010680999.1|  PREDICTED: 14-3-3 protein 2-like isoform X2      91.7    2e-19   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX91676.1|  BnaC08g05950D                                        91.7    2e-19   
ref|XP_009110140.1|  PREDICTED: 14-3-3-like protein GF14 omega        91.7    2e-19   Brassica rapa
emb|CDY41483.1|  BnaA08g20850D                                        91.7    2e-19   Brassica napus [oilseed rape]
sp|P29307.2|1433_OENEH  RecName: Full=14-3-3-like protein             91.3    2e-19   Oenothera elata subsp. hookeri [Hooker's evening primrose]
emb|CDY71290.1|  BnaCnng72220D                                        91.3    2e-19   Brassica napus [oilseed rape]
ref|XP_006650484.1|  PREDICTED: 14-3-3-like protein GF14-F-like       91.3    2e-19   Oryza brachyantha
ref|XP_009125075.1|  PREDICTED: 14-3-3-like protein GF14 psi          91.3    2e-19   Brassica rapa
ref|XP_006659421.1|  PREDICTED: 14-3-3-like protein GF14-C-like       91.3    2e-19   Oryza brachyantha
emb|CDX67405.1|  BnaA07g14450D                                        91.3    2e-19   
ref|NP_001051051.1|  Os03g0710800                                     91.3    2e-19   
dbj|BAA03711.1|  brain specific protein                               91.3    2e-19   Oryza sativa [red rice]
gb|ACN73536.1|  1433-3                                                90.9    3e-19   Brassica napus [oilseed rape]
ref|XP_009410139.1|  PREDICTED: 14-3-3-like protein 16R               90.9    3e-19   Musa acuminata subsp. malaccensis [pisang utan]
gb|AIU34467.1|  putative 14-3-3 protein                               90.9    3e-19   Taraxacum brevicorniculatum
gb|ADO95306.1|  14-3-3-like protein GF14 Omega                        90.9    3e-19   Eutrema salsugineum [saltwater cress]
ref|XP_006389998.1|  hypothetical protein EUTSA_v10019018mg           90.9    3e-19   Eutrema salsugineum [saltwater cress]
ref|XP_009145139.1|  PREDICTED: 14-3-3-like protein GF14 phi          90.9    3e-19   Brassica rapa
gb|KJB10444.1|  hypothetical protein B456_001G201400                  90.5    4e-19   Gossypium raimondii
dbj|BAB11740.1|  TaWIN2                                               90.5    4e-19   Triticum aestivum [Canadian hard winter wheat]
gb|ADK93080.1|  14-3-3g protein                                       90.5    4e-19   Gossypium hirsutum [American cotton]
gb|ACH59993.1|  14-3-3 protein                                        86.3    4e-19   Pseudotsuga menziesii
emb|CDX73313.1|  BnaC05g27930D                                        90.5    5e-19   
gb|EPS72907.1|  14-3-3 a-1 protein                                    90.1    6e-19   Genlisea aurea
ref|XP_003574663.1|  PREDICTED: 14-3-3-like protein GF14-A            90.1    6e-19   Brachypodium distachyon [annual false brome]
gb|AAD27827.2|  14-3-3 protein                                        89.7    7e-19   Picea glauca
ref|NP_001061856.1|  Os08g0430500                                     89.7    8e-19   
gb|EAZ07074.1|  hypothetical protein OsI_29320                        89.7    8e-19   Oryza sativa Indica Group [Indian rice]
ref|NP_564453.1|  14-3-3-like protein GF14 phi                        89.7    8e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002891161.1|  At1g35160/T32G9_30                               89.7    8e-19   Arabidopsis lyrata subsp. lyrata
gb|AAK63949.1|  At1g35160/T32G9_30                                    89.7    8e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006408411.1|  hypothetical protein EUTSA_v10021346mg           89.7    8e-19   Eutrema salsugineum [saltwater cress]
dbj|BAJ91347.1|  predicted protein                                    89.4    9e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABC00200.1|  14-3-3D                                               89.4    1e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABY65002.1|  14-3-3c protein                                       89.0    1e-18   Gossypium hirsutum [American cotton]
gb|AFK46913.1|  unknown                                               89.4    1e-18   Lotus japonicus
gb|KJB79630.1|  hypothetical protein B456_013G059800                  89.0    1e-18   Gossypium raimondii
emb|CDY00447.1|  BnaC07g13790D                                        89.0    1e-18   
ref|XP_009408999.1|  PREDICTED: 14-3-3-like protein GF14-C            89.0    1e-18   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY46646.1|  BnaA07g10500D                                        89.0    1e-18   Brassica napus [oilseed rape]
ref|XP_009397483.1|  PREDICTED: 14-3-3-like protein                   89.0    1e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009419276.1|  PREDICTED: 14-3-3-like protein GF14-C            89.0    2e-18   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABR25750.1|  14-3-3-like protein                                   88.2    2e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_009403466.1|  PREDICTED: 14-3-3-like protein                   88.6    2e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001280837.1|  14-3-3-like protein A                            88.6    2e-18   Malus domestica [apple tree]
gb|AHB33318.1|  14-3-3a protein                                       88.6    2e-18   Pyrus pyrifolia [sha li]
gb|AAP48904.1|  14-3-3-like protein                                   88.6    2e-18   Saccharum hybrid cultivar CP65-357
gb|EYU44646.1|  hypothetical protein MIMGU_mgv1a012225mg              88.6    2e-18   Erythranthe guttata [common monkey flower]
gb|EYU34391.1|  hypothetical protein MIMGU_mgv1a012246mg              88.6    2e-18   Erythranthe guttata [common monkey flower]
ref|XP_006662988.1|  PREDICTED: 14-3-3-like protein GF14-D-like       88.6    2e-18   Oryza brachyantha
ref|XP_008362235.1|  PREDICTED: 14-3-3-like protein A                 88.6    2e-18   
emb|CAA06198.1|  14-3-3 Protein                                       84.7    2e-18   Glycine max [soybeans]
ref|XP_004968972.1|  PREDICTED: 14-3-3-like protein GF14-C-like i...  88.6    2e-18   Setaria italica
ref|XP_007216106.1|  hypothetical protein PRUPE_ppa018655mg           88.2    2e-18   
ref|XP_008466219.1|  PREDICTED: 14-3-3-like protein                   88.6    2e-18   Cucumis melo [Oriental melon]
gb|ACN39847.1|  unknown                                               88.6    2e-18   Picea sitchensis
ref|XP_010450904.1|  PREDICTED: 14-3-3-like protein GF14 psi          88.6    2e-18   Camelina sativa [gold-of-pleasure]
ref|XP_009357045.1|  PREDICTED: 14-3-3-like protein A                 88.6    2e-18   Pyrus x bretschneideri [bai li]
ref|NP_001068067.2|  Os11g0546900                                     88.6    2e-18   
ref|XP_010440961.1|  PREDICTED: 14-3-3-like protein GF14 psi          88.2    2e-18   
ref|XP_004136278.1|  PREDICTED: 14-3-3-like protein-like              88.2    2e-18   Cucumis sativus [cucumbers]
ref|XP_006346922.1|  PREDICTED: 14-3-3 protein 4-like                 88.2    2e-18   Solanum tuberosum [potatoes]
ref|XP_006284363.1|  hypothetical protein CARUB_v10005536mg           88.2    2e-18   
ref|XP_010473202.1|  PREDICTED: uncharacterized protein LOC104752695  91.7    2e-18   Camelina sativa [gold-of-pleasure]
dbj|BAF46314.1|  14-3-3 protein                                       88.2    2e-18   Ipomoea nil [qian niu]
ref|XP_008230392.1|  PREDICTED: 14-3-3-like protein A                 88.2    2e-18   Prunus mume [ume]
ref|XP_009106540.1|  PREDICTED: 14-3-3-like protein GF14 omega        88.2    2e-18   Brassica rapa
emb|CDX88436.1|  BnaC06g38800D                                        88.2    3e-18   
gb|KHG12867.1|  Uncharacterized protein F383_16851                    88.2    3e-18   Gossypium arboreum [tree cotton]
gb|ADP00759.1|  14-3-3 protein                                        88.2    3e-18   Litchi chinensis [litchi]
ref|XP_011011192.1|  PREDICTED: 14-3-3-like protein A                 88.2    3e-18   Populus euphratica
gb|ADD79961.1|  14-3-3 family protein                                 88.2    3e-18   Dimocarpus longan [longan]
ref|XP_008379530.1|  PREDICTED: 14-3-3-like protein A                 88.2    3e-18   
gb|KJB59911.1|  hypothetical protein B456_009G280500                  88.2    3e-18   Gossypium raimondii
ref|XP_010916166.1|  PREDICTED: 14-3-3-like protein                   87.8    4e-18   Elaeis guineensis
ref|XP_004304139.1|  PREDICTED: 14-3-3-like protein A                 87.8    4e-18   Fragaria vesca subsp. vesca
gb|AEA03664.1|  14-3-3 protein 3                                      87.8    4e-18   Hevea brasiliensis [jebe]
gb|AAF76226.1|AF272572_1  14-3-3 protein                              87.8    4e-18   Populus tremula x Populus alba [gray poplar]
ref|XP_011021224.1|  PREDICTED: 14-3-3-like protein                   87.8    4e-18   Populus euphratica
gb|AEG67284.1|  14-3-3 protein                                        87.8    4e-18   Pyrus pyrifolia [sha li]
ref|XP_002863080.1|  hypothetical protein ARALYDRAFT_920500           84.7    4e-18   
emb|CDX87455.1|  BnaA07g34180D                                        87.8    5e-18   
emb|CBI33672.3|  unnamed protein product                              85.1    5e-18   Vitis vinifera
ref|XP_002516746.1|  14-3-3 protein, putative                         85.1    6e-18   Ricinus communis
ref|XP_009128290.1|  PREDICTED: 14-3-3-like protein GF14 omega        87.4    6e-18   Brassica rapa
ref|XP_009388642.1|  PREDICTED: 14-3-3-like protein                   87.0    6e-18   Musa acuminata subsp. malaccensis [pisang utan]
sp|P42652.1|14334_SOLLC  RecName: Full=14-3-3 protein 4; AltName:...  87.0    7e-18   Solanum lycopersicum
gb|AGT17033.1|  14-3-3 protein                                        87.0    7e-18   Saccharum hybrid cultivar R570
ref|NP_001234007.1|  14-3-3 protein 4                                 87.0    7e-18   Solanum lycopersicum
ref|XP_010435756.1|  PREDICTED: 14-3-3-like protein GF14 psi isof...  87.0    7e-18   Camelina sativa [gold-of-pleasure]
gb|AEX00343.1|  14-3-3 protein b                                      87.0    7e-18   Ipomoea batatas [batate]
gb|ACK76233.1|  14-3-3 protein                                        87.0    7e-18   Dimocarpus longan [longan]
ref|XP_002449656.1|  hypothetical protein SORBIDRAFT_05g021020        87.0    7e-18   Sorghum bicolor [broomcorn]
ref|NP_001031982.1|  14-3-3-like protein GF14 psi                     87.0    7e-18   
ref|XP_009800018.1|  PREDICTED: 14-3-3 protein 4-like                 87.0    7e-18   Nicotiana sylvestris
gb|KHG19539.1|  Uncharacterized protein F383_05852                    87.0    8e-18   Gossypium arboreum [tree cotton]
gb|AEX00342.1|  14-3-3 protein a                                      87.0    8e-18   Ipomoea batatas [batate]
ref|XP_008775117.1|  PREDICTED: 14-3-3-like protein                   87.0    8e-18   
sp|P93342.1|1433A_TOBAC  RecName: Full=14-3-3-like protein A          86.7    8e-18   Nicotiana tabacum [American tobacco]
ref|XP_010094131.1|  14-3-3-like protein F                            86.7    8e-18   Morus notabilis
gb|ABY65004.1|  14-3-3e protein                                       86.7    9e-18   Gossypium hirsutum [American cotton]
ref|XP_010525152.1|  PREDICTED: 14-3-3-like protein                   87.0    9e-18   Tarenaya hassleriana [spider flower]
gb|ACH63229.1|  14-3-3 protein                                        86.7    9e-18   Rheum australe [Himalayan rhubarb]
ref|XP_006433941.1|  hypothetical protein CICLE_v10003615mg           87.8    9e-18   
gb|EPS59645.1|  14-3-3 protein                                        86.7    9e-18   Genlisea aurea
emb|CAA44259.1|  14-3-3 protein homologue                             86.7    9e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
sp|P29305.1|1433A_HORVU  RecName: Full=14-3-3-like protein A; Sho...  86.7    9e-18   Hordeum vulgare [barley]
ref|XP_009114721.1|  PREDICTED: 14-3-3-like protein GF14 phi          86.7    9e-18   Brassica rapa
emb|CDP02788.1|  unnamed protein product                              84.3    9e-18   Coffea canephora [robusta coffee]
ref|NP_567344.1|  14-3-3-like protein GF14 chi                        86.7    1e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010528468.1|  PREDICTED: 14-3-3-like protein GF14 psi          86.7    1e-17   Tarenaya hassleriana [spider flower]
gb|AAR89812.1|  14-3-3 protein                                        86.7    1e-17   Triticum aestivum [Canadian hard winter wheat]
gb|KDP32938.1|  hypothetical protein JCGZ_12969                       86.7    1e-17   Jatropha curcas
ref|XP_010553922.1|  PREDICTED: 14-3-3-like protein GF14 psi          86.7    1e-17   Tarenaya hassleriana [spider flower]
ref|XP_009615235.1|  PREDICTED: 14-3-3 protein 4-like                 86.7    1e-17   Nicotiana tomentosiformis
gb|AEA03663.1|  14-3-3 protein 2                                      86.7    1e-17   
gb|ADD92154.1|  14-3-3 protein                                        86.7    1e-17   
gb|ABK21293.1|  unknown                                               86.7    1e-17   
dbj|BAD12554.1|  14-3-3 f-2 protein                                   86.3    1e-17   
gb|ABD96912.1|  hypothetical protein                                  86.3    1e-17   
ref|XP_003577480.1|  PREDICTED: 14-3-3-like protein GF14-D            86.3    1e-17   
ref|XP_011099565.1|  PREDICTED: 14-3-3-like protein                   86.3    1e-17   
ref|XP_004137196.1|  PREDICTED: 14-3-3-like protein-like              86.3    1e-17   
dbj|BAM20996.1|  14-3-3 protein                                       86.3    1e-17   
ref|XP_010061867.1|  PREDICTED: 14-3-3-like protein GF14 psi          86.3    2e-17   
ref|XP_006853053.1|  hypothetical protein AMTR_s00038p00055100        86.3    2e-17   
gb|AEX00344.1|  14-3-3 protein c                                      85.9    2e-17   
ref|XP_010530165.1|  PREDICTED: 14-3-3-like protein GF14 chi          85.9    2e-17   
ref|NP_001235653.1|  14-3-3-like protein A                            85.9    2e-17   
gb|KHN24947.1|  14-3-3-like protein A                                 85.9    2e-17   
ref|XP_002283492.1|  PREDICTED: 14-3-3-like protein A                 85.9    2e-17   
gb|AIJ04690.1|  14-3-3a                                               85.9    2e-17   
ref|XP_004234565.1|  PREDICTED: 14-3-3-like protein                   85.9    2e-17   
gb|ABK95847.1|  unknown                                               83.6    2e-17   
ref|XP_010263205.1|  PREDICTED: 14-3-3-like protein                   85.9    2e-17   
ref|XP_004974055.1|  PREDICTED: 14-3-3-like protein GF14-C-like i...  85.1    2e-17   
ref|XP_010926139.1|  PREDICTED: 14-3-3-like protein                   85.5    2e-17   
ref|XP_008781204.1|  PREDICTED: 14-3-3-like protein                   85.5    2e-17   
ref|XP_002863822.1|  hypothetical protein ARALYDRAFT_917601           84.0    2e-17   
sp|Q9SP07.1|1433_LILLO  RecName: Full=14-3-3-like protein             85.5    3e-17   
gb|AAC04811.1|  GF14 protein                                          85.5    3e-17   
gb|ACF84704.1|  unknown                                               85.1    3e-17   
ref|XP_006400137.1|  hypothetical protein EUTSA_v10014395mg           85.1    3e-17   
gb|AGV54551.1|  14-3-3 family protein                                 85.1    3e-17   
ref|XP_010032624.1|  PREDICTED: 14-3-3-like protein A                 85.1    3e-17   
ref|XP_004974053.1|  PREDICTED: 14-3-3-like protein GF14-C-like i...  85.1    3e-17   
ref|XP_007139133.1|  hypothetical protein PHAVU_008G004300g           85.1    3e-17   
ref|XP_004973494.1|  PREDICTED: 14-3-3-like protein GF14-C-like i...  85.1    3e-17   
ref|XP_004979440.1|  PREDICTED: LOW QUALITY PROTEIN: 14-3-3-like ...  85.1    4e-17   
gb|AGV54353.1|  14-3-3-like protein A                                 85.1    4e-17   
ref|XP_010436066.1|  PREDICTED: 14-3-3-like protein GF14 chi          85.1    4e-17   
ref|XP_006298337.1|  hypothetical protein CARUB_v10014407mg           85.1    4e-17   
ref|XP_010485561.1|  PREDICTED: 14-3-3-like protein GF14 nu           84.7    4e-17   
ref|XP_010498313.1|  PREDICTED: 14-3-3-like protein GF14 nu           84.7    4e-17   
gb|AAA96254.1|  GF14chi isoform                                       84.7    4e-17   
ref|XP_010558549.1|  PREDICTED: 14-3-3-like protein                   84.7    4e-17   
ref|XP_006430798.1|  hypothetical protein CICLE_v10012495mg           84.7    4e-17   
gb|EAY94422.1|  hypothetical protein OsI_16191                        80.9    4e-17   
gb|ACG35164.1|  14-3-3-like protein                                   82.8    4e-17   
gb|KHG17540.1|  hypothetical protein F383_23617                       84.7    4e-17   
ref|XP_010463663.1|  PREDICTED: 14-3-3-like protein GF14 nu           84.7    4e-17   
ref|XP_010435754.1|  PREDICTED: 14-3-3-like protein GF14 psi isof...  85.1    4e-17   
ref|XP_010265205.1|  PREDICTED: 14-3-3-like protein                   84.7    5e-17   
ref|XP_008801147.1|  PREDICTED: 14-3-3-like protein                   84.7    5e-17   
ref|XP_006384210.1|  hypothetical protein POPTR_0004s10120g           84.7    5e-17   
gb|AAY67798.1|  14-3-3 protein                                        84.7    5e-17   
gb|ACG24337.1|  14-3-3-like protein                                   84.3    5e-17   
ref|XP_008664668.1|  PREDICTED: 14-3-3-like protein GF14-C            84.3    5e-17   
gb|AGZ13503.1|  14-3-3 protein                                        84.3    5e-17   
ref|XP_004489124.1|  PREDICTED: 14-3-3-like protein A-like            84.3    5e-17   
ref|NP_001105677.1|  14-3-3-like protein                              84.3    5e-17   
gb|ACG24283.1|  14-3-3-like protein                                   84.3    6e-17   
ref|XP_009103239.1|  PREDICTED: 14-3-3-like protein GF14 omega        84.3    6e-17   
ref|XP_006288456.1|  hypothetical protein CARUB_v10001717mg           84.7    6e-17   
sp|P29308.1|1433_SPIOL  RecName: Full=14-3-3-like protein             84.0    6e-17   
ref|XP_006373446.1|  14-3-3 family protein                            84.3    6e-17   
ref|XP_008670779.1|  PREDICTED: 14-3-3-like protein                   85.9    6e-17   
gb|AGC13184.1|  14-3-3 protein                                        84.3    6e-17   
ref|XP_009134679.1|  PREDICTED: 14-3-3-like protein GF14 nu           84.3    6e-17   
emb|CDX74252.1|  BnaA03g27950D                                        84.3    6e-17   
emb|CDX91996.1|  BnaC03g32980D                                        84.3    7e-17   
ref|XP_008800764.1|  PREDICTED: 14-3-3-like protein                   84.3    7e-17   
tpg|DAA40949.1|  TPA: hypothetical protein ZEAMMB73_370232            82.4    7e-17   
ref|NP_001236005.1|  14-.3.3 protein                                  84.0    7e-17   
gb|AGJ98232.1|  PIB41 14-3-3 protein                                  84.3    7e-17   
tpg|DAA43914.1|  TPA: hypothetical protein ZEAMMB73_770743            82.0    7e-17   
emb|CDY28698.1|  BnaCnng05840D                                        84.0    8e-17   
ref|XP_009147332.1|  PREDICTED: 14-3-3-like protein GF14 nu           84.0    8e-17   
ref|NP_568325.1|  14-3-3-like protein GF14 upsilon                    84.0    1e-16   
ref|XP_010420282.1|  PREDICTED: 14-3-3-like protein GF14 upsilon      83.6    1e-16   
ref|XP_010453757.1|  PREDICTED: 14-3-3-like protein GF14 upsilon ...  83.6    1e-16   
ref|NP_001275262.1|  14-3-3-like protein                              83.6    1e-16   
ref|XP_001765070.1|  predicted protein                                83.2    1e-16   
ref|XP_006288457.1|  hypothetical protein CARUB_v10001718mg           83.2    1e-16   
gb|ABR25721.1|  14-3-3-like protein gf14-6                            81.6    1e-16   
ref|XP_002873753.1|  predicted protein                                83.2    1e-16   
ref|XP_008671782.1|  PREDICTED: 14-3-3-like protein GF14-A            82.4    1e-16   
gb|ABR25888.1|  14-3-3-like protein b                                 81.6    2e-16   
ref|NP_001151592.1|  LOC100285226                                     83.2    2e-16   
gb|AIJ04692.1|  14-3-3c                                               83.2    2e-16   
ref|XP_010908756.1|  PREDICTED: 14-3-3-like protein                   83.2    2e-16   
gb|AFK34571.1|  unknown                                               82.8    2e-16   
ref|XP_008675640.1|  PREDICTED: 14-3-3-like protein GF14-A            82.4    2e-16   
ref|XP_006605542.1|  PREDICTED: 14-3-3-like protein GF14 iota-like    82.8    2e-16   
sp|P93259.1|1433_MESCR  RecName: Full=14-3-3-like protein; AltNam...  82.8    2e-16   
ref|NP_566174.1|  14-3-3-like protein GF14 nu                         82.8    2e-16   
gb|KJB10359.1|  hypothetical protein B456_001G197200                  82.4    2e-16   
gb|EMS56398.1|  14-3-3-like protein GF14-D                            82.0    2e-16   
gb|ACU19485.1|  unknown                                               82.8    2e-16   
gb|ABO15466.1|  14-3-3 protein Lil 1433-1                             82.8    2e-16   
ref|XP_010103809.1|  14-3-3 protein 4                                 85.5    2e-16   
gb|ACU23290.1|  unknown                                               82.8    2e-16   
sp|Q96450.1|1433A_SOYBN  RecName: Full=14-3-3-like protein A; Alt...  82.8    3e-16   
ref|XP_009401429.1|  PREDICTED: 14-3-3-like protein                   82.8    3e-16   
ref|XP_010492477.1|  PREDICTED: 14-3-3-like protein GF14 upsilon      82.8    3e-16   
ref|XP_009388227.1|  PREDICTED: 14-3-3-like protein                   82.4    3e-16   
ref|XP_010692757.1|  PREDICTED: 14-3-3-like protein                   82.4    3e-16   
gb|KJB10357.1|  hypothetical protein B456_001G197200                  82.4    3e-16   
gb|ABE01401.1|  14-3-3 protein                                        82.4    3e-16   
gb|ABC00201.1|  14-3-3E                                               82.4    3e-16   
dbj|BAB11739.1|  TaWIN1                                               82.4    4e-16   
gb|AGT16964.1|  14-3-3 protein                                        82.0    4e-16   
ref|XP_004975868.1|  PREDICTED: 14-3-3-like protein GF14-12-like      82.0    4e-16   
ref|XP_008661810.1|  PREDICTED: 14-3-3-like protein GF14-12 isofo...  82.0    4e-16   
emb|CDP20333.1|  unnamed protein product                              80.1    4e-16   
ref|NP_001047234.1|  Os02g0580300                                     82.0    4e-16   
ref|NP_001053003.1|  Os04g0462500                                     82.0    4e-16   
ref|NP_001105350.2|  14-3-3-like protein GF14-6                       82.0    4e-16   
ref|XP_006652359.1|  PREDICTED: 14-3-3-like protein GF14-B-like i...  82.0    4e-16   
ref|XP_002965976.1|  hypothetical protein SELMODRAFT_439395           82.0    4e-16   
ref|XP_002446626.1|  hypothetical protein SORBIDRAFT_06g019100        82.0    4e-16   
ref|NP_001141053.1|  uncharacterized protein LOC100273134             82.0    4e-16   
gb|AFW65503.1|  14-3-3-like protein                                   82.0    4e-16   
ref|NP_001148842.1|  LOC100282460                                     82.0    4e-16   
tpg|DAA37434.1|  TPA: LOW QUALITY PROTEIN: general regulatory fac...  82.0    4e-16   
ref|XP_006647421.1|  PREDICTED: 14-3-3-like protein GF14-E-like       82.0    5e-16   
ref|XP_008665913.1|  PREDICTED: uncharacterized protein LOC103644495  82.8    5e-16   
ref|XP_003528560.2|  PREDICTED: 14-3-3-like protein GF14 iota-like    82.0    5e-16   
ref|XP_009381101.1|  PREDICTED: 14-3-3-like protein                   82.0    5e-16   
gb|KHN42946.1|  14-3-3-like protein GF14 iota                         81.6    5e-16   
ref|XP_007157838.1|  hypothetical protein PHAVU_002G102500g           81.6    5e-16   
ref|XP_002874496.1|  hypothetical protein ARALYDRAFT_911048           81.6    5e-16   
ref|XP_004952897.1|  PREDICTED: 14-3-3-like protein GF14-E-like       81.6    6e-16   
ref|XP_002960748.1|  hypothetical protein SELMODRAFT_229825           81.6    6e-16   
gb|ACG30202.1|  14-3-3-like protein                                   81.6    6e-16   
dbj|BAD12182.1|  14-3-3 i-1 protein                                   81.6    7e-16   
ref|XP_003579911.1|  PREDICTED: 14-3-3-like protein GF14-B            81.3    7e-16   
gb|AET81041.1|  14-3-3 protein                                        81.3    7e-16   
ref|XP_009770957.1|  PREDICTED: 14-3-3 protein 4                      81.3    8e-16   
gb|KIZ00461.1|  14-3-3-like protein                                   80.9    9e-16   
ref|XP_009406238.1|  PREDICTED: 14-3-3-like protein C                 80.9    1e-15   
gb|EMT12878.1|  14-3-3-like protein GF14-D                            81.3    1e-15   
ref|XP_005645700.1|  14-3-3 protein                                   80.9    1e-15   
gb|AIZ68200.1|  14-3-3-like protein                                   80.9    1e-15   
ref|XP_009617450.1|  PREDICTED: 14-3-3 protein 4                      80.5    1e-15   
ref|XP_002884324.1|  hypothetical protein ARALYDRAFT_477486           80.5    2e-15   
dbj|BAE43225.1|  unnamed protein product                              77.4    2e-15   
ref|XP_010473743.1|  PREDICTED: 14-3-3-like protein GF14 omega        78.6    2e-15   
ref|NP_001080705.1|  tyrosine 3-monooxygenase/tryptophan 5-monoox...  80.1    2e-15   
ref|XP_004228408.1|  PREDICTED: 14-3-3-like protein GF14 iota         80.1    2e-15   
ref|XP_006365133.1|  PREDICTED: 14-3-3-like protein GF14 iota-like    80.1    2e-15   
ref|XP_010461289.1|  PREDICTED: 14-3-3-like protein GF14 phi          79.7    2e-15   
ref|XP_010501783.1|  PREDICTED: 14-3-3-like protein GF14 phi          79.7    2e-15   
gb|KHG05238.1|  Uncharacterized protein F383_30797                    79.7    2e-15   
gb|KJB64237.1|  hypothetical protein B456_010G038600                  79.7    3e-15   
ref|XP_001771622.1|  predicted protein                                79.7    3e-15   
ref|XP_010695853.1|  PREDICTED: 14-3-3-like protein                   79.7    3e-15   
gb|ESW96184.1|  protein BMH2                                          79.3    3e-15   
sp|Q01526.2|14332_MAIZE  RecName: Full=14-3-3-like protein GF14-12    79.3    4e-15   
ref|NP_001160169.1|  14-3-3-like protein GF14-12                      79.3    4e-15   
gb|EYU22375.1|  hypothetical protein MIMGU_mgv1a012051mg              79.3    4e-15   
ref|XP_009349095.1|  PREDICTED: 14-3-3-like protein D                 79.3    4e-15   
dbj|BAH14572.1|  unnamed protein product                              78.2    4e-15   
gb|EDL12838.1|  tyrosine 3-monooxygenase/tryptophan 5-monooxygena...  78.2    4e-15   
gb|EKD02257.1|  hypothetical protein A1Q2_03404                       82.0    4e-15   
ref|XP_009415239.1|  PREDICTED: 14-3-3-like protein B                 79.0    5e-15   
ref|XP_001771385.1|  predicted protein                                79.0    5e-15   
ref|XP_010416813.1|  PREDICTED: 14-3-3-like protein GF14 omega        79.0    5e-15   
ref|XP_001771436.1|  predicted protein                                79.0    5e-15   
ref|XP_010472047.1|  PREDICTED: 14-3-3-like protein GF14 omega        79.0    5e-15   
gb|EHB01781.1|  14-3-3 protein epsilon                                75.5    5e-15   
emb|CDS08486.1|  Putative 14-3-3 family protein 7                     79.0    5e-15   
emb|CDH53016.1|  14-3-3 family protein                                79.0    5e-15   
ref|XP_007437318.1|  PREDICTED: 14-3-3 protein epsilon-like isofo...  78.6    6e-15   
emb|CDQ70100.1|  unnamed protein product                              78.6    6e-15   
emb|CDH53017.1|  14-3-3 family protein                                78.6    6e-15   
ref|XP_010892107.1|  PREDICTED: 14-3-3 protein epsilon isoform X2     78.6    6e-15   
ref|XP_007229712.1|  PREDICTED: 14-3-3 protein epsilon-like isofo...  78.6    6e-15   
ref|XP_007229715.1|  PREDICTED: 14-3-3 protein epsilon-like isofo...  78.6    7e-15   
ref|XP_007229713.1|  PREDICTED: 14-3-3 protein epsilon-like isofo...  78.6    7e-15   
gb|EDM05238.1|  tyrosine 3-monooxygenase/tryptophan 5-monooxygena...  77.8    7e-15   
sp|P29306.1|1433X_MAIZE  RecName: Full=14-3-3-like protein            75.1    7e-15   
ref|XP_005817287.1|  PREDICTED: 14-3-3 protein epsilon-like           76.6    7e-15   
ref|XP_003770144.1|  PREDICTED: 14-3-3 protein epsilon-like           78.2    7e-15   
ref|XP_005502058.1|  PREDICTED: 14-3-3 protein epsilon isoform X1     78.2    7e-15   
gb|ELK01896.1|  14-3-3 protein epsilon                                78.2    7e-15   
gb|EHB10352.1|  14-3-3 protein epsilon                                78.2    7e-15   
ref|XP_005858385.1|  PREDICTED: 14-3-3 protein epsilon                78.6    7e-15   
gb|AAC37321.1|  14-3-3 protein                                        78.2    7e-15   
ref|XP_004901050.1|  PREDICTED: 14-3-3 protein epsilon-like           78.2    7e-15   
gb|ACG37368.1|  14-3-3-like protein GF14-6                            78.6    7e-15   
dbj|BAK62340.1|  14-3-3 protein epsilon                               78.2    7e-15   
gb|EDL12840.1|  tyrosine 3-monooxygenase/tryptophan 5-monooxygena...  77.8    8e-15   
ref|XP_007076168.1|  PREDICTED: 14-3-3 protein epsilon isoform X1     78.6    8e-15   
gb|EMC77099.1|  14-3-3 protein epsilon                                78.2    8e-15   
ref|XP_004012588.1|  PREDICTED: 14-3-3 protein epsilon                78.2    8e-15   
ref|XP_008994634.1|  PREDICTED: 14-3-3 protein epsilon isoform X3     78.2    8e-15   
gb|EHH57557.1|  14-3-3 protein epsilon                                78.2    8e-15   
ref|XP_009387444.1|  PREDICTED: 14-3-3-like protein                   78.6    8e-15   
ref|XP_005975824.1|  PREDICTED: 14-3-3 protein epsilon                78.2    8e-15   
ref|XP_007245994.1|  PREDICTED: 14-3-3 protein epsilon-like isofo...  78.2    8e-15   
ref|XP_010862490.1|  PREDICTED: 14-3-3 protein epsilon isoform X1     78.2    8e-15   
ref|XP_005624977.1|  PREDICTED: 14-3-3 protein epsilon isoform X3     78.6    8e-15   
ref|XP_011310552.1|  PREDICTED: 14-3-3 protein epsilon                78.2    8e-15   
dbj|BAC36106.1|  unnamed protein product                              78.2    8e-15   
gb|ABO15467.1|  14-3-3 protein Lil 1433-2                             78.2    8e-15   
gb|EQB78292.1|  14-3-3 protein epsilon-like protein                   78.2    8e-15   
ref|XP_004640239.1|  PREDICTED: 14-3-3 protein epsilon-like           78.2    8e-15   
ref|XP_002718936.1|  PREDICTED: 14-3-3 protein epsilon isoform X1     78.2    8e-15   
ref|NP_997770.1|  14-3-3 protein epsilon                              78.2    8e-15   
ref|XP_006167597.1|  PREDICTED: 14-3-3 protein epsilon-like           78.2    8e-15   
gb|EYU28855.1|  hypothetical protein MIMGU_mgv1a012202mg              78.2    9e-15   
ref|XP_008445452.1|  PREDICTED: 14-3-3-like protein GF14 iota         78.2    9e-15   
ref|XP_006901375.1|  PREDICTED: 14-3-3 protein epsilon-like           78.2    9e-15   
ref|XP_006641186.1|  PREDICTED: 14-3-3 protein epsilon-like           78.2    9e-15   
ref|XP_004684862.1|  PREDICTED: 14-3-3 protein epsilon                78.2    9e-15   
ref|NP_006752.1|  14-3-3 protein epsilon                              78.2    9e-15   
ref|XP_010915526.1|  PREDICTED: 14-3-3-like protein D isoform X1      78.2    9e-15   
gb|EYU28854.1|  hypothetical protein MIMGU_mgv1a012202mg              78.2    9e-15   
ref|XP_002530700.1|  14-3-3 protein sigma, gamma, zeta, beta/alph...  75.5    9e-15   
ref|XP_002747869.1|  PREDICTED: 14-3-3 protein epsilon isoform X1     78.2    9e-15   
ref|NP_113791.1|  14-3-3 protein epsilon                              78.2    9e-15   
ref|XP_007507935.1|  PREDICTED: LOW QUALITY PROTEIN: tyrosine 3-m...  78.2    9e-15   
gb|AAP36544.1|  Homo sapiens tyrosine 3-monooxygenase/tryptophan ...  78.2    9e-15   
ref|XP_001702812.1|  14-3-3 protein                                   78.2    9e-15   
gb|EHH24334.1|  14-3-3 protein epsilon                                78.2    9e-15   



>emb|CAC84142.3| 14-3-3 protein [Nicotiana tabacum]
Length=258

 Score =   103 bits (257),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 50/52 (96%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDG DEIKEA+KPDNE
Sbjct  205  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGTDEIKEAAKPDNE  256



>ref|XP_009623182.1| PREDICTED: 14-3-3-like protein 16R [Nicotiana tomentosiformis]
 ref|XP_009773768.1| PREDICTED: 14-3-3-like protein 16R [Nicotiana sylvestris]
 dbj|BAD10939.1| 14-3-3 protein [Nicotiana tabacum]
 dbj|BAD12180.1| 14-3-3 h-1 protein [Nicotiana tabacum]
 dbj|BAD12181.1| 14-3-3 h-2 protein [Nicotiana tabacum]
Length=258

 Score =   103 bits (257),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 50/52 (96%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDG DEIKEA+KPDNE
Sbjct  205  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGTDEIKEAAKPDNE  256



>gb|AGJ98234.1| PIB67 14-3-3 protein [Petunia x hybrida]
Length=256

 Score =   103 bits (257),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 50/52 (96%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDG DEIKEA+KPDNE
Sbjct  205  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGTDEIKEAAKPDNE  256



>emb|CDP01506.1| unnamed protein product [Coffea canephora]
Length=256

 Score =   103 bits (256),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 50/52 (96%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDG +EIKEASKPDNE
Sbjct  205  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGTEEIKEASKPDNE  256



>emb|CDP01098.1| unnamed protein product [Coffea canephora]
Length=131

 Score =   100 bits (249),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 50/52 (96%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA K DNE
Sbjct  78   EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAPKADNE  129



>gb|AIJ04691.1| 14-3-3b [Morus alba var. atropurpurea]
Length=257

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/52 (96%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKP +E
Sbjct  204  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPSDE  255



>ref|XP_010098629.1| 14-3-3-like protein [Morus notabilis]
 gb|EXB75368.1| 14-3-3-like protein [Morus notabilis]
Length=257

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/52 (96%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKP +E
Sbjct  204  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPSDE  255



>gb|KDO81026.1| hypothetical protein CISIN_1g024620mg [Citrus sinensis]
Length=265

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 52/52 (100%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA+KP++E
Sbjct  212  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAAKPESE  263



>ref|XP_006472571.1| PREDICTED: 14-3-3-like protein-like [Citrus sinensis]
Length=265

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 52/52 (100%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA+KP++E
Sbjct  212  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAAKPESE  263



>gb|EPS73301.1| 14-3-3 h-1 protein [Genlisea aurea]
Length=255

 Score =   101 bits (251),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDD +DEIKEASKP+NE
Sbjct  204  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDNSDEIKEASKPENE  255



>gb|AAR98782.1| 14-3-3 protein isoform 20R [Solanum tuberosum]
Length=255

 Score =   100 bits (250),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 50/52 (96%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKE SK DNE
Sbjct  204  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEPSKADNE  255



>gb|KDP41413.1| hypothetical protein JCGZ_15820 [Jatropha curcas]
Length=260

 Score =   100 bits (249),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA+KP  E
Sbjct  207  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAAKPTEE  258



>emb|CBI19195.3| unnamed protein product [Vitis vinifera]
Length=159

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA K D+E
Sbjct  106  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAPKRDDE  157



>ref|XP_004299669.1| PREDICTED: 14-3-3-like protein [Fragaria vesca subsp. vesca]
Length=260

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/55 (91%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  165
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA KP  E  Q
Sbjct  206  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAPKPAEEAKQ  260



>gb|EYU34581.1| hypothetical protein MIMGU_mgv1a012286mg [Erythranthe guttata]
Length=255

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDD ++EIKEA+KPDNE
Sbjct  204  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDNSEEIKEAAKPDNE  255



>gb|EYU36484.1| hypothetical protein MIMGU_mgv1a011964mg [Erythranthe guttata]
Length=265

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/50 (96%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  150
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA+KP+
Sbjct  209  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAAKPE  258



>ref|NP_001275217.1| 14-3-3 protein 2-like [Solanum tuberosum]
 emb|CAA72382.1| 14-3-3 protein [Solanum tuberosum]
 dbj|BAM28646.1| putative 14-3-3 protein, partial [Solanum tuberosum]
Length=254

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/52 (96%), Positives = 51/52 (98%), Gaps = 1/52 (2%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKE +KPDNE
Sbjct  202  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKE-TKPDNE  252



>ref|XP_011097537.1| PREDICTED: 14-3-3-like protein 16R [Sesamum indicum]
Length=255

 Score = 99.0 bits (245),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDD ++EIKEA KPDNE
Sbjct  204  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDNSEEIKEAPKPDNE  255



>gb|ACD69679.1| 14-3-3, partial [Mangifera indica]
Length=261

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSD+ DDGADEIKEA+KPD+E
Sbjct  208  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDIPDDGADEIKEATKPDSE  259



>gb|AAS78777.1| 14-3-3 protein [Solanum chacoense]
Length=255

 Score = 99.0 bits (245),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDG DEIKE SK DNE
Sbjct  204  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGTDEIKEPSKADNE  255



>gb|EPS60562.1| 14-3-3 h-1 protein [Genlisea aurea]
Length=255

 Score = 99.0 bits (245),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDD ++EIKEA KPDNE
Sbjct  204  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDNSEEIKEAPKPDNE  255



>sp|P93210.1|14335_SOLLC RecName: Full=14-3-3 protein 5 [Solanum lycopersicum]
 emb|CAA65148.1| 14-3-3 protein [Solanum lycopersicum]
Length=255

 Score = 99.0 bits (245),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDG DEIKE SK DNE
Sbjct  204  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGTDEIKEPSKADNE  255



>ref|NP_001234107.1| 14-3-3 family protein [Solanum lycopersicum]
 gb|AAL04426.1| 14-3-3 family protein [Solanum lycopersicum]
Length=256

 Score = 99.0 bits (245),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDG DEIKE SK DNE
Sbjct  205  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGTDEIKEPSKADNE  256



>gb|KHN08951.1| 14-3-3-like protein [Glycine soja]
Length=224

 Score = 98.2 bits (243),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 52/53 (98%), Gaps = 1/53 (2%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA+ KPD++
Sbjct  172  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAAPKPDDQ  224



>ref|XP_009345790.1| PREDICTED: 14-3-3-like protein 16R [Pyrus x bretschneideri]
Length=261

 Score = 98.6 bits (244),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  165
            EAIAELDTLGE+SYKDSTLIMQLLRDNLTLWTSDMQDDG DEIKEASKP  E  Q
Sbjct  207  EAIAELDTLGEDSYKDSTLIMQLLRDNLTLWTSDMQDDGTDEIKEASKPQAEPQQ  261



>gb|ABY65003.1| 14-3-3d protein [Gossypium hirsutum]
 gb|KJB77547.1| hypothetical protein B456_012G142900 [Gossypium raimondii]
Length=261

 Score = 98.6 bits (244),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGE+SYKDSTLIMQLLRDNLTLWTSDMQDDG DEIKEASKP+ E
Sbjct  207  EAIAELDTLGEDSYKDSTLIMQLLRDNLTLWTSDMQDDGTDEIKEASKPEEE  258



>sp|Q43643.1|14332_SOLTU RecName: Full=14-3-3-like protein RA215 [Solanum tuberosum]
 emb|CAA60800.1| 14-3-3 protein [Solanum tuberosum]
Length=254

 Score = 98.2 bits (243),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIA++DTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKE SK DNE
Sbjct  203  EAIADVDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEPSKADNE  254



>emb|CBI33141.3| unnamed protein product [Vitis vinifera]
Length=173

 Score = 96.3 bits (238),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDG DEIKEA K D E
Sbjct  122  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGGDEIKEAPKHDEE  173



>gb|EYU30984.1| hypothetical protein MIMGU_mgv1a012292mg [Erythranthe guttata]
Length=255

 Score = 97.8 bits (242),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDD ++EIKEA KPDNE
Sbjct  204  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDMSEEIKEAPKPDNE  255



>dbj|BAD12178.1| 14-3-3 f-1 protein [Nicotiana tabacum]
Length=258

 Score = 97.8 bits (242),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQD+G +E+KE +KPDNE
Sbjct  205  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDEGTEEMKEVAKPDNE  256



>ref|XP_009589383.1| PREDICTED: 14-3-3-like protein F [Nicotiana tomentosiformis]
Length=258

 Score = 97.8 bits (242),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQD+G +E+KE +KPDNE
Sbjct  205  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDEGTEEMKEVAKPDNE  256



>gb|ACQ45021.1| 14-3-3 [Cicer arietinum]
Length=261

 Score = 97.8 bits (242),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 50/51 (98%), Gaps = 1/51 (2%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA-SKPD  150
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA SKPD
Sbjct  207  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAPSKPD  257



>ref|XP_009799312.1| PREDICTED: 14-3-3-like protein F [Nicotiana sylvestris]
 sp|O49998.1|1433F_TOBAC RecName: Full=14-3-3-like protein F [Nicotiana tabacum]
 gb|AAC49895.1| 14-3-3 isoform f [Nicotiana tabacum]
 dbj|BAD10941.1| 14-3-3 protein [Nicotiana tabacum]
Length=258

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQD+G +E+KE +KPDNE
Sbjct  205  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDEGTEEMKEVAKPDNE  256



>ref|XP_009380873.1| PREDICTED: 14-3-3 protein 6-like [Musa acuminata subsp. malaccensis]
Length=256

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDG DEIKEASK D+E
Sbjct  205  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGMDEIKEASKLDDE  256



>ref|XP_009757667.1| PREDICTED: 14-3-3-like protein C [Nicotiana sylvestris]
 dbj|BAD12172.1| 14-3-3 c-2 protein [Nicotiana tabacum]
Length=260

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/50 (96%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  150
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKE  KPD
Sbjct  207  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEDPKPD  256



>ref|XP_009619695.1| PREDICTED: 14-3-3-like protein C [Nicotiana tomentosiformis]
 sp|P93343.1|1433C_TOBAC RecName: Full=14-3-3-like protein C; AltName: Full=14-3-3-like 
protein B [Nicotiana tabacum]
 pdb|1O9C|A Chain A, Structural View Of A Fungal Toxin Acting On A 14-3-3 
Regulatory Complex
 pdb|1O9D|A Chain A, Structural View Of A Fungal Toxin Acting On A 14-3-3 
Regulatory Complex
 pdb|1O9E|A Chain A, Structural View Of A Fungal Toxin Acting On A 14-3-3 
Regulatory Complex
 pdb|1O9F|A Chain A, Structural View Of A Fungal Toxin Acting On A 14-3-3 
Regulatory Complex
 pdb|3E6Y|A Chain A, Structure Of 14-3-3 In Complex With The Differentiation-Inducing 
Agent Cotylenin A
 pdb|3E6Y|B Chain B, Structure Of 14-3-3 In Complex With The Differentiation-Inducing 
Agent Cotylenin A
 emb|CAA72094.1| 14-3-3-like protein B [Nicotiana tabacum]
 gb|AAC49892.1| 14-3-3 isoform c [Nicotiana tabacum]
 dbj|BAD10940.1| 14-3-3 protein [Nicotiana tabacum]
 dbj|BAD12171.1| 14-3-3 c-1 protein [Nicotiana tabacum]
Length=260

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/50 (96%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  150
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKE  KPD
Sbjct  207  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEDPKPD  256



>ref|NP_001275062.1| 14-3-3-like protein 16R [Solanum tuberosum]
 sp|P93784.1|14335_SOLTU RecName: Full=14-3-3-like protein 16R [Solanum tuberosum]
 emb|CAA72381.1| 14-3-3 protein [Solanum tuberosum]
 gb|AAL50217.1| 14-3-3 protein isoform 16R [Solanum tuberosum]
Length=258

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 50/52 (96%), Gaps = 1/52 (2%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDN  153
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDG DEIKEA+ KPDN
Sbjct  205  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGTDEIKEAAPKPDN  256



>gb|AAT35546.1| 14-3-3 protein [Tropaeolum majus]
Length=259

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/49 (96%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  147
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA+ P
Sbjct  204  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAAAP  252



>gb|KHG29578.1| Uncharacterized protein F383_10830 [Gossypium arboreum]
Length=261

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGE+SYKDSTLIMQLLRDNLTLWTSDMQDDG DEIKEASKP  E
Sbjct  207  EAIAELDTLGEDSYKDSTLIMQLLRDNLTLWTSDMQDDGTDEIKEASKPAEE  258



>ref|XP_010917299.1| PREDICTED: 14-3-3-like protein [Elaeis guineensis]
Length=258

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA K ++E
Sbjct  205  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAPKHEDE  256



>ref|NP_001274876.1| 14-3-3-like protein RA215 [Solanum tuberosum]
 gb|ABC01910.1| 14-3-3 protein-like protein [Solanum tuberosum]
Length=255

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDG D+IKE SK DNE
Sbjct  204  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGTDDIKEPSKADNE  255



>ref|XP_003526571.1| PREDICTED: 14-3-3-like protein-like [Glycine max]
Length=259

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 52/53 (98%), Gaps = 1/53 (2%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA+ KPD++
Sbjct  207  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAAPKPDDQ  259



>ref|XP_008782168.1| PREDICTED: 14-3-3 protein 6-like [Phoenix dactylifera]
Length=258

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDG DEIKEA K D+E
Sbjct  205  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGVDEIKEAPKHDDE  256



>ref|XP_011098686.1| PREDICTED: 14-3-3-like protein C [Sesamum indicum]
 ref|XP_011098695.1| PREDICTED: 14-3-3-like protein C [Sesamum indicum]
 ref|XP_011098703.1| PREDICTED: 14-3-3-like protein C [Sesamum indicum]
Length=257

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  150
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGAD+IKEA KP+
Sbjct  204  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADDIKEAPKPE  253



>gb|KHG29579.1| Uncharacterized protein F383_10830 [Gossypium arboreum]
Length=280

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGE+SYKDSTLIMQLLRDNLTLWTSDMQDDG DEIKEASKP  E
Sbjct  207  EAIAELDTLGEDSYKDSTLIMQLLRDNLTLWTSDMQDDGTDEIKEASKPAEE  258



>gb|ABR25623.1| 14-3-3-like protein a [Oryza sativa Indica Group]
Length=100

 Score = 93.2 bits (230),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAI+ELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDG DE+++A+KP++E
Sbjct  48   EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGGDEMRDATKPEDE  99



>gb|AES73074.2| general regulatory factor 2 [Medicago truncatula]
Length=260

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 51/53 (96%), Gaps = 1/53 (2%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA+ KPD +
Sbjct  207  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAAPKPDEQ  259



>ref|XP_008387340.1| PREDICTED: 14-3-3-like protein 16R [Malus domestica]
Length=261

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  165
            EAIAELDTLGE+SYKDSTLIMQLLRDNLTLWTSDMQDDG DEIKEA KP  E  Q
Sbjct  207  EAIAELDTLGEDSYKDSTLIMQLLRDNLTLWTSDMQDDGTDEIKEAPKPQAEPQQ  261



>ref|XP_002262802.1| PREDICTED: 14-3-3-like protein [Vitis vinifera]
 emb|CAN64479.1| hypothetical protein VITISV_032972 [Vitis vinifera]
Length=255

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDG DEIKEA K D E
Sbjct  204  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGGDEIKEAPKHDEE  255



>ref|XP_009375314.1| PREDICTED: 14-3-3-like protein 16R [Pyrus x bretschneideri]
Length=261

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  165
            EAIAELDTLGE+SYKDSTLIMQLLRDNLTLWTSDMQDDG DEIKEA KP  E  Q
Sbjct  207  EAIAELDTLGEDSYKDSTLIMQLLRDNLTLWTSDMQDDGTDEIKEAPKPQAEPQQ  261



>ref|XP_009350360.1| PREDICTED: 14-3-3-like protein 16R [Pyrus x bretschneideri]
Length=261

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  165
            EAIAELDTLGE+SYKDSTLIMQLLRDNLTLWTSDMQDDG DEIKEA KP  E  Q
Sbjct  207  EAIAELDTLGEDSYKDSTLIMQLLRDNLTLWTSDMQDDGTDEIKEAPKPQAEAQQ  261



>gb|KJB12306.1| hypothetical protein B456_002G012500 [Gossypium raimondii]
Length=261

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  165
            EAI+ELDTLGE+SYKDSTLIMQLLRDNLTLWTSDMQ+DG DEIKEASKP++E  Q
Sbjct  207  EAISELDTLGEDSYKDSTLIMQLLRDNLTLWTSDMQEDGTDEIKEASKPEDEKQQ  261



>gb|AEH50082.1| 14-3-3-like protein 2 [Gossypium hirsutum]
Length=261

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  165
            EAI+ELDTLGE+SYKDSTLIMQLLRDNLTLWTSDMQ+DG DEIKEASKP++E  Q
Sbjct  207  EAISELDTLGEDSYKDSTLIMQLLRDNLTLWTSDMQEDGTDEIKEASKPEDEKQQ  261



>gb|KHG12828.1| Uncharacterized protein F383_00373 [Gossypium arboreum]
Length=261

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  165
            EAI+ELDTLGE+SYKDSTLIMQLLRDNLTLWTSDMQ+DG DEIKEASKP++E  Q
Sbjct  207  EAISELDTLGEDSYKDSTLIMQLLRDNLTLWTSDMQEDGTDEIKEASKPEDEKQQ  261



>ref|XP_003602823.1| 14-3-3-like protein [Medicago truncatula]
Length=303

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 51/53 (96%), Gaps = 1/53 (2%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA+ KPD +
Sbjct  207  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAAPKPDEQ  259



>ref|XP_002513956.1| 14-3-3 protein, putative [Ricinus communis]
 gb|EEF48539.1| 14-3-3 protein, putative [Ricinus communis]
Length=257

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 51/53 (96%), Gaps = 1/53 (2%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA+ KP +E
Sbjct  203  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAAPKPSDE  255



>ref|XP_002444843.1| hypothetical protein SORBIDRAFT_07g029110 [Sorghum bicolor]
 gb|EES14338.1| hypothetical protein SORBIDRAFT_07g029110 [Sorghum bicolor]
Length=259

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 52/52 (100%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAI+ELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQ+DG+DE+++ASKPD+E
Sbjct  208  EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQEDGSDEMRDASKPDDE  259



>ref|XP_010676024.1| PREDICTED: 14-3-3-like protein [Beta vulgaris subsp. vulgaris]
Length=261

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASK  144
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA+K
Sbjct  206  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAAK  253



>ref|NP_001234677.1| 14-3-3 protein 3 [Solanum lycopersicum]
 gb|AAA99430.1| 14-3-3 protein homologue [Solanum lycopersicum]
 prf||2019487A 14-3-3 protein
Length=229

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  150
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKE  KP+
Sbjct  177  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEDPKPE  226



>gb|AAD27823.2| 14-3-3 protein [Populus tremula x Populus alba]
Length=261

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 51/53 (96%), Gaps = 1/53 (2%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA+ KP +E
Sbjct  207  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAAPKPGDE  259



>ref|NP_001275270.1| 14-3-3-like protein C-like [Solanum tuberosum]
 emb|CAA72383.1| 14-3-3 protein [Solanum tuberosum]
Length=259

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  150
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKE  KP+
Sbjct  207  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEDPKPE  256



>ref|XP_006423811.1| hypothetical protein CICLE_v10029087mg [Citrus clementina]
 ref|XP_006492624.1| PREDICTED: 14-3-3 protein 6-like [Citrus sinensis]
 gb|ESR37051.1| hypothetical protein CICLE_v10029087mg [Citrus clementina]
 gb|KDO45012.1| hypothetical protein CISIN_1g024897mg [Citrus sinensis]
Length=261

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  165
            EAI+ELDTLGE+SYKDSTLIMQLLRDNLTLWTSDMQDDG DEIKEA KP+ E  Q
Sbjct  207  EAISELDTLGEDSYKDSTLIMQLLRDNLTLWTSDMQDDGTDEIKEAPKPEEEKKQ  261



>ref|XP_002301071.1| 14-3-3 protein 32kDa endonuclease [Populus trichocarpa]
 gb|ABK93142.1| unknown [Populus trichocarpa]
 gb|EEE80344.1| 14-3-3 protein 32kDa endonuclease [Populus trichocarpa]
Length=261

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 51/53 (96%), Gaps = 1/53 (2%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA+ KP +E
Sbjct  207  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAAPKPGDE  259



>ref|XP_006659506.1| PREDICTED: LOW QUALITY PROTEIN: 14-3-3-like protein GF14-A-like 
[Oryza brachyantha]
Length=264

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAI+ELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDG DE+++A+KPD+E
Sbjct  212  EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGGDEMRDATKPDDE  263



>ref|XP_008346360.1| PREDICTED: 14-3-3-like protein [Malus domestica]
 ref|XP_008356357.1| PREDICTED: 14-3-3-like protein [Malus domestica]
Length=263

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE*SQ  165
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA+ KP  E  Q
Sbjct  208  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAAPKPTEEPKQ  263



>ref|NP_001267852.1| 14-3-3 protein [Vitis vinifera]
 gb|ACO40495.1| 14-3-3 protein [Vitis vinifera]
Length=260

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDN TLWTSDMQDDGADEIKEA K D+E
Sbjct  207  EAIAELDTLGEESYKDSTLIMQLLRDNHTLWTSDMQDDGADEIKEAPKRDDE  258



>ref|XP_011016779.1| PREDICTED: 14-3-3-like protein [Populus euphratica]
Length=261

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 51/53 (96%), Gaps = 1/53 (2%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA+ KP +E
Sbjct  207  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAAPKPADE  259



>gb|KHN26095.1| 14-3-3-like protein [Glycine soja]
 gb|KHN35492.1| 14-3-3-like protein [Glycine soja]
Length=132

 Score = 93.2 bits (230),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/47 (98%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAS  141
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA+
Sbjct  78   EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAA  124



>sp|P93209.1|14333_SOLLC RecName: Full=14-3-3 protein 3; AltName: Full=PBLT3 [Solanum 
lycopersicum]
 emb|CAA65147.1| 14-3-3 protein [Solanum lycopersicum]
Length=260

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  150
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKE  KP+
Sbjct  208  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEDPKPE  257



>gb|ABA81882.1| 14-3-3 protein-like [Solanum tuberosum]
Length=255

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTS+MQDDG D+IKE SK DNE
Sbjct  204  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSNMQDDGTDDIKEPSKADNE  255



>ref|XP_008805904.1| PREDICTED: 14-3-3 protein 6-like [Phoenix dactylifera]
Length=258

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKE +K ++E
Sbjct  206  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKETTKHEDE  257



>ref|XP_011074203.1| PREDICTED: 14-3-3-like protein B [Sesamum indicum]
Length=264

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  150
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQD+GAD+IKEA KP+
Sbjct  208  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDEGADDIKEAPKPE  257



>gb|AFK34151.1| unknown [Medicago truncatula]
Length=260

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 50/53 (94%), Gaps = 1/53 (2%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE  156
            EAIAELDTLGEESYKDSTLIMQL RDNLTLWTSDMQDDGADEIKEA+ KPD +
Sbjct  207  EAIAELDTLGEESYKDSTLIMQLFRDNLTLWTSDMQDDGADEIKEAAPKPDEQ  259



>ref|XP_010060042.1| PREDICTED: 14-3-3-like protein [Eucalyptus grandis]
Length=262

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQ+DGADEIKEA K D +
Sbjct  210  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQEDGADEIKEAPKADEQ  261



>ref|XP_007018723.1| General regulatory factor 2, OMEGA [Theobroma cacao]
 gb|EOY15948.1| General regulatory factor 2, OMEGA [Theobroma cacao]
Length=267

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASK  144
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA K
Sbjct  207  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAPK  254



>ref|XP_009632004.1| PREDICTED: 14-3-3-like protein B [Nicotiana tomentosiformis]
 dbj|BAB68526.1| 14-3-3 protein [Nicotiana tabacum]
 dbj|BAD12170.1| 14-3-3 b-2 protein [Nicotiana tabacum]
Length=255

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 50/52 (96%), Gaps = 1/52 (2%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKE +K DNE
Sbjct  203  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKE-TKADNE  253



>ref|XP_004973733.1| PREDICTED: 14-3-3-like protein GF14-A-like [Setaria italica]
Length=259

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAI+ELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDG DE+++ASKP++E
Sbjct  208  EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGGDEMRDASKPEDE  259



>ref|XP_010937379.1| PREDICTED: 14-3-3-like protein B [Elaeis guineensis]
Length=261

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKE +K ++E
Sbjct  207  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKETTKREDE  258



>ref|XP_008219335.1| PREDICTED: 14-3-3-like protein [Prunus mume]
Length=262

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/51 (94%), Positives = 50/51 (98%), Gaps = 1/51 (2%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPD  150
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA+ KP+
Sbjct  208  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAAPKPE  258



>ref|XP_007223394.1| hypothetical protein PRUPE_ppa010148mg [Prunus persica]
 gb|EMJ24593.1| hypothetical protein PRUPE_ppa010148mg [Prunus persica]
Length=262

 Score = 95.5 bits (236),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/51 (94%), Positives = 50/51 (98%), Gaps = 1/51 (2%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPD  150
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA+ KP+
Sbjct  208  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAAPKPE  258



>ref|XP_009777542.1| PREDICTED: 14-3-3-like protein B [Nicotiana sylvestris]
 sp|O49995.1|1433B_TOBAC RecName: Full=14-3-3-like protein B [Nicotiana tabacum]
 gb|AAC49891.1| 14-3-3 isoform b [Nicotiana tabacum]
 dbj|BAD12169.1| 14-3-3 b-1 protein [Nicotiana tabacum]
Length=255

 Score = 95.5 bits (236),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 50/52 (96%), Gaps = 1/52 (2%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKE +K DNE
Sbjct  203  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKE-TKTDNE  253



>ref|XP_009381498.1| PREDICTED: 14-3-3 protein 6-like [Musa acuminata subsp. malaccensis]
Length=257

 Score = 95.5 bits (236),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  153
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQ+DG DE++E SKPD+
Sbjct  205  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQEDGVDEMRETSKPDD  255



>gb|ABQ95992.1| 14-3-3-like protein [Cicer arietinum]
 gb|ABQ95994.1| 14-3-3-like protein [Cicer arietinum]
Length=261

 Score = 95.5 bits (236),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  165
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA+   N+  Q
Sbjct  207  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAAPKGNDEPQ  261



>sp|P42653.1|1433A_VICFA RecName: Full=14-3-3-like protein A; AltName: Full=VFA-1433A 
[Vicia faba]
 emb|CAA88415.1| 14-3-3 brain protein homolog [Vicia faba]
Length=261

 Score = 95.5 bits (236),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  165
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA+   N+  Q
Sbjct  207  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAAPKGNDEPQ  261



>emb|CAB42547.1| 14-3-3-like protein [Pisum sativum]
Length=261

 Score = 95.5 bits (236),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  165
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA+   N+  Q
Sbjct  207  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAAPKGNDEPQ  261



>ref|XP_008804781.1| PREDICTED: 14-3-3 protein 6 [Phoenix dactylifera]
 ref|XP_008804782.1| PREDICTED: 14-3-3 protein 6 [Phoenix dactylifera]
Length=260

 Score = 95.5 bits (236),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDG DEIKEA K ++E
Sbjct  207  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGVDEIKEAPKHEDE  258



>ref|XP_008778192.1| PREDICTED: 14-3-3 protein 6-like [Phoenix dactylifera]
Length=262

 Score = 95.5 bits (236),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDG DEIKEA K ++E
Sbjct  209  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGVDEIKEAPKHEDE  260



>gb|KJB58994.1| hypothetical protein B456_009G234600 [Gossypium raimondii]
 gb|KJB58995.1| hypothetical protein B456_009G234600 [Gossypium raimondii]
 gb|KJB58996.1| hypothetical protein B456_009G234600 [Gossypium raimondii]
Length=268

 Score = 95.5 bits (236),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  150
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGAD+IKEA K D
Sbjct  209  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADDIKEAPKRD  258



>gb|ABY65001.1| 14-3-3b protein [Gossypium hirsutum]
Length=268

 Score = 95.5 bits (236),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  150
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGAD+IKEA K D
Sbjct  209  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADDIKEAPKRD  258



>emb|CDO97418.1| unnamed protein product [Coffea canephora]
Length=131

 Score = 92.8 bits (229),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGE+SYKDSTLIMQLLRDNLTLWTSDMQDDGA+EIKE SK ++E
Sbjct  78   EAIAELDTLGEDSYKDSTLIMQLLRDNLTLWTSDMQDDGAEEIKETSKREDE  129



>gb|KHG20751.1| Uncharacterized protein F383_04220 [Gossypium arboreum]
Length=269

 Score = 95.5 bits (236),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  150
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGAD+IKEA K D
Sbjct  209  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADDIKEAPKRD  258



>ref|XP_008790917.1| PREDICTED: 14-3-3 protein 6 [Phoenix dactylifera]
Length=264

 Score = 95.5 bits (236),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGAD+IKE +K D+E
Sbjct  212  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADDIKETTKNDDE  263



>gb|AFK35595.1| unknown [Lotus japonicus]
Length=259

 Score = 95.1 bits (235),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 51/53 (96%), Gaps = 1/53 (2%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQD+GADEIKEA+ KPD +
Sbjct  207  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDEGADEIKEAAPKPDEQ  259



>gb|KCW66571.1| hypothetical protein EUGRSUZ_F00370 [Eucalyptus grandis]
 gb|KCW66572.1| hypothetical protein EUGRSUZ_F00370 [Eucalyptus grandis]
Length=332

 Score = 95.9 bits (237),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQ+DGADEIKEA K D +
Sbjct  280  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQEDGADEIKEAPKADEQ  331



>gb|KHG14081.1| Uncharacterized protein F383_17151 [Gossypium arboreum]
Length=269

 Score = 95.1 bits (235),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSD+QDDGADEIKEA K + E
Sbjct  208  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDLQDDGADEIKEAPKQEEE  259



>ref|XP_004252529.1| PREDICTED: 14-3-3 protein 2 [Solanum lycopersicum]
 sp|P93208.2|14332_SOLLC RecName: Full=14-3-3 protein 2 [Solanum lycopersicum]
 emb|CAA65146.2| 14-3-3 protein [Solanum lycopersicum]
Length=254

 Score = 95.1 bits (235),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 50/52 (96%), Gaps = 1/52 (2%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKE +K DNE
Sbjct  202  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKE-TKNDNE  252



>gb|ACF23046.1| ST73-2, partial [Eutrema halophilum]
Length=54

 Score = 90.5 bits (223),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  153
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDM D+  DEIKEASKP+ 
Sbjct  2    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMTDEAGDEIKEASKPEG  52



>ref|XP_010428953.1| PREDICTED: 14-3-3-like protein GF14 omega [Camelina sativa]
Length=260

 Score = 95.1 bits (235),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  147
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDD ADEIKEA+ P
Sbjct  205  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDAADEIKEAAAP  253



>ref|XP_006302543.1| hypothetical protein CARUB_v10020644mg, partial [Capsella rubella]
 gb|EOA35441.1| hypothetical protein CARUB_v10020644mg, partial [Capsella rubella]
Length=327

 Score = 95.5 bits (236),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  147
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDD ADEIKEA+ P
Sbjct  269  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDAADEIKEAAAP  317



>ref|NP_001234097.1| 14-3-3 protein 6 [Solanum lycopersicum]
 sp|P93211.2|14336_SOLLC RecName: Full=14-3-3 protein 6 [Solanum lycopersicum]
 gb|AAL04424.1| 14-3-3 family protein [Solanum lycopersicum]
 emb|CAA65149.2| 14-3-3 protein [Solanum lycopersicum]
Length=258

 Score = 95.1 bits (235),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 48/51 (94%), Positives = 49/51 (96%), Gaps = 1/51 (2%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPD  150
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDG DEIKEA+ KPD
Sbjct  205  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGTDEIKEATPKPD  255



>ref|XP_002887733.1| GF14 omega [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63992.1| GF14 omega [Arabidopsis lyrata subsp. lyrata]
Length=260

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  147
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDD ADEIKEA+ P
Sbjct  205  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDAADEIKEAAAP  253



>ref|XP_010939692.1| PREDICTED: 14-3-3 protein 6-like [Elaeis guineensis]
Length=257

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAI+ELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGAD+IKEA+K ++E
Sbjct  205  EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADDIKEATKHEDE  256



>gb|EAZ43101.1| hypothetical protein OsJ_27692 [Oryza sativa Japonica Group]
Length=264

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAI+ELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDG DE+++A+KP++E
Sbjct  212  EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGGDEMRDATKPEDE  263



>ref|NP_565176.1| 14-3-3-like protein GF14 omega [Arabidopsis thaliana]
 sp|Q01525.2|14332_ARATH RecName: Full=14-3-3-like protein GF14 omega; AltName: Full=General 
regulatory factor 2 [Arabidopsis thaliana]
 gb|AAF71808.1|AC013430_17 F3F9.16 [Arabidopsis thaliana]
 gb|AAL58901.1|AF462807_1 At1g78300/F3F9_16 [Arabidopsis thaliana]
 gb|AAA32798.1| GF14 [Arabidopsis thaliana]
 gb|AAL76145.1| At1g78300/F3F9_16 [Arabidopsis thaliana]
 gb|AAM67316.1| 14-3-3 protein GF14omega (grf2) [Arabidopsis thaliana]
 gb|AEE36093.1| 14-3-3-like protein GF14 omega [Arabidopsis thaliana]
Length=259

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  147
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDD ADEIKEA+ P
Sbjct  204  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDAADEIKEAAAP  252



>gb|AAA96253.1| GF14omega isoform [Arabidopsis thaliana]
Length=259

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  147
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDD ADEIKEA+ P
Sbjct  204  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDAADEIKEAAAP  252



>ref|XP_007141044.1| hypothetical protein PHAVU_008G162500g [Phaseolus vulgaris]
 gb|ESW13038.1| hypothetical protein PHAVU_008G162500g [Phaseolus vulgaris]
Length=261

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 50/53 (94%), Gaps = 1/53 (2%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA+ K D E
Sbjct  207  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAAPKADGE  259



>ref|XP_010025879.1| PREDICTED: 14-3-3-like protein [Eucalyptus grandis]
 gb|KCW83076.1| hypothetical protein EUGRSUZ_B00034 [Eucalyptus grandis]
Length=263

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDG DEIKE +K D +
Sbjct  212  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGVDEIKETAKADEQ  263



>ref|XP_008386122.1| PREDICTED: 14-3-3-like protein [Malus domestica]
Length=264

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  147
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDD ADE+KEA+ P
Sbjct  208  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDAADEVKEAAAP  256



>gb|ADP24188.1| 14-3-3-like protein [Galega orientalis]
Length=260

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA+   +E
Sbjct  208  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAAPKGDE  259



>ref|NP_001062060.1| Os08g0480800 [Oryza sativa Japonica Group]
 sp|Q84J55.1|14331_ORYSJ RecName: Full=14-3-3-like protein GF14-A; AltName: Full=G-box 
factor 14-3-3 homolog A [Oryza sativa Japonica Group]
 gb|AAO72553.1| WIN2-like protein [Oryza sativa Japonica Group]
 gb|AAO72644.1| TaWIN2-like protein [Oryza sativa Japonica Group]
 dbj|BAD09765.1| putative TaWIN2 [Oryza sativa Japonica Group]
 dbj|BAD10275.1| putative TaWIN2 [Oryza sativa Japonica Group]
 dbj|BAF23974.1| Os08g0480800 [Oryza sativa Japonica Group]
 gb|EAZ07375.1| hypothetical protein OsI_29626 [Oryza sativa Indica Group]
Length=264

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAI+ELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDG DE+++A+KP++E
Sbjct  212  EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGGDEMRDATKPEDE  263



>ref|XP_009373053.1| PREDICTED: 14-3-3-like protein [Pyrus x bretschneideri]
Length=319

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE*SQ  165
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGAD+IKEA+ KP  E  Q
Sbjct  264  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADDIKEAAPKPTEEPKQ  319



>gb|AFK37964.1| unknown [Medicago truncatula]
Length=260

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/47 (98%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAS  141
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA+
Sbjct  207  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAA  253



>ref|XP_003615160.1| 14-3-3 protein [Medicago truncatula]
 gb|ACJ84712.1| unknown [Medicago truncatula]
 gb|AES98118.1| general regulatory factor 2 [Medicago truncatula]
Length=260

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/47 (98%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAS  141
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA+
Sbjct  207  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAA  253



>ref|XP_007200586.1| hypothetical protein PRUPE_ppa010141mg [Prunus persica]
 ref|XP_008237283.1| PREDICTED: 14-3-3-like protein 16R [Prunus mume]
 gb|EMJ01785.1| hypothetical protein PRUPE_ppa010141mg [Prunus persica]
Length=262

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE*SQ  165
            EAIAELDTLGE+SYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA+ KP  E  Q
Sbjct  207  EAIAELDTLGEDSYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAAPKPQAEQQQ  262



>ref|XP_010272995.1| PREDICTED: LOW QUALITY PROTEIN: 14-3-3-like protein [Nelumbo 
nucifera]
Length=300

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 51/53 (96%), Gaps = 1/53 (2%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA+ K D+E
Sbjct  210  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAAPKRDDE  262



>emb|CDX79255.1| BnaC06g20480D [Brassica napus]
 emb|CDX68022.1| BnaA07g20620D [Brassica napus]
Length=260

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  4    AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  147
            AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDD ADEIKEAS P
Sbjct  206  AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDAADEIKEASAP  253



>ref|XP_009104576.1| PREDICTED: 14-3-3-like protein GF14 omega [Brassica rapa]
Length=260

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  4    AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  147
            AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDD ADEIKEAS P
Sbjct  206  AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDAADEIKEASAP  253



>sp|P46266.1|1433_PEA RecName: Full=14-3-3-like protein [Pisum sativum]
 gb|AAA85817.1| 14-3-3-like protein [Pisum sativum]
Length=260

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA+   +E
Sbjct  207  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAAPKADE  258



>gb|ACR33862.1| unknown [Zea mays]
Length=130

 Score = 91.7 bits (226),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAI+ELD+LGEESYKDSTLIMQLLRDNLTLWTSDMQ+DG DE+++A+KPD E
Sbjct  78   EAISELDSLGEESYKDSTLIMQLLRDNLTLWTSDMQEDGGDEMRDANKPDEE  129



>emb|CAB42546.2| 14-3-3-like protein [Pisum sativum]
Length=260

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA+   +E
Sbjct  207  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAAPKADE  258



>ref|NP_001238389.1| 14-3-3 protein SGF14h [Glycine max]
 gb|ADU60526.1| SGF14h [Glycine max]
 gb|KHN19782.1| 14-3-3-like protein [Glycine soja]
Length=259

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/47 (98%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAS  141
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA+
Sbjct  207  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAA  253



>ref|XP_003544808.1| PREDICTED: 14-3-3-like protein-like [Glycine max]
Length=261

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/47 (98%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAS  141
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA+
Sbjct  207  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAA  253



>ref|NP_001239690.1| uncharacterized protein LOC100798989 [Glycine max]
 gb|ACU21064.1| unknown [Glycine max]
Length=262

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/47 (98%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAS  141
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA+
Sbjct  208  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAA  254



>dbj|BAB47119.1| 14-3-3 protein [Vigna angularis]
Length=259

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/47 (98%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAS  141
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA+
Sbjct  207  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAA  253



>gb|ACN28697.1| unknown [Zea mays]
Length=143

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAI+ELD+LGEESYKDSTLIMQLLRDNLTLWTSDMQ+DG DE+++A+KPD E
Sbjct  91   EAISELDSLGEESYKDSTLIMQLLRDNLTLWTSDMQEDGGDEMRDANKPDEE  142



>ref|XP_007136271.1| hypothetical protein PHAVU_009G032500g [Phaseolus vulgaris]
 ref|XP_007136272.1| hypothetical protein PHAVU_009G032500g [Phaseolus vulgaris]
 gb|AGV54448.1| 14-3-3 protein [Phaseolus vulgaris]
 gb|ESW08265.1| hypothetical protein PHAVU_009G032500g [Phaseolus vulgaris]
 gb|ESW08266.1| hypothetical protein PHAVU_009G032500g [Phaseolus vulgaris]
Length=259

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/47 (98%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAS  141
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA+
Sbjct  207  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAA  253



>ref|XP_008444853.1| PREDICTED: 14-3-3-like protein [Cucumis melo]
Length=261

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 48/52 (92%), Gaps = 1/52 (2%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA  P  E
Sbjct  207  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAP-PKRE  257



>ref|XP_004152627.1| PREDICTED: 14-3-3-like protein-like [Cucumis sativus]
 ref|XP_004162227.1| PREDICTED: 14-3-3-like protein-like [Cucumis sativus]
 gb|KGN62706.1| hypothetical protein Csa_2G369070 [Cucumis sativus]
Length=261

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 48/52 (92%), Gaps = 1/52 (2%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA  P  E
Sbjct  207  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAP-PKRE  257



>ref|XP_009404035.1| PREDICTED: 14-3-3 protein 6 [Musa acuminata subsp. malaccensis]
Length=256

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDG DEIKEA K +++
Sbjct  205  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGVDEIKEAPKGEDQ  256



>ref|NP_001265880.1| 14-3-3-like protein A-like [Cicer arietinum]
 gb|AEE60912.1| 14.3.3-like protein [Cicer arietinum]
Length=261

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  165
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDM+DDGADEIKEA+   N+  Q
Sbjct  207  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMRDDGADEIKEAAPKGNDEPQ  261



>sp|O65352.1|1433_HELAN RecName: Full=14-3-3-like protein [Helianthus annuus]
 gb|AAC17447.1| 14-3-3-like protein [Helianthus annuus]
Length=259

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGE+SYKDSTLIMQLLRDNLTLWTSDMQDD A+E+KEA KPD++
Sbjct  208  EAIAELDTLGEDSYKDSTLIMQLLRDNLTLWTSDMQDDTAEEVKEAPKPDDQ  259



>ref|XP_010543865.1| PREDICTED: 14-3-3-like protein GF14 omega [Tarenaya hassleriana]
Length=262

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 50/53 (94%), Gaps = 1/53 (2%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDG DEIKEA+ KP +E
Sbjct  206  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGVDEIKEATPKPADE  258



>ref|XP_009380212.1| PREDICTED: 14-3-3-like protein [Musa acuminata subsp. malaccensis]
Length=258

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELD+LGEESYKDSTLIMQLLRDNLTLWTSDMQDDG DEIKEA K + E
Sbjct  206  EAIAELDSLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGVDEIKEAPKQEEE  257



>ref|XP_010521176.1| PREDICTED: 14-3-3-like protein GF14 omega [Tarenaya hassleriana]
Length=260

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 49/54 (91%), Gaps = 2/54 (4%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKE--ASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDD ADEIKE  ASKP  E
Sbjct  205  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDAADEIKEAAASKPVEE  258



>gb|AGG10561.1| 14-3-3 [Elaeis guineensis]
Length=258

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDG DE KEA K + E
Sbjct  205  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGVDEFKEAPKHEGE  256



>ref|XP_009609727.1| PREDICTED: 14-3-3-like protein A [Nicotiana tomentosiformis]
 ref|XP_009622063.1| PREDICTED: 14-3-3-like protein A [Nicotiana tomentosiformis]
 dbj|BAD12168.1| 14-3-3 a-1 protein [Nicotiana tabacum]
Length=255

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDG DEIKE SK + +
Sbjct  203  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGTDEIKEPSKAEEQ  254



>ref|XP_010535331.1| PREDICTED: 14-3-3-like protein GF14 omega [Tarenaya hassleriana]
Length=259

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 49/53 (92%), Gaps = 1/53 (2%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKE-ASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDD ADEIKE A+KP  E
Sbjct  205  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDAADEIKEAAAKPGEE  257



>ref|XP_009786458.1| PREDICTED: 14-3-3-like protein A [Nicotiana sylvestris]
Length=255

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDG DEIKE SK + +
Sbjct  203  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGTDEIKEPSKAEEQ  254



>gb|ACG37387.1| 14-3-3-like protein A [Zea mays]
Length=220

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAI+ELD+LGEESYKDSTLIMQLLRDNLTLWTSDMQ+DG DE+++A+KPD E
Sbjct  168  EAISELDSLGEESYKDSTLIMQLLRDNLTLWTSDMQEDGGDEMRDANKPDEE  219



>ref|XP_010534083.1| PREDICTED: 14-3-3-like protein GF14 omega [Tarenaya hassleriana]
Length=259

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 49/53 (92%), Gaps = 1/53 (2%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDD ADEIKEA+ KP  E
Sbjct  205  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDAADEIKEAAPKPAEE  257



>gb|ADO95303.1| 14-3-3-like protein GF14 Psi [Eutrema salsugineum]
Length=255

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  150
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDM D+  DEIKEASKP+
Sbjct  203  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMTDEAGDEIKEASKPE  252



>gb|AGV54291.1| 14-3-3 protein [Phaseolus vulgaris]
Length=261

 Score = 93.6 bits (231),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAS  141
            EAIAELDTLGEESY+DSTLIMQLLRDNLTLWTSDMQDDGADEIKEA+
Sbjct  207  EAIAELDTLGEESYRDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAA  253



>ref|XP_006405765.1| hypothetical protein EUTSA_v10027892mg [Eutrema salsugineum]
 gb|ESQ47218.1| hypothetical protein EUTSA_v10027892mg [Eutrema salsugineum]
Length=258

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  150
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDM D+  DEIKEASKP+
Sbjct  206  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMTDEAGDEIKEASKPE  255



>ref|XP_009139790.1| PREDICTED: 14-3-3-like protein GF14 psi [Brassica rapa]
Length=257

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  150
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDM D+  DEIKEASKP+
Sbjct  203  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMTDEAGDEIKEASKPE  252



>emb|CDY01659.1| BnaC04g30930D [Brassica napus]
Length=257

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  150
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDM D+  DEIKEASKP+
Sbjct  203  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMTDEAGDEIKEASKPE  252



>emb|CDX74521.1| BnaA04g08680D [Brassica napus]
Length=257

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  150
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDM D+  DEIKEASKP+
Sbjct  203  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMTDEAGDEIKEASKPE  252



>gb|KJB32075.1| hypothetical protein B456_005G222600 [Gossypium raimondii]
Length=261

 Score = 93.2 bits (230),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGE+SYKDSTLIMQLLRDNLTLWTSDMQDDG DEIKEA K ++E
Sbjct  207  EAIAELDTLGEDSYKDSTLIMQLLRDNLTLWTSDMQDDGTDEIKEAPKQEDE  258



>ref|NP_568557.1| 14-3-3-like protein GF14 psi [Arabidopsis thaliana]
 sp|P42644.2|14333_ARATH RecName: Full=14-3-3-like protein GF14 psi; AltName: Full=General 
regulatory factor 3; AltName: Full=Protein RARE COLD INDUCIBLE 
1A [Arabidopsis thaliana]
 gb|AAL06546.1|AF412093_1 AT5g16050/F1N13_190 [Arabidopsis thaliana]
 emb|CAA52237.1| RCI14A [Arabidopsis thaliana]
 dbj|BAB10138.1| 14-3-3 protein homolog RCI1 [Arabidopsis thaliana]
 gb|AAM16237.1| AT5g16050/F1N13_190 [Arabidopsis thaliana]
 dbj|BAF00404.1| 14-3-3 protein homolog RCI1 [Arabidopsis thaliana]
 dbj|BAE98382.1| 14-3-3 protein homolog RCI1 [Arabidopsis thaliana]
 gb|AED94323.1| 14-3-3-like protein GF14 psi [Arabidopsis thaliana]
Length=255

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +1

Query  4    AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  150
            AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDM D+  DEIKEASKPD
Sbjct  204  AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMTDEAGDEIKEASKPD  252



>gb|AAA32799.1| GF14 psi chain [Arabidopsis thaliana]
 gb|AAA96252.1| GF14psi isoform [Arabidopsis thaliana]
Length=255

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +1

Query  4    AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  150
            AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDM D+  DEIKEASKPD
Sbjct  204  AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMTDEAGDEIKEASKPD  252



>ref|XP_003560774.1| PREDICTED: 14-3-3-like protein A [Brachypodium distachyon]
 ref|XP_010231073.1| PREDICTED: 14-3-3-like protein A [Brachypodium distachyon]
Length=260

 Score = 92.8 bits (229),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELD+LGEESYKDSTLIMQLLRDNLTLWTSD  D+G DEIKEASKP+ E
Sbjct  207  EAIAELDSLGEESYKDSTLIMQLLRDNLTLWTSDNADEGGDEIKEASKPEGE  258



>gb|KJB12045.1| hypothetical protein B456_002G141000 [Gossypium raimondii]
 gb|KJB12047.1| hypothetical protein B456_002G141000 [Gossypium raimondii]
 gb|KJB12048.1| hypothetical protein B456_002G141000 [Gossypium raimondii]
Length=269

 Score = 92.8 bits (229),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 45/46 (98%), Positives = 46/46 (100%), Gaps = 0/46 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEA  138
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSD+QDDGADEIKEA
Sbjct  208  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDLQDDGADEIKEA  253



>ref|NP_001149589.1| 14-3-3-like protein A [Zea mays]
 gb|ACG35962.1| 14-3-3-like protein A [Zea mays]
 gb|AFW65100.1| 14-3-3-like protein A [Zea mays]
Length=259

 Score = 92.4 bits (228),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAI+ELD+LGEESYKDSTLIMQLLRDNLTLWTSDMQ+DG DE+++A+KPD E
Sbjct  207  EAISELDSLGEESYKDSTLIMQLLRDNLTLWTSDMQEDGGDEMRDANKPDEE  258



>gb|KFK24544.1| hypothetical protein AALP_AAs41798U000400 [Arabis alpina]
Length=264

 Score = 92.4 bits (228),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 44/49 (90%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  147
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQD+G +EIKEA+ P
Sbjct  207  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDEGTEEIKEAAAP  255



>ref|XP_006397430.1| hypothetical protein EUTSA_v10001833mg [Eutrema salsugineum]
 gb|ADO95302.1| 14-3-3-like protein GF14 Phi [Eutrema salsugineum]
 gb|ESQ38883.1| hypothetical protein EUTSA_v10001833mg [Eutrema salsugineum]
Length=267

 Score = 92.4 bits (228),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 44/49 (90%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  147
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQD+G +EIKEA+ P
Sbjct  210  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDEGTEEIKEAAAP  258



>ref|XP_006303273.1| hypothetical protein CARUB_v10010011mg [Capsella rubella]
 gb|EOA36171.1| hypothetical protein CARUB_v10010011mg [Capsella rubella]
Length=270

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/49 (90%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  147
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQD+G +EIKEA+ P
Sbjct  213  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDEGTEEIKEAAAP  261



>gb|KDP40925.1| hypothetical protein JCGZ_24924 [Jatropha curcas]
Length=261

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  165
            EAI+ELDTLGE+SYKDSTLIMQLLRDNLTLWTSDMQDDG DEIK+ASK + E  Q
Sbjct  207  EAISELDTLGEDSYKDSTLIMQLLRDNLTLWTSDMQDDGTDEIKDASKKEEEQKQ  261



>ref|XP_007042905.1| General regulatory factor 2, OMEGA [Theobroma cacao]
 gb|EOX98736.1| General regulatory factor 2, OMEGA [Theobroma cacao]
Length=261

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  165
            EAI+ELDTLGE+SYKDSTLIMQLLRDNLTLWTSDMQDDG DEIKEA K ++E  Q
Sbjct  207  EAISELDTLGEDSYKDSTLIMQLLRDNLTLWTSDMQDDGTDEIKEAPKREDEKQQ  261



>ref|XP_011009578.1| PREDICTED: 14-3-3-like protein isoform X2 [Populus euphratica]
Length=260

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAS  141
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDD ADEIKEA+
Sbjct  207  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDAADEIKEAA  253



>ref|XP_002307363.1| 14-3-3 protein 32kDa endonuclease [Populus trichocarpa]
 gb|ABK93650.1| unknown [Populus trichocarpa]
 gb|EEE94359.1| 14-3-3 protein 32kDa endonuclease [Populus trichocarpa]
Length=260

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAS  141
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDD ADEIKEA+
Sbjct  207  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDAADEIKEAA  253



>ref|XP_010455312.1| PREDICTED: 14-3-3-like protein GF14 chi [Camelina sativa]
Length=265

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE*SQ  165
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDD AD+IKEA+ KP  E  Q
Sbjct  209  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDAADDIKEAALKPAEEQQQ  264



>ref|XP_010421819.1| PREDICTED: 14-3-3-like protein GF14 chi [Camelina sativa]
Length=265

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE*SQ  165
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDD AD+IKEA+ KP  E  Q
Sbjct  209  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDAADDIKEAAPKPAEEQQQ  264



>gb|AAK26634.1|AF342780_1 GF14 omega [Brassica napus]
Length=260

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  4    AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  147
            AIAELDTLGE SYKDSTLIMQLLRDNLTLWTSDMQDD ADEIKEAS P
Sbjct  206  AIAELDTLGEGSYKDSTLIMQLLRDNLTLWTSDMQDDAADEIKEASAP  253



>ref|XP_010680998.1| PREDICTED: 14-3-3 protein 2-like isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=260

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGE+SYKDSTLIMQLLRDNLTLWTSDMQ+DGADEIKE+S   +E
Sbjct  207  EAIAELDTLGEDSYKDSTLIMQLLRDNLTLWTSDMQEDGADEIKESSNKQDE  258



>ref|XP_002870838.1| hypothetical protein ARALYDRAFT_494127 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47097.1| hypothetical protein ARALYDRAFT_494127 [Arabidopsis lyrata subsp. 
lyrata]
Length=258

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/49 (90%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +1

Query  4    AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  150
            AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDM D+  DEIKEASKP+
Sbjct  207  AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMTDEAGDEIKEASKPE  255



>ref|XP_010680999.1| PREDICTED: 14-3-3 protein 2-like isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=259

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGE+SYKDSTLIMQLLRDNLTLWTSDMQ+DGADEIKE+S   +E
Sbjct  206  EAIAELDTLGEDSYKDSTLIMQLLRDNLTLWTSDMQEDGADEIKESSNKQDE  257



>emb|CDX91676.1| BnaC08g05950D [Brassica napus]
Length=259

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  4    AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  147
            AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQD+ ADEIKEA+ P
Sbjct  205  AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDEAADEIKEATPP  252



>ref|XP_009110140.1| PREDICTED: 14-3-3-like protein GF14 omega [Brassica rapa]
Length=259

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  4    AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  147
            AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQD+ ADEIKEA+ P
Sbjct  205  AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDEAADEIKEATPP  252



>emb|CDY41483.1| BnaA08g20850D [Brassica napus]
Length=259

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  4    AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  147
            AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQD+ ADEIKEA+ P
Sbjct  205  AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDEAADEIKEATPP  252



>sp|P29307.2|1433_OENEH RecName: Full=14-3-3-like protein [Oenothera elata subsp. hookeri]
 emb|CAA44642.1| protein kinase C inhibitor homologue [Oenothera elata subsp. 
hookeri]
Length=260

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 49/53 (92%), Gaps = 1/53 (2%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE  156
            EAIAELDTL EESYKDSTLIMQLLRDNLTLWTSDMQDDG DEIKEA+ KPD +
Sbjct  207  EAIAELDTLEEESYKDSTLIMQLLRDNLTLWTSDMQDDGGDEIKEAAPKPDEQ  259



>emb|CDY71290.1| BnaCnng72220D [Brassica napus]
Length=257

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  150
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDM D+  DEIKE SKP+
Sbjct  204  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMTDEAGDEIKETSKPE  253



>ref|XP_006650484.1| PREDICTED: 14-3-3-like protein GF14-F-like [Oryza brachyantha]
Length=260

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +1

Query  4    AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSD  +DG DEIKEA+KP+ E
Sbjct  208  AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDNAEDGGDEIKEAAKPEGE  258



>ref|XP_009125075.1| PREDICTED: 14-3-3-like protein GF14 psi [Brassica rapa]
Length=258

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  150
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDM D+  DEIKE SKP+
Sbjct  205  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMTDEAGDEIKETSKPE  254



>ref|XP_006659421.1| PREDICTED: 14-3-3-like protein GF14-C-like [Oryza brachyantha]
Length=256

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  150
            EAI+ELDTLGEESYKDSTLIMQLLRDNLTLWTSD+ +DGADE+KEASK D
Sbjct  202  EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDLTEDGADEVKEASKGD  251



>emb|CDX67405.1| BnaA07g14450D [Brassica napus]
Length=258

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  150
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDM D+  DEIKE SKP+
Sbjct  205  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMTDEAGDEIKETSKPE  254



>ref|NP_001051051.1| Os03g0710800 [Oryza sativa Japonica Group]
 sp|Q06967.2|14336_ORYSJ RecName: Full=14-3-3-like protein GF14-F; AltName: Full=14-3-3-like 
protein S94; AltName: Full=G-box factor 14-3-3 homolog 
F; AltName: Full=OsGF14a; AltName: Full=Stress-regulated 14-3-3 
protein; Short=SR14-3-3 [Oryza sativa Japonica Group]
 gb|AAX95656.1| 14-3-3 protein [Oryza sativa Japonica Group]
 gb|ABF98505.1| 14-3-3-like protein S94, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABF98506.1| 14-3-3-like protein S94, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABF98507.1| 14-3-3-like protein S94, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12965.1| Os03g0710800 [Oryza sativa Japonica Group]
 gb|EAY91605.1| hypothetical protein OsI_13240 [Oryza sativa Indica Group]
 gb|EAZ28334.1| hypothetical protein OsJ_12311 [Oryza sativa Japonica Group]
 gb|ACA50522.1| 14-3-3 protein [Oryza sativa Japonica Group]
 dbj|BAG88210.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95867.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AGT42305.1| 14-3-3 protein [Oryza sativa Japonica Group]
Length=260

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +1

Query  4    AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSD  +DG DEIKEA+KP+ E
Sbjct  208  AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDNAEDGGDEIKEAAKPEGE  258



>dbj|BAA03711.1| brain specific protein [Oryza sativa]
Length=260

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +1

Query  4    AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSD  +DG DEIKEA+KP+ E
Sbjct  208  AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDNAEDGGDEIKEAAKPEGE  258



>gb|ACN73536.1| 1433-3 [Brassica napus]
 gb|ACN73537.1| 1433-3 [Brassica napus]
Length=258

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/49 (90%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  147
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDM D+  DEIKE SKP
Sbjct  205  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMTDEAGDEIKETSKP  253



>ref|XP_009410139.1| PREDICTED: 14-3-3-like protein 16R [Musa acuminata subsp. malaccensis]
Length=259

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASK  144
            EAI+ELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQ+DG DEI+EASK
Sbjct  205  EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQEDGLDEIREASK  252



>gb|AIU34467.1| putative 14-3-3 protein, partial [Taraxacum brevicorniculatum]
Length=258

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  150
            EAIAELDTLGE+SYKDSTLIMQLLRDNLTLWTSDMQDD A+EIKEA K D
Sbjct  208  EAIAELDTLGEDSYKDSTLIMQLLRDNLTLWTSDMQDDSAEEIKEAPKAD  257



>gb|ADO95306.1| 14-3-3-like protein GF14 Omega [Eutrema salsugineum]
Length=260

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  4    AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  147
            AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDD  +EIKEAS P
Sbjct  206  AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDAPEEIKEASAP  253



>ref|XP_006389998.1| hypothetical protein EUTSA_v10019018mg [Eutrema salsugineum]
 gb|ABY86894.1| 14-3-3 protein GF14 omega [Eutrema halophilum]
 gb|ESQ27284.1| hypothetical protein EUTSA_v10019018mg [Eutrema salsugineum]
Length=260

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  4    AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  147
            AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDD  +EIKEAS P
Sbjct  206  AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDAPEEIKEASAP  253



>ref|XP_009145139.1| PREDICTED: 14-3-3-like protein GF14 phi [Brassica rapa]
 emb|CDY28408.1| BnaA05g18320D [Brassica napus]
Length=263

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 49/54 (91%), Gaps = 2/54 (4%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAS--KPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQD+G +EIKEA+  KP  E
Sbjct  206  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDEGTEEIKEAAATKPAQE  259



>gb|KJB10444.1| hypothetical protein B456_001G201400 [Gossypium raimondii]
Length=262

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  153
            EAI+ELDTLGEESYKDSTLIMQLLRDNLTLWTSD+ D+  DEIKEASKP++
Sbjct  207  EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDITDEAGDEIKEASKPES  257



>dbj|BAB11740.1| TaWIN2 [Triticum aestivum]
Length=259

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELD+LGE+SYKDSTLIMQLLRDNLTLWTSDMQDD  DE++++SKP++E
Sbjct  207  EAIAELDSLGEDSYKDSTLIMQLLRDNLTLWTSDMQDDAGDEMRDSSKPEDE  258



>gb|ADK93080.1| 14-3-3g protein [Gossypium hirsutum]
 gb|KHG21797.1| Uncharacterized protein F383_27919 [Gossypium arboreum]
Length=262

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  153
            EAI+ELDTLGEESYKDSTLIMQLLRDNLTLWTSD+ D+  DEIKEASKP++
Sbjct  207  EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDITDEAGDEIKEASKPES  257



>gb|ACH59993.1| 14-3-3 protein, partial [Pseudotsuga menziesii]
 gb|ACH59994.1| 14-3-3 protein, partial [Pseudotsuga menziesii]
 gb|ACH59995.1| 14-3-3 protein, partial [Pseudotsuga menziesii]
 gb|ACH59996.1| 14-3-3 protein, partial [Pseudotsuga menziesii]
 gb|ACH59997.1| 14-3-3 protein, partial [Pseudotsuga menziesii]
 gb|ACH59998.1| 14-3-3 protein, partial [Pseudotsuga menziesii]
 gb|ACH59999.1| 14-3-3 protein, partial [Pseudotsuga menziesii]
 gb|ACH60000.1| 14-3-3 protein, partial [Pseudotsuga menziesii]
 gb|ACH60001.1| 14-3-3 protein, partial [Pseudotsuga menziesii]
 gb|ACH60002.1| 14-3-3 protein, partial [Pseudotsuga menziesii]
 gb|ACH60003.1| 14-3-3 protein, partial [Pseudotsuga menziesii]
 gb|ACH60004.1| 14-3-3 protein, partial [Pseudotsuga menziesii]
 gb|ACH60005.1| 14-3-3 protein, partial [Pseudotsuga menziesii]
 gb|ACH60006.1| 14-3-3 protein, partial [Pseudotsuga menziesii]
 gb|ACH60007.1| 14-3-3 protein, partial [Pseudotsuga menziesii]
 gb|ACH60008.1| 14-3-3 protein, partial [Pseudotsuga menziesii]
 gb|ACH60009.1| 14-3-3 protein, partial [Pseudotsuga menziesii]
 gb|ACH60010.1| 14-3-3 protein, partial [Pseudotsuga macrocarpa]
Length=58

 Score = 86.3 bits (212),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASK  144
            EAIAELDTLGE+SYKDSTLIMQLLRDNLTLWTSDMQ+D  DEIKE SK
Sbjct  4    EAIAELDTLGEDSYKDSTLIMQLLRDNLTLWTSDMQEDAGDEIKETSK  51



>emb|CDX73313.1| BnaC05g27930D [Brassica napus]
Length=265

 Score = 90.5 bits (223),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 49/54 (91%), Gaps = 2/54 (4%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAS--KPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQD+G +EIKEA+  KP  E
Sbjct  208  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDEGTEEIKEAAATKPAEE  261



>gb|EPS72907.1| 14-3-3 a-1 protein [Genlisea aurea]
Length=255

 Score = 90.1 bits (222),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 48/52 (92%), Gaps = 1/52 (2%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDD  DEIKEA+K D E
Sbjct  205  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDD-TDEIKEANKADKE  255



>ref|XP_003574663.1| PREDICTED: 14-3-3-like protein GF14-A [Brachypodium distachyon]
Length=262

 Score = 90.1 bits (222),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  153
            EAIAELD+LGE+SYKDSTLIMQLLRDNLTLWTSDMQDD  DE+++ASKP++
Sbjct  209  EAIAELDSLGEDSYKDSTLIMQLLRDNLTLWTSDMQDDAGDEMRDASKPED  259



>gb|AAD27827.2| 14-3-3 protein [Picea glauca]
Length=259

 Score = 89.7 bits (221),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  150
            EAIAELDTLGE+SYKDSTLIMQLLRDNLTLWTSDMQ+D  DEIKE SK D
Sbjct  205  EAIAELDTLGEDSYKDSTLIMQLLRDNLTLWTSDMQEDAGDEIKETSKRD  254



>ref|NP_001061856.1| Os08g0430500 [Oryza sativa Japonica Group]
 sp|Q6ZKC0.1|14333_ORYSJ RecName: Full=14-3-3-like protein GF14-C; AltName: Full=G-box 
factor 14-3-3 homolog C [Oryza sativa Japonica Group]
 gb|AAB07457.1| GF14-c protein [Oryza sativa Japonica Group]
 dbj|BAD01170.1| GF14-c protein [Oryza sativa Japonica Group]
 dbj|BAF23770.1| Os08g0430500 [Oryza sativa Japonica Group]
 gb|EAZ42820.1| hypothetical protein OsJ_27405 [Oryza sativa Japonica Group]
 gb|ACJ54928.1| G-box binding factor [Oryza sativa Japonica Group]
 dbj|BAG89441.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00820.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH01420.1| unnamed protein product [Oryza sativa Japonica Group]
Length=256

 Score = 89.7 bits (221),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  150
            EAI+ELDTLGEESYKDSTLIMQLLRDNLTLWTSD+ +DG DE+KEASK D
Sbjct  202  EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDLTEDGGDEVKEASKGD  251



>gb|EAZ07074.1| hypothetical protein OsI_29320 [Oryza sativa Indica Group]
Length=256

 Score = 89.7 bits (221),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  150
            EAI+ELDTLGEESYKDSTLIMQLLRDNLTLWTSD+ +DG DE+KEASK D
Sbjct  202  EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDLTEDGGDEVKEASKGD  251



>ref|NP_564453.1| 14-3-3-like protein GF14 phi [Arabidopsis thaliana]
 sp|P46077.2|14334_ARATH RecName: Full=14-3-3-like protein GF14 phi; AltName: Full=General 
regulatory factor 4 [Arabidopsis thaliana]
 gb|AAG50610.1|AC079605_15 14-3-3 protein, putative [Arabidopsis thaliana]
 gb|AAB06231.1| GF14 protein phi chain [Arabidopsis thaliana]
 gb|AAB62224.1| 14-3-3-like protein GF14 phi [Arabidopsis thaliana]
 gb|AAM60925.1| 14-3-3 protein GF14phi (grf4) [Arabidopsis thaliana]
 gb|AEE31760.1| 14-3-3-like protein GF14 phi [Arabidopsis thaliana]
Length=267

 Score = 89.7 bits (221),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  147
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQD+  +EIKEA+ P
Sbjct  210  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDESPEEIKEAAAP  258



>ref|XP_002891161.1| At1g35160/T32G9_30 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67420.1| At1g35160/T32G9_30 [Arabidopsis lyrata subsp. lyrata]
Length=267

 Score = 89.7 bits (221),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  147
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQD+  +EIKEA+ P
Sbjct  210  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDESPEEIKEAAAP  258



>gb|AAK63949.1| At1g35160/T32G9_30 [Arabidopsis thaliana]
 gb|AAL31165.1| At1g35160/T32G9_30 [Arabidopsis thaliana]
Length=267

 Score = 89.7 bits (221),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  147
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQD+  +EIKEA+ P
Sbjct  210  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDESPEEIKEAAAP  258



>ref|XP_006408411.1| hypothetical protein EUTSA_v10021346mg [Eutrema salsugineum]
 gb|ESQ49864.1| hypothetical protein EUTSA_v10021346mg [Eutrema salsugineum]
Length=261

 Score = 89.7 bits (221),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 50/53 (94%), Gaps = 1/53 (2%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDD-GADEIKEASKPDNE  156
            EAI+ELDTLGEESYKDSTLIMQLLRDNLTLWTSD+ D+ G DEIKEASKP++E
Sbjct  204  EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDINDEAGGDEIKEASKPESE  256



>dbj|BAJ91347.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=235

 Score = 89.4 bits (220),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELD+LGE+SYKDSTLIMQLLRDNLTLWTSDMQDD  DE +++SKP++E
Sbjct  183  EAIAELDSLGEDSYKDSTLIMQLLRDNLTLWTSDMQDDAGDETRDSSKPEDE  234



>gb|ABC00200.1| 14-3-3D [Hordeum vulgare subsp. vulgare]
Length=259

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAIAELD+LGE+SYKDSTLIMQLLRDNLTLWTSDMQDD  DE +++SKP++E
Sbjct  207  EAIAELDSLGEDSYKDSTLIMQLLRDNLTLWTSDMQDDAGDETRDSSKPEDE  258



>gb|ABY65002.1| 14-3-3c protein [Gossypium hirsutum]
Length=261

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAI+ELDTLGE+SYKDSTLIMQLLRDNLTLWTSDMQDD  DEIKEA K + E
Sbjct  207  EAISELDTLGEDSYKDSTLIMQLLRDNLTLWTSDMQDDATDEIKEAPKREEE  258



>gb|AFK46913.1| unknown [Lotus japonicus]
Length=264

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  153
            EAI+ELDTLGEESYKDSTLIMQLLRDNLTLWTSD+ DD  DEIKE SKP +
Sbjct  209  EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDITDDAGDEIKETSKPQS  259



>gb|KJB79630.1| hypothetical protein B456_013G059800 [Gossypium raimondii]
Length=261

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE  156
            EAI+ELDTLGE+SYKDSTLIMQLLRDNLTLWTSDMQDD  DEIKEA K + E
Sbjct  207  EAISELDTLGEDSYKDSTLIMQLLRDNLTLWTSDMQDDATDEIKEAPKREEE  258



>emb|CDY00447.1| BnaC07g13790D [Brassica napus]
Length=260

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 48/54 (89%), Gaps = 3/54 (6%)
 Frame = +1

Query  4    AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAS---KPDNE  156
            AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQD+ ADEIKEA+   KP  E
Sbjct  205  AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDESADEIKEAAAAPKPTEE  258



>ref|XP_009408999.1| PREDICTED: 14-3-3-like protein GF14-C [Musa acuminata subsp. 
malaccensis]
Length=261

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  153
            EAI+ELDTLGEESYKDSTLIMQLLRDNLTLWTSD+ +DGADEIKEA K ++
Sbjct  207  EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDITEDGADEIKEAPKKES  257



>emb|CDY46646.1| BnaA07g10500D [Brassica napus]
Length=260

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 48/54 (89%), Gaps = 3/54 (6%)
 Frame = +1

Query  4    AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAS---KPDNE  156
            AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQD+ ADEIKEA+   KP  E
Sbjct  205  AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDESADEIKEAAAGPKPTEE  258



>ref|XP_009397483.1| PREDICTED: 14-3-3-like protein [Musa acuminata subsp. malaccensis]
Length=261

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  153
            EAI+ELDTLGEESYKDSTLIMQLLRDNLTLWTSD+ +DGADEIKEA K ++
Sbjct  207  EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDITEDGADEIKEAPKKES  257



>ref|XP_009419276.1| PREDICTED: 14-3-3-like protein GF14-C [Musa acuminata subsp. 
malaccensis]
 ref|XP_009419277.1| PREDICTED: 14-3-3-like protein GF14-C [Musa acuminata subsp. 
malaccensis]
Length=261

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  153
            EAI+ELDTLGEESYKDSTLIMQLLRDNLTLWTSD+ +DGADEIKEA K ++
Sbjct  207  EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDITEDGADEIKEAPKKES  257



>gb|ABR25750.1| 14-3-3-like protein [Oryza sativa Indica Group]
Length=228

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  147
            EAI+ELD+LGEESYKDSTLIMQLLRDNLTLWTSD  DDG DEIKEA+ P
Sbjct  174  EAISELDSLGEESYKDSTLIMQLLRDNLTLWTSDANDDGGDEIKEAAAP  222



>ref|XP_009403466.1| PREDICTED: 14-3-3-like protein [Musa acuminata subsp. malaccensis]
 ref|XP_009403467.1| PREDICTED: 14-3-3-like protein [Musa acuminata subsp. malaccensis]
Length=261

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  165
            EAI+ELDTLGEESYKDSTLIMQLLRDNLTLWTSD+ +DGADEI EA K ++E  Q
Sbjct  207  EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDITEDGADEINEAPKKESEEGQ  261



>ref|NP_001280837.1| 14-3-3-like protein A [Malus domestica]
 gb|AAV50005.1| 14-3-3 family protein [Malus domestica]
Length=262

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  165
            EAI+ELDTLGEESYKDSTLIMQLLRDNLTLWTSD+ DD  DEIKEASK ++  +Q
Sbjct  207  EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDITDDAGDEIKEASKRESSETQ  261



>gb|AHB33318.1| 14-3-3a protein [Pyrus pyrifolia]
Length=261

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  165
            EAI+ELDTLGEESYKDSTLIMQLLRDNLTLWTSD+ DD  DEIKEASK ++  +Q
Sbjct  207  EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDITDDAGDEIKEASKRESSEAQ  261



>gb|AAP48904.1| 14-3-3-like protein [Saccharum hybrid cultivar CP65-357]
 gb|AFO59571.1| 14-3-3-like protein [Saccharum hybrid cultivar GT28]
 gb|AHX42563.1| 14-3-3 protein [Saccharum hybrid cultivar ROC22]
Length=256

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  150
            EAI+ELDTLGEESYKDSTLIMQLLRDNLTLWTSD+ +DGADE KEASK D
Sbjct  202  EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDLTEDGADEGKEASKGD  251



>gb|EYU44646.1| hypothetical protein MIMGU_mgv1a012225mg [Erythranthe guttata]
Length=257

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASK  144
            EAI+ELDTLGEESYKDSTLIMQLLRDNLTLWTSD+ DDG DEIKE SK
Sbjct  208  EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDIADDGGDEIKETSK  255



>gb|EYU34391.1| hypothetical protein MIMGU_mgv1a012246mg [Erythranthe guttata]
Length=257

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  153
            EAI+ELDTLGEESYKDSTLIMQLLRDNLTLWTSD  DD  DEIKEASK D+
Sbjct  202  EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDAADDAGDEIKEASKRDS  252



>ref|XP_006662988.1| PREDICTED: 14-3-3-like protein GF14-D-like [Oryza brachyantha]
Length=265

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  147
            EAI+ELD+LGEESYKDSTLIMQLLRDNLTLWTSD  DDG DEIKEA+ P
Sbjct  211  EAISELDSLGEESYKDSTLIMQLLRDNLTLWTSDANDDGGDEIKEAAAP  259



>ref|XP_008362235.1| PREDICTED: 14-3-3-like protein A [Malus domestica]
 ref|XP_008362236.1| PREDICTED: 14-3-3-like protein A [Malus domestica]
 ref|XP_008362237.1| PREDICTED: 14-3-3-like protein A [Malus domestica]
 ref|XP_008368488.1| PREDICTED: 14-3-3-like protein A [Malus domestica]
 ref|XP_008368489.1| PREDICTED: 14-3-3-like protein A [Malus domestica]
 ref|XP_008368490.1| PREDICTED: 14-3-3-like protein A [Malus domestica]
Length=261

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  165
            EAI+ELDTLGEESYKDSTLIMQLLRDNLTLWTSD+ DD  DEIKEASK ++  +Q
Sbjct  207  EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDITDDAGDEIKEASKRESSEAQ  261



>emb|CAA06198.1| 14-3-3 Protein [Glycine max]
Length=68

 Score = 84.7 bits (208),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASK  144
            EAI+ELDTLGEESYKDSTLIMQLLRDNLTLWTSD+ DD  DEIKE SK
Sbjct  16   EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDITDDAGDEIKETSK  63



>ref|XP_004968972.1| PREDICTED: 14-3-3-like protein GF14-C-like isoform X2 [Setaria 
italica]
Length=256

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  150
            EAI+ELDTLGEESYKDSTLIMQLLRDNLTLWTSD+ +DGADE KEASK D
Sbjct  202  EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDLTEDGADEGKEASKGD  251



>ref|XP_007216106.1| hypothetical protein PRUPE_ppa018655mg [Prunus persica]
 gb|EMJ17305.1| hypothetical protein PRUPE_ppa018655mg [Prunus persica]
Length=250

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  165
            EAI+ELDTLGEESYKDSTLIMQLLRDNLTLWTSD+ DD  DEIKEASK ++  +Q
Sbjct  195  EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDITDDAGDEIKEASKRESAEAQ  249



>ref|XP_008466219.1| PREDICTED: 14-3-3-like protein [Cucumis melo]
Length=258

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 50/53 (94%), Gaps = 2/53 (4%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDG DEIKEA+ K D+E
Sbjct  207  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDG-DEIKEAAPKRDDE  258



>gb|ACN39847.1| unknown [Picea sitchensis]
 gb|ACN39934.1| unknown [Picea sitchensis]
 gb|ACN40751.1| unknown [Picea sitchensis]
Length=264

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPD  150
            EAIAELDTLGE+SYKDSTLIMQLLRDNLTLWTSDMQ++  DEIKE SK D
Sbjct  210  EAIAELDTLGEDSYKDSTLIMQLLRDNLTLWTSDMQEEAGDEIKETSKRD  259



>ref|XP_010450904.1| PREDICTED: 14-3-3-like protein GF14 psi [Camelina sativa]
Length=259

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 46/50 (92%), Gaps = 1/50 (2%)
 Frame = +1

Query  4    AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKE-ASKPD  150
            AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDM D+  DEIKE ASKPD
Sbjct  207  AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMTDEAGDEIKEAASKPD  256



>ref|XP_009357045.1| PREDICTED: 14-3-3-like protein A [Pyrus x bretschneideri]
 ref|XP_009357046.1| PREDICTED: 14-3-3-like protein A [Pyrus x bretschneideri]
 ref|XP_009357047.1| PREDICTED: 14-3-3-like protein A [Pyrus x bretschneideri]
Length=262

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  165
            EAI+ELDTLGEESYKDSTLIMQLLRDNLTLWTSD+ DD  DEIKEASK ++  +Q
Sbjct  207  EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDITDDAGDEIKEASKRESSEAQ  261



>ref|NP_001068067.2| Os11g0546900 [Oryza sativa Japonica Group]
 sp|Q2R2W2.1|14334_ORYSJ RecName: Full=14-3-3-like protein GF14-D; AltName: Full=G-box 
factor 14-3-3 homolog D [Oryza sativa Japonica Group]
 gb|AAB07458.1| GF14-d protein [Oryza sativa Japonica Group]
 gb|ABA94230.1| 14-3-3, putative, expressed [Oryza sativa Japonica Group]
 gb|EAZ18679.1| hypothetical protein OsJ_34200 [Oryza sativa Japonica Group]
 dbj|BAG92023.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95132.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF28430.2| Os11g0546900 [Oryza sativa Japonica Group]
Length=265

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKP  147
            EAI+ELD+LGEESYKDSTLIMQLLRDNLTLWTSD  DDG DEIKEA+ P
Sbjct  211  EAISELDSLGEESYKDSTLIMQLLRDNLTLWTSDANDDGGDEIKEAAAP  259



>ref|XP_010440961.1| PREDICTED: 14-3-3-like protein GF14 psi [Camelina sativa]
Length=259

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 46/50 (92%), Gaps = 1/50 (2%)
 Frame = +1

Query  4    AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKE-ASKPD  150
            AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDM D+  DEIKE ASKPD
Sbjct  207  AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMTDEAGDEIKEAASKPD  256



>ref|XP_004136278.1| PREDICTED: 14-3-3-like protein-like [Cucumis sativus]
 ref|XP_004169036.1| PREDICTED: 14-3-3-like protein-like [Cucumis sativus]
 gb|KGN60225.1| hypothetical protein Csa_3G889810 [Cucumis sativus]
Length=258

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 50/53 (94%), Gaps = 2/53 (4%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAS-KPDNE  156
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDG DEIKEA+ K D+E
Sbjct  207  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDG-DEIKEAAPKRDDE  258



>ref|XP_006346922.1| PREDICTED: 14-3-3 protein 4-like [Solanum tuberosum]
Length=260

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  153
            EAI+ELDTLGEESYKDSTLIMQLLRDNLTLWTSD  DD  D+IKEASKP++
Sbjct  205  EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDNADDAGDDIKEASKPES  255



>ref|XP_006284363.1| hypothetical protein CARUB_v10005536mg [Capsella rubella]
 gb|EOA17261.1| hypothetical protein CARUB_v10005536mg [Capsella rubella]
Length=259

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 46/50 (92%), Gaps = 1/50 (2%)
 Frame = +1

Query  4    AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKE-ASKPD  150
            AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDM D+  DEIKE ASKPD
Sbjct  207  AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMTDEAGDEIKEAASKPD  256



>ref|XP_010473202.1| PREDICTED: uncharacterized protein LOC104752695 [Camelina sativa]
Length=1039

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 45/51 (88%), Positives = 48/51 (94%), Gaps = 1/51 (2%)
 Frame = +1

Query  1     EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKE-ASKPD  150
             +AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDM+D+  DEIKE ASKPD
Sbjct  986   DAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMRDEAGDEIKEAASKPD  1036



>dbj|BAF46314.1| 14-3-3 protein [Ipomoea nil]
Length=262

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  153
            EAI ELDTLGEESYKDSTLIMQLLRDNLTLWTSD  DDG DEIKEASK ++
Sbjct  207  EAILELDTLGEESYKDSTLIMQLLRDNLTLWTSDTADDGGDEIKEASKRES  257



>ref|XP_008230392.1| PREDICTED: 14-3-3-like protein A [Prunus mume]
Length=262

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  165
            EAI+ELDTLGEESYKDSTLIMQLLRDNLTLWTSD+ DD  DEIKEASK ++  +Q
Sbjct  207  EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDITDDAGDEIKEASKRESAEAQ  261



>ref|XP_009106540.1| PREDICTED: 14-3-3-like protein GF14 omega [Brassica rapa]
Length=260

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 47/50 (94%), Gaps = 1/50 (2%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGA-DEIKEASKP  147
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDD A +EIKEAS P
Sbjct  205  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDDAGEEIKEASAP  254



>emb|CDX88436.1| BnaC06g38800D [Brassica napus]
Length=260

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 47/50 (94%), Gaps = 1/50 (2%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGA-DEIKEASKP  147
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDD A +EIKEAS P
Sbjct  205  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDDAGEEIKEASAP  254



>gb|KHG12867.1| Uncharacterized protein F383_16851 [Gossypium arboreum]
Length=266

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/43 (98%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEI  129
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSD+QDDGADEI
Sbjct  209  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDLQDDGADEI  251



>gb|ADP00759.1| 14-3-3 protein [Litchi chinensis]
Length=261

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  153
            EAI+ELDTLGEESYKDSTLIMQLLRDNLTLWTSD+ DD  DEIKEASK ++
Sbjct  207  EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDITDDAGDEIKEASKRES  257



>ref|XP_011011192.1| PREDICTED: 14-3-3-like protein A [Populus euphratica]
Length=262

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  153
            EAI+ELDTLGEESYKDSTLIMQLLRDNLTLWTSD+ DD  DEIKEASK ++
Sbjct  207  EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDITDDAGDEIKEASKRES  257



>gb|ADD79961.1| 14-3-3 family protein [Dimocarpus longan]
 gb|ADD79962.1| 14-3-3 family protein [Dimocarpus longan]
Length=261

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  153
            EAI+ELDTLGEESYKDSTLIMQLLRDNLTLWTSD+ DD  DEIKEASK ++
Sbjct  207  EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDITDDAGDEIKEASKRES  257



>ref|XP_008379530.1| PREDICTED: 14-3-3-like protein A [Malus domestica]
 ref|XP_008379531.1| PREDICTED: 14-3-3-like protein A [Malus domestica]
Length=262

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  153
            EAI+ELDTLGEESYKDSTLIMQLLRDNLTLWTSD+ DD  DEIKEASK ++
Sbjct  207  EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDITDDAGDEIKEASKRES  257



>gb|KJB59911.1| hypothetical protein B456_009G280500 [Gossypium raimondii]
Length=266

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/43 (98%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEI  129
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSD+QDDGADEI
Sbjct  209  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDLQDDGADEI  251



>ref|XP_010916166.1| PREDICTED: 14-3-3-like protein [Elaeis guineensis]
Length=261

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  153
            EAI+ELDTLGEESYKDSTLIMQLLRDNLTLWTSD+ +DG DEIKEA+K ++
Sbjct  207  EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDITEDGGDEIKEATKRES  257



>ref|XP_004304139.1| PREDICTED: 14-3-3-like protein A [Fragaria vesca subsp. vesca]
Length=263

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  153
            EAI+ELDTLGEESYKDSTLIMQLLRDNLTLWTSD+ DD  DEIKEASK ++
Sbjct  207  EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDITDDAGDEIKEASKRES  257



>gb|AEA03664.1| 14-3-3 protein 3 [Hevea brasiliensis]
Length=264

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  153
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSD+ D+  DEIKEASK ++
Sbjct  207  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDIADEAGDEIKEASKRES  257



>gb|AAF76226.1|AF272572_1 14-3-3 protein [Populus tremula x Populus alba]
Length=262

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  153
            EAI+ELDTLGEESYKDSTLIMQLLRDNLTLWTSD+ DD  DEIKEASK ++
Sbjct  207  EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDITDDAGDEIKEASKRES  257



>ref|XP_011021224.1| PREDICTED: 14-3-3-like protein [Populus euphratica]
Length=262

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  153
            EAI+ELDTLGEESYKDSTLIMQLLRDNLTLWTSD+ DD  DEIKEASK ++
Sbjct  207  EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDITDDAGDEIKEASKRES  257



>gb|AEG67284.1| 14-3-3 protein [Pyrus pyrifolia]
Length=261

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDNE*SQ  165
            EAI+ELDTLGEESYKDSTLIMQL RDNLTLWTSD+ DD  DEIKEASK ++  +Q
Sbjct  207  EAISELDTLGEESYKDSTLIMQLFRDNLTLWTSDITDDAGDEIKEASKRESSEAQ  261



>ref|XP_002863080.1| hypothetical protein ARALYDRAFT_920500 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39339.1| hypothetical protein ARALYDRAFT_920500 [Arabidopsis lyrata subsp. 
lyrata]
Length=109

 Score = 84.7 bits (208),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/45 (93%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKE  135
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDD  D+IKE
Sbjct  51   EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDPTDDIKE  95



>emb|CDX87455.1| BnaA07g34180D [Brassica napus]
Length=299

 Score = 87.8 bits (216),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 47/50 (94%), Gaps = 1/50 (2%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGA-DEIKEASKP  147
            EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDD A +EIKE+S P
Sbjct  244  EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDDAGEEIKESSAP  293



>emb|CBI33672.3| unnamed protein product [Vitis vinifera]
Length=133

 Score = 85.1 bits (209),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASK  144
            EAI+ELDTLGEESYKDSTLIMQLLRDNLTLWTSD+ DD  D+IKEASK
Sbjct  78   EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDITDDAGDDIKEASK  125



>ref|XP_002516746.1| 14-3-3 protein, putative [Ricinus communis]
 gb|EEF45644.1| 14-3-3 protein, putative [Ricinus communis]
Length=135

 Score = 85.1 bits (209),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASK  144
            EAI+ELDTLGEESYKDSTLIMQLLRDNLTLWTSD+ DD  D+IKEASK
Sbjct  78   EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDITDDAGDDIKEASK  125



>ref|XP_009128290.1| PREDICTED: 14-3-3-like protein GF14 omega [Brassica rapa]
 emb|CDY14618.1| BnaC02g24950D [Brassica napus]
Length=260

 Score = 87.4 bits (215),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 45/49 (92%), Gaps = 1/49 (2%)
 Frame = +1

Query  4    AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGAD-EIKEASKP  147
            AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDD AD EIKE S P
Sbjct  205  AIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDAADEEIKEESAP  253



>ref|XP_009388642.1| PREDICTED: 14-3-3-like protein [Musa acuminata subsp. malaccensis]
 ref|XP_009388643.1| PREDICTED: 14-3-3-like protein [Musa acuminata subsp. malaccensis]
 ref|XP_009388644.1| PREDICTED: 14-3-3-like protein [Musa acuminata subsp. malaccensis]
 ref|XP_009388645.1| PREDICTED: 14-3-3-like protein [Musa acuminata subsp. malaccensis]
 ref|XP_009388647.1| PREDICTED: 14-3-3-like protein [Musa acuminata subsp. malaccensis]
Length=261

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEASKPDN  153
            EAI+ELDTLGEESYKDSTLIMQLLRDNLTLWTSD+ +DGADEIKE  K ++
Sbjct  207  EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDITEDGADEIKETPKKES  257



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562275868875