BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS068E05

Length=614
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002526718.1|  nucleic acid binding protein, putative             142   2e-35   Ricinus communis
ref|XP_010257240.1|  PREDICTED: zinc finger CCCH domain-containin...    142   2e-35   Nelumbo nucifera [Indian lotus]
ref|XP_010257241.1|  PREDICTED: zinc finger CCCH domain-containin...    142   3e-35   Nelumbo nucifera [Indian lotus]
gb|KDO45407.1|  hypothetical protein CISIN_1g006944mg                   139   1e-34   Citrus sinensis [apfelsine]
emb|CDP18658.1|  unnamed protein product                                139   1e-34   Coffea canephora [robusta coffee]
ref|XP_004249196.1|  PREDICTED: zinc finger CCCH domain-containin...    138   4e-34   Solanum lycopersicum
ref|XP_009804762.1|  PREDICTED: zinc finger CCCH domain-containin...    138   5e-34   Nicotiana sylvestris
ref|XP_009781965.1|  PREDICTED: zinc finger CCCH domain-containin...    137   7e-34   Nicotiana sylvestris
ref|XP_006351223.1|  PREDICTED: zinc finger CCCH domain-containin...    137   9e-34   Solanum tuberosum [potatoes]
ref|XP_006493920.1|  PREDICTED: zinc finger CCCH domain-containin...    137   1e-33   Citrus sinensis [apfelsine]
ref|XP_006421436.1|  hypothetical protein CICLE_v10004423mg             137   1e-33   Citrus clementina [clementine]
gb|KDP26019.1|  hypothetical protein JCGZ_21052                         137   1e-33   Jatropha curcas
gb|ADL36655.1|  C3HL domain class transcription factor                  135   6e-33   Malus domestica [apple tree]
ref|XP_009340782.1|  PREDICTED: zinc finger CCCH domain-containin...    135   7e-33   Pyrus x bretschneideri [bai li]
ref|XP_009777511.1|  PREDICTED: zinc finger CCCH domain-containin...    134   7e-33   Nicotiana sylvestris
ref|NP_565962.1|  zinc finger CCCH domain-containing protein 30         135   8e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010278986.1|  PREDICTED: zinc finger CCCH domain-containin...    134   1e-32   Nelumbo nucifera [Indian lotus]
ref|XP_002526717.1|  nucleic acid binding protein, putative             134   1e-32   Ricinus communis
ref|XP_011033310.1|  PREDICTED: zinc finger CCCH domain-containin...    134   2e-32   Populus euphratica
ref|XP_010092985.1|  Zinc finger CCCH domain-containing protein 30      133   2e-32   Morus notabilis
ref|NP_001280976.1|  zinc finger CCCH domain-containing protein 30      133   3e-32   Malus domestica [apple tree]
ref|XP_007028819.1|  C3HL domain class transcription factor isofo...    133   4e-32   
gb|KJB14960.1|  hypothetical protein B456_002G152400                    132   4e-32   Gossypium raimondii
ref|XP_004234834.1|  PREDICTED: zinc finger CCCH domain-containin...    132   5e-32   Solanum lycopersicum
ref|XP_009617179.1|  PREDICTED: zinc finger CCCH domain-containin...    132   6e-32   Nicotiana tomentosiformis
ref|XP_002308038.2|  zinc finger family protein                         132   7e-32   Populus trichocarpa [western balsam poplar]
gb|KDP43473.1|  hypothetical protein JCGZ_16760                         132   7e-32   Jatropha curcas
ref|XP_009340157.1|  PREDICTED: zinc finger CCCH domain-containin...    132   8e-32   Pyrus x bretschneideri [bai li]
ref|XP_009334960.1|  PREDICTED: zinc finger CCCH domain-containin...    132   8e-32   Pyrus x bretschneideri [bai li]
ref|XP_010554845.1|  PREDICTED: zinc finger CCCH domain-containin...    132   9e-32   Tarenaya hassleriana [spider flower]
ref|XP_002314035.2|  hypothetical protein POPTR_0009s06580g             132   1e-31   
emb|CDY14802.1|  BnaC04g47990D                                          130   1e-31   Brassica napus [oilseed rape]
emb|CBI24886.3|  unnamed protein product                                130   1e-31   Vitis vinifera
ref|NP_001267839.1|  zinc finger CCCH domain-containing protein 3...    132   1e-31   Vitis vinifera
ref|XP_009618285.1|  PREDICTED: zinc finger CCCH domain-containin...    131   1e-31   Nicotiana tomentosiformis
ref|XP_011020339.1|  PREDICTED: zinc finger CCCH domain-containin...    130   3e-31   Populus euphratica
gb|KJB14972.1|  hypothetical protein B456_002G152300                    130   3e-31   Gossypium raimondii
emb|CDY06895.1|  BnaA04g24200D                                          129   3e-31   
gb|KHG03427.1|  hypothetical protein F383_27140                         130   4e-31   Gossypium arboreum [tree cotton]
ref|XP_010505990.1|  PREDICTED: zinc finger CCCH domain-containin...    130   4e-31   Camelina sativa [gold-of-pleasure]
gb|KHG06713.1|  hypothetical protein F383_33331                         130   4e-31   Gossypium arboreum [tree cotton]
ref|XP_002308039.2|  zinc finger family protein                         130   5e-31   
ref|XP_011020337.1|  PREDICTED: zinc finger CCCH domain-containin...    129   5e-31   Populus euphratica
ref|XP_010517688.1|  PREDICTED: zinc finger CCCH domain-containin...    130   5e-31   Camelina sativa [gold-of-pleasure]
ref|XP_011025440.1|  PREDICTED: zinc finger CCCH domain-containin...    129   6e-31   Populus euphratica
ref|XP_009142026.1|  PREDICTED: zinc finger CCCH domain-containin...    129   6e-31   Brassica rapa
ref|XP_010524053.1|  PREDICTED: zinc finger CCCH domain-containin...    129   7e-31   Tarenaya hassleriana [spider flower]
ref|XP_002323312.1|  zinc finger family protein                         129   7e-31   Populus trichocarpa [western balsam poplar]
ref|XP_008240870.1|  PREDICTED: zinc finger CCCH domain-containin...    129   7e-31   Prunus mume [ume]
ref|XP_007204626.1|  hypothetical protein PRUPE_ppa002189mg             129   7e-31   
ref|XP_004493518.1|  PREDICTED: zinc finger CCCH domain-containin...    129   8e-31   Cicer arietinum [garbanzo]
ref|XP_006293740.1|  hypothetical protein CARUB_v10022702mg             129   8e-31   Capsella rubella
ref|XP_008392207.1|  PREDICTED: zinc finger CCCH domain-containin...    129   8e-31   
ref|XP_006293739.1|  hypothetical protein CARUB_v10022702mg             129   1e-30   
gb|KHG19524.1|  hypothetical protein F383_24471                         129   1e-30   Gossypium arboreum [tree cotton]
ref|XP_006411461.1|  hypothetical protein EUTSA_v10016315mg             129   1e-30   Eutrema salsugineum [saltwater cress]
ref|XP_003625157.1|  Zinc finger CCCH domain-containing protein         129   1e-30   Medicago truncatula
ref|XP_006351322.1|  PREDICTED: zinc finger CCCH domain-containin...    128   2e-30   Solanum tuberosum [potatoes]
emb|CBI29869.3|  unnamed protein product                                127   2e-30   Vitis vinifera
ref|XP_010508649.1|  PREDICTED: zinc finger CCCH domain-containin...    128   2e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010923439.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    127   3e-30   
ref|XP_002277747.2|  PREDICTED: zinc finger CCCH domain-containin...    127   3e-30   Vitis vinifera
gb|KJB36039.1|  hypothetical protein B456_006G138100                    127   5e-30   Gossypium raimondii
ref|XP_004249271.1|  PREDICTED: zinc finger CCCH domain-containin...    126   7e-30   Solanum lycopersicum
ref|XP_007145619.1|  hypothetical protein PHAVU_007G254100g             126   8e-30   Phaseolus vulgaris [French bean]
ref|XP_006439117.1|  hypothetical protein CICLE_v10030816mg             126   9e-30   Citrus clementina [clementine]
ref|XP_006439118.1|  hypothetical protein CICLE_v10030816mg             126   9e-30   Citrus clementina [clementine]
ref|XP_010937003.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    126   1e-29   Elaeis guineensis
ref|XP_010672777.1|  PREDICTED: zinc finger CCCH domain-containin...    125   1e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006482880.1|  PREDICTED: zinc finger CCCH domain-containin...    126   1e-29   Citrus sinensis [apfelsine]
gb|KDO83402.1|  hypothetical protein CISIN_1g004911mg                   125   1e-29   Citrus sinensis [apfelsine]
gb|KDO83403.1|  hypothetical protein CISIN_1g004911mg                   125   1e-29   Citrus sinensis [apfelsine]
ref|XP_008778438.1|  PREDICTED: zinc finger CCCH domain-containin...    125   2e-29   Phoenix dactylifera
ref|XP_010931016.1|  PREDICTED: zinc finger CCCH domain-containin...    125   2e-29   Elaeis guineensis
gb|KFK37035.1|  hypothetical protein AALP_AA4G204000                    125   2e-29   Arabis alpina [alpine rockcress]
gb|KHN46294.1|  Zinc finger CCCH domain-containing protein 30           125   2e-29   Glycine soja [wild soybean]
ref|XP_006589016.1|  PREDICTED: zinc finger CCCH domain-containin...    125   2e-29   Glycine max [soybeans]
ref|XP_006349561.1|  PREDICTED: zinc finger CCCH domain-containin...    124   5e-29   Solanum tuberosum [potatoes]
ref|XP_010909716.1|  PREDICTED: zinc finger CCCH domain-containin...    124   6e-29   Elaeis guineensis
gb|KHG27269.1|  hypothetical protein F383_12616                         123   1e-28   Gossypium arboreum [tree cotton]
gb|KJB19291.1|  hypothetical protein B456_003G093600                    123   1e-28   Gossypium raimondii
ref|XP_008801953.1|  PREDICTED: zinc finger CCCH domain-containin...    123   1e-28   Phoenix dactylifera
ref|XP_002298434.1|  hypothetical protein POPTR_0001s27370g             123   1e-28   Populus trichocarpa [western balsam poplar]
ref|XP_003540529.1|  PREDICTED: zinc finger CCCH domain-containin...    122   1e-28   Glycine max [soybeans]
gb|KHN37619.1|  Zinc finger CCCH domain-containing protein 30           122   3e-28   Glycine soja [wild soybean]
ref|XP_011047401.1|  PREDICTED: zinc finger CCCH domain-containin...    122   3e-28   Populus euphratica
ref|XP_008786132.1|  PREDICTED: zinc finger CCCH domain-containin...    122   3e-28   Phoenix dactylifera
ref|XP_007133821.1|  hypothetical protein PHAVU_011G211700g             121   4e-28   Phaseolus vulgaris [French bean]
ref|XP_010057404.1|  PREDICTED: zinc finger CCCH domain-containin...    120   8e-28   Eucalyptus grandis [rose gum]
ref|XP_011078886.1|  PREDICTED: zinc finger CCCH domain-containin...    120   1e-27   Sesamum indicum [beniseed]
ref|XP_008443126.1|  PREDICTED: zinc finger CCCH domain-containin...    120   1e-27   Cucumis melo [Oriental melon]
ref|XP_004136593.1|  PREDICTED: zinc finger CCCH domain-containin...    120   1e-27   Cucumis sativus [cucumbers]
emb|CDY22543.1|  BnaC03g23530D                                          119   2e-27   Brassica napus [oilseed rape]
ref|XP_004229627.1|  PREDICTED: zinc finger CCCH domain-containin...    119   2e-27   Solanum lycopersicum
ref|XP_007052531.1|  CCCH-type zinc finger protein with ARM repea...    119   3e-27   
ref|XP_009133516.1|  PREDICTED: zinc finger CCCH domain-containin...    118   3e-27   Brassica rapa
ref|XP_009799603.1|  PREDICTED: zinc finger CCCH domain-containin...    119   4e-27   Nicotiana sylvestris
gb|KJB22263.1|  hypothetical protein B456_004G037500                    119   4e-27   Gossypium raimondii
ref|XP_008778227.1|  PREDICTED: zinc finger CCCH domain-containin...    119   4e-27   Phoenix dactylifera
emb|CDY35396.1|  BnaA03g19640D                                          117   4e-27   Brassica napus [oilseed rape]
ref|XP_011075220.1|  PREDICTED: zinc finger CCCH domain-containin...    118   4e-27   Sesamum indicum [beniseed]
ref|XP_006345451.1|  PREDICTED: zinc finger CCCH domain-containin...    118   5e-27   Solanum tuberosum [potatoes]
gb|KHN07386.1|  Zinc finger CCCH domain-containing protein 30           116   2e-26   Glycine soja [wild soybean]
ref|XP_003521185.1|  PREDICTED: zinc finger CCCH domain-containin...    116   2e-26   Glycine max [soybeans]
ref|XP_009396384.1|  PREDICTED: zinc finger CCCH domain-containin...    116   4e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009395592.1|  PREDICTED: zinc finger CCCH domain-containin...    115   5e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004510954.1|  PREDICTED: zinc finger CCCH domain-containin...    115   6e-26   Cicer arietinum [garbanzo]
ref|XP_009599703.1|  PREDICTED: zinc finger CCCH domain-containin...    115   9e-26   Nicotiana tomentosiformis
gb|EPS64556.1|  hypothetical protein M569_10225                         114   1e-25   Genlisea aurea
gb|AES69409.2|  ARM repeat CCCH-type zinc finger protein                114   2e-25   Medicago truncatula
ref|XP_003599158.1|  Zinc finger CCCH domain-containing protein         114   2e-25   
ref|XP_004499884.1|  PREDICTED: zinc finger CCCH domain-containin...    112   7e-25   Cicer arietinum [garbanzo]
ref|XP_011087691.1|  PREDICTED: zinc finger CCCH domain-containin...    112   8e-25   Sesamum indicum [beniseed]
gb|KGN58590.1|  hypothetical protein Csa_3G696850                       111   1e-24   Cucumis sativus [cucumbers]
emb|CDP07776.1|  unnamed protein product                                111   1e-24   Coffea canephora [robusta coffee]
ref|XP_010695261.1|  PREDICTED: zinc finger CCCH domain-containin...    111   1e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011468826.1|  PREDICTED: zinc finger CCCH domain-containin...    110   3e-24   Fragaria vesca subsp. vesca
ref|XP_004149598.1|  PREDICTED: zinc finger CCCH domain-containin...    110   3e-24   Cucumis sativus [cucumbers]
ref|XP_004172112.1|  PREDICTED: zinc finger CCCH domain-containin...    110   3e-24   
ref|XP_009394397.1|  PREDICTED: zinc finger CCCH domain-containin...    110   5e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009394396.1|  PREDICTED: zinc finger CCCH domain-containin...    110   5e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009414744.1|  PREDICTED: zinc finger CCCH domain-containin...    109   9e-24   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU29028.1|  hypothetical protein MIMGU_mgv1a002533mg                108   1e-23   Erythranthe guttata [common monkey flower]
gb|EYU27048.1|  hypothetical protein MIMGU_mgv1a002486mg                107   3e-23   Erythranthe guttata [common monkey flower]
ref|XP_011093548.1|  PREDICTED: zinc finger CCCH domain-containin...    106   1e-22   Sesamum indicum [beniseed]
emb|CBI16373.3|  unnamed protein product                                105   1e-22   Vitis vinifera
gb|KHN39938.1|  Zinc finger CCCH domain-containing protein 30           105   1e-22   Glycine soja [wild soybean]
ref|XP_006598269.1|  PREDICTED: zinc finger CCCH domain-containin...    105   1e-22   Glycine max [soybeans]
ref|XP_009411280.1|  PREDICTED: zinc finger CCCH domain-containin...    105   1e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009386116.1|  PREDICTED: zinc finger CCCH domain-containin...    105   2e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006587172.1|  PREDICTED: zinc finger CCCH domain-containin...    104   3e-22   Glycine max [soybeans]
ref|XP_003632114.1|  PREDICTED: zinc finger CCCH domain-containin...    104   3e-22   Vitis vinifera
ref|XP_009407642.1|  PREDICTED: zinc finger CCCH domain-containin...    104   4e-22   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAN74402.1|  hypothetical protein VITISV_043632                     104   4e-22   Vitis vinifera
ref|XP_008363574.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    104   4e-22   
ref|XP_003533897.1|  PREDICTED: zinc finger CCCH domain-containin...    104   4e-22   Glycine max [soybeans]
ref|XP_010088235.1|  Zinc finger CCCH domain-containing protein 30      104   6e-22   
ref|XP_008461797.1|  PREDICTED: zinc finger CCCH domain-containin...    103   7e-22   Cucumis melo [Oriental melon]
ref|XP_008355305.1|  PREDICTED: zinc finger CCCH domain-containin...    102   1e-21   
ref|XP_008227307.1|  PREDICTED: zinc finger CCCH domain-containin...    102   2e-21   Prunus mume [ume]
ref|XP_006838347.1|  hypothetical protein AMTR_s00103p00162010          101   5e-21   
ref|XP_009343733.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  99.0    2e-20   Pyrus x bretschneideri [bai li]
ref|XP_006604367.1|  PREDICTED: zinc finger CCCH domain-containin...  99.4    2e-20   Glycine max [soybeans]
ref|XP_002314073.2|  hypothetical protein POPTR_0009s05810g           99.0    3e-20   Populus trichocarpa [western balsam poplar]
ref|XP_010673641.1|  PREDICTED: zinc finger CCCH domain-containin...  98.2    6e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011045434.1|  PREDICTED: zinc finger CCCH domain-containin...  98.2    6e-20   Populus euphratica
ref|XP_002298403.2|  hypothetical protein POPTR_0001s26560g           97.8    7e-20   
ref|XP_011025532.1|  PREDICTED: zinc finger CCCH domain-containin...  97.4    1e-19   Populus euphratica
ref|XP_007214231.1|  hypothetical protein PRUPE_ppa025636mg           97.4    1e-19   
gb|KEH15615.1|  ARM repeat CCCH-type zinc finger protein              96.7    1e-19   Medicago truncatula
gb|EYU18755.1|  hypothetical protein MIMGU_mgv1a005424mg              95.1    3e-19   Erythranthe guttata [common monkey flower]
ref|XP_002513504.1|  transcription factor, putative                   94.4    1e-18   Ricinus communis
gb|KDO61256.1|  hypothetical protein CISIN_1g004266mg                 94.0    2e-18   Citrus sinensis [apfelsine]
ref|XP_006446118.1|  hypothetical protein CICLE_v10014437mg           93.6    2e-18   
gb|KEH41397.1|  ARM repeat CCCH-type zinc finger protein              93.2    2e-18   Medicago truncatula
gb|ACN39879.1|  unknown                                               93.2    3e-18   Picea sitchensis
ref|XP_011045435.1|  PREDICTED: zinc finger CCCH domain-containin...  92.8    4e-18   Populus euphratica
ref|XP_011006197.1|  PREDICTED: zinc finger CCCH domain-containin...  92.8    4e-18   Populus euphratica
gb|KDP22093.1|  hypothetical protein JCGZ_25924                       92.4    4e-18   Jatropha curcas
gb|KJB09387.1|  hypothetical protein B456_001G138300                  91.7    1e-17   Gossypium raimondii
ref|XP_010536082.1|  PREDICTED: zinc finger CCCH domain-containin...  90.9    2e-17   Tarenaya hassleriana [spider flower]
ref|XP_007015052.1|  C3HL domain class transcription factor, puta...  90.1    3e-17   
ref|XP_004982091.1|  PREDICTED: zinc finger CCCH domain-containin...  90.1    4e-17   Setaria italica
ref|XP_008665236.1|  PREDICTED: zinc finger CCCH domain-containin...  89.7    5e-17   Zea mays [maize]
ref|NP_196789.1|  zinc finger CCCH domain-containing protein 56       89.0    8e-17   Arabidopsis thaliana [mouse-ear cress]
gb|AAM20612.1|  zinc finger transcription factor-like protein         89.0    8e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002466619.1|  hypothetical protein SORBIDRAFT_01g011150        88.2    2e-16   Sorghum bicolor [broomcorn]
ref|XP_006286367.1|  hypothetical protein CARUB_v10000345mg           87.4    3e-16   Capsella rubella
ref|XP_010492018.1|  PREDICTED: zinc finger CCCH domain-containin...  86.7    5e-16   Camelina sativa [gold-of-pleasure]
emb|CDX91160.1|  BnaC02g04370D                                        85.9    7e-16   
ref|XP_010453333.1|  PREDICTED: zinc finger CCCH domain-containin...  85.1    2e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010419842.1|  PREDICTED: zinc finger CCCH domain-containin...  84.3    3e-15   Camelina sativa [gold-of-pleasure]
gb|KEH33323.1|  ARM repeat CCCH-type zinc finger protein              83.6    3e-15   Medicago truncatula
ref|XP_006399772.1|  hypothetical protein EUTSA_v10012818mg           84.0    4e-15   Eutrema salsugineum [saltwater cress]
emb|CDY53968.1|  BnaA10g30000D                                        84.0    4e-15   Brassica napus [oilseed rape]
ref|XP_009125867.1|  PREDICTED: zinc finger CCCH domain-containin...  84.0    4e-15   Brassica rapa
emb|CDX85685.1|  BnaA02g01280D                                        84.3    4e-15   
ref|XP_002871530.1|  hypothetical protein ARALYDRAFT_488102           84.0    5e-15   
ref|XP_010555058.1|  PREDICTED: zinc finger CCCH domain-containin...  83.2    7e-15   Tarenaya hassleriana [spider flower]
ref|XP_003559545.1|  PREDICTED: zinc finger CCCH domain-containin...  82.4    1e-14   Brachypodium distachyon [annual false brome]
ref|NP_001050982.1|  Os03g0698800                                     82.4    1e-14   
gb|AAO38462.1|  unknown protein                                       82.4    1e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009121831.1|  PREDICTED: zinc finger CCCH domain-containin...  82.0    1e-14   Brassica rapa
emb|CDX97207.1|  BnaC09g44180D                                        81.3    2e-14   
ref|XP_006426807.1|  hypothetical protein CICLE_v10026863mg           74.3    9e-14   
ref|XP_002314096.2|  hypothetical protein POPTR_0009s05150g           79.7    1e-13   
dbj|BAK06499.1|  predicted protein                                    79.7    1e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011032109.1|  PREDICTED: zinc finger CCCH domain-containin...  78.6    2e-13   Populus euphratica
ref|XP_011032108.1|  PREDICTED: zinc finger CCCH domain-containin...  78.6    2e-13   Populus euphratica
gb|ADP02201.1|  zinc finger CCCH domain-containing protein            78.2    3e-13   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006843575.1|  hypothetical protein AMTR_s00007p00102750        76.6    1e-12   
ref|XP_004294290.1|  PREDICTED: zinc finger CCCH domain-containin...  76.6    1e-12   Fragaria vesca subsp. vesca
ref|NP_181543.1|  zinc finger CCCH domain-containing protein 29       76.3    1e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002525655.1|  transcription factor, putative                   76.6    1e-12   Ricinus communis
ref|XP_010508901.1|  PREDICTED: zinc finger CCCH domain-containin...  75.5    3e-12   Camelina sativa [gold-of-pleasure]
ref|XP_007208332.1|  hypothetical protein PRUPE_ppa002251mg           75.1    3e-12   Prunus persica
ref|XP_008220916.1|  PREDICTED: zinc finger CCCH domain-containin...  75.1    4e-12   Prunus mume [ume]
ref|XP_009347250.1|  PREDICTED: zinc finger CCCH domain-containin...  74.7    5e-12   Pyrus x bretschneideri [bai li]
ref|XP_010685536.1|  PREDICTED: zinc finger CCCH domain-containin...  74.7    5e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008355011.1|  PREDICTED: zinc finger CCCH domain-containin...  74.7    5e-12   
gb|KDP46484.1|  hypothetical protein JCGZ_08456                       73.9    9e-12   Jatropha curcas
ref|XP_002299802.2|  hypothetical protein POPTR_0001s25960g           73.9    9e-12   
gb|KJB35241.1|  hypothetical protein B456_006G106300                  73.9    9e-12   Gossypium raimondii
gb|EPS63683.1|  hypothetical protein M569_11102                       73.6    1e-11   Genlisea aurea
ref|XP_006411267.1|  hypothetical protein EUTSA_v10016372mg           73.2    1e-11   Eutrema salsugineum [saltwater cress]
ref|XP_010517427.1|  PREDICTED: zinc finger CCCH domain-containin...  73.2    1e-11   Camelina sativa [gold-of-pleasure]
ref|XP_007141759.1|  hypothetical protein PHAVU_008G223400g           73.2    1e-11   Phaseolus vulgaris [French bean]
ref|XP_002528294.1|  hypothetical protein RCOM_0838110                69.7    2e-11   
gb|ADL36657.1|  C3HL domain class transcription factor                72.4    3e-11   Malus domestica [apple tree]
gb|AES61101.2|  zinc finger CCCH domain protein, putative             72.4    3e-11   Medicago truncatula
ref|XP_006411266.1|  hypothetical protein EUTSA_v10016372mg           72.0    3e-11   
ref|XP_003590850.1|  Zinc finger CCCH domain-containing protein       72.4    3e-11   
ref|XP_009338915.1|  PREDICTED: zinc finger CCCH domain-containin...  72.0    3e-11   Pyrus x bretschneideri [bai li]
ref|XP_004500271.1|  PREDICTED: zinc finger CCCH domain-containin...  71.6    4e-11   Cicer arietinum [garbanzo]
ref|XP_006425080.1|  hypothetical protein CICLE_v10027883mg           71.6    5e-11   
ref|XP_006293865.1|  hypothetical protein CARUB_v10022848mg           71.2    5e-11   Capsella rubella
gb|KDO66906.1|  hypothetical protein CISIN_1g005270mg                 71.6    5e-11   Citrus sinensis [apfelsine]
ref|XP_006425079.1|  hypothetical protein CICLE_v10027883mg           71.6    5e-11   Citrus clementina [clementine]
ref|XP_010650895.1|  PREDICTED: zinc finger CCCH domain-containin...  71.2    6e-11   Vitis vinifera
gb|KJB08973.1|  hypothetical protein B456_001G116400                  71.2    6e-11   Gossypium raimondii
ref|XP_010554668.1|  PREDICTED: zinc finger CCCH domain-containin...  71.2    6e-11   Tarenaya hassleriana [spider flower]
ref|XP_010650896.1|  PREDICTED: zinc finger CCCH domain-containin...  71.2    7e-11   Vitis vinifera
ref|XP_010505737.1|  PREDICTED: zinc finger CCCH domain-containin...  70.9    7e-11   Camelina sativa [gold-of-pleasure]
emb|CAN78824.1|  hypothetical protein VITISV_006556                   71.2    7e-11   Vitis vinifera
emb|CBI15944.3|  unnamed protein product                              70.9    8e-11   Vitis vinifera
ref|XP_010516193.1|  PREDICTED: zinc finger CCCH domain-containin...  70.9    8e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010689596.1|  PREDICTED: zinc finger CCCH domain-containin...  70.5    9e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008384793.1|  PREDICTED: zinc finger CCCH domain-containin...  70.9    9e-11   
ref|XP_002961529.1|  hypothetical protein SELMODRAFT_62212            70.5    1e-10   
ref|XP_003600919.1|  Zinc finger CCCH domain-containing protein       70.1    1e-10   Medicago truncatula
ref|XP_010102344.1|  Zinc finger CCCH domain-containing protein 56    70.1    1e-10   Morus notabilis
ref|NP_567030.1|  salt-inducible zinc finger 1                        70.1    1e-10   Arabidopsis thaliana [mouse-ear cress]
emb|CDY54998.1|  BnaCnng27960D                                        69.7    1e-10   Brassica napus [oilseed rape]
emb|CAB87852.1|  putative protein                                     70.1    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006488539.1|  PREDICTED: zinc finger CCCH domain-containin...  70.1    2e-10   
ref|XP_006488540.1|  PREDICTED: zinc finger CCCH domain-containin...  69.7    2e-10   
ref|XP_010427402.1|  PREDICTED: zinc finger CCCH domain-containin...  69.3    2e-10   Camelina sativa [gold-of-pleasure]
ref|XP_003539330.1|  PREDICTED: zinc finger CCCH domain-containin...  69.3    2e-10   Glycine max [soybeans]
gb|KJB55721.1|  hypothetical protein B456_009G091200                  69.3    3e-10   Gossypium raimondii
gb|KJB55720.1|  hypothetical protein B456_009G091200                  69.3    3e-10   Gossypium raimondii
emb|CDY53667.1|  BnaA05g34540D                                        68.9    3e-10   Brassica napus [oilseed rape]
ref|XP_009143241.1|  PREDICTED: zinc finger CCCH domain-containin...  68.9    3e-10   Brassica rapa
ref|XP_010032980.1|  PREDICTED: zinc finger CCCH domain-containin...  68.9    3e-10   Eucalyptus grandis [rose gum]
ref|XP_006350842.1|  PREDICTED: zinc finger CCCH domain-containin...  68.9    4e-10   Solanum tuberosum [potatoes]
gb|EPS73791.1|  hypothetical protein M569_00965                       68.6    4e-10   Genlisea aurea
ref|XP_006651722.1|  PREDICTED: zinc finger CCCH domain-containin...  68.9    4e-10   
gb|KJB35240.1|  hypothetical protein B456_006G106200                  68.6    4e-10   Gossypium raimondii
gb|KGN50665.1|  hypothetical protein Csa_5G207940                     68.6    4e-10   Cucumis sativus [cucumbers]
ref|XP_006435753.1|  hypothetical protein CICLE_v10030920mg           68.6    4e-10   Citrus clementina [clementine]
ref|XP_004148184.1|  PREDICTED: zinc finger CCCH domain-containin...  68.6    4e-10   Cucumis sativus [cucumbers]
ref|XP_004163130.1|  PREDICTED: zinc finger CCCH domain-containin...  68.6    4e-10   
gb|KDO68940.1|  hypothetical protein CISIN_1g006236mg                 68.6    4e-10   Citrus sinensis [apfelsine]
ref|XP_010534604.1|  PREDICTED: zinc finger CCCH domain-containin...  68.6    4e-10   Tarenaya hassleriana [spider flower]
ref|NP_001284654.1|  zinc finger CCCH domain-containing protein 2...  68.6    5e-10   Cucumis melo [Oriental melon]
ref|XP_008464034.1|  PREDICTED: zinc finger CCCH domain-containin...  68.6    5e-10   Cucumis melo [Oriental melon]
ref|XP_010504473.1|  PREDICTED: zinc finger CCCH domain-containin...  68.2    5e-10   Camelina sativa [gold-of-pleasure]
ref|XP_004173380.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  68.6    5e-10   
ref|XP_004491031.1|  PREDICTED: zinc finger CCCH domain-containin...  68.6    5e-10   Cicer arietinum [garbanzo]
ref|XP_004143161.1|  PREDICTED: zinc finger CCCH domain-containin...  68.6    5e-10   Cucumis sativus [cucumbers]
gb|ABI30334.1|  Cys-3-His zinc finger protein                         68.2    5e-10   Capsicum annuum
ref|XP_002876344.1|  zinc finger (CCCH-type) family protein           68.2    5e-10   
gb|KDP44755.1|  hypothetical protein JCGZ_01255                       68.2    6e-10   Jatropha curcas
dbj|BAG15872.1|  transcription factor                                 67.8    7e-10   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_010031207.1|  PREDICTED: zinc finger CCCH domain-containin...  67.8    7e-10   Eucalyptus grandis [rose gum]
ref|XP_010031206.1|  PREDICTED: zinc finger CCCH domain-containin...  67.8    7e-10   Eucalyptus grandis [rose gum]
emb|CDY07621.1|  BnaA03g18900D                                        67.0    9e-10   Brassica napus [oilseed rape]
gb|AFN53676.1|  ankyrin repeat domain-containing protein              66.6    9e-10   Linum usitatissimum
ref|XP_009795434.1|  PREDICTED: zinc finger CCCH domain-containin...  67.4    1e-09   Nicotiana sylvestris
ref|XP_009795435.1|  PREDICTED: zinc finger CCCH domain-containin...  67.4    1e-09   Nicotiana sylvestris
gb|KGN47076.1|  hypothetical protein Csa_6G185260                     67.4    1e-09   Cucumis sativus [cucumbers]
ref|XP_009133413.1|  PREDICTED: zinc finger CCCH domain-containin...  67.0    1e-09   Brassica rapa
ref|XP_004242521.1|  PREDICTED: zinc finger CCCH domain-containin...  67.4    1e-09   Solanum lycopersicum
ref|XP_004242522.1|  PREDICTED: zinc finger CCCH domain-containin...  67.0    1e-09   Solanum lycopersicum
ref|XP_003519610.1|  PREDICTED: zinc finger CCCH domain-containin...  67.0    1e-09   Glycine max [soybeans]
ref|XP_009610396.1|  PREDICTED: zinc finger CCCH domain-containin...  67.0    1e-09   Nicotiana tomentosiformis
ref|XP_009345008.1|  PREDICTED: zinc finger CCCH domain-containin...  67.0    1e-09   Pyrus x bretschneideri [bai li]
gb|AES98646.2|  ARM repeat CCCH-type zinc finger protein              67.0    2e-09   Medicago truncatula
ref|XP_003615688.1|  Zinc finger CCCH domain-containing protein       66.6    2e-09   
gb|EYU26786.1|  hypothetical protein MIMGU_mgv1a025486mg              66.6    2e-09   Erythranthe guttata [common monkey flower]
ref|XP_006401060.1|  hypothetical protein EUTSA_v10012984mg           66.6    2e-09   
ref|XP_009369177.1|  PREDICTED: zinc finger CCCH domain-containin...  66.6    2e-09   
ref|XP_003551272.1|  PREDICTED: zinc finger CCCH domain-containin...  66.2    2e-09   
ref|XP_006403038.1|  hypothetical protein EUTSA_v10005860mg           66.2    2e-09   
ref|XP_008369265.1|  PREDICTED: zinc finger CCCH domain-containin...  66.2    2e-09   
emb|CDY52117.1|  BnaA10g29460D                                        65.9    3e-09   
ref|XP_009120378.1|  PREDICTED: zinc finger CCCH domain-containin...  65.9    3e-09   
emb|CDX80350.1|  BnaC09g33920D                                        65.9    3e-09   
emb|CDY24926.1|  BnaC03g22460D                                        65.9    3e-09   
ref|XP_007016084.1|  Zinc finger family protein                       65.9    3e-09   
ref|XP_010443605.1|  PREDICTED: zinc finger CCCH domain-containin...  65.9    4e-09   
gb|KHN23869.1|  Zinc finger CCCH domain-containing protein 29         65.9    4e-09   
ref|XP_003544707.1|  PREDICTED: zinc finger CCCH domain-containin...  65.9    4e-09   
ref|XP_007142204.1|  hypothetical protein PHAVU_008G260900g           65.5    4e-09   
ref|XP_009805065.1|  PREDICTED: zinc finger CCCH domain-containin...  65.5    4e-09   
ref|XP_011084902.1|  PREDICTED: zinc finger CCCH domain-containin...  65.5    4e-09   
gb|AJB84602.1|  C3H zinc finger protein                               65.5    5e-09   
ref|XP_010253756.1|  PREDICTED: zinc finger CCCH domain-containin...  65.5    5e-09   
ref|XP_003519252.1|  PREDICTED: zinc finger CCCH domain-containin...  65.5    5e-09   
ref|XP_002318200.2|  hypothetical protein POPTR_0012s12760g           65.5    5e-09   
ref|XP_007220214.1|  hypothetical protein PRUPE_ppa002415mg           65.5    5e-09   
ref|XP_008233766.1|  PREDICTED: zinc finger CCCH domain-containin...  65.1    6e-09   
ref|XP_006290794.1|  hypothetical protein CARUB_v10016897mg           65.1    6e-09   
gb|KJB21659.1|  hypothetical protein B456_004G007300                  65.1    6e-09   
ref|XP_007142205.1|  hypothetical protein PHAVU_008G260900g           65.1    7e-09   
gb|KHG10972.1|  hypothetical protein F383_11482                       64.7    7e-09   
ref|XP_011035926.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  64.7    8e-09   
ref|XP_002316207.2|  zinc finger family protein                       64.7    8e-09   
ref|XP_010453982.1|  PREDICTED: zinc finger CCCH domain-containin...  64.3    9e-09   
ref|XP_010101427.1|  Zinc finger CCCH domain-containing protein 29    64.3    1e-08   
ref|XP_010097625.1|  Zinc finger CCCH domain-containing protein 66    64.3    1e-08   
ref|XP_011047835.1|  PREDICTED: zinc finger CCCH domain-containin...  64.3    1e-08   
ref|XP_006280195.1|  hypothetical protein CARUB_v10026101mg           64.3    1e-08   
ref|XP_008354155.1|  PREDICTED: zinc finger CCCH domain-containin...  64.3    1e-08   
gb|ADL36650.1|  C3HL domain class transcription factor                64.3    1e-08   
ref|NP_200670.1|  zinc finger CCCH domain-containing protein 66       63.9    1e-08   
ref|XP_009622998.1|  PREDICTED: zinc finger CCCH domain-containin...  63.9    1e-08   
emb|CBI25469.3|  unnamed protein product                              63.5    2e-08   
ref|XP_002864583.1|  zinc finger (CCCH-type) family protein           63.5    2e-08   
ref|XP_011076700.1|  PREDICTED: zinc finger CCCH domain-containin...  63.5    2e-08   
ref|XP_010264619.1|  PREDICTED: zinc finger CCCH domain-containin...  63.5    2e-08   
gb|EPS69392.1|  hypothetical protein M569_05374                       63.2    2e-08   
gb|AES99612.2|  ARM repeat CCCH-type zinc finger protein              63.2    2e-08   
ref|XP_003616654.1|  Zinc finger CCCH domain-containing protein       63.2    2e-08   
ref|XP_002269430.1|  PREDICTED: zinc finger CCCH domain-containin...  62.8    3e-08   
ref|XP_007008951.1|  Zinc finger family protein                       62.8    3e-08   
ref|XP_008789109.1|  PREDICTED: zinc finger CCCH domain-containin...  62.8    3e-08   
gb|KJB74343.1|  hypothetical protein B456_011G289400                  62.8    3e-08   
emb|CAN68018.1|  hypothetical protein VITISV_014472                   62.8    3e-08   
ref|XP_011043783.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  62.4    4e-08   
dbj|BAI94489.1|  CCCH-type zinc finger protein                        62.4    4e-08   
ref|XP_006379630.1|  hypothetical protein POPTR_0008s06940g           62.4    5e-08   
ref|XP_006355652.1|  PREDICTED: zinc finger CCCH domain-containin...  62.4    5e-08   
ref|XP_010067533.1|  PREDICTED: zinc finger CCCH domain-containin...  62.0    5e-08   
ref|XP_004239943.1|  PREDICTED: zinc finger CCCH domain-containin...  62.0    6e-08   
ref|XP_010264620.1|  PREDICTED: zinc finger CCCH domain-containin...  62.0    6e-08   
gb|KJB78766.1|  hypothetical protein B456_013G017600                  61.6    7e-08   
emb|CDX72183.1|  BnaC08g26910D                                        61.6    8e-08   
ref|XP_004307656.1|  PREDICTED: zinc finger CCCH domain-containin...  61.6    8e-08   
ref|XP_009116292.1|  PREDICTED: zinc finger CCCH domain-containin...  61.2    9e-08   
emb|CDY54602.1|  BnaA05g28580D                                        61.2    9e-08   
ref|XP_010483463.1|  PREDICTED: zinc finger CCCH domain-containin...  61.2    1e-07   
gb|KDO61257.1|  hypothetical protein CISIN_1g004266mg                 60.5    2e-07   
ref|XP_003575849.1|  PREDICTED: zinc finger CCCH domain-containin...  60.1    2e-07   
ref|XP_006470613.1|  PREDICTED: zinc finger CCCH domain-containin...  60.5    2e-07   
gb|EYU20000.1|  hypothetical protein MIMGU_mgv1a002934mg              60.1    2e-07   
emb|CDP14011.1|  unnamed protein product                              60.1    2e-07   
ref|XP_004490603.1|  PREDICTED: zinc finger CCCH domain-containin...  59.7    3e-07   
gb|KEH34294.1|  zinc finger CCCH domain protein                       59.3    3e-07   
gb|KJB67557.1|  hypothetical protein B456_010G196500                  59.3    4e-07   
gb|KJB67558.1|  hypothetical protein B456_010G196500                  59.3    4e-07   
gb|KHN40076.1|  Zinc finger CCCH domain-containing protein 66         57.0    2e-06   
ref|XP_006596425.1|  PREDICTED: zinc finger CCCH domain-containin...  57.0    2e-06   
ref|XP_010937855.1|  PREDICTED: zinc finger CCCH domain-containin...  56.6    3e-06   
ref|XP_009384917.1|  PREDICTED: zinc finger CCCH domain-containin...  55.8    7e-06   
ref|XP_010920847.1|  PREDICTED: zinc finger CCCH domain-containin...  55.5    8e-06   
ref|XP_003569054.1|  PREDICTED: zinc finger CCCH domain-containin...  55.1    1e-05   
emb|CDP19841.1|  unnamed protein product                              54.3    1e-05   
ref|XP_010535371.1|  PREDICTED: zinc finger CCCH domain-containin...  54.7    2e-05   
ref|XP_010535372.1|  PREDICTED: zinc finger CCCH domain-containin...  54.3    2e-05   
ref|XP_004962884.1|  PREDICTED: zinc finger CCCH domain-containin...  53.9    2e-05   
emb|CDP09199.1|  unnamed protein product                              53.9    3e-05   
gb|KEH34292.1|  CCCH-type zinc finger protein, putative               53.5    3e-05   
ref|XP_002532939.1|  hypothetical protein RCOM_0169960                48.9    1e-04   
ref|XP_002442230.1|  hypothetical protein SORBIDRAFT_08g016640        51.2    2e-04   
ref|XP_008793149.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  51.6    2e-04   
gb|ACN25172.1|  unknown                                               51.2    2e-04   
ref|NP_001147048.1|  nucleic acid binding protein                     51.2    2e-04   
gb|EMT11555.1|  hypothetical protein F775_31604                       50.8    2e-04   
ref|XP_008657958.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  51.2    2e-04   
ref|XP_010237224.1|  PREDICTED: zinc finger CCCH domain-containin...  51.2    2e-04   
ref|XP_009406924.1|  PREDICTED: zinc finger CCCH domain-containin...  50.8    3e-04   
tpg|DAA41140.1|  TPA: hypothetical protein ZEAMMB73_262629            49.7    6e-04   
ref|XP_003078560.1|  putative finger transcription factor (ISS)       49.3    6e-04   
dbj|BAJ96143.1|  predicted protein                                    49.7    7e-04   
ref|NP_001145979.1|  uncharacterized protein LOC100279507             49.7    8e-04   
gb|EAZ20669.1|  hypothetical protein OsJ_36284                        49.3    8e-04   
ref|XP_003562905.1|  PREDICTED: zinc finger CCCH domain-containin...  49.3    9e-04   
ref|XP_009380689.1|  PREDICTED: zinc finger CCCH domain-containin...  49.3    0.001   
tpg|DAA41142.1|  TPA: hypothetical protein ZEAMMB73_262629            48.9    0.001   



>ref|XP_002526718.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF35632.1| nucleic acid binding protein, putative [Ricinus communis]
Length=728

 Score =   142 bits (358),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 68/90 (76%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = +3

Query  345  ITVDNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQ  524
            I+ ++S +T +++NHLTVETEDTF+SLLELAANNDIEG KR I  DPS +DE+G WYGR+
Sbjct  19   ISSEDSRSTNIDMNHLTVETEDTFASLLELAANNDIEGFKRTIERDPSCVDEIGLWYGRR  78

Query  525  KGSKQMVLEHRTPLMVAATYGSIDVLKLIL  614
            KGSKQMV EHRTPLMVAATYGSIDV+KLIL
Sbjct  79   KGSKQMVNEHRTPLMVAATYGSIDVIKLIL  108



>ref|XP_010257240.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
isoform X1 [Nelumbo nucifera]
Length=742

 Score =   142 bits (358),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 67/82 (82%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +3

Query  369  TIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVL  548
            TI ++NHLTVETED+FSSLLELAANND+EG KR +  D S++DE+G WYGRQKGSKQMVL
Sbjct  38   TIKSMNHLTVETEDSFSSLLELAANNDLEGFKRSLERDASAVDEIGLWYGRQKGSKQMVL  97

Query  549  EHRTPLMVAATYGSIDVLKLIL  614
            EHRTPLMVAATYGSIDVLKLIL
Sbjct  98   EHRTPLMVAATYGSIDVLKLIL  119



>ref|XP_010257241.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
isoform X2 [Nelumbo nucifera]
Length=729

 Score =   142 bits (357),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 67/82 (82%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +3

Query  369  TIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVL  548
            TI ++NHLTVETED+FSSLLELAANND+EG KR +  D S++DE+G WYGRQKGSKQMVL
Sbjct  25   TIKSMNHLTVETEDSFSSLLELAANNDLEGFKRSLERDASAVDEIGLWYGRQKGSKQMVL  84

Query  549  EHRTPLMVAATYGSIDVLKLIL  614
            EHRTPLMVAATYGSIDVLKLIL
Sbjct  85   EHRTPLMVAATYGSIDVLKLIL  106



>gb|KDO45407.1| hypothetical protein CISIN_1g006944mg [Citrus sinensis]
 gb|KDO45408.1| hypothetical protein CISIN_1g006944mg [Citrus sinensis]
Length=624

 Score =   139 bits (349),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 65/90 (72%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +3

Query  345  ITVDNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQ  524
            I+ D S  T +++NHLTVET+D F+SLLELAANND+EG KR I  DPS +DEVG WYGRQ
Sbjct  19   ISFDESRHTNVDMNHLTVETDDAFASLLELAANNDVEGFKRSIVCDPSGVDEVGLWYGRQ  78

Query  525  KGSKQMVLEHRTPLMVAATYGSIDVLKLIL  614
            KGSKQMV E RTPLMVAATYGSID+++LIL
Sbjct  79   KGSKQMVNEQRTPLMVAATYGSIDIIRLIL  108



>emb|CDP18658.1| unnamed protein product [Coffea canephora]
Length=702

 Score =   139 bits (351),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 63/80 (79%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  375  MNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEH  554
            M++NHLTVETED  +S+LELAANND++G KRW+  DP+S+DEVG WYGRQKGSKQMVLE 
Sbjct  1    MDMNHLTVETEDVLASVLELAANNDMDGFKRWVEQDPTSVDEVGLWYGRQKGSKQMVLEE  60

Query  555  RTPLMVAATYGSIDVLKLIL  614
            RTPLMVAATYGSIDVL+LIL
Sbjct  61   RTPLMVAATYGSIDVLELIL  80



>ref|XP_004249196.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Solanum lycopersicum]
 ref|XP_004249197.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Solanum lycopersicum]
Length=703

 Score =   138 bits (348),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 64/80 (80%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +3

Query  375  MNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEH  554
            MN+NHLTVETEDT +SLLE+A+NNDI+  KRWI  D SSI+EVG WYGRQKG++QMVLEH
Sbjct  1    MNMNHLTVETEDTLASLLEIASNNDIDAFKRWIEHDLSSINEVGMWYGRQKGTRQMVLEH  60

Query  555  RTPLMVAATYGSIDVLKLIL  614
            RTPLMVAA YGSIDVLKLIL
Sbjct  61   RTPLMVAAMYGSIDVLKLIL  80



>ref|XP_009804762.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Nicotiana sylvestris]
Length=693

 Score =   138 bits (347),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 66/80 (83%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  375  MNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEH  554
            M +N+LTVET DTF+SLLELAANNDIE   RWI  D SSI EVGQWYGRQKGSKQMVLEH
Sbjct  1    MTMNNLTVETVDTFASLLELAANNDIEAFTRWIERDLSSIHEVGQWYGRQKGSKQMVLEH  60

Query  555  RTPLMVAATYGSIDVLKLIL  614
            RT LM+AATYGSIDVLKLIL
Sbjct  61   RTALMIAATYGSIDVLKLIL  80



>ref|XP_009781965.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Nicotiana sylvestris]
Length=701

 Score =   137 bits (346),  Expect = 7e-34, Method: Composition-based stats.
 Identities = 65/80 (81%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  375  MNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEH  554
            MN+NHLTVETEDTF+SLLE AANNDIE  K W+  D S I EVG WYGRQKGSKQMVLEH
Sbjct  1    MNMNHLTVETEDTFASLLEFAANNDIEAFKSWMERDISGIHEVGLWYGRQKGSKQMVLEH  60

Query  555  RTPLMVAATYGSIDVLKLIL  614
            RTPLMVAA YGS+DVLKLIL
Sbjct  61   RTPLMVAAMYGSVDVLKLIL  80



>ref|XP_006351223.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Solanum tuberosum]
Length=703

 Score =   137 bits (345),  Expect = 9e-34, Method: Composition-based stats.
 Identities = 64/80 (80%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  375  MNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEH  554
            MN+NHLTVETEDT +SLLE+A+NNDI+  KRWI  D SS+ EVG WYGRQKGS+QMVLEH
Sbjct  1    MNMNHLTVETEDTLASLLEIASNNDIDAFKRWIEHDLSSVHEVGLWYGRQKGSRQMVLEH  60

Query  555  RTPLMVAATYGSIDVLKLIL  614
            RTPLMVAA YGSIDVLKLIL
Sbjct  61   RTPLMVAAMYGSIDVLKLIL  80



>ref|XP_006493920.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
isoform X1 [Citrus sinensis]
 ref|XP_006493921.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
isoform X2 [Citrus sinensis]
Length=732

 Score =   137 bits (345),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 65/90 (72%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +3

Query  345  ITVDNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQ  524
            I+ D S  T +++NHLTVET+D F+SLLELAANND+EG KR I  DPS +DEVG WYGRQ
Sbjct  19   ISFDESRHTNVDMNHLTVETDDAFASLLELAANNDVEGFKRSIVCDPSGVDEVGLWYGRQ  78

Query  525  KGSKQMVLEHRTPLMVAATYGSIDVLKLIL  614
            KGSKQMV E RTPLMVAATYGSID+++LIL
Sbjct  79   KGSKQMVNEQRTPLMVAATYGSIDIIRLIL  108



>ref|XP_006421436.1| hypothetical protein CICLE_v10004423mg [Citrus clementina]
 gb|ESR34676.1| hypothetical protein CICLE_v10004423mg [Citrus clementina]
Length=731

 Score =   137 bits (345),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 65/90 (72%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +3

Query  345  ITVDNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQ  524
            I+ D S  T +++NHLTVET+D F+SLLELAANND+EG KR I  DPS +DEVG WYGRQ
Sbjct  19   ISFDESRHTNVDMNHLTVETDDAFASLLELAANNDVEGFKRSIVCDPSGVDEVGLWYGRQ  78

Query  525  KGSKQMVLEHRTPLMVAATYGSIDVLKLIL  614
            KGSKQMV E RTPLMVAATYGSID+++LIL
Sbjct  79   KGSKQMVNEQRTPLMVAATYGSIDIIRLIL  108



>gb|KDP26019.1| hypothetical protein JCGZ_21052 [Jatropha curcas]
Length=703

 Score =   137 bits (344),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 63/78 (81%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +3

Query  381  INHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRT  560
            +NHLTVETEDTF+SLLELAANND+EG KRWI  DP  +DEVG WYGRQKGSKQMV +HRT
Sbjct  1    MNHLTVETEDTFASLLELAANNDVEGFKRWIERDPLCVDEVGLWYGRQKGSKQMVNQHRT  60

Query  561  PLMVAATYGSIDVLKLIL  614
            PLMVAATYGSI V+KL+L
Sbjct  61   PLMVAATYGSIGVIKLVL  78



>gb|ADL36655.1| C3HL domain class transcription factor [Malus domestica]
Length=736

 Score =   135 bits (340),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 67/90 (74%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +3

Query  345  ITVDNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQ  524
            I+VD S  +   +NHLTVETED F+SLLELAANNDIE  KR I  DPS+IDE+G WY RQ
Sbjct  19   ISVDESRLSNTAMNHLTVETEDAFASLLELAANNDIESFKRSIEQDPSAIDEIGLWYCRQ  78

Query  525  KGSKQMVLEHRTPLMVAATYGSIDVLKLIL  614
            KGSKQMV E RTPLMVAATYGSIDV+KLIL
Sbjct  79   KGSKQMVNEQRTPLMVAATYGSIDVMKLIL  108



>ref|XP_009340782.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Pyrus x bretschneideri]
 ref|XP_009340785.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Pyrus x bretschneideri]
Length=736

 Score =   135 bits (339),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 67/90 (74%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +3

Query  345  ITVDNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQ  524
            I+VD S  +   +NHLTVETED F+SLLELAANNDIE  KR I  DPS+IDE+G WY RQ
Sbjct  19   ISVDESRLSNTAMNHLTVETEDAFASLLELAANNDIESFKRSIEQDPSAIDEIGLWYCRQ  78

Query  525  KGSKQMVLEHRTPLMVAATYGSIDVLKLIL  614
            KGSKQMV E RTPLMVAATYGSIDV+KLIL
Sbjct  79   KGSKQMVNEQRTPLMVAATYGSIDVVKLIL  108



>ref|XP_009777511.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Nicotiana sylvestris]
 ref|XP_009777516.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Nicotiana sylvestris]
Length=678

 Score =   134 bits (338),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 65/80 (81%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  375  MNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEH  554
            MN+N+LTVETED+F SLLELAANNDI   KRWI  D S I EVG WYGRQKGS+QMVLEH
Sbjct  1    MNMNNLTVETEDSFVSLLELAANNDIVAFKRWIEHDLSGIHEVGLWYGRQKGSRQMVLEH  60

Query  555  RTPLMVAATYGSIDVLKLIL  614
            RTPL+VAATYGSIDVLKLIL
Sbjct  61   RTPLLVAATYGSIDVLKLIL  80



>ref|NP_565962.1| zinc finger CCCH domain-containing protein 30 [Arabidopsis thaliana]
 sp|P93755.2|C3H30_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 30; 
Short=AtC3H30 [Arabidopsis thaliana]
 gb|AAK59832.1| At2g41900/T6D20.20 [Arabidopsis thaliana]
 gb|AAB63552.2| putative CCCH-type zinc finger protein [Arabidopsis thaliana]
 gb|AAM16218.1| At2g41900/T6D20.20 [Arabidopsis thaliana]
 gb|AEC10046.1| zinc finger CCCH domain-containing protein 30 [Arabidopsis thaliana]
Length=716

 Score =   135 bits (339),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 64/87 (74%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +3

Query  354  DNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGS  533
            DN+L T  ++NHLTVETEDTF+SLLELAANND+EGV+  I  DPS +DE G WYGRQKGS
Sbjct  25   DNNLVTNTDMNHLTVETEDTFASLLELAANNDVEGVRLSIERDPSCVDEAGLWYGRQKGS  84

Query  534  KQMVLEHRTPLMVAATYGSIDVLKLIL  614
            K MV ++RTPLMVAATYGSIDV+KLI+
Sbjct  85   KAMVNDYRTPLMVAATYGSIDVIKLIV  111



>ref|XP_010278986.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Nelumbo nucifera]
Length=737

 Score =   134 bits (338),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 64/79 (81%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +3

Query  378  NINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHR  557
            ++NHLTVETED+FSSLLELAANND+EG KR +  D S+IDE+G WY RQKGSKQ+VLEHR
Sbjct  30   SMNHLTVETEDSFSSLLELAANNDVEGFKRSLERDASAIDEIGLWYVRQKGSKQIVLEHR  89

Query  558  TPLMVAATYGSIDVLKLIL  614
            TPLMVAATYGSIDVLKLIL
Sbjct  90   TPLMVAATYGSIDVLKLIL  108



>ref|XP_002526717.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF35631.1| nucleic acid binding protein, putative [Ricinus communis]
Length=725

 Score =   134 bits (338),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 65/90 (72%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +3

Query  345  ITVDNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQ  524
            I++  S  T +++NHLTVET DTF+SLLELAANND+EG KR I  +PS +DEVG WYGR+
Sbjct  19   ISLQESRQTSIDMNHLTVETADTFASLLELAANNDVEGFKRSIKREPSCVDEVGLWYGRK  78

Query  525  KGSKQMVLEHRTPLMVAATYGSIDVLKLIL  614
            KGSKQMV E RTPLMVAATYGSIDV+KLIL
Sbjct  79   KGSKQMVNELRTPLMVAATYGSIDVIKLIL  108



>ref|XP_011033310.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Populus euphratica]
Length=732

 Score =   134 bits (337),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 62/90 (69%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +3

Query  345  ITVDNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQ  524
            I  D S  + M++NHLT++TED F+SLLELAANND+EG K++I  DPS +DE+G WYGRQ
Sbjct  19   IYFDKSRPSNMDMNHLTIKTEDAFASLLELAANNDVEGFKKYIECDPSCVDEIGLWYGRQ  78

Query  525  KGSKQMVLEHRTPLMVAATYGSIDVLKLIL  614
            KGSKQMV + RTPLMVAATYGSIDV+K+IL
Sbjct  79   KGSKQMVNDLRTPLMVAATYGSIDVIKVIL  108



>ref|XP_010092985.1| Zinc finger CCCH domain-containing protein 30 [Morus notabilis]
 gb|EXB53134.1| Zinc finger CCCH domain-containing protein 30 [Morus notabilis]
Length=735

 Score =   133 bits (335),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 65/90 (72%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +3

Query  345  ITVDNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQ  524
            I+ + +  + + +NHLTVETEDTF+SLLELAANND+EG KR I  DPSSIDE G WYGRQ
Sbjct  19   ISFEENRVSNIAMNHLTVETEDTFASLLELAANNDVEGFKRSIERDPSSIDEPGLWYGRQ  78

Query  525  KGSKQMVLEHRTPLMVAATYGSIDVLKLIL  614
            KGSK MV E RTPLMVAATYGSIDV+K+IL
Sbjct  79   KGSKLMVNEQRTPLMVAATYGSIDVMKVIL  108



>ref|NP_001280976.1| zinc finger CCCH domain-containing protein 30 [Malus domestica]
 gb|ADL36658.1| C3HL domain class transcription factor [Malus domestica]
 gb|ADL36659.1| C3HL domain class transcription factor [Malus domestica]
Length=731

 Score =   133 bits (335),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 66/90 (73%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +3

Query  345  ITVDNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQ  524
            I+VD S  +   +NHLTVETED F+SLLELAANNDI+  KR I  DPS IDE+G WY RQ
Sbjct  19   ISVDESRLSNTAMNHLTVETEDAFASLLELAANNDIQSFKRSIEHDPSGIDEIGLWYCRQ  78

Query  525  KGSKQMVLEHRTPLMVAATYGSIDVLKLIL  614
            KGSKQMV E RTPLMVAATYGSIDV+KLIL
Sbjct  79   KGSKQMVNEQRTPLMVAATYGSIDVMKLIL  108



>ref|XP_007028819.1| C3HL domain class transcription factor isoform 1 [Theobroma cacao]
 ref|XP_007028820.1| C3HL domain class transcription factor isoform 1 [Theobroma cacao]
 ref|XP_007028821.1| C3HL domain class transcription factor isoform 1 [Theobroma cacao]
 gb|EOY09321.1| C3HL domain class transcription factor isoform 1 [Theobroma cacao]
 gb|EOY09322.1| C3HL domain class transcription factor isoform 1 [Theobroma cacao]
 gb|EOY09323.1| C3HL domain class transcription factor isoform 1 [Theobroma cacao]
Length=727

 Score =   133 bits (334),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 65/90 (72%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +3

Query  345  ITVDNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQ  524
            I+ ++S    +++NHLTVETED F+SLLELAANND+EG K  I  DPS +DEVG WYGRQ
Sbjct  19   ISFEDSRHPSVDMNHLTVETEDAFASLLELAANNDVEGFKLSIERDPSGVDEVGLWYGRQ  78

Query  525  KGSKQMVLEHRTPLMVAATYGSIDVLKLIL  614
            KGSKQMV E RTPLMVAATYGSIDV+KLIL
Sbjct  79   KGSKQMVNEERTPLMVAATYGSIDVIKLIL  108



>gb|KJB14960.1| hypothetical protein B456_002G152400 [Gossypium raimondii]
 gb|KJB14961.1| hypothetical protein B456_002G152400 [Gossypium raimondii]
Length=684

 Score =   132 bits (333),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +3

Query  381  INHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRT  560
            +NHLT+ T+DTF+SLLELAANND+EG KRWI  DP S+DEVG WYGRQKGSKQMV E RT
Sbjct  1    MNHLTLVTDDTFASLLELAANNDVEGFKRWIEHDPFSVDEVGLWYGRQKGSKQMVNEERT  60

Query  561  PLMVAATYGSIDVLKLIL  614
            PLMVA+TYGSIDV+KLI+
Sbjct  61   PLMVASTYGSIDVIKLII  78



>ref|XP_004234834.1| PREDICTED: zinc finger CCCH domain-containing protein 30 [Solanum 
lycopersicum]
Length=695

 Score =   132 bits (332),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 62/85 (73%), Positives = 73/85 (86%), Gaps = 1/85 (1%)
 Frame = +3

Query  363  LATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSD-PSSIDEVGQWYGRQKGSKQ  539
            + T MN+NHLTVETEDTF+SLLE+AANND+   KRW+  D  SSI EVG WYG QKGS++
Sbjct  1    MITTMNMNHLTVETEDTFASLLEIAANNDVVACKRWMEYDLSSSIHEVGLWYGHQKGSRK  60

Query  540  MVLEHRTPLMVAATYGSIDVLKLIL  614
            MVLEHRTPLM+A+TYGS+DVLKLIL
Sbjct  61   MVLEHRTPLMIASTYGSVDVLKLIL  85



>ref|XP_009617179.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Nicotiana tomentosiformis]
Length=695

 Score =   132 bits (332),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 63/80 (79%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  375  MNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEH  554
            MN+NHLTVETEDTF+SLLE AANND+E  K  +  D S I EVG WYGRQKGSKQMVLEH
Sbjct  1    MNMNHLTVETEDTFASLLEFAANNDVEAFKSLMERDISGIHEVGLWYGRQKGSKQMVLEH  60

Query  555  RTPLMVAATYGSIDVLKLIL  614
            RTPLMVAA YGS+DVLKLIL
Sbjct  61   RTPLMVAAMYGSVDVLKLIL  80



>ref|XP_002308038.2| zinc finger family protein [Populus trichocarpa]
 gb|EEE91561.2| zinc finger family protein [Populus trichocarpa]
Length=735

 Score =   132 bits (332),  Expect = 7e-32, Method: Composition-based stats.
 Identities = 63/90 (70%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +3

Query  345  ITVDNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQ  524
            I+ D +L + + +NHLTVETEDTF+SLLELAANND+EG K+ I  D S +DE+G WYGR+
Sbjct  19   ISSDENLPSNIVMNHLTVETEDTFASLLELAANNDVEGFKQSIERDLSCVDEIGLWYGRK  78

Query  525  KGSKQMVLEHRTPLMVAATYGSIDVLKLIL  614
            KGSKQMV EHRTPLMVA+TYGSIDV+K+IL
Sbjct  79   KGSKQMVNEHRTPLMVASTYGSIDVIKVIL  108



>gb|KDP43473.1| hypothetical protein JCGZ_16760 [Jatropha curcas]
Length=731

 Score =   132 bits (332),  Expect = 7e-32, Method: Composition-based stats.
 Identities = 62/78 (79%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +3

Query  381  INHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRT  560
            +NHLTVETED+FSSLLE AANND+EG K  I  D SSIDEVG WYGRQKGSK +VL+HRT
Sbjct  1    MNHLTVETEDSFSSLLEFAANNDVEGFKHLIERDASSIDEVGYWYGRQKGSKNIVLDHRT  60

Query  561  PLMVAATYGSIDVLKLIL  614
            PLMVAATYGS+DVLK IL
Sbjct  61   PLMVAATYGSLDVLKFIL  78



>ref|XP_009340157.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Pyrus x bretschneideri]
Length=732

 Score =   132 bits (332),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 65/90 (72%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +3

Query  345  ITVDNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQ  524
            I+VD S  +   +NHLTVETED F+SLLELAANNDI+  KR I  DPS IDE+G WY RQ
Sbjct  19   ISVDESRLSNTAMNHLTVETEDAFASLLELAANNDIQSFKRSIEHDPSGIDEIGLWYCRQ  78

Query  525  KGSKQMVLEHRTPLMVAATYGSIDVLKLIL  614
            KGSKQMV E R+PLMVAATYGSIDV+KLIL
Sbjct  79   KGSKQMVNEQRSPLMVAATYGSIDVMKLIL  108



>ref|XP_009334960.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Pyrus x bretschneideri]
Length=732

 Score =   132 bits (332),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 65/90 (72%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +3

Query  345  ITVDNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQ  524
            I+VD S  +   +NHLTVETED F+SLLELAANNDI+  KR I  DPS IDE+G WY RQ
Sbjct  19   ISVDESRLSNTAMNHLTVETEDAFASLLELAANNDIQSFKRSIEHDPSGIDEIGLWYCRQ  78

Query  525  KGSKQMVLEHRTPLMVAATYGSIDVLKLIL  614
            KGSKQMV E R+PLMVAATYGSIDV+KLIL
Sbjct  79   KGSKQMVNEQRSPLMVAATYGSIDVMKLIL  108



>ref|XP_010554845.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Tarenaya hassleriana]
Length=710

 Score =   132 bits (331),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 62/87 (71%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +3

Query  354  DNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGS  533
            DN LA   ++NHLTVETEDTF+SLLELAANND+EG +  +  DPS +DEVG WYGRQKGS
Sbjct  24   DNVLAPYTDMNHLTVETEDTFASLLELAANNDVEGFRLSLVRDPSCVDEVGLWYGRQKGS  83

Query  534  KQMVLEHRTPLMVAATYGSIDVLKLIL  614
            + MV + RTPLMVAATYGSIDV+KLI+
Sbjct  84   RSMVNDQRTPLMVAATYGSIDVIKLII  110



>ref|XP_002314035.2| hypothetical protein POPTR_0009s06580g [Populus trichocarpa]
 gb|EEE87990.2| hypothetical protein POPTR_0009s06580g [Populus trichocarpa]
Length=728

 Score =   132 bits (331),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 67/89 (75%), Positives = 75/89 (84%), Gaps = 1/89 (1%)
 Frame = +3

Query  348  TVDNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQK  527
            TV+NS  T   +N LTVETED+FSSLLELAANND+EG KR+I  D SSI EVG WYGRQK
Sbjct  19   TVENSPIT-KEMNCLTVETEDSFSSLLELAANNDVEGFKRFIEQDASSIKEVGFWYGRQK  77

Query  528  GSKQMVLEHRTPLMVAATYGSIDVLKLIL  614
            GSKQ+VL+ RTPLMVAATYGS+DVLK IL
Sbjct  78   GSKQIVLDQRTPLMVAATYGSVDVLKFIL  106



>emb|CDY14802.1| BnaC04g47990D [Brassica napus]
Length=597

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +3

Query  369  TIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVL  548
            T   +NHL VETEDTF+SLLELAANND+EGV+  I  DPS +DE G WYGRQKGSK MV 
Sbjct  19   TNTEMNHLRVETEDTFASLLELAANNDVEGVRLSIDRDPSCVDEPGLWYGRQKGSKAMVN  78

Query  549  EHRTPLMVAATYGSIDVLKLIL  614
            +HRTPLMVAATYGSIDV+KLIL
Sbjct  79   DHRTPLMVAATYGSIDVIKLIL  100



>emb|CBI24886.3| unnamed protein product [Vitis vinifera]
Length=518

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  381  INHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRT  560
            +NHLTVETED+FSSL ELAANND++G KR +  D S+I+EVG WYGRQKGSKQMVL+HRT
Sbjct  1    MNHLTVETEDSFSSLHELAANNDVDGFKRSLERDASAINEVGLWYGRQKGSKQMVLKHRT  60

Query  561  PLMVAATYGSIDVLKLIL  614
            P+MVAATYGS++VLKLIL
Sbjct  61   PMMVAATYGSVEVLKLIL  78



>ref|NP_001267839.1| zinc finger CCCH domain-containing protein 30-like [Vitis vinifera]
 gb|ADE74631.1| unknown [Vitis vinifera]
Length=740

 Score =   132 bits (331),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 61/80 (76%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  375  MNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEH  554
            +++NHLTVETED+FSSL ELAANND++G KR +  D S+I+EVG WYGRQKGSKQMVLEH
Sbjct  26   IDMNHLTVETEDSFSSLHELAANNDVDGFKRSLERDASAINEVGLWYGRQKGSKQMVLEH  85

Query  555  RTPLMVAATYGSIDVLKLIL  614
            RTP+MVAATYGS++VLKLIL
Sbjct  86   RTPMMVAATYGSVEVLKLIL  105



>ref|XP_009618285.1| PREDICTED: zinc finger CCCH domain-containing protein 30 [Nicotiana 
tomentosiformis]
 ref|XP_009618286.1| PREDICTED: zinc finger CCCH domain-containing protein 30 [Nicotiana 
tomentosiformis]
Length=697

 Score =   131 bits (330),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 64/80 (80%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  375  MNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEH  554
            MN+NHLTVETED+F SLLELAANNDI   KR +  D S I EVG WYGRQKGS+QMVLEH
Sbjct  1    MNMNHLTVETEDSFVSLLELAANNDIVAFKRLMEHDLSGIHEVGLWYGRQKGSRQMVLEH  60

Query  555  RTPLMVAATYGSIDVLKLIL  614
            RTPL+VAATYGSIDVLKLIL
Sbjct  61   RTPLLVAATYGSIDVLKLIL  80



>ref|XP_011020339.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Populus euphratica]
 ref|XP_011020340.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Populus euphratica]
Length=735

 Score =   130 bits (328),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 62/90 (69%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +3

Query  345  ITVDNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQ  524
            I+ D +  + + +NHLTVETEDTF+SLLELAANND+EG K+ I  D S +DE+G WYGR+
Sbjct  19   ISSDKNQPSNIVMNHLTVETEDTFASLLELAANNDVEGFKQSIEHDLSCVDEIGLWYGRK  78

Query  525  KGSKQMVLEHRTPLMVAATYGSIDVLKLIL  614
            KGSKQMV EHRTPLMVAATYGSIDV+++IL
Sbjct  79   KGSKQMVNEHRTPLMVAATYGSIDVIRVIL  108



>gb|KJB14972.1| hypothetical protein B456_002G152300 [Gossypium raimondii]
Length=716

 Score =   130 bits (327),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 64/87 (74%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = +3

Query  354  DNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGS  533
            DN L  + ++NHLTV TEDTF+SLLELAANND+EG KR +  DPS +DEVG WYGRQKGS
Sbjct  23   DNRLPRV-DMNHLTVATEDTFASLLELAANNDVEGFKRSMEHDPSGVDEVGLWYGRQKGS  81

Query  534  KQMVLEHRTPLMVAATYGSIDVLKLIL  614
            KQMV E RTPLMVA+ YGSIDV+KLIL
Sbjct  82   KQMVNEERTPLMVASMYGSIDVIKLIL  108



>emb|CDY06895.1| BnaA04g24200D [Brassica napus]
Length=620

 Score =   129 bits (325),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 64/95 (67%), Positives = 74/95 (78%), Gaps = 0/95 (0%)
 Frame = +3

Query  330  NQVI*ITVDNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQ  509
            +Q+  I+      T   +NHL VETEDTF+SLLELAANND+EGV+  I  DPS +DE G 
Sbjct  6    DQLNQISSPEDTTTNTEMNHLRVETEDTFASLLELAANNDVEGVRLSIDRDPSCVDEPGL  65

Query  510  WYGRQKGSKQMVLEHRTPLMVAATYGSIDVLKLIL  614
            WYGRQKGSK MV +HRTPLMVAATYGSIDV+KLIL
Sbjct  66   WYGRQKGSKAMVNDHRTPLMVAATYGSIDVIKLIL  100



>gb|KHG03427.1| hypothetical protein F383_27140 [Gossypium arboreum]
Length=695

 Score =   130 bits (326),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 62/78 (79%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +3

Query  381  INHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRT  560
            +NHLT+ETEDTF+SLLELAANND+EG KR I  DPS +DEVG WYGR KGSKQMV   RT
Sbjct  1    MNHLTLETEDTFASLLELAANNDVEGFKRSIQRDPSGVDEVGLWYGRPKGSKQMVNNERT  60

Query  561  PLMVAATYGSIDVLKLIL  614
            PLMVAATYGSIDV+KLIL
Sbjct  61   PLMVAATYGSIDVIKLIL  78



>ref|XP_010505990.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Camelina sativa]
Length=721

 Score =   130 bits (326),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 62/87 (71%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +3

Query  354  DNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGS  533
            DN+L T + +NHL VETEDTF+SLLELAANND+EGV+  I  DPS +DE G WYGRQKGS
Sbjct  24   DNNLVTNLVMNHLRVETEDTFASLLELAANNDVEGVRLSIERDPSCVDEAGLWYGRQKGS  83

Query  534  KQMVLEHRTPLMVAATYGSIDVLKLIL  614
            K MV + RTPLMVAATYGS+DV+KLI+
Sbjct  84   KAMVNDQRTPLMVAATYGSLDVIKLIV  110



>gb|KHG06713.1| hypothetical protein F383_33331 [Gossypium arboreum]
Length=684

 Score =   130 bits (326),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 60/78 (77%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +3

Query  381  INHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRT  560
            +NHLT+ T+DTF+SLLELAANND+EG K WI  DP S+DEVG WYGRQKGSKQMV E RT
Sbjct  1    MNHLTLVTDDTFASLLELAANNDVEGFKLWIEHDPFSVDEVGLWYGRQKGSKQMVNEERT  60

Query  561  PLMVAATYGSIDVLKLIL  614
            PLMVA+TYGSIDV+KLI+
Sbjct  61   PLMVASTYGSIDVIKLII  78



>ref|XP_002308039.2| zinc finger family protein [Populus trichocarpa]
 gb|EEE91562.2| zinc finger family protein [Populus trichocarpa]
Length=701

 Score =   130 bits (326),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  375  MNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEH  554
            M++NHLTVETEDTF+SLLELAA ND+EG KR I  DPS +D++G WYGRQKGSKQM  E+
Sbjct  1    MDMNHLTVETEDTFASLLELAATNDVEGFKRSIERDPSCVDQIGLWYGRQKGSKQMANEY  60

Query  555  RTPLMVAATYGSIDVLKLIL  614
            RTPLMVAATYGSI V+K+IL
Sbjct  61   RTPLMVAATYGSIGVIKVIL  80



>ref|XP_011020337.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Populus euphratica]
 ref|XP_011020338.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Populus euphratica]
Length=699

 Score =   129 bits (325),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 60/78 (77%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +3

Query  381  INHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRT  560
            +NHLTVETEDTF+SLLELAANND+EG KR I  DPS +D++G WYGRQKGSKQM  E+RT
Sbjct  1    MNHLTVETEDTFASLLELAANNDVEGFKRSIERDPSCVDQIGLWYGRQKGSKQMANEYRT  60

Query  561  PLMVAATYGSIDVLKLIL  614
            PLMVAATYGSI V+K+IL
Sbjct  61   PLMVAATYGSIGVIKVIL  78



>ref|XP_010517688.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Camelina sativa]
Length=742

 Score =   130 bits (326),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 62/87 (71%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +3

Query  354  DNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGS  533
            DN+L T + +NHL VETEDTF+SLLELAANND+EGV+  I  DPS +DE G WYGRQKGS
Sbjct  24   DNNLVTNLVMNHLRVETEDTFASLLELAANNDVEGVRLSIERDPSCVDEAGLWYGRQKGS  83

Query  534  KQMVLEHRTPLMVAATYGSIDVLKLIL  614
            K MV + RTPLMVAATYGS+DV+KLI+
Sbjct  84   KAMVNDQRTPLMVAATYGSLDVIKLIV  110



>ref|XP_011025440.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Populus euphratica]
 ref|XP_011025441.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Populus euphratica]
Length=727

 Score =   129 bits (325),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 66/89 (74%), Positives = 74/89 (83%), Gaps = 1/89 (1%)
 Frame = +3

Query  348  TVDNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQK  527
            TV+NS  T   +N LTVETED+FSSLLELAANND+EG KR+I  D SS  EVG WYGRQK
Sbjct  18   TVENSPIT-KEMNCLTVETEDSFSSLLELAANNDVEGFKRFIEQDASSTKEVGFWYGRQK  76

Query  528  GSKQMVLEHRTPLMVAATYGSIDVLKLIL  614
            GSKQ+VL+ RTPLMVAATYGS+DVLK IL
Sbjct  77   GSKQIVLDRRTPLMVAATYGSVDVLKFIL  105



>ref|XP_009142026.1| PREDICTED: zinc finger CCCH domain-containing protein 30 [Brassica 
rapa]
Length=696

 Score =   129 bits (324),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 64/95 (67%), Positives = 74/95 (78%), Gaps = 0/95 (0%)
 Frame = +3

Query  330  NQVI*ITVDNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQ  509
            +Q+  I+      T   +NHL VETEDTF+SLLELAANND+EGV+  I  DPS +DE G 
Sbjct  6    DQLNQISSPEDTTTNTEMNHLRVETEDTFASLLELAANNDVEGVRLSIDRDPSCVDEPGL  65

Query  510  WYGRQKGSKQMVLEHRTPLMVAATYGSIDVLKLIL  614
            WYGRQKGSK MV +HRTPLMVAATYGSIDV+KLIL
Sbjct  66   WYGRQKGSKAMVNDHRTPLMVAATYGSIDVIKLIL  100



>ref|XP_010524053.1| PREDICTED: zinc finger CCCH domain-containing protein 30 [Tarenaya 
hassleriana]
 ref|XP_010524061.1| PREDICTED: zinc finger CCCH domain-containing protein 30 [Tarenaya 
hassleriana]
Length=714

 Score =   129 bits (325),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 61/87 (70%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +3

Query  354  DNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGS  533
            DN      ++NHLTVETEDTF+SLLELAANND+EG +  +  DP  IDEVG WYGRQKGS
Sbjct  24   DNDFVPYPDMNHLTVETEDTFASLLELAANNDVEGFRLSLERDPCCIDEVGLWYGRQKGS  83

Query  534  KQMVLEHRTPLMVAATYGSIDVLKLIL  614
            K MV + RTPLMVAATYGSIDV+KLI+
Sbjct  84   KAMVNDQRTPLMVAATYGSIDVIKLII  110



>ref|XP_002323312.1| zinc finger family protein [Populus trichocarpa]
 gb|EEF05073.1| zinc finger family protein [Populus trichocarpa]
Length=732

 Score =   129 bits (325),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 61/90 (68%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +3

Query  345  ITVDNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQ  524
            I  D S  + +++NHLT++TED F+SLLELAANND+EG K+ I  DPS  DE+G WYGRQ
Sbjct  19   IYFDKSRPSNIDMNHLTIKTEDAFASLLELAANNDVEGFKKSIECDPSCADEIGLWYGRQ  78

Query  525  KGSKQMVLEHRTPLMVAATYGSIDVLKLIL  614
            KGSKQMV + RTPLMVAATYGSIDV+K+IL
Sbjct  79   KGSKQMVNDLRTPLMVAATYGSIDVIKVIL  108



>ref|XP_008240870.1| PREDICTED: zinc finger CCCH domain-containing protein 30 [Prunus 
mume]
 ref|XP_008240871.1| PREDICTED: zinc finger CCCH domain-containing protein 30 [Prunus 
mume]
Length=703

 Score =   129 bits (324),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 63/77 (82%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = +3

Query  384  NHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTP  563
            NHLTVETEDTF+SLLELAANNDIE  KR I  DPS+IDE+G WY RQKGSKQMV E RTP
Sbjct  3    NHLTVETEDTFASLLELAANNDIESFKRSIERDPSAIDEIGLWYCRQKGSKQMVNEQRTP  62

Query  564  LMVAATYGSIDVLKLIL  614
            LMVAA YGSIDV+KLIL
Sbjct  63   LMVAAIYGSIDVIKLIL  79



>ref|XP_007204626.1| hypothetical protein PRUPE_ppa002189mg [Prunus persica]
 gb|EMJ05825.1| hypothetical protein PRUPE_ppa002189mg [Prunus persica]
Length=703

 Score =   129 bits (324),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 63/77 (82%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = +3

Query  384  NHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTP  563
            NHLTVETEDTF+SLLELAANNDIE  KR I  DPS+IDE+G WY RQKGSKQMV E RTP
Sbjct  3    NHLTVETEDTFASLLELAANNDIESFKRSIERDPSAIDEIGLWYCRQKGSKQMVNEQRTP  62

Query  564  LMVAATYGSIDVLKLIL  614
            LMVAA YGSIDV+KLIL
Sbjct  63   LMVAAIYGSIDVIKLIL  79



>ref|XP_004493518.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Cicer arietinum]
Length=727

 Score =   129 bits (324),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 59/78 (76%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +3

Query  381  INHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRT  560
            +NHLTV TED+F+SLLELAANND+EG KR I  DPSS+DEVG WYGR+KGSK+MV E RT
Sbjct  31   MNHLTVGTEDSFASLLELAANNDVEGFKRLIEYDPSSVDEVGLWYGRRKGSKKMVNEQRT  90

Query  561  PLMVAATYGSIDVLKLIL  614
            PLMVAATYGSID++K+I+
Sbjct  91   PLMVAATYGSIDIMKMII  108



>ref|XP_006293740.1| hypothetical protein CARUB_v10022702mg [Capsella rubella]
 gb|EOA26638.1| hypothetical protein CARUB_v10022702mg [Capsella rubella]
Length=721

 Score =   129 bits (324),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 62/87 (71%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +3

Query  354  DNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGS  533
            DN+L    ++NHL VETEDTF+SLLELAANND+EGV+  I  DPS +DE G WYGRQKGS
Sbjct  24   DNNLFNNTDMNHLRVETEDTFASLLELAANNDVEGVRLSIERDPSCVDEAGLWYGRQKGS  83

Query  534  KQMVLEHRTPLMVAATYGSIDVLKLIL  614
            K MV + RTPLMVAATYGSIDV+KLI+
Sbjct  84   KTMVNDQRTPLMVAATYGSIDVIKLIV  110



>ref|XP_008392207.1| PREDICTED: zinc finger CCCH domain-containing protein 30 [Malus 
domestica]
Length=731

 Score =   129 bits (324),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 64/90 (71%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +3

Query  345  ITVDNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQ  524
            I+VD S  +   +NHLTVETED F+SLLELAANNDI+  KR I  DPS IDE+  WY RQ
Sbjct  19   ISVDESRLSNTAMNHLTVETEDAFASLLELAANNDIQSFKRSIEHDPSGIDEIXLWYCRQ  78

Query  525  KGSKQMVLEHRTPLMVAATYGSIDVLKLIL  614
            KGSKQMV E RTPLMVAATYGSIDV++LIL
Sbjct  79   KGSKQMVNEQRTPLMVAATYGSIDVMQLIL  108



>ref|XP_006293739.1| hypothetical protein CARUB_v10022702mg [Capsella rubella]
 gb|EOA26637.1| hypothetical protein CARUB_v10022702mg [Capsella rubella]
Length=746

 Score =   129 bits (324),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 62/87 (71%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +3

Query  354  DNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGS  533
            DN+L    ++NHL VETEDTF+SLLELAANND+EGV+  I  DPS +DE G WYGRQKGS
Sbjct  49   DNNLFNNTDMNHLRVETEDTFASLLELAANNDVEGVRLSIERDPSCVDEAGLWYGRQKGS  108

Query  534  KQMVLEHRTPLMVAATYGSIDVLKLIL  614
            K MV + RTPLMVAATYGSIDV+KLI+
Sbjct  109  KTMVNDQRTPLMVAATYGSIDVIKLIV  135



>gb|KHG19524.1| hypothetical protein F383_24471 [Gossypium arboreum]
Length=716

 Score =   129 bits (323),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 63/87 (72%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = +3

Query  354  DNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGS  533
            DN +  + ++NHLTV TEDTF+SLLELAANND+EG KR +  DPS +DEVG WYGRQKGS
Sbjct  23   DNRVPRV-DMNHLTVVTEDTFASLLELAANNDVEGFKRSMEHDPSGVDEVGLWYGRQKGS  81

Query  534  KQMVLEHRTPLMVAATYGSIDVLKLIL  614
            KQMV E RTPLMVA+ YGSIDV+KLIL
Sbjct  82   KQMVNEERTPLMVASMYGSIDVIKLIL  108



>ref|XP_006411461.1| hypothetical protein EUTSA_v10016315mg [Eutrema salsugineum]
 dbj|BAJ33641.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ52914.1| hypothetical protein EUTSA_v10016315mg [Eutrema salsugineum]
Length=723

 Score =   129 bits (323),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 62/87 (71%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +3

Query  354  DNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGS  533
            D +L T  ++NHL VETEDTF+SLLELAANND+EGV+  I  DPS +DE G WYGRQKGS
Sbjct  24   DTNLLTNTDMNHLRVETEDTFASLLELAANNDVEGVRLSIERDPSCVDEAGLWYGRQKGS  83

Query  534  KQMVLEHRTPLMVAATYGSIDVLKLIL  614
            K MV + RTPLMVAATYGSIDV+KLI+
Sbjct  84   KAMVNDQRTPLMVAATYGSIDVIKLIV  110



>ref|XP_003625157.1| Zinc finger CCCH domain-containing protein [Medicago truncatula]
 gb|ABN08215.1| Zinc finger, CCCH-type [Medicago truncatula]
 gb|AES81375.1| ARM repeat CCCH-type zinc finger protein [Medicago truncatula]
Length=734

 Score =   129 bits (323),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 60/78 (77%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +3

Query  381  INHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRT  560
            +NHLT+ TED+F+SLLELAANND+EG KR I  DP S+DEVG WYGR+KGSKQMV E RT
Sbjct  33   MNHLTISTEDSFASLLELAANNDVEGFKRLIEYDPMSVDEVGLWYGRRKGSKQMVNEQRT  92

Query  561  PLMVAATYGSIDVLKLIL  614
            PLMVAATYGSIDV+KLI 
Sbjct  93   PLMVAATYGSIDVMKLIF  110



>ref|XP_006351322.1| PREDICTED: zinc finger CCCH domain-containing protein 24-like 
[Solanum tuberosum]
Length=697

 Score =   128 bits (322),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 61/80 (76%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  375  MNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEH  554
            M +++ T+ETEDTF+SLLELAANNDIE  K WI  D +SI EVG WYGRQKGSKQMVL+H
Sbjct  1    MTMSNPTIETEDTFASLLELAANNDIEAFKIWIERDLASIHEVGLWYGRQKGSKQMVLDH  60

Query  555  RTPLMVAATYGSIDVLKLIL  614
            RTPLMVAATYGSID LK IL
Sbjct  61   RTPLMVAATYGSIDALKQIL  80



>emb|CBI29869.3| unnamed protein product [Vitis vinifera]
Length=619

 Score =   127 bits (320),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 60/78 (77%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +3

Query  381  INHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRT  560
            +NHLTV TED F+SLLELAANND    K+ I  +PS +DE+GQWYGRQKGSKQMVLE+RT
Sbjct  1    MNHLTVVTEDAFASLLELAANNDFGRFKQSIEREPSGVDEIGQWYGRQKGSKQMVLEYRT  60

Query  561  PLMVAATYGSIDVLKLIL  614
            PLMVAATYGSIDV+KLIL
Sbjct  61   PLMVAATYGSIDVMKLIL  78



>ref|XP_010508649.1| PREDICTED: zinc finger CCCH domain-containing protein 30 [Camelina 
sativa]
 ref|XP_010508650.1| PREDICTED: zinc finger CCCH domain-containing protein 30 [Camelina 
sativa]
 ref|XP_010508651.1| PREDICTED: zinc finger CCCH domain-containing protein 30 [Camelina 
sativa]
Length=727

 Score =   128 bits (321),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 61/87 (70%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +3

Query  354  DNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGS  533
            +N+L T + +NHL VETEDTF+SLLELAANND+EGV+  I  DPS +DE G WYGRQKGS
Sbjct  25   NNNLVTNLVMNHLRVETEDTFASLLELAANNDVEGVRLSIERDPSCVDEAGLWYGRQKGS  84

Query  534  KQMVLEHRTPLMVAATYGSIDVLKLIL  614
            K MV + RTPLMVAATYGS+DV+KLI+
Sbjct  85   KAMVNDQRTPLMVAATYGSLDVIKLIV  111



>ref|XP_010923439.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein 24-like [Elaeis guineensis]
Length=736

 Score =   127 bits (320),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 59/87 (68%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +3

Query  354  DNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGS  533
            +NS + +  + HLT+ET D FSSLLELAANND +G KR +  +PS+IDE+G WYGR+KGS
Sbjct  24   NNSSSDLSXMKHLTIETGDNFSSLLELAANNDADGFKRSVEEEPSAIDEIGLWYGRKKGS  83

Query  534  KQMVLEHRTPLMVAATYGSIDVLKLIL  614
             +MVLEHRTPLMVAATYGSI+VL+LIL
Sbjct  84   NRMVLEHRTPLMVAATYGSIEVLRLIL  110



>ref|XP_002277747.2| PREDICTED: zinc finger CCCH domain-containing protein 30 [Vitis 
vinifera]
 ref|XP_010653797.1| PREDICTED: zinc finger CCCH domain-containing protein 30 [Vitis 
vinifera]
Length=703

 Score =   127 bits (319),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 60/78 (77%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +3

Query  381  INHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRT  560
            +NHLTV TED F+SLLELAANND    K+ I  +PS +DE+GQWYGRQKGSKQMVLE+RT
Sbjct  1    MNHLTVVTEDAFASLLELAANNDFGRFKQSIEREPSGVDEIGQWYGRQKGSKQMVLEYRT  60

Query  561  PLMVAATYGSIDVLKLIL  614
            PLMVAATYGSIDV+KLIL
Sbjct  61   PLMVAATYGSIDVMKLIL  78



>gb|KJB36039.1| hypothetical protein B456_006G138100 [Gossypium raimondii]
 gb|KJB36041.1| hypothetical protein B456_006G138100 [Gossypium raimondii]
Length=695

 Score =   127 bits (318),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 61/78 (78%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +3

Query  381  INHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRT  560
            +NHLT+ETEDTF+SLLELAANND+ G KR I  DPS +DEVG WYGR KGSKQMV   RT
Sbjct  1    MNHLTLETEDTFASLLELAANNDVVGFKRSIQRDPSGVDEVGLWYGRPKGSKQMVNNERT  60

Query  561  PLMVAATYGSIDVLKLIL  614
            PLMVAATYGSIDV+KLIL
Sbjct  61   PLMVAATYGSIDVIKLIL  78



>ref|XP_004249271.1| PREDICTED: zinc finger CCCH domain-containing protein 24-like 
[Solanum lycopersicum]
Length=697

 Score =   126 bits (317),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 60/80 (75%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  375  MNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEH  554
            M +++ T+ETEDTF+SLLELAAN+DIE  K WI  D +SI EVG WYGRQKGSKQMVL+H
Sbjct  1    MTMSNSTIETEDTFASLLELAANDDIEAFKIWIERDLASIHEVGLWYGRQKGSKQMVLDH  60

Query  555  RTPLMVAATYGSIDVLKLIL  614
            RTPLMVAATYGSID LK IL
Sbjct  61   RTPLMVAATYGSIDALKQIL  80



>ref|XP_007145619.1| hypothetical protein PHAVU_007G254100g [Phaseolus vulgaris]
 gb|ESW17613.1| hypothetical protein PHAVU_007G254100g [Phaseolus vulgaris]
Length=700

 Score =   126 bits (316),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 58/78 (74%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +3

Query  381  INHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRT  560
            +NHLT+ETED+F+SLLELAANND+EG KR I  DPS +DEVG WY RQKGS++MV E RT
Sbjct  2    MNHLTIETEDSFASLLELAANNDVEGFKRMIERDPSCVDEVGLWYSRQKGSRRMVNELRT  61

Query  561  PLMVAATYGSIDVLKLIL  614
            PLMVAA+YGSID+L LIL
Sbjct  62   PLMVAASYGSIDILDLIL  79



>ref|XP_006439117.1| hypothetical protein CICLE_v10030816mg [Citrus clementina]
 gb|ESR52357.1| hypothetical protein CICLE_v10030816mg [Citrus clementina]
Length=711

 Score =   126 bits (316),  Expect = 9e-30, Method: Composition-based stats.
 Identities = 58/77 (75%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = +3

Query  384  NHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTP  563
            N+ T ETED+F+S+LELA+NND+EG KR +  DPSS+DEVG WYGR  GSKQMV EHRTP
Sbjct  3    NNSTAETEDSFTSMLELASNNDVEGFKRMLERDPSSVDEVGLWYGRVNGSKQMVSEHRTP  62

Query  564  LMVAATYGSIDVLKLIL  614
            LMVAATYGS+DVLKLIL
Sbjct  63   LMVAATYGSVDVLKLIL  79



>ref|XP_006439118.1| hypothetical protein CICLE_v10030816mg [Citrus clementina]
 gb|ESR52358.1| hypothetical protein CICLE_v10030816mg [Citrus clementina]
Length=725

 Score =   126 bits (317),  Expect = 9e-30, Method: Composition-based stats.
 Identities = 58/77 (75%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = +3

Query  384  NHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTP  563
            N+ T ETED+F+S+LELA+NND+EG KR +  DPSS+DEVG WYGR  GSKQMV EHRTP
Sbjct  17   NNSTAETEDSFTSMLELASNNDVEGFKRMLERDPSSVDEVGLWYGRVNGSKQMVSEHRTP  76

Query  564  LMVAATYGSIDVLKLIL  614
            LMVAATYGS+DVLKLIL
Sbjct  77   LMVAATYGSVDVLKLIL  93



>ref|XP_010937003.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein 24-like [Elaeis guineensis]
Length=747

 Score =   126 bits (316),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 57/86 (66%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +3

Query  357  NSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSK  536
            N+ +  +++NHLT+ET+D FSSLLELAANND +G +R +  DPS++DE+G WYGR+KGS 
Sbjct  27   NNSSPPVDMNHLTIETDDNFSSLLELAANNDADGFQRSVDEDPSAVDEIGLWYGRKKGSN  86

Query  537  QMVLEHRTPLMVAATYGSIDVLKLIL  614
            +MVLE RTPLMVAATYGSI+VL+LIL
Sbjct  87   RMVLEPRTPLMVAATYGSIEVLRLIL  112



>ref|XP_010672777.1| PREDICTED: zinc finger CCCH domain-containing protein 30 [Beta 
vulgaris subsp. vulgaris]
Length=673

 Score =   125 bits (315),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 58/78 (74%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +3

Query  381  INHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRT  560
            +NHLTV+T DTFSSLLE++ANND+EG KR I  DPS +DEVG WY R+KGSKQMV +HRT
Sbjct  1    MNHLTVQTVDTFSSLLEVSANNDVEGFKRLIEDDPSGLDEVGLWYVRKKGSKQMVYQHRT  60

Query  561  PLMVAATYGSIDVLKLIL  614
            PLMVA+ YGS+DVLKLIL
Sbjct  61   PLMVASMYGSMDVLKLIL  78



>ref|XP_006482880.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
isoform X1 [Citrus sinensis]
Length=725

 Score =   126 bits (316),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 58/77 (75%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = +3

Query  384  NHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTP  563
            N+ T ETED+F+S+LELA+NND+EG KR +  DPSS+DEVG WYGR  GSKQMV EHRTP
Sbjct  17   NNSTAETEDSFTSMLELASNNDVEGFKRMLERDPSSVDEVGIWYGRVNGSKQMVSEHRTP  76

Query  564  LMVAATYGSIDVLKLIL  614
            LMVAATYGS+DVLKLIL
Sbjct  77   LMVAATYGSVDVLKLIL  93



>gb|KDO83402.1| hypothetical protein CISIN_1g004911mg [Citrus sinensis]
Length=724

 Score =   125 bits (315),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 58/77 (75%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = +3

Query  384  NHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTP  563
            N+ T ETED+F+S+LELA+NND+EG KR +  DPSS+DEVG WYGR  GSKQMV EHRTP
Sbjct  17   NNSTAETEDSFTSMLELASNNDVEGFKRMLERDPSSVDEVGLWYGRVNGSKQMVSEHRTP  76

Query  564  LMVAATYGSIDVLKLIL  614
            LMVAATYGS+DVLKLIL
Sbjct  77   LMVAATYGSVDVLKLIL  93



>gb|KDO83403.1| hypothetical protein CISIN_1g004911mg [Citrus sinensis]
Length=710

 Score =   125 bits (315),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 58/77 (75%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = +3

Query  384  NHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTP  563
            N+ T ETED+F+S+LELA+NND+EG KR +  DPSS+DEVG WYGR  GSKQMV EHRTP
Sbjct  3    NNSTAETEDSFTSMLELASNNDVEGFKRMLERDPSSVDEVGLWYGRVNGSKQMVSEHRTP  62

Query  564  LMVAATYGSIDVLKLIL  614
            LMVAATYGS+DVLKLIL
Sbjct  63   LMVAATYGSVDVLKLIL  79



>ref|XP_008778438.1| PREDICTED: zinc finger CCCH domain-containing protein 24-like 
[Phoenix dactylifera]
Length=749

 Score =   125 bits (315),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 62/89 (70%), Positives = 73/89 (82%), Gaps = 2/89 (2%)
 Frame = +3

Query  348  TVDNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQK  527
            T  +SLA  M+  HLTV T+D FSSLLELAANND +G +R +  DPS++DEVG WYGR+K
Sbjct  15   TRSSSLARSMS--HLTVVTDDCFSSLLELAANNDADGFRRSLDRDPSAVDEVGMWYGRKK  72

Query  528  GSKQMVLEHRTPLMVAATYGSIDVLKLIL  614
            GS QMVLE RTPLMVAATYGS+DVL+LIL
Sbjct  73   GSNQMVLERRTPLMVAATYGSLDVLRLIL  101



>ref|XP_010931016.1| PREDICTED: zinc finger CCCH domain-containing protein 24-like 
[Elaeis guineensis]
Length=747

 Score =   125 bits (315),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 55/78 (71%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +3

Query  381  INHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRT  560
            +NHLTVET+D+FS+LL+LAANND EG +R +  DPS++DEVG WYGR+KG+  M+L HRT
Sbjct  28   MNHLTVETDDSFSTLLDLAANNDAEGFQRSLDRDPSAVDEVGMWYGRKKGTNLMILLHRT  87

Query  561  PLMVAATYGSIDVLKLIL  614
            PLMVAATYGS+DVL+LIL
Sbjct  88   PLMVAATYGSLDVLRLIL  105



>gb|KFK37035.1| hypothetical protein AALP_AA4G204000 [Arabis alpina]
Length=675

 Score =   125 bits (313),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 59/78 (76%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +3

Query  381  INHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRT  560
            +NHL VETEDTF+SLLELAANND+EGV+  I  DPS +DE G WYGRQKGSK MV + RT
Sbjct  1    MNHLRVETEDTFASLLELAANNDVEGVRLSIERDPSCVDEPGLWYGRQKGSKAMVNDQRT  60

Query  561  PLMVAATYGSIDVLKLIL  614
            PLMVAATYGSIDV+KLI+
Sbjct  61   PLMVAATYGSIDVIKLIV  78



>gb|KHN46294.1| Zinc finger CCCH domain-containing protein 30 [Glycine soja]
Length=709

 Score =   125 bits (313),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 58/78 (74%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +3

Query  381  INHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRT  560
            +N+LT+ETED+F+SLLELAANND+EG KR I  DPS +DEVG WY RQKGS++MV E RT
Sbjct  1    MNNLTIETEDSFASLLELAANNDVEGFKRMIERDPSCVDEVGLWYSRQKGSRRMVNELRT  60

Query  561  PLMVAATYGSIDVLKLIL  614
            PLMVAATYGSID+L LIL
Sbjct  61   PLMVAATYGSIDILDLIL  78



>ref|XP_006589016.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Glycine max]
Length=710

 Score =   125 bits (313),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 58/78 (74%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +3

Query  381  INHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRT  560
            +N+LT+ETED+F+SLLELAANND+EG KR I  DPS +DEVG WY RQKGS++MV E RT
Sbjct  2    MNNLTIETEDSFASLLELAANNDVEGFKRMIERDPSCVDEVGLWYSRQKGSRRMVNELRT  61

Query  561  PLMVAATYGSIDVLKLIL  614
            PLMVAATYGSID+L LIL
Sbjct  62   PLMVAATYGSIDILDLIL  79



>ref|XP_006349561.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Solanum tuberosum]
Length=695

 Score =   124 bits (310),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 61/85 (72%), Positives = 71/85 (84%), Gaps = 1/85 (1%)
 Frame = +3

Query  363  LATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSD-PSSIDEVGQWYGRQKGSKQ  539
            + T MN+NHLTVETEDT +SLLE+AANND+   KRW+  D  SSI EVG WYG QKGS++
Sbjct  1    MITTMNMNHLTVETEDTSASLLEIAANNDVVVCKRWMEHDLSSSIHEVGLWYGHQKGSRK  60

Query  540  MVLEHRTPLMVAATYGSIDVLKLIL  614
            MVLE RTPLMVA+TYGS+DVLKLIL
Sbjct  61   MVLEDRTPLMVASTYGSVDVLKLIL  85



>ref|XP_010909716.1| PREDICTED: zinc finger CCCH domain-containing protein 24-like 
[Elaeis guineensis]
Length=739

 Score =   124 bits (311),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 57/78 (73%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +3

Query  381  INHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRT  560
            ++HLTV T+D FSSLLELAANND +G +R +  DPS++DEVG WYGR+KGS QMVLE RT
Sbjct  24   MSHLTVVTDDCFSSLLELAANNDADGFRRSLDRDPSAVDEVGMWYGRKKGSNQMVLERRT  83

Query  561  PLMVAATYGSIDVLKLIL  614
            PLMVAATYGS+DVL+LIL
Sbjct  84   PLMVAATYGSLDVLRLIL  101



>gb|KHG27269.1| hypothetical protein F383_12616 [Gossypium arboreum]
Length=710

 Score =   123 bits (308),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 57/79 (72%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +3

Query  378  NINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHR  557
            ++NHLTV+TED+FSSLLELA+NND+EG+K+ I  D SSIDEVG WY R+KGS ++V +HR
Sbjct  12   DMNHLTVKTEDSFSSLLELASNNDVEGIKQSIEKDVSSIDEVGLWYCREKGSNRIVAKHR  71

Query  558  TPLMVAATYGSIDVLKLIL  614
            TPLMVAATYGS+DV+KLIL
Sbjct  72   TPLMVAATYGSVDVVKLIL  90



>gb|KJB19291.1| hypothetical protein B456_003G093600 [Gossypium raimondii]
 gb|KJB19292.1| hypothetical protein B456_003G093600 [Gossypium raimondii]
Length=720

 Score =   123 bits (308),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 58/80 (73%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  375  MNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEH  554
            + +N LTVETED F++LLELAANND+EG KR I  DPS +DEVG WYGR+KGSKQMV + 
Sbjct  29   VEMNRLTVETEDIFATLLELAANNDVEGFKRTIEHDPSVVDEVGLWYGRRKGSKQMVHDE  88

Query  555  RTPLMVAATYGSIDVLKLIL  614
            RTPLM+AATYGSI V+KLIL
Sbjct  89   RTPLMIAATYGSIGVIKLIL  108



>ref|XP_008801953.1| PREDICTED: zinc finger CCCH domain-containing protein 24-like 
[Phoenix dactylifera]
Length=772

 Score =   123 bits (309),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 55/78 (71%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +3

Query  381  INHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRT  560
            +NHLTVET+D+FS+LLELAANND E  +R +  DPS++DE G WYGR+KG+  MVL HRT
Sbjct  62   MNHLTVETDDSFSTLLELAANNDAEAFRRSLDRDPSAVDEAGMWYGRKKGTNLMVLLHRT  121

Query  561  PLMVAATYGSIDVLKLIL  614
            PLMVAATYGS+DVL+LIL
Sbjct  122  PLMVAATYGSLDVLRLIL  139



>ref|XP_002298434.1| hypothetical protein POPTR_0001s27370g [Populus trichocarpa]
 gb|ABK93336.1| unknown [Populus trichocarpa]
 gb|EEE83239.1| hypothetical protein POPTR_0001s27370g [Populus trichocarpa]
Length=710

 Score =   123 bits (308),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 60/78 (77%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +3

Query  381  INHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRT  560
            +N L+VETED FSSLLELAANND EG KR+I  D SSI+E G WY RQKGSKQ+VL+ RT
Sbjct  1    MNFLSVETEDAFSSLLELAANNDAEGFKRFIKRDASSINEAGFWYIRQKGSKQIVLDQRT  60

Query  561  PLMVAATYGSIDVLKLIL  614
            PLMVAATYGS+DVLKLIL
Sbjct  61   PLMVAATYGSLDVLKLIL  78



>ref|XP_003540529.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
isoform X1 [Glycine max]
Length=704

 Score =   122 bits (307),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 59/78 (76%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +3

Query  381  INHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRT  560
            +  LTV TED+FSSLLELA+NNDIEG K  +  D SSI+EVG WYGRQ GSKQ VLEHRT
Sbjct  1    MKSLTVNTEDSFSSLLELASNNDIEGFKVLLEKDSSSINEVGLWYGRQNGSKQFVLEHRT  60

Query  561  PLMVAATYGSIDVLKLIL  614
            PLMVAATYGSIDV+K+IL
Sbjct  61   PLMVAATYGSIDVMKIIL  78



>gb|KHN37619.1| Zinc finger CCCH domain-containing protein 30 [Glycine soja]
Length=699

 Score =   122 bits (305),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 57/78 (73%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +3

Query  381  INHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRT  560
            +  LTV TED+FSSLLELA+NNDIEG K  +  D S+I+EVG WYGRQ GSKQ VLEHRT
Sbjct  1    MKSLTVNTEDSFSSLLELASNNDIEGFKVLLEKDSSTINEVGLWYGRQNGSKQFVLEHRT  60

Query  561  PLMVAATYGSIDVLKLIL  614
            PLMVAATYGSIDV+K++L
Sbjct  61   PLMVAATYGSIDVMKMVL  78



>ref|XP_011047401.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Populus euphratica]
 ref|XP_011047402.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Populus euphratica]
 ref|XP_011047403.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Populus euphratica]
Length=705

 Score =   122 bits (305),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 60/78 (77%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +3

Query  381  INHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRT  560
            +N L+VET DTFSSLLELAANND EG KR+I  D SSI+E G WY RQKGSKQ+VL+ RT
Sbjct  1    MNCLSVETADTFSSLLELAANNDAEGFKRFIKRDASSINEAGFWYVRQKGSKQIVLDQRT  60

Query  561  PLMVAATYGSIDVLKLIL  614
            PLMVAATYGS+DVLKLIL
Sbjct  61   PLMVAATYGSLDVLKLIL  78



>ref|XP_008786132.1| PREDICTED: zinc finger CCCH domain-containing protein 24-like 
[Phoenix dactylifera]
 ref|XP_008786133.1| PREDICTED: zinc finger CCCH domain-containing protein 24-like 
[Phoenix dactylifera]
Length=753

 Score =   122 bits (306),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 55/79 (70%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  378  NINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHR  557
            ++ HLT+ET D FSSLLELAANND +G KR +  +PS++DE+G WYGR+KGS +MVLE R
Sbjct  37   DMKHLTIETGDNFSSLLELAANNDADGFKRSVDEEPSAVDEIGLWYGRKKGSNRMVLEPR  96

Query  558  TPLMVAATYGSIDVLKLIL  614
            TPLMVAATYGSI+VL+LIL
Sbjct  97   TPLMVAATYGSIEVLRLIL  115



>ref|XP_007133821.1| hypothetical protein PHAVU_011G211700g [Phaseolus vulgaris]
 gb|ESW05815.1| hypothetical protein PHAVU_011G211700g [Phaseolus vulgaris]
Length=707

 Score =   121 bits (304),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +3

Query  390  LTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLM  569
            LTV TED+FSSLLELA+NNDIE  K  +  DP++I+EVG WYGRQ GSKQ+VLEHRTPLM
Sbjct  4    LTVNTEDSFSSLLELASNNDIEAFKVLLEKDPAAINEVGFWYGRQNGSKQIVLEHRTPLM  63

Query  570  VAATYGSIDVLKLIL  614
            VAATYGS DVLKLIL
Sbjct  64   VAATYGSNDVLKLIL  78



>ref|XP_010057404.1| PREDICTED: zinc finger CCCH domain-containing protein 30 [Eucalyptus 
grandis]
 ref|XP_010057411.1| PREDICTED: zinc finger CCCH domain-containing protein 30 [Eucalyptus 
grandis]
 ref|XP_010057418.1| PREDICTED: zinc finger CCCH domain-containing protein 30 [Eucalyptus 
grandis]
 gb|KCW90220.1| hypothetical protein EUGRSUZ_A02384 [Eucalyptus grandis]
Length=704

 Score =   120 bits (302),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 56/78 (72%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +3

Query  381  INHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRT  560
            ++ LT++TEDTF+SLLELAANND E   R +  DPSSIDE+G WYGRQKGSKQMV   RT
Sbjct  1    MSQLTIQTEDTFASLLELAANNDTESFGRCVERDPSSIDEIGYWYGRQKGSKQMVNMQRT  60

Query  561  PLMVAATYGSIDVLKLIL  614
            PLMVAATYGS+DV++LIL
Sbjct  61   PLMVAATYGSVDVMRLIL  78



>ref|XP_011078886.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Sesamum indicum]
Length=705

 Score =   120 bits (301),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 54/80 (68%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  375  MNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEH  554
            MN+N   VE  D F+SLLELAANND+EG ++++  +P S+D +G WYGRQKGS QMVL+H
Sbjct  1    MNVNLSNVENRDAFASLLELAANNDLEGFQKYVDREPLSVDVIGLWYGRQKGSNQMVLQH  60

Query  555  RTPLMVAATYGSIDVLKLIL  614
            RTPLMVAATYGSIDVLK I+
Sbjct  61   RTPLMVAATYGSIDVLKHII  80



>ref|XP_008443126.1| PREDICTED: zinc finger CCCH domain-containing protein 30 [Cucumis 
melo]
Length=701

 Score =   120 bits (301),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 58/78 (74%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +3

Query  381  INHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRT  560
            +N+LTVETED FSSLLELAAN+DI+  KR I  DPS IDE+G WYGR +GSKQM  E RT
Sbjct  1    MNNLTVETEDVFSSLLELAANDDIDAFKRSIERDPSGIDEIGLWYGRLRGSKQMTNEQRT  60

Query  561  PLMVAATYGSIDVLKLIL  614
            PLMVAATYGS +VLKLIL
Sbjct  61   PLMVAATYGSTEVLKLIL  78



>ref|XP_004136593.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Cucumis sativus]
 ref|XP_004165487.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
isoform 1 [Cucumis sativus]
 ref|XP_004165488.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
isoform 2 [Cucumis sativus]
 gb|KGN59348.1| hypothetical protein Csa_3G812200 [Cucumis sativus]
Length=701

 Score =   120 bits (300),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 58/78 (74%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +3

Query  381  INHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRT  560
            +N+LTVETED FSSLLELAAN+DI+  KR I  DPS IDE+G WYGR +GSKQM  E RT
Sbjct  1    MNNLTVETEDVFSSLLELAANDDIDAFKRSIERDPSGIDEIGLWYGRLRGSKQMTNEQRT  60

Query  561  PLMVAATYGSIDVLKLIL  614
            PLMVAATYGS +VLKLIL
Sbjct  61   PLMVAATYGSTEVLKLIL  78



>emb|CDY22543.1| BnaC03g23530D [Brassica napus]
Length=567

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 66/79 (84%), Gaps = 1/79 (1%)
 Frame = +3

Query  381  INHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQ-MVLEHR  557
            +NHL VETEDTFSSLLELAANND+EGV+  I  DPS +DE G WYGRQKGSK  MV + R
Sbjct  2    MNHLRVETEDTFSSLLELAANNDVEGVRLSIDRDPSCVDEPGLWYGRQKGSKSVMVNDLR  61

Query  558  TPLMVAATYGSIDVLKLIL  614
            TPLMVAATYGS+DV+K IL
Sbjct  62   TPLMVAATYGSVDVIKAIL  80



>ref|XP_004229627.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Solanum lycopersicum]
Length=724

 Score =   119 bits (299),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 59/89 (66%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +3

Query  348  TVDNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQK  527
            +V +S +++  I  LTVETED+FSSLLELAANND+EG KR +  D S+IDEVG W  R+K
Sbjct  11   SVTDSTSSMKGITKLTVETEDSFSSLLELAANNDLEGFKRSVELDASAIDEVGLWLVRKK  70

Query  528  GSKQMVLEHRTPLMVAATYGSIDVLKLIL  614
            G+KQ+V E RTPLMVAATYGS+DVLKLI+
Sbjct  71   GAKQIVNEERTPLMVAATYGSLDVLKLII  99



>ref|XP_007052531.1| CCCH-type zinc finger protein with ARM repeat domain isoform 
1 [Theobroma cacao]
 ref|XP_007052532.1| CCCH-type zinc finger protein with ARM repeat domain isoform 
1 [Theobroma cacao]
 ref|XP_007052533.1| CCCH-type zinc finger protein with ARM repeat domain isoform 
1 [Theobroma cacao]
 gb|EOX96688.1| CCCH-type zinc finger protein with ARM repeat domain isoform 
1 [Theobroma cacao]
 gb|EOX96689.1| CCCH-type zinc finger protein with ARM repeat domain isoform 
1 [Theobroma cacao]
 gb|EOX96690.1| CCCH-type zinc finger protein with ARM repeat domain isoform 
1 [Theobroma cacao]
Length=734

 Score =   119 bits (298),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 55/79 (70%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +3

Query  378  NINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHR  557
            +++HLTV+TED+FSSLLELA+NND+EG+K+ I  D SSIDEVG WY R+K S Q+V +HR
Sbjct  26   DMDHLTVKTEDSFSSLLELASNNDVEGIKQSIVQDASSIDEVGLWYSREKSSNQIVAKHR  85

Query  558  TPLMVAATYGSIDVLKLIL  614
            TPLMVAATYGS+D +KLIL
Sbjct  86   TPLMVAATYGSVDAVKLIL  104



>ref|XP_009133516.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Brassica rapa]
 ref|XP_009133517.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Brassica rapa]
 ref|XP_009133518.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Brassica rapa]
 ref|XP_009133520.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Brassica rapa]
Length=586

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 66/79 (84%), Gaps = 1/79 (1%)
 Frame = +3

Query  381  INHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQ-MVLEHR  557
            +NHL VETEDTFSSLLELAANND+EGV+  I  DPS +DE G WYGRQKGSK  MV + R
Sbjct  2    MNHLRVETEDTFSSLLELAANNDVEGVRLSIDRDPSCVDEPGLWYGRQKGSKSIMVNDLR  61

Query  558  TPLMVAATYGSIDVLKLIL  614
            TPLMVAATYGS+DV+K IL
Sbjct  62   TPLMVAATYGSLDVIKAIL  80



>ref|XP_009799603.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Nicotiana sylvestris]
Length=727

 Score =   119 bits (297),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 58/89 (65%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +3

Query  348  TVDNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQK  527
            ++ +S +++  I  LTVETED+FSSLLELAANND+EG KR +  D S+IDEVG W  R+K
Sbjct  17   SITDSKSSMKGIAKLTVETEDSFSSLLELAANNDLEGFKRSVERDASAIDEVGLWLVRKK  76

Query  528  GSKQMVLEHRTPLMVAATYGSIDVLKLIL  614
            G+KQ+V E RTPLMVAATYGS+DVLKLI+
Sbjct  77   GAKQIVNEERTPLMVAATYGSLDVLKLII  105



>gb|KJB22263.1| hypothetical protein B456_004G037500 [Gossypium raimondii]
Length=710

 Score =   119 bits (297),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 55/79 (70%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +3

Query  378  NINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHR  557
            ++NHL V+TED+FSSL ELA+NND+EG+K+ I  D SSIDEVG WY R+KGS ++V +HR
Sbjct  12   DMNHLNVKTEDSFSSLHELASNNDVEGIKQSIEKDVSSIDEVGLWYCREKGSNRIVAKHR  71

Query  558  TPLMVAATYGSIDVLKLIL  614
            TPLMVAATYGS+DV+KLIL
Sbjct  72   TPLMVAATYGSVDVVKLIL  90



>ref|XP_008778227.1| PREDICTED: zinc finger CCCH domain-containing protein 24-like 
[Phoenix dactylifera]
Length=749

 Score =   119 bits (297),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 53/80 (66%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  375  MNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEH  554
            +++NHLT+ET+D FSSLLEL A+ND +G++R +   PS++DE+G WYGR+KGS +MVLE 
Sbjct  33   VDMNHLTLETDDNFSSLLELVADNDADGLRRAVDEYPSAVDEIGLWYGRKKGSNRMVLEP  92

Query  555  RTPLMVAATYGSIDVLKLIL  614
            RTPLMVAATYGSI+VL+LIL
Sbjct  93   RTPLMVAATYGSIEVLQLIL  112



>emb|CDY35396.1| BnaA03g19640D [Brassica napus]
Length=564

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 66/79 (84%), Gaps = 1/79 (1%)
 Frame = +3

Query  381  INHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQ-MVLEHR  557
            +NHL VETEDTFSSLLELAANND+EGV+  I  DPS +DE G WYGRQKGSK  MV + R
Sbjct  2    MNHLRVETEDTFSSLLELAANNDVEGVRLSIERDPSCVDEPGLWYGRQKGSKSIMVNDLR  61

Query  558  TPLMVAATYGSIDVLKLIL  614
            TPLMVAATYGS+DV+K IL
Sbjct  62   TPLMVAATYGSLDVIKAIL  80



>ref|XP_011075220.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Sesamum indicum]
Length=664

 Score =   118 bits (296),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 53/80 (66%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  375  MNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEH  554
            MN++ L VETED F  LLE AANND+EG K+++  +PSS+DEVG WYGRQKGS +M+++ 
Sbjct  1    MNVSLLNVETEDAFWGLLEFAANNDLEGFKKYVDHEPSSVDEVGLWYGRQKGSNKMIVQQ  60

Query  555  RTPLMVAATYGSIDVLKLIL  614
             TPLMVAATYGS DVLKLI+
Sbjct  61   MTPLMVAATYGSTDVLKLIV  80



>ref|XP_006345451.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006345452.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
isoform X2 [Solanum tuberosum]
Length=730

 Score =   118 bits (296),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 58/89 (65%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +3

Query  348  TVDNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQK  527
            +V +S +++  I  LTVETED+FSSLLELAANND++G KR +  D S+IDEVG W  R+K
Sbjct  11   SVTDSTSSMKGITKLTVETEDSFSSLLELAANNDLDGFKRSVELDASAIDEVGLWLVRKK  70

Query  528  GSKQMVLEHRTPLMVAATYGSIDVLKLIL  614
            G+KQ+V E RTPLMVAATYGS+DVLKLI+
Sbjct  71   GAKQIVNEERTPLMVAATYGSLDVLKLII  99



>gb|KHN07386.1| Zinc finger CCCH domain-containing protein 30, partial [Glycine 
soja]
Length=683

 Score =   116 bits (291),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 58/79 (73%), Positives = 66/79 (84%), Gaps = 1/79 (1%)
 Frame = +3

Query  381  INHLTVETED-TFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHR  557
            +NHL+++TED + SSLLELAANND+ G KR I  DPSSIDEVG WY R K SK+MV E R
Sbjct  4    MNHLSLDTEDYSLSSLLELAANNDVSGFKRLIECDPSSIDEVGLWYIRHKESKKMVNEQR  63

Query  558  TPLMVAATYGSIDVLKLIL  614
            TPLMVAATYGSIDV+KLIL
Sbjct  64   TPLMVAATYGSIDVMKLIL  82



>ref|XP_003521185.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
isoform X1 [Glycine max]
 ref|XP_006576830.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
isoform X2 [Glycine max]
 ref|XP_006576831.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
isoform X3 [Glycine max]
 ref|XP_006576832.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
isoform X4 [Glycine max]
 ref|XP_006576833.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
isoform X5 [Glycine max]
Length=680

 Score =   116 bits (291),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 58/79 (73%), Positives = 66/79 (84%), Gaps = 1/79 (1%)
 Frame = +3

Query  381  INHLTVETED-TFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHR  557
            +NHL+++TED + SSLLELAANND+ G KR I  DPSSIDEVG WY R K SK+MV E R
Sbjct  1    MNHLSLDTEDYSLSSLLELAANNDVSGFKRLIECDPSSIDEVGLWYIRHKESKKMVNEQR  60

Query  558  TPLMVAATYGSIDVLKLIL  614
            TPLMVAATYGSIDV+KLIL
Sbjct  61   TPLMVAATYGSIDVMKLIL  79



>ref|XP_009396384.1| PREDICTED: zinc finger CCCH domain-containing protein 24-like 
[Musa acuminata subsp. malaccensis]
Length=778

 Score =   116 bits (290),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 1/81 (1%)
 Frame = +3

Query  372  IMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLE  551
            ++ +NHLTVE  D+ SSLLELAANND E   R +  DP ++D+VG WYGR+KGS +MVLE
Sbjct  59   VLGMNHLTVEIADS-SSLLELAANNDAEAFGRSLDRDPLAVDDVGLWYGRRKGSNRMVLE  117

Query  552  HRTPLMVAATYGSIDVLKLIL  614
            HRTPLMVAATYGS+DVLK IL
Sbjct  118  HRTPLMVAATYGSLDVLKFIL  138



>ref|XP_009395592.1| PREDICTED: zinc finger CCCH domain-containing protein 24-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009395593.1| PREDICTED: zinc finger CCCH domain-containing protein 24-like 
[Musa acuminata subsp. malaccensis]
Length=743

 Score =   115 bits (289),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 53/80 (66%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  375  MNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEH  554
            + +NHLTVET+D  SSLLELAAN+D++  ++ +  DPS+I+E G WY R+KGS QMVLEH
Sbjct  33   LGMNHLTVETDDFSSSLLELAANDDVDAFRQSLDRDPSAINEAGLWYSRRKGSNQMVLEH  92

Query  555  RTPLMVAATYGSIDVLKLIL  614
            RTPLMVAATYGS+ VLKLI+
Sbjct  93   RTPLMVAATYGSLSVLKLIV  112



>ref|XP_004510954.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Cicer arietinum]
Length=689

 Score =   115 bits (288),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 56/76 (74%), Positives = 65/76 (86%), Gaps = 1/76 (1%)
 Frame = +3

Query  390  LTVETEDTFSSLLELAANNDIEGVKRWIGSD-PSSIDEVGQWYGRQKGSKQMVLEHRTPL  566
            LT++TED+FSSLLE A+NNDIEG K  +  +  SSI+E G WYGRQ GSKQ+VLEHRTPL
Sbjct  4    LTIDTEDSFSSLLEFASNNDIEGFKLLLDKEGASSINEAGIWYGRQNGSKQIVLEHRTPL  63

Query  567  MVAATYGSIDVLKLIL  614
            MVAATYGSIDV+KLIL
Sbjct  64   MVAATYGSIDVMKLIL  79



>ref|XP_009599703.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Nicotiana tomentosiformis]
Length=726

 Score =   115 bits (287),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 56/89 (63%), Positives = 71/89 (80%), Gaps = 0/89 (0%)
 Frame = +3

Query  348  TVDNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQK  527
            ++ +S +++  I  LTVETED+FSSLLELAANND+EG KR +    S+IDE G W  R+K
Sbjct  17   SITDSKSSMKGITKLTVETEDSFSSLLELAANNDLEGFKRSVERGASAIDEAGLWLVRKK  76

Query  528  GSKQMVLEHRTPLMVAATYGSIDVLKLIL  614
            G+KQ+V E RTPLMVAATYGS+DVLKLI+
Sbjct  77   GAKQIVNEERTPLMVAATYGSLDVLKLII  105



>gb|EPS64556.1| hypothetical protein M569_10225 [Genlisea aurea]
Length=608

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +3

Query  402  TEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAAT  581
            +ED F SLLELAANN++EG K+ +  DPSS+ EVG WYGRQKGS QMVL+H TPLMVAAT
Sbjct  5    SEDAFGSLLELAANNNLEGFKKCVECDPSSVGEVGLWYGRQKGSNQMVLQHMTPLMVAAT  64

Query  582  YGSIDVLKLIL  614
            YGS DVLK IL
Sbjct  65   YGSTDVLKFIL  75



>gb|AES69409.2| ARM repeat CCCH-type zinc finger protein [Medicago truncatula]
Length=731

 Score =   114 bits (285),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 55/82 (67%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +3

Query  369  TIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVL  548
            T+ ++ +LTV T+D+FSSLLE A+NND E  K  + SD S I+EVG WY RQKGS Q+VL
Sbjct  27   TVEDMKNLTVRTDDSFSSLLEHASNNDFEDFKVALDSDASLINEVGFWYVRQKGSNQIVL  86

Query  549  EHRTPLMVAATYGSIDVLKLIL  614
            EHRTPLMVAA+YGSID+LKLIL
Sbjct  87   EHRTPLMVAASYGSIDILKLIL  108



>ref|XP_003599158.1| Zinc finger CCCH domain-containing protein [Medicago truncatula]
Length=773

 Score =   114 bits (285),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 55/82 (67%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +3

Query  369  TIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVL  548
            T+ ++ +LTV T+D+FSSLLE A+NND E  K  + SD S I+EVG WY RQKGS Q+VL
Sbjct  69   TVEDMKNLTVRTDDSFSSLLEHASNNDFEDFKVALDSDASLINEVGFWYVRQKGSNQIVL  128

Query  549  EHRTPLMVAATYGSIDVLKLIL  614
            EHRTPLMVAA+YGSID+LKLIL
Sbjct  129  EHRTPLMVAASYGSIDILKLIL  150



>ref|XP_004499884.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Cicer arietinum]
Length=726

 Score =   112 bits (280),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 54/81 (67%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +3

Query  372  IMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLE  551
            + ++ +LTV T+D+FSSLLELA+NND E  K  + S  S I+EVG WY RQ GSKQ+VLE
Sbjct  28   VKDMKNLTVHTDDSFSSLLELASNNDFEEFKVALDSSASLINEVGFWYVRQNGSKQIVLE  87

Query  552  HRTPLMVAATYGSIDVLKLIL  614
            HRTPLMVAA+YGSID+LKLIL
Sbjct  88   HRTPLMVAASYGSIDILKLIL  108



>ref|XP_011087691.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Sesamum indicum]
Length=732

 Score =   112 bits (280),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 55/87 (63%), Positives = 67/87 (77%), Gaps = 0/87 (0%)
 Frame = +3

Query  354  DNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGS  533
            D     + ++N+L+VETED+FSSLLE AANNDIE  KR I  D S++DE G WY R+KG 
Sbjct  20   DKKTNNMKDLNNLSVETEDSFSSLLEYAANNDIEAFKRSIELDLSAVDEAGLWYVRKKGL  79

Query  534  KQMVLEHRTPLMVAATYGSIDVLKLIL  614
            KQ+  E RTPLM+AATYGSIDVLKLI+
Sbjct  80   KQITQEERTPLMLAATYGSIDVLKLIV  106



>gb|KGN58590.1| hypothetical protein Csa_3G696850 [Cucumis sativus]
Length=593

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +3

Query  378  NINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHR  557
            ++NHLTV+ ED+F SLLEL ++ND EG KR + SD  S+++ G WY RQKGSKQ+V EHR
Sbjct  23   DMNHLTVDCEDSFYSLLELVSDNDAEGFKRLMQSDLFSLNKSGLWYVRQKGSKQVVNEHR  82

Query  558  TPLMVAATYGSIDVLKLIL  614
            TPLMVAATYG +DVLKLIL
Sbjct  83   TPLMVAATYGCVDVLKLIL  101



>emb|CDP07776.1| unnamed protein product [Coffea canephora]
Length=705

 Score =   111 bits (278),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 52/78 (67%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +3

Query  381  INHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRT  560
            +N L+V TED FSSLLELAA+ND++G K+ +  DPS+IDEVG W  R+KG+KQ+V E RT
Sbjct  1    MNKLSVVTEDCFSSLLELAADNDVDGFKQMVERDPSAIDEVGLWLVRKKGTKQIVREERT  60

Query  561  PLMVAATYGSIDVLKLIL  614
            PLMVAA YGS+DVLKLI+
Sbjct  61   PLMVAAAYGSVDVLKLIV  78



>ref|XP_010695261.1| PREDICTED: zinc finger CCCH domain-containing protein 24-like 
[Beta vulgaris subsp. vulgaris]
Length=715

 Score =   111 bits (278),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 52/77 (68%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +3

Query  384  NHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTP  563
            NH  VE+E+ F +LLELA+N+D+EG K+ +  D S I  VG WYGRQKGS+QMVLEHRTP
Sbjct  5    NHTAVESENCFFNLLELASNDDVEGFKKILEHDASKICAVGLWYGRQKGSRQMVLEHRTP  64

Query  564  LMVAATYGSIDVLKLIL  614
            LMVAATYGS+ VL+LIL
Sbjct  65   LMVAATYGSLGVLQLIL  81



>ref|XP_011468826.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Fragaria vesca subsp. vesca]
Length=697

 Score =   110 bits (276),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 50/78 (64%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +3

Query  381  INHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRT  560
            +NHLTV TED+FS  LE A++ND++G K+ I  D SSI+++G WY RQKGSK +V E RT
Sbjct  1    MNHLTVATEDSFSRALEFASDNDVQGFKQLIDHDTSSINQIGLWYSRQKGSKHIVSEQRT  60

Query  561  PLMVAATYGSIDVLKLIL  614
            PLMVAATYGS+DV+KLI+
Sbjct  61   PLMVAATYGSVDVVKLIV  78



>ref|XP_004149598.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Cucumis sativus]
Length=724

 Score =   110 bits (276),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 53/79 (67%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +3

Query  378  NINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHR  557
            ++NHLTV+ ED+F SLLEL ++ND EG KR + SD  S+++ G WY RQKGSKQ+V EHR
Sbjct  23   DMNHLTVDCEDSFYSLLELVSDNDAEGFKRLMQSDLFSLNKSGLWYVRQKGSKQVVNEHR  82

Query  558  TPLMVAATYGSIDVLKLIL  614
            TPLMVAATYG +DVLKLIL
Sbjct  83   TPLMVAATYGCVDVLKLIL  101



>ref|XP_004172112.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Cucumis sativus]
Length=724

 Score =   110 bits (276),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 53/79 (67%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +3

Query  378  NINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHR  557
            ++NHLTV+ ED+F SLLEL ++ND EG KR + SD  S+++ G WY RQKGSKQ+V EHR
Sbjct  23   DMNHLTVDCEDSFYSLLELVSDNDAEGFKRLMQSDLFSLNKSGLWYVRQKGSKQVVNEHR  82

Query  558  TPLMVAATYGSIDVLKLIL  614
            TPLMVAATYG +DVLKLIL
Sbjct  83   TPLMVAATYGCVDVLKLIL  101



>ref|XP_009394397.1| PREDICTED: zinc finger CCCH domain-containing protein 24-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=739

 Score =   110 bits (274),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 58/86 (67%), Positives = 71/86 (83%), Gaps = 4/86 (5%)
 Frame = +3

Query  360  SLATIMNINHLTVETEDTFS-SLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSK  536
            SLA  M+   LTVE  D+FS SLLELAANND++ ++ ++  DPS++DEVG WYGR+KGS 
Sbjct  30   SLAAGMS--RLTVEI-DSFSLSLLELAANNDVDALRLFLDRDPSAVDEVGLWYGRRKGSN  86

Query  537  QMVLEHRTPLMVAATYGSIDVLKLIL  614
            +MVLE RTPLMVAATYGS+DVLKLIL
Sbjct  87   RMVLEQRTPLMVAATYGSLDVLKLIL  112



>ref|XP_009394396.1| PREDICTED: zinc finger CCCH domain-containing protein 24-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=779

 Score =   110 bits (274),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 58/86 (67%), Positives = 71/86 (83%), Gaps = 4/86 (5%)
 Frame = +3

Query  360  SLATIMNINHLTVETEDTFS-SLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSK  536
            SLA  M+   LTVE  D+FS SLLELAANND++ ++ ++  DPS++DEVG WYGR+KGS 
Sbjct  70   SLAAGMS--RLTVEI-DSFSLSLLELAANNDVDALRLFLDRDPSAVDEVGLWYGRRKGSN  126

Query  537  QMVLEHRTPLMVAATYGSIDVLKLIL  614
            +MVLE RTPLMVAATYGS+DVLKLIL
Sbjct  127  RMVLEQRTPLMVAATYGSLDVLKLIL  152



>ref|XP_009414744.1| PREDICTED: zinc finger CCCH domain-containing protein 24-like 
[Musa acuminata subsp. malaccensis]
Length=721

 Score =   109 bits (272),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 48/70 (69%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +3

Query  381  INHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRT  560
            +NHL VET+D+ SSLLELAANND+   +R +  DPS++DEVG WYGR+KGS +M+L+HRT
Sbjct  37   MNHLVVETDDSSSSLLELAANNDVGAFRRSLDRDPSAVDEVGLWYGREKGSNRMLLQHRT  96

Query  561  PLMVAATYGS  590
            PLMVAATYGS
Sbjct  97   PLMVAATYGS  106



>gb|EYU29028.1| hypothetical protein MIMGU_mgv1a002533mg [Erythranthe guttata]
Length=662

 Score =   108 bits (271),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 51/78 (65%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +3

Query  381  INHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRT  560
            +N L+VET D+FSSLLE AANND+E  +R I  D S +DE G WY R+KGSKQ++ E RT
Sbjct  4    MNGLSVETVDSFSSLLEFAANNDVEAFRRSIELDLSGVDEAGPWYVRKKGSKQIIQEERT  63

Query  561  PLMVAATYGSIDVLKLIL  614
            PLMVAA YGS+DVLKLI+
Sbjct  64   PLMVAAMYGSVDVLKLIV  81



>gb|EYU27048.1| hypothetical protein MIMGU_mgv1a002486mg [Erythranthe guttata]
Length=668

 Score =   107 bits (268),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 49/86 (57%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +3

Query  357  NSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSK  536
            NS ++  ++N L V+T+D+FS+LLE AANND+E  KR+I  D S++DE G WY R++ SK
Sbjct  9    NSESSTKDMNKLHVDTDDSFSNLLEFAANNDVESFKRFIELDLSAVDEAGLWYVRKRDSK  68

Query  537  QMVLEHRTPLMVAATYGSIDVLKLIL  614
            Q+  E RTPLM+AATYGS+D+LKLI+
Sbjct  69   QITHEERTPLMIAATYGSVDILKLIV  94



>ref|XP_011093548.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Sesamum indicum]
 ref|XP_011093549.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Sesamum indicum]
Length=710

 Score =   106 bits (264),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 51/78 (65%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +3

Query  381  INHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRT  560
            ++ L+VETED+FSSLLE AANNDIE  +R I  D S +DE G WY R+ GSKQ+  + RT
Sbjct  4    MSKLSVETEDSFSSLLEFAANNDIEAFRRSIELDLSGVDEAGLWYVRKIGSKQITQDERT  63

Query  561  PLMVAATYGSIDVLKLIL  614
            PLMVAATYGS+DVLKLI+
Sbjct  64   PLMVAATYGSVDVLKLIV  81



>emb|CBI16373.3| unnamed protein product [Vitis vinifera]
Length=548

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +3

Query  357  NSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSK  536
            N+    MN     VE+E++FSSLLE AANND+EG ++ I  + S+ID+VG WY  +K SK
Sbjct  22   NTSTKDMNKPTGEVESENSFSSLLEFAANNDVEGFQKSIALNGSAIDKVGLWYVHRKVSK  81

Query  537  QMVLEHRTPLMVAATYGSIDVLKLIL  614
            QMVLEHRTPLMVAA YGS+D++KLIL
Sbjct  82   QMVLEHRTPLMVAAMYGSVDIVKLIL  107



>gb|KHN39938.1| Zinc finger CCCH domain-containing protein 30 [Glycine soja]
Length=722

 Score =   105 bits (263),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 54/79 (68%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = +3

Query  378  NINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHR  557
            ++N LTV   D+FS LLELA+NND E  K  +  D S I EVG WY RQ GSKQ+VLEHR
Sbjct  27   DMNKLTVHAADSFSCLLELASNNDFEDFKLALVRDVSLISEVGLWYVRQIGSKQIVLEHR  86

Query  558  TPLMVAATYGSIDVLKLIL  614
            TPLMVAA YGSIDVLKLIL
Sbjct  87   TPLMVAAMYGSIDVLKLIL  105



>ref|XP_006598269.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Glycine max]
Length=722

 Score =   105 bits (263),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 54/79 (68%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = +3

Query  378  NINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHR  557
            ++N LTV   D+FS LLELA+NND E  K  +  D S I EVG WY RQ GSKQ+VLEHR
Sbjct  27   DMNKLTVHAADSFSCLLELASNNDFEDFKLALVRDVSLISEVGLWYVRQIGSKQIVLEHR  86

Query  558  TPLMVAATYGSIDVLKLIL  614
            TPLMVAA YGSIDVLKLIL
Sbjct  87   TPLMVAAMYGSIDVLKLIL  105



>ref|XP_009411280.1| PREDICTED: zinc finger CCCH domain-containing protein 24-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009411281.1| PREDICTED: zinc finger CCCH domain-containing protein 24-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009411282.1| PREDICTED: zinc finger CCCH domain-containing protein 24-like 
[Musa acuminata subsp. malaccensis]
Length=744

 Score =   105 bits (263),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 51/78 (65%), Positives = 67/78 (86%), Gaps = 1/78 (1%)
 Frame = +3

Query  381  INHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRT  560
            +N LTV+ +++ SSLLELAAN+D++ +K  +  DPS+I+EVG WYGR+KG  +MVLEHRT
Sbjct  35   MNVLTVDIDNS-SSLLELAANDDVDALKVALDRDPSAIEEVGLWYGRRKGFSRMVLEHRT  93

Query  561  PLMVAATYGSIDVLKLIL  614
            PLMVAATYGS+DVLKLI+
Sbjct  94   PLMVAATYGSLDVLKLIV  111



>ref|XP_009386116.1| PREDICTED: zinc finger CCCH domain-containing protein 24-like 
[Musa acuminata subsp. malaccensis]
Length=711

 Score =   105 bits (262),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/68 (68%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +3

Query  381  INHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRT  560
            +NHL VE +D+FS+LLELAANND++  +R +  DPS+IDE G WYGR+KGS +MVLE RT
Sbjct  1    MNHLAVEPDDSFSNLLELAANNDVDAFRRSLDRDPSAIDEFGLWYGREKGSNRMVLERRT  60

Query  561  PLMVAATY  584
            PLMVAATY
Sbjct  61   PLMVAATY  68



>ref|XP_006587172.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
isoform X2 [Glycine max]
 gb|KHM98951.1| Zinc finger CCCH domain-containing protein 30 [Glycine soja]
Length=728

 Score =   104 bits (260),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 52/79 (66%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +3

Query  378  NINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHR  557
            ++ +LTV TED+FS LLELA+NND E +K  +  D S I+EVG WY RQ GSKQ+VL+ R
Sbjct  27   DMKNLTVHTEDSFSCLLELASNNDFEDLKLALDRDASLINEVGLWYVRQIGSKQIVLQPR  86

Query  558  TPLMVAATYGSIDVLKLIL  614
            TPLMVAA YGSIDVLKL+L
Sbjct  87   TPLMVAAMYGSIDVLKLLL  105



>ref|XP_003632114.1| PREDICTED: zinc finger CCCH domain-containing protein 30 [Vitis 
vinifera]
 ref|XP_010651227.1| PREDICTED: zinc finger CCCH domain-containing protein 30 [Vitis 
vinifera]
Length=725

 Score =   104 bits (260),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 52/86 (60%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +3

Query  357  NSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSK  536
            N+    MN     VE+E++FSSLLE AANND+EG ++ I  + S+ID+VG WY  +K SK
Sbjct  22   NTSTKDMNKPTGEVESENSFSSLLEFAANNDVEGFQKSIALNGSAIDKVGLWYVHRKVSK  81

Query  537  QMVLEHRTPLMVAATYGSIDVLKLIL  614
            QMVLEHRTPLMVAA YGS+D++KLIL
Sbjct  82   QMVLEHRTPLMVAAMYGSVDIVKLIL  107



>ref|XP_009407642.1| PREDICTED: zinc finger CCCH domain-containing protein 24-like 
[Musa acuminata subsp. malaccensis]
Length=720

 Score =   104 bits (260),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 49/71 (69%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +3

Query  402  TEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAAT  581
            T+D+FSSLLELAANND  G +R +  DPS++DEV  WYGR+KGS +MVLE  TPLMVAAT
Sbjct  28   TDDSFSSLLELAANNDAGGFRRSLDRDPSAVDEVCLWYGREKGSNRMVLERHTPLMVAAT  87

Query  582  YGSIDVLKLIL  614
            YGS+DVL L+L
Sbjct  88   YGSLDVLGLLL  98



>emb|CAN74402.1| hypothetical protein VITISV_043632 [Vitis vinifera]
Length=718

 Score =   104 bits (259),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 52/86 (60%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +3

Query  357  NSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSK  536
            N+    MN     VE+E++FSSLLE AANND+EG ++ I  + S+ID+VG WY  +K SK
Sbjct  15   NTSTKDMNKPTGEVESENSFSSLLEFAANNDVEGFQKSIALNGSAIDKVGLWYVHRKVSK  74

Query  537  QMVLEHRTPLMVAATYGSIDVLKLIL  614
            QMVLEHRTPLMVAA YGS+D++KLIL
Sbjct  75   QMVLEHRTPLMVAAMYGSVDIVKLIL  100



>ref|XP_008363574.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein 56-like [Malus domestica]
Length=682

 Score =   104 bits (259),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 48/74 (65%), Positives = 63/74 (85%), Gaps = 1/74 (1%)
 Frame = +3

Query  393  TVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMV  572
            TVE E +FSSLLELAA+ND++G K+ I SDP+ ++E+G WYGR   S++MVLE+RTPLMV
Sbjct  32   TVEAEHSFSSLLELAADNDVKGFKQSI-SDPAVVNEIGLWYGRHSASRRMVLEYRTPLMV  90

Query  573  AATYGSIDVLKLIL  614
            A+ YGS+DV+KLIL
Sbjct  91   ASKYGSVDVVKLIL  104



>ref|XP_003533897.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
isoform X1 [Glycine max]
Length=701

 Score =   104 bits (259),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 52/78 (67%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +3

Query  381  INHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRT  560
            + +LTV TED+FS LLELA+NND E +K  +  D S I+EVG WY RQ GSKQ+VL+ RT
Sbjct  1    MKNLTVHTEDSFSCLLELASNNDFEDLKLALDRDASLINEVGLWYVRQIGSKQIVLQPRT  60

Query  561  PLMVAATYGSIDVLKLIL  614
            PLMVAA YGSIDVLKL+L
Sbjct  61   PLMVAAMYGSIDVLKLLL  78



>ref|XP_010088235.1| Zinc finger CCCH domain-containing protein 30 [Morus notabilis]
 gb|EXB32787.1| Zinc finger CCCH domain-containing protein 30 [Morus notabilis]
Length=755

 Score =   104 bits (259),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 49/74 (66%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = +3

Query  393  TVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMV  572
            T++ +++FSSLLELA+NND+EG KR I  D SSI+E+  WY R KG+K +V E+RTPLMV
Sbjct  30   TLKADESFSSLLELASNNDVEGFKRSIDRDASSINEIALWYTRGKGAKHIVREYRTPLMV  89

Query  573  AATYGSIDVLKLIL  614
            AATYGS+DVLKLIL
Sbjct  90   AATYGSVDVLKLIL  103



>ref|XP_008461797.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Cucumis melo]
 ref|XP_008461798.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Cucumis melo]
 ref|XP_008461799.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
[Cucumis melo]
Length=725

 Score =   103 bits (258),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 51/79 (65%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +3

Query  378  NINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHR  557
            ++N LTV+ ED+F SLLEL ++ND EG K  + SD  S+++ G WY RQKGSKQ+V EHR
Sbjct  24   DMNLLTVDCEDSFYSLLELVSDNDAEGFKSLMESDLFSLNKSGLWYVRQKGSKQVVHEHR  83

Query  558  TPLMVAATYGSIDVLKLIL  614
            TPLMVAATYG +DVLKLIL
Sbjct  84   TPLMVAATYGCVDVLKLIL  102



>ref|XP_008355305.1| PREDICTED: zinc finger CCCH domain-containing protein 56-like 
[Malus domestica]
Length=686

 Score =   102 bits (255),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 62/73 (85%), Gaps = 1/73 (1%)
 Frame = +3

Query  396  VETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVA  575
            VE E +FSSLLELAA+ND++G K+ I SDP+ ++E+G WYGR   S++MVLE+RTPLMVA
Sbjct  37   VEAEHSFSSLLELAADNDVKGFKQSI-SDPAVVNEIGLWYGRHSASRRMVLEYRTPLMVA  95

Query  576  ATYGSIDVLKLIL  614
            + YGS+DV+KLIL
Sbjct  96   SKYGSVDVVKLIL  108



>ref|XP_008227307.1| PREDICTED: zinc finger CCCH domain-containing protein 56-like 
[Prunus mume]
Length=702

 Score =   102 bits (254),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 62/73 (85%), Gaps = 1/73 (1%)
 Frame = +3

Query  396  VETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVA  575
            +ETE +F SLLELAA+ND+EG K+ I S+ S ++E+G WYGR + S++MVLEHRTPLMVA
Sbjct  35   LETEHSFCSLLELAADNDVEGFKQSI-SEASIVNEIGLWYGRDRASRRMVLEHRTPLMVA  93

Query  576  ATYGSIDVLKLIL  614
            + YGS+DV+KLIL
Sbjct  94   SKYGSVDVVKLIL  106



>ref|XP_006838347.1| hypothetical protein AMTR_s00103p00162010 [Amborella trichopoda]
 gb|ERN00916.1| hypothetical protein AMTR_s00103p00162010 [Amborella trichopoda]
Length=725

 Score =   101 bits (251),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 48/74 (65%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +3

Query  393  TVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMV  572
            ++  ED+FS LLELAANNDIEG K+ + +DP+ ID VG WY RQ GS QMVLE RTPLMV
Sbjct  31   SLTEEDSFSPLLELAANNDIEGFKKAMQNDPTLIDGVGVWYCRQNGSNQMVLEQRTPLMV  90

Query  573  AATYGSIDVLKLIL  614
            A+ YGS++VL  IL
Sbjct  91   ASMYGSLEVLAHIL  104



>ref|XP_009343733.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein 56-like [Pyrus x bretschneideri]
Length=505

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 65/84 (77%), Gaps = 5/84 (6%)
 Frame = +3

Query  363  LATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQM  542
            +AT + I    VE E +FSSLLELAA+ND+EG K+ I SD   ++E+G WYGR   S++M
Sbjct  1    MATPLKI----VEAEHSFSSLLELAADNDVEGFKQSI-SDLVVVNEIGLWYGRHSASRRM  55

Query  543  VLEHRTPLMVAATYGSIDVLKLIL  614
            VLE+RTPLMVA+ YGS+DV+KLIL
Sbjct  56   VLEYRTPLMVASKYGSVDVVKLIL  79



>ref|XP_006604367.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
isoform X1 [Glycine max]
 ref|XP_006604368.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like 
isoform X2 [Glycine max]
 gb|KHN26333.1| Zinc finger CCCH domain-containing protein 30 [Glycine soja]
Length=667

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 53/79 (67%), Positives = 63/79 (80%), Gaps = 1/79 (1%)
 Frame = +3

Query  381  INHLTVETEDTFSSLLELAA-NNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHR  557
            +NHL+++TED+ +SLL   A NND+ G KR I  +PSSIDEVG WYGR K SK+MV E R
Sbjct  1    MNHLSLDTEDSLASLLLELAANNDVSGFKRLIECEPSSIDEVGLWYGRHKESKKMVNEQR  60

Query  558  TPLMVAATYGSIDVLKLIL  614
            TPLMVAATYGSIDV+ LIL
Sbjct  61   TPLMVAATYGSIDVMTLIL  79



>ref|XP_002314073.2| hypothetical protein POPTR_0009s05810g [Populus trichocarpa]
 gb|EEE88028.2| hypothetical protein POPTR_0009s05810g [Populus trichocarpa]
Length=628

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +3

Query  396  VETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVA  575
            ++TED+FSSLLE AA+N++EG KR +  D S I EVG WYGR   S++MVLE RTPLM+A
Sbjct  20   IDTEDSFSSLLEFAADNNVEGFKRSV-FDESEIKEVGLWYGRLGASRKMVLEQRTPLMIA  78

Query  576  ATYGSIDVLKLIL  614
            A YGS DVLKL+L
Sbjct  79   AKYGSADVLKLLL  91



>ref|XP_010673641.1| PREDICTED: zinc finger CCCH domain-containing protein 24 [Beta 
vulgaris subsp. vulgaris]
Length=675

 Score = 98.2 bits (243),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 45/80 (56%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  375  MNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEH  554
            MN    T+E + +FS LLELAA+ND+EG K  + S+P+ I+E+G WYGRQ G++ MVLE+
Sbjct  5    MNSFSETLEAKISFSHLLELAADNDVEGFKLNVESNPNVINEIGLWYGRQLGARGMVLEY  64

Query  555  RTPLMVAATYGSIDVLKLIL  614
            RTPL++A+ YGS+DV+K+IL
Sbjct  65   RTPLIIASMYGSLDVMKVIL  84



>ref|XP_011045434.1| PREDICTED: zinc finger CCCH domain-containing protein 56-like 
isoform X1 [Populus euphratica]
 ref|XP_011006196.1| PREDICTED: zinc finger CCCH domain-containing protein 56-like 
isoform X1 [Populus euphratica]
Length=676

 Score = 98.2 bits (243),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 45/73 (62%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +3

Query  396  VETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVA  575
            ++TE +FSSLLE AA+ND+EG +R    D S + EVG WY RQ GS++MVLE RTPLM+A
Sbjct  20   IDTEHSFSSLLEFAADNDVEGFRR-SAFDESEVKEVGLWYSRQGGSRKMVLEQRTPLMIA  78

Query  576  ATYGSIDVLKLIL  614
            A YGS+D++KLIL
Sbjct  79   AKYGSVDIVKLIL  91



>ref|XP_002298403.2| hypothetical protein POPTR_0001s26560g [Populus trichocarpa]
 gb|EEE83208.2| hypothetical protein POPTR_0001s26560g [Populus trichocarpa]
Length=675

 Score = 97.8 bits (242),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 44/74 (59%), Positives = 59/74 (80%), Gaps = 1/74 (1%)
 Frame = +3

Query  393  TVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMV  572
            +++TE +FSSLLE AA ND+EG +R +  D S + +VG WYGR  GS++MVLE RTPLM+
Sbjct  19   SIDTEHSFSSLLEFAAGNDVEGFRRSV-FDESEVKQVGLWYGRHGGSRKMVLEQRTPLMI  77

Query  573  AATYGSIDVLKLIL  614
            AA YGS+D++KLIL
Sbjct  78   AAKYGSVDIVKLIL  91



>ref|XP_011025532.1| PREDICTED: zinc finger CCCH domain-containing protein 56-like 
[Populus euphratica]
Length=630

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 45/73 (62%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = +3

Query  396  VETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVA  575
            ++TED+FSSLLE AA+N++EG KR +  + S + +VG WYGR   S++MVLE RTPLM+A
Sbjct  23   IDTEDSFSSLLEFAADNNVEGFKRSVFHE-SEVKDVGLWYGRLGASRKMVLEQRTPLMIA  81

Query  576  ATYGSIDVLKLIL  614
            A YGS+DVLKLIL
Sbjct  82   ARYGSVDVLKLIL  94



>ref|XP_007214231.1| hypothetical protein PRUPE_ppa025636mg [Prunus persica]
 gb|EMJ15430.1| hypothetical protein PRUPE_ppa025636mg [Prunus persica]
Length=691

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 45/73 (62%), Positives = 61/73 (84%), Gaps = 1/73 (1%)
 Frame = +3

Query  396  VETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVA  575
            +ETE +  SLLELAA+ND++G K+ I S+ S ++E+G WYGR + S++MVLEHRTPLMVA
Sbjct  8    LETEHSSCSLLELAADNDVDGFKQSI-SEASIVNEIGLWYGRDRASRRMVLEHRTPLMVA  66

Query  576  ATYGSIDVLKLIL  614
            + YGS+DV+KLIL
Sbjct  67   SKYGSVDVVKLIL  79



>gb|KEH15615.1| ARM repeat CCCH-type zinc finger protein, partial [Medicago truncatula]
Length=626

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 48/94 (51%), Positives = 68/94 (72%), Gaps = 1/94 (1%)
 Frame = +3

Query  336  VI*ITVDNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSD-PSSIDEVGQW  512
            V+ + +   ++T  ++  L V  +D+F SLL LA++ND EG K  +  +  +SI+E G W
Sbjct  2    VVCVQLTVEVSTFKDMETLAVNIKDSFPSLLVLASHNDSEGFKLLLEKEGAASINEAGIW  61

Query  513  YGRQKGSKQMVLEHRTPLMVAATYGSIDVLKLIL  614
            YGRQ GS ++VLEH+TPLMVAATYGSIDV+K+IL
Sbjct  62   YGRQTGSTEIVLEHKTPLMVAATYGSIDVMKVIL  95



>gb|EYU18755.1| hypothetical protein MIMGU_mgv1a005424mg [Erythranthe guttata]
Length=484

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = +3

Query  375  MNINHLT-VETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLE  551
            MN ++L  VE ED F SLLELAAN+D+E  + +I   P  +++VG WYGRQ G  +M L 
Sbjct  1    MNDDNLPKVENEDAFQSLLELAANDDLEAFRTYIDRQPLIVNDVGLWYGRQNGPARMALH  60

Query  552  HRTPLMVAATYGSIDVLKLIL  614
            H TPLMVA+TYGS+DV+ LIL
Sbjct  61   HLTPLMVASTYGSLDVVNLIL  81



>ref|XP_002513504.1| transcription factor, putative [Ricinus communis]
 gb|EEF48907.1| transcription factor, putative [Ricinus communis]
Length=675

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 50/80 (63%), Positives = 60/80 (75%), Gaps = 1/80 (1%)
 Frame = +3

Query  375  MNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEH  554
            MN +  TV TE +FS LLE AA+ND+EG K+ +  D S I  VG WYG Q+ SK+ VLEH
Sbjct  1    MNNSVDTVGTEHSFSVLLEYAADNDVEGFKQSV-CDESEIGVVGLWYGHQRLSKKRVLEH  59

Query  555  RTPLMVAATYGSIDVLKLIL  614
            RTPLMVAA YGS+DV+KLIL
Sbjct  60   RTPLMVAAKYGSVDVVKLIL  79



>gb|KDO61256.1| hypothetical protein CISIN_1g004266mg [Citrus sinensis]
Length=765

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 46/74 (62%), Positives = 61/74 (82%), Gaps = 1/74 (1%)
 Frame = +3

Query  393  TVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMV  572
            T++++ +FS LLELAA+ND+EG K+ I  D S+I EVG WY  Q+ SK++VL+HRTPLMV
Sbjct  88   TMKSDHSFSRLLELAADNDVEGFKQCI-CDTSAICEVGLWYSFQRLSKKIVLQHRTPLMV  146

Query  573  AATYGSIDVLKLIL  614
            AA YGS+DV+KLIL
Sbjct  147  AAEYGSVDVVKLIL  160



>ref|XP_006446118.1| hypothetical protein CICLE_v10014437mg [Citrus clementina]
 ref|XP_006446119.1| hypothetical protein CICLE_v10014437mg [Citrus clementina]
 ref|XP_006446120.1| hypothetical protein CICLE_v10014437mg [Citrus clementina]
 ref|XP_006470610.1| PREDICTED: zinc finger CCCH domain-containing protein 56-like 
isoform X1 [Citrus sinensis]
 ref|XP_006470611.1| PREDICTED: zinc finger CCCH domain-containing protein 56-like 
isoform X2 [Citrus sinensis]
 ref|XP_006470612.1| PREDICTED: zinc finger CCCH domain-containing protein 56-like 
isoform X3 [Citrus sinensis]
 gb|ESR59358.1| hypothetical protein CICLE_v10014437mg [Citrus clementina]
 gb|ESR59359.1| hypothetical protein CICLE_v10014437mg [Citrus clementina]
 gb|ESR59360.1| hypothetical protein CICLE_v10014437mg [Citrus clementina]
Length=712

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 46/74 (62%), Positives = 61/74 (82%), Gaps = 1/74 (1%)
 Frame = +3

Query  393  TVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMV  572
            T++++ +FS LLELAA+ND+EG K+ I  D S+I EVG WY  Q+ SK++VL+HRTPLMV
Sbjct  35   TMKSDHSFSRLLELAADNDVEGFKQCI-CDTSAICEVGLWYSFQRLSKKIVLQHRTPLMV  93

Query  573  AATYGSIDVLKLIL  614
            AA YGS+DV+KLIL
Sbjct  94   AAEYGSVDVVKLIL  107



>gb|KEH41397.1| ARM repeat CCCH-type zinc finger protein [Medicago truncatula]
Length=590

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 59/76 (78%), Gaps = 1/76 (1%)
 Frame = +3

Query  390  LTVETEDTFSSLLELAANNDIEGVKRWIGSD-PSSIDEVGQWYGRQKGSKQMVLEHRTPL  566
            L V  +D+F SLL LA++ND EG K  +  +  +SI+E G WYGRQ GS ++VLEH+TPL
Sbjct  4    LAVNIKDSFPSLLVLASHNDSEGFKLLLEKEGAASINEAGIWYGRQTGSTEIVLEHKTPL  63

Query  567  MVAATYGSIDVLKLIL  614
            MVAATYGSIDV+K+IL
Sbjct  64   MVAATYGSIDVMKVIL  79



>gb|ACN39879.1| unknown [Picea sitchensis]
Length=768

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 46/72 (64%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +3

Query  399  ETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAA  578
            E  ++ SSL ELAANND+ G K+ +  + S IDEV  WYGRQ GS QMVLE RTPLMVAA
Sbjct  32   EISESCSSLHELAANNDLIGFKKAMEEEGSKIDEVNFWYGRQNGSNQMVLEQRTPLMVAA  91

Query  579  TYGSIDVLKLIL  614
             YGS+D LK IL
Sbjct  92   LYGSVDALKYIL  103



>ref|XP_011045435.1| PREDICTED: zinc finger CCCH domain-containing protein 56-like 
isoform X2 [Populus euphratica]
Length=645

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 42/70 (60%), Positives = 55/70 (79%), Gaps = 1/70 (1%)
 Frame = +3

Query  396  VETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVA  575
            ++TE +FSSLLE AA+ND+EG +R    D S + EVG WY RQ GS++MVLE RTPLM+A
Sbjct  20   IDTEHSFSSLLEFAADNDVEGFRR-SAFDESEVKEVGLWYSRQGGSRKMVLEQRTPLMIA  78

Query  576  ATYGSIDVLK  605
            A YGS+D++K
Sbjct  79   AKYGSVDIVK  88



>ref|XP_011006197.1| PREDICTED: zinc finger CCCH domain-containing protein 56-like 
isoform X2 [Populus euphratica]
Length=658

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 42/70 (60%), Positives = 55/70 (79%), Gaps = 1/70 (1%)
 Frame = +3

Query  396  VETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVA  575
            ++TE +FSSLLE AA+ND+EG +R    D S + EVG WY RQ GS++MVLE RTPLM+A
Sbjct  33   IDTEHSFSSLLEFAADNDVEGFRR-SAFDESEVKEVGLWYSRQGGSRKMVLEQRTPLMIA  91

Query  576  ATYGSIDVLK  605
            A YGS+D++K
Sbjct  92   AKYGSVDIVK  101



>gb|KDP22093.1| hypothetical protein JCGZ_25924 [Jatropha curcas]
Length=589

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 59/80 (74%), Gaps = 1/80 (1%)
 Frame = +3

Query  375  MNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEH  554
            MN +  TVETE +FS LLE AA+ND+EG KR +  D S + +VG WY   + SK+ VLEH
Sbjct  1    MNTSVGTVETEYSFSMLLECAADNDVEGFKRSVF-DESEVRQVGLWYVHHRVSKKGVLEH  59

Query  555  RTPLMVAATYGSIDVLKLIL  614
            RTPLMVAA YGS DV+KLIL
Sbjct  60   RTPLMVAAKYGSADVMKLIL  79



>gb|KJB09387.1| hypothetical protein B456_001G138300 [Gossypium raimondii]
Length=685

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 44/69 (64%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +3

Query  411  TFSSLLELAANNDIEGVKRW-IGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAATYG  587
            +FS LLE AA+ND+EG +R+ I S  S + EVG WYG +K SKQMV+E RTPLM+AA YG
Sbjct  29   SFSVLLEFAADNDVEGFQRYMIASHVSLVGEVGLWYGYRKSSKQMVVEQRTPLMIAARYG  88

Query  588  SIDVLKLIL  614
            S+DV+KLIL
Sbjct  89   SVDVVKLIL  97



>ref|XP_010536082.1| PREDICTED: zinc finger CCCH domain-containing protein 56 [Tarenaya 
hassleriana]
 ref|XP_010536083.1| PREDICTED: zinc finger CCCH domain-containing protein 56 [Tarenaya 
hassleriana]
Length=694

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 41/74 (55%), Positives = 62/74 (84%), Gaps = 1/74 (1%)
 Frame = +3

Query  393  TVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMV  572
            +++++ +FS+LLE AA+ND+EG K  + SD S I+++G WY R++  ++MV+EHRTPLMV
Sbjct  33   SIDSDCSFSALLEFAADNDVEGFKSHL-SDVSCINKIGLWYARRRFLRKMVVEHRTPLMV  91

Query  573  AATYGSIDVLKLIL  614
            AATYGS+DV+KLI+
Sbjct  92   AATYGSVDVVKLII  105



>ref|XP_007015052.1| C3HL domain class transcription factor, putative [Theobroma cacao]
 gb|EOY32671.1| C3HL domain class transcription factor, putative [Theobroma cacao]
Length=708

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = +3

Query  396  VETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVA  575
            V +E +FS LLE AA+ND+EG +R I  D S + EVG WYGR+K +KQ+V+E RTPLM+A
Sbjct  31   VGSECSFSVLLEFAADNDVEGFQRSI-RDGSLVGEVGLWYGRRKCTKQIVVERRTPLMIA  89

Query  576  ATYGSIDVLKLIL  614
            A YGS+DV+ LIL
Sbjct  90   AKYGSVDVVNLIL  102



>ref|XP_004982091.1| PREDICTED: zinc finger CCCH domain-containing protein 24-like 
[Setaria italica]
Length=753

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 44/77 (57%), Positives = 60/77 (78%), Gaps = 6/77 (8%)
 Frame = +3

Query  387  HLTVETEDTFSSLLELAANNDIEGVKRWIG-SDPSSIDEVGQWYGRQKGSKQMVLEHRTP  563
            HLTV+T+D F+ LLELAA++D EG++R +  + P++ DE G WYGR+K     VLEHRTP
Sbjct  41   HLTVDTDDAFAGLLELAADDDAEGLRRALERAPPAAADEAGLWYGRRK-----VLEHRTP  95

Query  564  LMVAATYGSIDVLKLIL  614
            LMVAATYGS+  L+L++
Sbjct  96   LMVAATYGSLAALRLLV  112



>ref|XP_008665236.1| PREDICTED: zinc finger CCCH domain-containing protein 24 [Zea 
mays]
 tpg|DAA50817.1| TPA: hypothetical protein ZEAMMB73_900150 [Zea mays]
Length=746

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 45/77 (58%), Positives = 60/77 (78%), Gaps = 6/77 (8%)
 Frame = +3

Query  387  HLTVETEDTFSSLLELAANNDIEGVKRWIG-SDPSSIDEVGQWYGRQKGSKQMVLEHRTP  563
            HLTV+TEDTF+ LLELAA++D EG++  +  + P++ DE G WYGR+K     VLEHRTP
Sbjct  40   HLTVDTEDTFAGLLELAADDDAEGLRLALERAPPAAADEAGLWYGRRK-----VLEHRTP  94

Query  564  LMVAATYGSIDVLKLIL  614
            LMVAATYGS+  L+L++
Sbjct  95   LMVAATYGSLAALRLLV  111



>ref|NP_196789.1| zinc finger CCCH domain-containing protein 56 [Arabidopsis thaliana]
 sp|Q9LXV4.1|C3H56_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 56; 
Short=AtC3H56 [Arabidopsis thaliana]
 emb|CAB88249.1| zinc finger transcription factor-like protein [Arabidopsis thaliana]
 dbj|BAE99190.1| zinc finger transcription factor -like protein [Arabidopsis thaliana]
 gb|AED91821.1| zinc finger CCCH domain-containing protein 56 [Arabidopsis thaliana]
Length=706

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 47/87 (54%), Positives = 63/87 (72%), Gaps = 4/87 (5%)
 Frame = +3

Query  354  DNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGS  533
            + SLA  MN      E E +FS+LLE AA+ND+EG +R + SD S I+++G WY RQ+  
Sbjct  22   NESLAKPMND---AAEWEHSFSALLEFAADNDVEGFRRQL-SDVSCINQMGLWYRRQRFV  77

Query  534  KQMVLEHRTPLMVAATYGSIDVLKLIL  614
            ++MVLE RTPLMVA+ YGS+DV+K IL
Sbjct  78   RRMVLEQRTPLMVASLYGSLDVVKFIL  104



>gb|AAM20612.1| zinc finger transcription factor-like protein [Arabidopsis thaliana]
 gb|AAM91291.1| zinc finger transcription factor-like protein [Arabidopsis thaliana]
Length=706

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 47/87 (54%), Positives = 63/87 (72%), Gaps = 4/87 (5%)
 Frame = +3

Query  354  DNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGS  533
            + SLA  MN      E E +FS+LLE AA+ND+EG +R + SD S I+++G WY RQ+  
Sbjct  22   NESLAKPMND---VAEWEHSFSALLEFAADNDVEGFRRQL-SDVSCINQMGLWYRRQRFV  77

Query  534  KQMVLEHRTPLMVAATYGSIDVLKLIL  614
            ++MVLE RTPLMVA+ YGS+DV+K IL
Sbjct  78   RRMVLEQRTPLMVASLYGSLDVVKFIL  104



>ref|XP_002466619.1| hypothetical protein SORBIDRAFT_01g011150 [Sorghum bicolor]
 gb|EER93617.1| hypothetical protein SORBIDRAFT_01g011150 [Sorghum bicolor]
Length=745

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 43/77 (56%), Positives = 59/77 (77%), Gaps = 6/77 (8%)
 Frame = +3

Query  387  HLTVETEDTFSSLLELAANNDIEGVKRWIG-SDPSSIDEVGQWYGRQKGSKQMVLEHRTP  563
            HLTV+TED F+ LLE AA+++ EG++R +  + P++ DE G WYGR+K     VLEHRTP
Sbjct  40   HLTVDTEDAFAGLLEFAADDNAEGLRRALERAPPAAADEAGLWYGRRK-----VLEHRTP  94

Query  564  LMVAATYGSIDVLKLIL  614
            LMVAATYGS+  L+L++
Sbjct  95   LMVAATYGSLAALRLLV  111



>ref|XP_006286367.1| hypothetical protein CARUB_v10000345mg [Capsella rubella]
 ref|XP_006286368.1| hypothetical protein CARUB_v10000345mg [Capsella rubella]
 gb|EOA19265.1| hypothetical protein CARUB_v10000345mg [Capsella rubella]
 gb|EOA19266.1| hypothetical protein CARUB_v10000345mg [Capsella rubella]
Length=705

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 47/85 (55%), Positives = 62/85 (73%), Gaps = 5/85 (6%)
 Frame = +3

Query  360  SLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQ  539
            SLA  MN      E E +FS+LLE AA+ND+EG KR + S  S I+++G WY RQ+  ++
Sbjct  24   SLAKPMN----NAEWEHSFSALLEFAADNDVEGFKRQL-SVVSCINQMGLWYRRQRFVRR  78

Query  540  MVLEHRTPLMVAATYGSIDVLKLIL  614
            MV+E RTPLMVA+ YGS+DV+KLIL
Sbjct  79   MVVEQRTPLMVASIYGSLDVVKLIL  103



>ref|XP_010492018.1| PREDICTED: zinc finger CCCH domain-containing protein 56-like 
[Camelina sativa]
 ref|XP_010492019.1| PREDICTED: zinc finger CCCH domain-containing protein 56-like 
[Camelina sativa]
 ref|XP_010492020.1| PREDICTED: zinc finger CCCH domain-containing protein 56-like 
[Camelina sativa]
 ref|XP_010492021.1| PREDICTED: zinc finger CCCH domain-containing protein 56-like 
[Camelina sativa]
Length=708

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 47/85 (55%), Positives = 62/85 (73%), Gaps = 5/85 (6%)
 Frame = +3

Query  360  SLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQ  539
            SLA  MN      E E +FS+LLE AA+ND+EG KR + S  S I+++G WY RQ+  ++
Sbjct  24   SLAKPMN----DAEWEHSFSALLEFAADNDVEGFKRQL-SVVSCINQMGLWYRRQRFVRR  78

Query  540  MVLEHRTPLMVAATYGSIDVLKLIL  614
            MV+E RTPLMVA+ YGS+DV+KLIL
Sbjct  79   MVVEQRTPLMVASLYGSLDVVKLIL  103



>emb|CDX91160.1| BnaC02g04370D [Brassica napus]
Length=650

 Score = 85.9 bits (211),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 46/89 (52%), Positives = 63/89 (71%), Gaps = 4/89 (4%)
 Frame = +3

Query  348  TVDNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQK  527
            T+ +SL+  MN      E E +FS+LLE AA+ND+EG K  + S  SS+++V  WY R +
Sbjct  73   TLSDSLSKPMNN---AAECEHSFSALLEFAADNDVEGFKHQL-SLVSSVNQVSLWYRRHR  128

Query  528  GSKQMVLEHRTPLMVAATYGSIDVLKLIL  614
              K+MV+E RTPLMVA+ YGS+DV+KLIL
Sbjct  129  LVKRMVVEQRTPLMVASLYGSLDVVKLIL  157



>ref|XP_010453333.1| PREDICTED: zinc finger CCCH domain-containing protein 56-like 
[Camelina sativa]
 ref|XP_010453334.1| PREDICTED: zinc finger CCCH domain-containing protein 56-like 
[Camelina sativa]
Length=707

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 46/85 (54%), Positives = 62/85 (73%), Gaps = 5/85 (6%)
 Frame = +3

Query  360  SLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQ  539
            SLA  MN      E E +FS+LLE AA++D+EG KR + S  S I+++G WY RQ+  ++
Sbjct  24   SLAKPMN----DAEWEHSFSALLEFAADDDVEGFKRQL-SVVSCINQMGLWYRRQRFVRR  78

Query  540  MVLEHRTPLMVAATYGSIDVLKLIL  614
            MV+E RTPLMVA+ YGS+DV+KLIL
Sbjct  79   MVVEQRTPLMVASLYGSLDVVKLIL  103



>ref|XP_010419842.1| PREDICTED: zinc finger CCCH domain-containing protein 56 [Camelina 
sativa]
 ref|XP_010419843.1| PREDICTED: zinc finger CCCH domain-containing protein 56 [Camelina 
sativa]
Length=707

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 42/72 (58%), Positives = 57/72 (79%), Gaps = 1/72 (1%)
 Frame = +3

Query  399  ETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAA  578
            E E +FS+LLE AA+ND+EG KR + S  S I+++G WY RQ+  ++MV+E RTPLMVA+
Sbjct  33   EWEHSFSALLEFAADNDVEGFKRQL-SVVSCINQMGLWYRRQRFVRRMVVEQRTPLMVAS  91

Query  579  TYGSIDVLKLIL  614
             YGS+DV+KLIL
Sbjct  92   LYGSLDVVKLIL  103



>gb|KEH33323.1| ARM repeat CCCH-type zinc finger protein [Medicago truncatula]
Length=469

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +3

Query  372  IMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLE  551
            + ++ +LTV T D+ SSLLE A+ ND E  K  + SD S + EVG W  RQ G  Q+VLE
Sbjct  15   VEDMKNLTVTTNDSLSSLLEHASKNDFEQFKIALDSDASLLLEVGAWCVRQNGHNQIVLE  74

Query  552  HRTPLMVAATYGSIDVLKLIL  614
             RT LMVAA+ GSID+LKLIL
Sbjct  75   DRTALMVAASCGSIDILKLIL  95



>ref|XP_006399772.1| hypothetical protein EUTSA_v10012818mg [Eutrema salsugineum]
 dbj|BAJ33608.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ41225.1| hypothetical protein EUTSA_v10012818mg [Eutrema salsugineum]
Length=707

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 61/86 (71%), Gaps = 5/86 (6%)
 Frame = +3

Query  357  NSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSK  536
            +S+A  MN      E E +FS+LLE AA+N++EG KR +   P  I++ G WY RQ+  +
Sbjct  24   DSVAKPMN----DAEWEHSFSALLEFAADNNVEGFKRQLSVVPC-INQEGLWYRRQRFVR  78

Query  537  QMVLEHRTPLMVAATYGSIDVLKLIL  614
            +MVLE RTPLMVA+ YGS+DV+KLIL
Sbjct  79   KMVLEQRTPLMVASIYGSLDVVKLIL  104



>emb|CDY53968.1| BnaA10g30000D [Brassica napus]
Length=607

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 56/72 (78%), Gaps = 1/72 (1%)
 Frame = +3

Query  399  ETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAA  578
            E E +FS+LLE AA+N++EG K+ +   P  I+++G WY RQ+  ++MV+E RTPLMVA+
Sbjct  10   ELEHSFSALLEFAADNNVEGFKQQLSLVPC-INQMGLWYRRQRFVRRMVVEQRTPLMVAS  68

Query  579  TYGSIDVLKLIL  614
             YGS+DV+KLIL
Sbjct  69   IYGSVDVVKLIL  80



>ref|XP_009125867.1| PREDICTED: zinc finger CCCH domain-containing protein 56-like 
[Brassica rapa]
Length=627

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 46/88 (52%), Positives = 62/88 (70%), Gaps = 4/88 (5%)
 Frame = +3

Query  351  VDNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKG  530
            + +SL+  MN      E E +FS+LLE AA+ND+EG K  + S  SSI++   WY RQ+ 
Sbjct  15   LSHSLSKPMND---AAECEHSFSALLEFAADNDVEGFKHQL-SLVSSINQASLWYRRQRL  70

Query  531  SKQMVLEHRTPLMVAATYGSIDVLKLIL  614
             K+MV+E RTPLMVA+ YGS+DV+KLIL
Sbjct  71   IKRMVVEQRTPLMVASLYGSLDVVKLIL  98



>emb|CDX85685.1| BnaA02g01280D [Brassica napus]
Length=910

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 46/88 (52%), Positives = 63/88 (72%), Gaps = 4/88 (5%)
 Frame = +3

Query  351  VDNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKG  530
            + +SL+  MN      E E +FS+LLE AA+ND++G K  + S  SSI++V  WY RQ+ 
Sbjct  299  LSHSLSKPMND---AAECEHSFSALLEFAADNDVDGFKHQL-SLVSSINQVSLWYRRQRL  354

Query  531  SKQMVLEHRTPLMVAATYGSIDVLKLIL  614
             K+MV+E RTPLMVA+ YGS+DV+KLIL
Sbjct  355  IKRMVVEQRTPLMVASLYGSLDVVKLIL  382



>ref|XP_002871530.1| hypothetical protein ARALYDRAFT_488102 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47789.1| hypothetical protein ARALYDRAFT_488102 [Arabidopsis lyrata subsp. 
lyrata]
Length=706

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 45/87 (52%), Positives = 62/87 (71%), Gaps = 4/87 (5%)
 Frame = +3

Query  354  DNSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGS  533
            + SLA  MN      E E +FS+LLE AA+ND++G KR + S  S I+++G WY RQ+  
Sbjct  22   NESLAKSMND---VAEWEHSFSALLEFAADNDVDGFKRQL-SLVSCINQMGLWYRRQRFV  77

Query  534  KQMVLEHRTPLMVAATYGSIDVLKLIL  614
            ++MV+E RTPLMVA+ YGS+DV+K IL
Sbjct  78   RRMVVEQRTPLMVASIYGSLDVVKFIL  104



>ref|XP_010555058.1| PREDICTED: zinc finger CCCH domain-containing protein 56-like 
[Tarenaya hassleriana]
 ref|XP_010555059.1| PREDICTED: zinc finger CCCH domain-containing protein 56-like 
[Tarenaya hassleriana]
Length=703

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 43/80 (54%), Positives = 58/80 (73%), Gaps = 1/80 (1%)
 Frame = +3

Query  375  MNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEH  554
            MN +    E+E +F +LLE AA+ND+E  KR +  D S ++++G WY RQ   ++MVLE 
Sbjct  30   MNGSIGETESECSFLALLEFAADNDVESFKRHL-LDASRVNQIGLWYSRQSFLRKMVLEP  88

Query  555  RTPLMVAATYGSIDVLKLIL  614
            RTPLMVAA YGS+DV+KLIL
Sbjct  89   RTPLMVAAMYGSVDVVKLIL  108



>ref|XP_003559545.1| PREDICTED: zinc finger CCCH domain-containing protein 24 [Brachypodium 
distachyon]
Length=761

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 41/69 (59%), Positives = 52/69 (75%), Gaps = 6/69 (9%)
 Frame = +3

Query  387  HLTVETEDTFSSLLELAANNDIEGVKRWIGSD-PSSIDEVGQWYGRQKGSKQMVLEHRTP  563
            HLTV+T+D F+SLLELAA +D +G++R + S  P++ DE G WYGRQK      +E RTP
Sbjct  40   HLTVDTDDAFASLLELAAEDDADGLRRALESGPPAAADEAGLWYGRQK-----FMEQRTP  94

Query  564  LMVAATYGS  590
            LMVAATYGS
Sbjct  95   LMVAATYGS  103



>ref|NP_001050982.1| Os03g0698800 [Oryza sativa Japonica Group]
 sp|Q10EL1.1|C3H24_ORYSJ RecName: Full=Zinc finger CCCH domain-containing protein 24; 
Short=OsC3H24 [Oryza sativa Japonica Group]
 gb|ABF98372.1| Zinc finger C-x8-C-x5-C-x3-H type family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF12896.1| Os03g0698800 [Oryza sativa Japonica Group]
 dbj|BAH00104.1| unnamed protein product [Oryza sativa Japonica Group]
Length=764

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 41/68 (60%), Positives = 53/68 (78%), Gaps = 6/68 (9%)
 Frame = +3

Query  390  LTVETEDTFSSLLELAANNDIEGVKRWIG-SDPSSIDEVGQWYGRQKGSKQMVLEHRTPL  566
            LTV+T+D F+ LLELAA++D EG++R +  + P++ DE G WYGR+K     VLEHRTPL
Sbjct  59   LTVDTDDAFAGLLELAADDDAEGLRRALERAPPAAADEAGLWYGRRK-----VLEHRTPL  113

Query  567  MVAATYGS  590
            MVAATYGS
Sbjct  114  MVAATYGS  121



>gb|AAO38462.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAY91513.1| hypothetical protein OsI_13148 [Oryza sativa Indica Group]
Length=749

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 41/68 (60%), Positives = 53/68 (78%), Gaps = 6/68 (9%)
 Frame = +3

Query  390  LTVETEDTFSSLLELAANNDIEGVKRWIG-SDPSSIDEVGQWYGRQKGSKQMVLEHRTPL  566
            LTV+T+D F+ LLELAA++D EG++R +  + P++ DE G WYGR+K     VLEHRTPL
Sbjct  44   LTVDTDDAFAGLLELAADDDAEGLRRALERAPPAAADEAGLWYGRRK-----VLEHRTPL  98

Query  567  MVAATYGS  590
            MVAATYGS
Sbjct  99   MVAATYGS  106



>ref|XP_009121831.1| PREDICTED: zinc finger CCCH domain-containing protein 56 [Brassica 
rapa]
 ref|XP_009121832.1| PREDICTED: zinc finger CCCH domain-containing protein 56 [Brassica 
rapa]
Length=647

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 39/72 (54%), Positives = 56/72 (78%), Gaps = 1/72 (1%)
 Frame = +3

Query  399  ETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAA  578
            E E +FS+LLE AA+N++EG K+ +   P  I+++G WY RQ+  ++MV+E RTPLMVA+
Sbjct  10   ELEHSFSALLEFAADNNVEGFKQQLSLVPC-INQMGLWYRRQRFVRRMVVEQRTPLMVAS  68

Query  579  TYGSIDVLKLIL  614
             YGS+DV+KLIL
Sbjct  69   IYGSVDVVKLIL  80



>emb|CDX97207.1| BnaC09g44180D [Brassica napus]
Length=642

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 39/72 (54%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = +3

Query  399  ETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAA  578
            E E +FS+LLE AA+N++EG K  +   P  I+++G WY RQ+  ++MV+E RTPLMVA+
Sbjct  10   ELEHSFSALLEFAADNNVEGFKHQLSLVPC-INQMGLWYRRQRFVRRMVVEQRTPLMVAS  68

Query  579  TYGSIDVLKLIL  614
             YGS+DV+KLIL
Sbjct  69   IYGSVDVVKLIL  80



>ref|XP_006426807.1| hypothetical protein CICLE_v10026863mg [Citrus clementina]
 gb|ESR40047.1| hypothetical protein CICLE_v10026863mg [Citrus clementina]
Length=85

 Score = 74.3 bits (181),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 47/58 (81%), Gaps = 3/58 (5%)
 Frame = +3

Query  450  IEGVKRWIGSDPSSIDEVGQWYGRQ-KGSKQMVLEHRTPLMV-AATYGSI-DVLKLIL  614
            ++ +KR +G DPSS+DEVG WYGR+  GSKQMV EHRTPLMV AATYG + DVL+L L
Sbjct  1    MQALKRMLGRDPSSVDEVGLWYGRRVNGSKQMVSEHRTPLMVAAATYGGLDDVLELSL  58



>ref|XP_002314096.2| hypothetical protein POPTR_0009s05150g [Populus trichocarpa]
 gb|EEE88051.2| hypothetical protein POPTR_0009s05150g [Populus trichocarpa]
Length=703

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 40/67 (60%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = +3

Query  414  FSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAATYGSI  593
            FS LLEL+A+ND+ G KR I  +   IDE G WYGR+ GSK+M  E RTPL++AA YGS 
Sbjct  30   FSLLLELSASNDLTGFKRAIEVEGHDIDEPGLWYGRRIGSKKMGFEERTPLIIAALYGSK  89

Query  594  DVLKLIL  614
            DVL  IL
Sbjct  90   DVLNYIL  96



>dbj|BAK06499.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=770

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 6/68 (9%)
 Frame = +3

Query  387  HLTVETEDTFSSLLELAANNDIEGVKRWIG-SDPSSIDEVGQWYGRQKGSKQMVLEHRTP  563
            HLTV+T+D F+ LLELAA++D +G++R +  + PS+ DE G WYGR+K      LE RTP
Sbjct  52   HLTVDTDDAFAGLLELAADDDADGLRRALERAPPSTADEAGLWYGRRKA-----LEQRTP  106

Query  564  LMVAATYG  587
            LMVAATYG
Sbjct  107  LMVAATYG  114



>ref|XP_011032109.1| PREDICTED: zinc finger CCCH domain-containing protein 66 isoform 
X2 [Populus euphratica]
Length=688

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +3

Query  414  FSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAATYGSI  593
            FS LLEL+A+ND+ G KR I  +   ID  G WYGR+ GSK+M  E RTPLM+AA YGS 
Sbjct  15   FSLLLELSASNDLTGFKRAIEVEGHDIDAPGLWYGRRIGSKKMGFEERTPLMIAALYGSK  74

Query  594  DVLKLIL  614
            DVL  IL
Sbjct  75   DVLNYIL  81



>ref|XP_011032108.1| PREDICTED: zinc finger CCCH domain-containing protein 66 isoform 
X1 [Populus euphratica]
Length=703

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +3

Query  414  FSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAATYGSI  593
            FS LLEL+A+ND+ G KR I  +   ID  G WYGR+ GSK+M  E RTPLM+AA YGS 
Sbjct  30   FSLLLELSASNDLTGFKRAIEVEGHDIDAPGLWYGRRIGSKKMGFEERTPLMIAALYGSK  89

Query  594  DVLKLIL  614
            DVL  IL
Sbjct  90   DVLNYIL  96



>gb|ADP02201.1| zinc finger CCCH domain-containing protein [Triticum aestivum]
Length=750

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 38/68 (56%), Positives = 51/68 (75%), Gaps = 6/68 (9%)
 Frame = +3

Query  387  HLTVETEDTFSSLLELAANNDIEGVKRWIG-SDPSSIDEVGQWYGRQKGSKQMVLEHRTP  563
            HLTV+T+D F+ LLELAA++D +G++R +  + P++ DE G WYGR+K      LE RTP
Sbjct  34   HLTVDTDDAFAGLLELAADDDADGLRRALERAPPAAADEAGLWYGRRKA-----LEQRTP  88

Query  564  LMVAATYG  587
            LMVAATYG
Sbjct  89   LMVAATYG  96



>ref|XP_006843575.1| hypothetical protein AMTR_s00007p00102750 [Amborella trichopoda]
 gb|ERN05250.1| hypothetical protein AMTR_s00007p00102750 [Amborella trichopoda]
Length=695

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 37/67 (55%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = +3

Query  414  FSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAATYGSI  593
            +SSLLEL+A+ND+   K+ +  D S+ID    WYGR+ GS +M +E RTPLMVAA +GS 
Sbjct  29   YSSLLELSASNDLISFKQAVEEDGSAIDGTALWYGRRSGSSRMSVEQRTPLMVAALFGST  88

Query  594  DVLKLIL  614
            DVL  IL
Sbjct  89   DVLSYIL  95



>ref|XP_004294290.1| PREDICTED: zinc finger CCCH domain-containing protein 66-like 
[Fragaria vesca subsp. vesca]
Length=701

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 35/68 (51%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = +3

Query  411  TFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAATYGS  590
            +FS LLELAA +D++G +  +  D   +DE   WYGR+ GSK+M  E RTPLM+AA +GS
Sbjct  32   SFSILLELAAADDLDGFRSAVEEDGHDVDEASYWYGRRVGSKKMGFEERTPLMIAAMFGS  91

Query  591  IDVLKLIL  614
            ++VL  IL
Sbjct  92   MNVLNYIL  99



>ref|NP_181543.1| zinc finger CCCH domain-containing protein 29 [Arabidopsis thaliana]
 ref|NP_001031517.1| zinc finger CCCH domain-containing protein 29 [Arabidopsis thaliana]
 sp|Q9XEE6.1|C3H29_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 29; 
Short=AtC3H29; AltName: Full=AtSZF2 [Arabidopsis thaliana]
 gb|AAD25930.1|AF085279_3 hypothetical Cys-3-His zinc finger protein [Arabidopsis thaliana]
 gb|AAM13015.1| putative CCCH-type zinc finger protein [Arabidopsis thaliana]
 gb|AAM91337.1| putative CCCH-type zinc finger protein [Arabidopsis thaliana]
 gb|AEC09787.1| zinc finger CCCH domain-containing protein 29 [Arabidopsis thaliana]
 gb|AEC09788.1| zinc finger CCCH domain-containing protein 29 [Arabidopsis thaliana]
Length=597

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 56/88 (64%), Gaps = 3/88 (3%)
 Frame = +3

Query  360  SLATIMNINHLTVETEDTFSS--LLELAANNDIEGVKRWIGSDPS-SIDEVGQWYGRQKG  530
            S  T+  +  +  ++ED  S+  LLE AA +D+   KR I  +PS  IDE G WY R+ G
Sbjct  10   SSKTLTEVEFMRQKSEDGASATCLLEFAACDDLSSFKREIEENPSVEIDESGFWYCRRVG  69

Query  531  SKQMVLEHRTPLMVAATYGSIDVLKLIL  614
            SK+M  E RTPLMVAA YGS++VL  I+
Sbjct  70   SKKMGFEERTPLMVAAMYGSMEVLNYII  97



>ref|XP_002525655.1| transcription factor, putative [Ricinus communis]
 gb|EEF36773.1| transcription factor, putative [Ricinus communis]
Length=702

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 53/77 (69%), Gaps = 4/77 (5%)
 Frame = +3

Query  396  VETEDTF----SSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTP  563
            ++ ED F    S LLEL+A+ND+ G KR I  +   +DE G WYGR+ GS++M +E RTP
Sbjct  18   LQKEDYFCYDLSILLELSASNDLIGFKRAIEEEGRDVDEPGLWYGRRIGSRKMGIEERTP  77

Query  564  LMVAATYGSIDVLKLIL  614
            LM+AA +GS DVL  IL
Sbjct  78   LMIAALFGSKDVLNYIL  94



>ref|XP_010508901.1| PREDICTED: zinc finger CCCH domain-containing protein 29 [Camelina 
sativa]
Length=614

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 42/88 (48%), Positives = 55/88 (63%), Gaps = 3/88 (3%)
 Frame = +3

Query  360  SLATIMNINHLTVETED--TFSSLLELAANNDIEGVKRWIGSDPS-SIDEVGQWYGRQKG  530
            S  T+  +  +  ++E+  T  SLLE AA +D+   KR I   PS  IDE G WY R+ G
Sbjct  10   SSKTLTEVEFMRQKSEEGATTMSLLEFAACDDLSSFKREIEEKPSVEIDEAGLWYCRRVG  69

Query  531  SKQMVLEHRTPLMVAATYGSIDVLKLIL  614
            SK+M  E RTPLMVAA YGS++VL  I+
Sbjct  70   SKKMGFEERTPLMVAAMYGSMEVLSYII  97



>ref|XP_007208332.1| hypothetical protein PRUPE_ppa002251mg [Prunus persica]
 gb|EMJ09531.1| hypothetical protein PRUPE_ppa002251mg [Prunus persica]
Length=695

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 35/68 (51%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = +3

Query  411  TFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAATYGS  590
            +FS LLEL+A++D++G KR +  +   +DE   WYGR  GSK+M  E RTPLM+AA +GS
Sbjct  27   SFSILLELSASDDLDGFKRAVEEEGHDVDEASYWYGRLIGSKKMGFEERTPLMIAAMFGS  86

Query  591  IDVLKLIL  614
             +VL  IL
Sbjct  87   KNVLNYIL  94



>ref|XP_008220916.1| PREDICTED: zinc finger CCCH domain-containing protein 66 [Prunus 
mume]
Length=700

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 35/68 (51%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = +3

Query  411  TFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAATYGS  590
            +FS LLEL+A++D++G KR +  +   +DE   WYGR  GSK+M  E RTPLM+AA +GS
Sbjct  27   SFSILLELSASDDLDGFKRAVEEEGHDVDEASYWYGRLIGSKKMGFEERTPLMIAAMFGS  86

Query  591  IDVLKLIL  614
             +VL  IL
Sbjct  87   KNVLNYIL  94



>ref|XP_009347250.1| PREDICTED: zinc finger CCCH domain-containing protein 66-like 
[Pyrus x bretschneideri]
Length=711

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 36/68 (53%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = +3

Query  411  TFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAATYGS  590
            +FS LLELAA +D+EG KR +  +   +DE   WYGR  GSK++  E RTPLM+AA +GS
Sbjct  27   SFSILLELAACDDLEGFKRAVEEEGHDVDEASYWYGRLIGSKKLGFEERTPLMIAAMFGS  86

Query  591  IDVLKLIL  614
             +VL  IL
Sbjct  87   KNVLNYIL  94



>ref|XP_010685536.1| PREDICTED: zinc finger CCCH domain-containing protein 66-like 
[Beta vulgaris subsp. vulgaris]
Length=644

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 37/74 (50%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +3

Query  393  TVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMV  572
            +VE +   S LLEL+A ND+   K  +  +   +DE G WYGR+ GSK+M  E RTPLMV
Sbjct  25   SVEEQQNSSVLLELSATNDLSSFKFAVEKEGYDVDEEGLWYGRRVGSKKMGFEERTPLMV  84

Query  573  AATYGSIDVLKLIL  614
            AA +GS D+L  IL
Sbjct  85   AAMFGSKDILNYIL  98



>ref|XP_008355011.1| PREDICTED: zinc finger CCCH domain-containing protein 66-like 
[Malus domestica]
Length=708

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 36/68 (53%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = +3

Query  411  TFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAATYGS  590
            +FS LLELAA +D+EG+KR +  +   +DE   WYGR  GSK++  E RTPLM+AA +GS
Sbjct  27   SFSILLELAACDDLEGLKRAVEEEGHDVDEASYWYGRLIGSKKLGXEERTPLMIAAMFGS  86

Query  591  IDVLKLIL  614
             +VL  IL
Sbjct  87   KNVLNYIL  94



>gb|KDP46484.1| hypothetical protein JCGZ_08456 [Jatropha curcas]
Length=689

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = +3

Query  414  FSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAATYGSI  593
             S LLEL+A+ND+ G KR I  +   ++E+G WYGR+ GS++M  E RTPLM+AA +GS 
Sbjct  15   LSILLELSASNDLLGFKRAIEEEGHDVNELGLWYGRRIGSRKMGFEERTPLMIAALFGSK  74

Query  594  DVLKLIL  614
            D+L  IL
Sbjct  75   DILNYIL  81



>ref|XP_002299802.2| hypothetical protein POPTR_0001s25960g [Populus trichocarpa]
 gb|EEE84607.2| hypothetical protein POPTR_0001s25960g [Populus trichocarpa]
Length=704

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 37/67 (55%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +3

Query  414  FSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAATYGSI  593
            FS LLEL+A ND+ G K+ I  +   +D  G WYGR+ GSK+M  E RTPLM+AA +GS 
Sbjct  30   FSGLLELSALNDLIGFKKAIEEEGHDVDMPGLWYGRRIGSKKMGFEERTPLMIAALFGSK  89

Query  594  DVLKLIL  614
            DVL  IL
Sbjct  90   DVLNYIL  96



>gb|KJB35241.1| hypothetical protein B456_006G106300 [Gossypium raimondii]
Length=676

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 52/78 (67%), Gaps = 0/78 (0%)
 Frame = +3

Query  381  INHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRT  560
            ++H   +    FS LLEL+A+ND+ G +  I  +   IDE   WYGR+ GS++M LE RT
Sbjct  4    VSHKVDKVPLKFSFLLELSASNDLIGFRNAIERERRDIDERSLWYGRRMGSRKMGLEQRT  63

Query  561  PLMVAATYGSIDVLKLIL  614
            PL++A+ +GS DV+K IL
Sbjct  64   PLLIASLFGSKDVVKYIL  81



>gb|EPS63683.1| hypothetical protein M569_11102 [Genlisea aurea]
Length=670

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 37/86 (43%), Positives = 52/86 (60%), Gaps = 0/86 (0%)
 Frame = +3

Query  357  NSLATIMNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSK  536
            NS +    +  L     D  +  LELAANND++  KR++ SD S+ D  G W+ R   S+
Sbjct  11   NSGSDRTAMKDLDRRVSDEAADPLELAANNDVQAFKRFVESDASAADGAGVWFVRNADSR  70

Query  537  QMVLEHRTPLMVAATYGSIDVLKLIL  614
             +  E RTPLMVAA+YGS DV+K ++
Sbjct  71   LITQESRTPLMVAASYGSTDVVKFLV  96



>ref|XP_006411267.1| hypothetical protein EUTSA_v10016372mg [Eutrema salsugineum]
 dbj|BAJ34526.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ52720.1| hypothetical protein EUTSA_v10016372mg [Eutrema salsugineum]
Length=600

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +3

Query  417  SSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAATYGSID  596
            + LLELAA +D+   +R I      IDE G WY R+ GSK+M  E RTPLMVAA YGSID
Sbjct  34   TCLLELAACDDLPSFRREIEEKSLEIDEPGFWYCRRVGSKKMGFEERTPLMVAAMYGSID  93

Query  597  VLKLIL  614
            VL  I+
Sbjct  94   VLNYII  99



>ref|XP_010517427.1| PREDICTED: zinc finger CCCH domain-containing protein 29-like 
[Camelina sativa]
 ref|XP_010517428.1| PREDICTED: zinc finger CCCH domain-containing protein 29-like 
[Camelina sativa]
Length=616

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 38/66 (58%), Positives = 45/66 (68%), Gaps = 1/66 (2%)
 Frame = +3

Query  420  SLLELAANNDIEGVKRWIGSDPS-SIDEVGQWYGRQKGSKQMVLEHRTPLMVAATYGSID  596
            SLLE AA +D+   KR I   PS  IDE G WY R+ GSK+M  E RTPLMVAA YGS++
Sbjct  36   SLLEFAACDDLSSFKREIEEKPSMEIDEAGLWYCRRVGSKKMGFEERTPLMVAAMYGSME  95

Query  597  VLKLIL  614
            VL  I+
Sbjct  96   VLSYII  101



>ref|XP_007141759.1| hypothetical protein PHAVU_008G223400g [Phaseolus vulgaris]
 gb|ESW13753.1| hypothetical protein PHAVU_008G223400g [Phaseolus vulgaris]
Length=683

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +3

Query  414  FSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAATYGSI  593
            FS+LLEL+A +D EG KR +      ++E G WYGR+ GSK+M  E RTPLM+A+ +GS 
Sbjct  31   FSALLELSACDDFEGFKREVDEKGLDVNEAGFWYGRRIGSKKMGSETRTPLMIASLFGST  90

Query  594  DVLKLIL  614
             VLK IL
Sbjct  91   RVLKYIL  97



>ref|XP_002528294.1| hypothetical protein RCOM_0838110 [Ricinus communis]
 gb|EEF34052.1| hypothetical protein RCOM_0838110 [Ricinus communis]
Length=177

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +3

Query  417  SSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAATYGSID  596
            S+LLEL+A++D  G K  +      +DE   WYGR+ GSK+M  E RTPLM+AA +GS +
Sbjct  32   SALLELSASDDFVGFKTEVEVKGLDVDEASCWYGRRIGSKKMGFEERTPLMIAAMFGSCN  91

Query  597  VLKLIL  614
            VLK I+
Sbjct  92   VLKYII  97



>gb|ADL36657.1| C3HL domain class transcription factor [Malus domestica]
Length=706

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 37/71 (52%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +3

Query  402  TEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAAT  581
            T   FS LLELAA +D+EG KR +  +   +DE   W GR  GSK++  E RTPLMVAA 
Sbjct  24   TRFNFSILLELAACDDLEGFKRAVEEEGLDVDEASYWCGRLIGSKKLGFEERTPLMVAAM  83

Query  582  YGSIDVLKLIL  614
            +GS++VL  IL
Sbjct  84   FGSMNVLNYIL  94



>gb|AES61101.2| zinc finger CCCH domain protein, putative [Medicago truncatula]
Length=653

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 36/72 (50%), Positives = 45/72 (63%), Gaps = 0/72 (0%)
 Frame = +3

Query  399  ETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAA  578
            E     S+LLE +A +D+      +  D  ++DEVG WYGR+ GSK+M  E RTPLMVAA
Sbjct  25   EHHHKISALLEFSAKDDVMAFTDAVEKDDHNVDEVGLWYGRKVGSKEMGYEERTPLMVAA  84

Query  579  TYGSIDVLKLIL  614
             YGS  VL  IL
Sbjct  85   LYGSKGVLSYIL  96



>ref|XP_006411266.1| hypothetical protein EUTSA_v10016372mg [Eutrema salsugineum]
 gb|ESQ52719.1| hypothetical protein EUTSA_v10016372mg [Eutrema salsugineum]
Length=631

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 37/66 (56%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +3

Query  417  SSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAATYGSID  596
            + LLELAA +D+   +R I      IDE G WY R+ GSK+M  E RTPLMVAA YGSID
Sbjct  65   TCLLELAACDDLPSFRREIEEKSLEIDEPGFWYCRRVGSKKMGFEERTPLMVAAMYGSID  124

Query  597  VLKLIL  614
            VL  I+
Sbjct  125  VLNYII  130



>ref|XP_003590850.1| Zinc finger CCCH domain-containing protein [Medicago truncatula]
Length=774

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 36/72 (50%), Positives = 45/72 (63%), Gaps = 0/72 (0%)
 Frame = +3

Query  399  ETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAA  578
            E     S+LLE +A +D+      +  D  ++DEVG WYGR+ GSK+M  E RTPLMVAA
Sbjct  25   EHHHKISALLEFSAKDDVMAFTDAVEKDDHNVDEVGLWYGRKVGSKEMGYEERTPLMVAA  84

Query  579  TYGSIDVLKLIL  614
             YGS  VL  IL
Sbjct  85   LYGSKGVLSYIL  96



>ref|XP_009338915.1| PREDICTED: zinc finger CCCH domain-containing protein 66-like 
[Pyrus x bretschneideri]
Length=703

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 36/71 (51%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +3

Query  402  TEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAAT  581
            T   FS LLELAA +D+EG KR +  +   +DE   W GR  GSK++  E RTPLM+AA 
Sbjct  24   TRYNFSILLELAACDDLEGFKRAVEEEGLDVDEASYWCGRLIGSKKLGFEERTPLMIAAM  83

Query  582  YGSIDVLKLIL  614
            +GS++VL  IL
Sbjct  84   FGSMNVLNYIL  94



>ref|XP_004500271.1| PREDICTED: zinc finger CCCH domain-containing protein 66-like 
[Cicer arietinum]
Length=631

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 34/66 (52%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +3

Query  417  SSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAATYGSID  596
            S+LLE +A +D+   K  +  D   +DEVG WYGR+ GSK+M  E RTPLM+AA +GS  
Sbjct  31   SALLEFSATDDLMAFKDAVEKDDHGVDEVGLWYGRKIGSKEMSYEERTPLMIAALFGSKG  90

Query  597  VLKLIL  614
            VL  IL
Sbjct  91   VLSYIL  96



>ref|XP_006425080.1| hypothetical protein CICLE_v10027883mg [Citrus clementina]
 gb|ESR38320.1| hypothetical protein CICLE_v10027883mg [Citrus clementina]
Length=741

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = +3

Query  411  TFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAATYGS  590
             FS LLEL A++D++G ++ I  D   IDE G WYGR  GS++M  E RTPLM+A+ +GS
Sbjct  65   NFSILLELTASDDLDGFRKAIEEDGHDIDESGLWYGRIIGSRKMGFEERTPLMIASMFGS  124

Query  591  IDVLKLIL  614
             DV+  ++
Sbjct  125  KDVVSYVI  132



>ref|XP_006293865.1| hypothetical protein CARUB_v10022848mg [Capsella rubella]
 gb|EOA26763.1| hypothetical protein CARUB_v10022848mg [Capsella rubella]
Length=602

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = +3

Query  399  ETEDTFSSLLELAANNDIEGVKRWIGSDPS-SIDEVGQWYGRQKGSKQMVLEHRTPLMVA  575
            E E   +SLLE AA +D+   +R I    S  IDE G WY R+ GSK+M  E RTPLMVA
Sbjct  25   EDEAAVTSLLEFAACDDLSSFRREIEEKSSVGIDETGFWYCRRVGSKKMGFEERTPLMVA  84

Query  576  ATYGSIDVLKLIL  614
            A YGS++VL  I+
Sbjct  85   AMYGSMEVLNYII  97



>gb|KDO66906.1| hypothetical protein CISIN_1g005270mg [Citrus sinensis]
 gb|KDO66907.1| hypothetical protein CISIN_1g005270mg [Citrus sinensis]
Length=705

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = +3

Query  411  TFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAATYGS  590
             FS LLEL A++D++G ++ I  D   IDE G WYGR  GS++M  E RTPLM+A+ +GS
Sbjct  29   NFSILLELTASDDLDGFRKAIEEDGHDIDESGLWYGRIIGSRKMGFEERTPLMIASMFGS  88

Query  591  IDVLKLIL  614
             DV+  ++
Sbjct  89   KDVVSYVI  96



>ref|XP_006425079.1| hypothetical protein CICLE_v10027883mg [Citrus clementina]
 gb|ESR38319.1| hypothetical protein CICLE_v10027883mg [Citrus clementina]
Length=705

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = +3

Query  411  TFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAATYGS  590
             FS LLEL A++D++G ++ I  D   IDE G WYGR  GS++M  E RTPLM+A+ +GS
Sbjct  29   NFSILLELTASDDLDGFRKAIEEDGHDIDESGLWYGRIIGSRKMGFEERTPLMIASMFGS  88

Query  591  IDVLKLIL  614
             DV+  ++
Sbjct  89   KDVVSYVI  96



>ref|XP_010650895.1| PREDICTED: zinc finger CCCH domain-containing protein 66 isoform 
X1 [Vitis vinifera]
Length=703

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = +3

Query  414  FSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAATYGSI  593
            FS LLEL+A ND+ G +  +  +   +DE   WYGR+ GSK+M  E RTPLM+AA +GS 
Sbjct  27   FSLLLELSAANDLIGFRTAVEEEGRDVDEASFWYGRRNGSKKMGFEERTPLMIAAMFGSK  86

Query  594  DVLKLIL  614
            +VL  IL
Sbjct  87   EVLNYIL  93



>gb|KJB08973.1| hypothetical protein B456_001G116400 [Gossypium raimondii]
Length=704

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +3

Query  414  FSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAATYGSI  593
            FS LLEL+A+ND+ G +R I  +   IDE   WYGR+ GSK++  E RTPL+VA+ +GS 
Sbjct  30   FSILLELSASNDLIGFRRAIEEEGYDIDESSLWYGRRMGSKKLGFEERTPLLVASMFGSK  89

Query  594  DVLKLIL  614
            DV+  I+
Sbjct  90   DVINYII  96



>ref|XP_010554668.1| PREDICTED: zinc finger CCCH domain-containing protein 29-like 
[Tarenaya hassleriana]
Length=603

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = +3

Query  399  ETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAA  578
            ET    SSLLE AA +D+   +R + S    +DE   WY R+ GSK+M  E RTPLMVAA
Sbjct  11   ETIRCSSSLLEFAACDDLAAFRREVESKGLDVDEPSFWYCRRVGSKKMGFEERTPLMVAA  70

Query  579  TYGSIDVLKLIL  614
             YGS +VLK I+
Sbjct  71   MYGSTEVLKYII  82



>ref|XP_010650896.1| PREDICTED: zinc finger CCCH domain-containing protein 66 isoform 
X2 [Vitis vinifera]
Length=691

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = +3

Query  414  FSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAATYGSI  593
            FS LLEL+A ND+ G +  +  +   +DE   WYGR+ GSK+M  E RTPLM+AA +GS 
Sbjct  15   FSLLLELSAANDLIGFRTAVEEEGRDVDEASFWYGRRNGSKKMGFEERTPLMIAAMFGSK  74

Query  594  DVLKLIL  614
            +VL  IL
Sbjct  75   EVLNYIL  81



>ref|XP_010505737.1| PREDICTED: zinc finger CCCH domain-containing protein 29-like 
[Camelina sativa]
Length=612

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 44/66 (67%), Gaps = 1/66 (2%)
 Frame = +3

Query  420  SLLELAANNDIEGVKRWIGSDPS-SIDEVGQWYGRQKGSKQMVLEHRTPLMVAATYGSID  596
            SLLE AA +D+   KR I   PS  IDE G WY R+ G K+M  E RTPLMVAA YGS++
Sbjct  39   SLLEFAACDDLSSFKREIEEKPSVEIDEAGLWYCRRVGLKKMGFEERTPLMVAAMYGSME  98

Query  597  VLKLIL  614
            VL  I+
Sbjct  99   VLSYII  104



>emb|CAN78824.1| hypothetical protein VITISV_006556 [Vitis vinifera]
Length=893

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = +3

Query  411  TFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAATYGS  590
             FS LLEL+A ND+ G +  +  +   +DE   WYGR+ GSK+M  E RTPLM+AA +GS
Sbjct  214  NFSLLLELSAANDLIGFRTAVEEEGRDVDEASFWYGRRNGSKKMGFEERTPLMIAAMFGS  273

Query  591  IDVLKLIL  614
             +VL  IL
Sbjct  274  KEVLNYIL  281



>emb|CBI15944.3| unnamed protein product [Vitis vinifera]
Length=752

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = +3

Query  414  FSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAATYGSI  593
            FS LLEL+A ND+ G +  +  +   +DE   WYGR+ GSK+M  E RTPLM+AA +GS 
Sbjct  156  FSLLLELSAANDLIGFRTAVEEEGRDVDEASFWYGRRNGSKKMGFEERTPLMIAAMFGSK  215

Query  594  DVLKLIL  614
            +VL  IL
Sbjct  216  EVLNYIL  222



>ref|XP_010516193.1| PREDICTED: zinc finger CCCH domain-containing protein 47-like 
[Camelina sativa]
Length=581

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  405  EDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAATY  584
            EDT   LLE AA++D++  KR +      +DE G WY RQ GSK+M  E RTPLMVAA Y
Sbjct  25   EDTMV-LLEFAASDDLDSFKRDVEEKGLDLDESGLWYCRQVGSKKMGFEERTPLMVAAMY  83

Query  585  GSIDVLKLIL  614
            GS+ VL  I+
Sbjct  84   GSVKVLSFIV  93



>ref|XP_010689596.1| PREDICTED: zinc finger CCCH domain-containing protein 29 [Beta 
vulgaris subsp. vulgaris]
Length=639

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 35/80 (44%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = +3

Query  375  MNINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEH  554
            M ++ +  +   + S+LLE AA++D+   K  + S   SID+VG WY R+ GS +M  E 
Sbjct  1    MGMDIIIQQQPTSTSTLLEFAASDDVNSFKLALQSSGLSIDDVGFWYTRRIGSNKMGYEQ  60

Query  555  RTPLMVAATYGSIDVLKLIL  614
            RTPLMVAA YGS+ V+  I+
Sbjct  61   RTPLMVAAQYGSVKVVDFII  80



>ref|XP_008384793.1| PREDICTED: zinc finger CCCH domain-containing protein 66-like 
[Malus domestica]
Length=706

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 37/71 (52%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +3

Query  402  TEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAAT  581
            T   FS LLELAA +D EG KR +  +   +DE   W GR  GSK++  E RTPLMVAA 
Sbjct  24   TRFNFSILLELAACDDXEGFKRAVEEEGLDVDEASYWCGRLIGSKKLGFEXRTPLMVAAM  83

Query  582  YGSIDVLKLIL  614
            +GS++VL  IL
Sbjct  84   FGSMNVLNYIL  94



>ref|XP_002961529.1| hypothetical protein SELMODRAFT_62212, partial [Selaginella moellendorffii]
 ref|XP_002971283.1| hypothetical protein SELMODRAFT_62214, partial [Selaginella moellendorffii]
 gb|EFJ27881.1| hypothetical protein SELMODRAFT_62214, partial [Selaginella moellendorffii]
 gb|EFJ36789.1| hypothetical protein SELMODRAFT_62212, partial [Selaginella moellendorffii]
Length=591

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +3

Query  423  LLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAATYGSIDVL  602
            LLELAANND+E  +R +      +DE   WY R+ GS +M  E R+PLM+AA YGSIDVL
Sbjct  1    LLELAANNDLETFRRVVEEGGMDLDEPDSWYLRKIGSTKMATEKRSPLMIAALYGSIDVL  60

Query  603  KLIL  614
              IL
Sbjct  61   SYIL  64



>ref|XP_003600919.1| Zinc finger CCCH domain-containing protein [Medicago truncatula]
 gb|AES71170.1| ARM repeat CCCH-type zinc finger protein [Medicago truncatula]
Length=517

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 49/72 (68%), Gaps = 2/72 (3%)
 Frame = +3

Query  405  EDTF--SSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAA  578
            E+ F  S+LLEL+A +DIE  KR +      ++E G WY R+ GSK+M  E RTPLM+A+
Sbjct  2    ENKFQNSTLLELSAIDDIEAFKREVEEKGYDVNEAGFWYCRKIGSKKMCYEKRTPLMIAS  61

Query  579  TYGSIDVLKLIL  614
             +GSI V+K I+
Sbjct  62   LFGSIRVVKYII  73



>ref|XP_010102344.1| Zinc finger CCCH domain-containing protein 56 [Morus notabilis]
 gb|EXB93305.1| Zinc finger CCCH domain-containing protein 56 [Morus notabilis]
Length=630

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 39/74 (53%), Positives = 53/74 (72%), Gaps = 6/74 (8%)
 Frame = +3

Query  393  TVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMV  572
            TV++  +FS LLE AANND+EG K+ + ++ + IDEVG        S+QM L+  TPLMV
Sbjct  34   TVKSGHSFSVLLEFAANNDVEGFKQSL-TNSTMIDEVGLL-----NSRQMALKRMTPLMV  87

Query  573  AATYGSIDVLKLIL  614
            AA YGS++V+KLIL
Sbjct  88   AALYGSVEVVKLIL  101



>ref|NP_567030.1| salt-inducible zinc finger 1 [Arabidopsis thaliana]
 sp|Q93ZS9.1|C3H47_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 47; 
Short=AtC3H47; AltName: Full=AtSZF1 [Arabidopsis thaliana]
 gb|AAL07131.1| unknown protein [Arabidopsis thaliana]
 gb|AAP40446.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE98950.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE79463.1| salt-inducible zinc finger 1 [Arabidopsis thaliana]
Length=580

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +3

Query  423  LLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAATYGSIDVL  602
            LLE AA +D++  KR +      +DE G WY R+ GSK+M LE RTPLMVAA YGSI VL
Sbjct  30   LLEFAACDDLDSFKREVEEKGLDLDESGLWYCRRVGSKKMGLEERTPLMVAAMYGSIKVL  89

Query  603  KLIL  614
              I+
Sbjct  90   TFIV  93



>emb|CDY54998.1| BnaCnng27960D [Brassica napus]
Length=542

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +3

Query  417  SSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAATYGSID  596
            + LLELAA + +   +R I  + S I+E G WY R+ GSK+M  + RTPLMVAA YGSID
Sbjct  32   TCLLELAACDYLPSFRREIEENSSDINESGFWYCRRVGSKKMGFQERTPLMVAAMYGSID  91

Query  597  VLKLIL  614
            VL  I+
Sbjct  92   VLTYII  97



>emb|CAB87852.1| putative protein [Arabidopsis thaliana]
Length=586

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +3

Query  423  LLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAATYGSIDVL  602
            LLE AA +D++  KR +      +DE G WY R+ GSK+M LE RTPLMVAA YGSI VL
Sbjct  36   LLEFAACDDLDSFKREVEEKGLDLDESGLWYCRRVGSKKMGLEERTPLMVAAMYGSIKVL  95

Query  603  KLIL  614
              I+
Sbjct  96   TFIV  99



>ref|XP_006488539.1| PREDICTED: zinc finger CCCH domain-containing protein 66-like 
isoform X1 [Citrus sinensis]
Length=774

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = +3

Query  411  TFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAATYGS  590
             FS LLEL A++D++G ++ I  +   IDE G WYGR  GS++M  E RTPLM+A+ +GS
Sbjct  98   NFSILLELTASDDLDGFRKAIEEEGHDIDEPGLWYGRIIGSRKMGFEERTPLMIASMFGS  157

Query  591  IDVLKLIL  614
             DV+  ++
Sbjct  158  KDVVSYVI  165



>ref|XP_006488540.1| PREDICTED: zinc finger CCCH domain-containing protein 66-like 
isoform X2 [Citrus sinensis]
Length=705

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = +3

Query  411  TFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAATYGS  590
             FS LLEL A++D++G ++ I  +   IDE G WYGR  GS++M  E RTPLM+A+ +GS
Sbjct  29   NFSILLELTASDDLDGFRKAIEEEGHDIDEPGLWYGRIIGSRKMGFEERTPLMIASMFGS  88

Query  591  IDVLKLIL  614
             DV+  ++
Sbjct  89   KDVVSYVI  96



>ref|XP_010427402.1| PREDICTED: zinc finger CCCH domain-containing protein 47-like 
[Camelina sativa]
Length=579

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 47/72 (65%), Gaps = 1/72 (1%)
 Frame = +3

Query  399  ETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAA  578
            + EDT   LLE AA++D++  KR +      +DE G WY R+ GSK+M  E RTPLMVAA
Sbjct  23   KKEDTMV-LLEFAASDDLDSFKRDVEEKELDLDESGLWYCRRVGSKKMGFEERTPLMVAA  81

Query  579  TYGSIDVLKLIL  614
             YGS+ VL  I+
Sbjct  82   MYGSVKVLSFIV  93



>ref|XP_003539330.1| PREDICTED: zinc finger CCCH domain-containing protein 66-like 
[Glycine max]
Length=605

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +3

Query  417  SSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAATYGSID  596
            S+LLE +A +D+   K  +  +   +DEVG WYGR+ GSK++  E RTPLM+AA +GS  
Sbjct  31   SALLEFSAADDVTSFKDAVEKEGHDVDEVGLWYGRRVGSKELCFEERTPLMIAAMFGSKS  90

Query  597  VLKLIL  614
            VL  IL
Sbjct  91   VLSYIL  96



>gb|KJB55721.1| hypothetical protein B456_009G091200 [Gossypium raimondii]
Length=688

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = +3

Query  399  ETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAA  578
            E    FS LLEL+A+ND+ G K  +      +DE G WYGR+ GSK+M  E RTPL++A+
Sbjct  10   EVPQKFSVLLELSASNDLIGFKISVEEGGHDMDEAGLWYGRRLGSKKMGFEERTPLLIAS  69

Query  579  TYGSIDVLKLIL  614
             +GS DV+  I+
Sbjct  70   LFGSQDVVNYIV  81



>gb|KJB55720.1| hypothetical protein B456_009G091200 [Gossypium raimondii]
Length=703

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = +3

Query  399  ETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAA  578
            E    FS LLEL+A+ND+ G K  +      +DE G WYGR+ GSK+M  E RTPL++A+
Sbjct  25   EVPQKFSVLLELSASNDLIGFKISVEEGGHDMDEAGLWYGRRLGSKKMGFEERTPLLIAS  84

Query  579  TYGSIDVLKLIL  614
             +GS DV+  I+
Sbjct  85   LFGSQDVVNYIV  96



>emb|CDY53667.1| BnaA05g34540D [Brassica napus]
Length=551

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +3

Query  417  SSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAATYGSID  596
            + LLELAA +D+   +R I  +   I+E G WY R+ GSK+M  + RTPLMVAA YGSI+
Sbjct  32   TCLLELAACDDLPSFRREIEENSLDINEPGFWYCRRVGSKKMGFQERTPLMVAAMYGSIE  91

Query  597  VLKLIL  614
            VL  I+
Sbjct  92   VLTYII  97



>ref|XP_009143241.1| PREDICTED: zinc finger CCCH domain-containing protein 29-like 
[Brassica rapa]
Length=556

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +3

Query  417  SSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAATYGSID  596
            + LLELAA +D+   +R I  +   I+E G WY R+ GSK+M  + RTPLMVAA YGSI+
Sbjct  32   TCLLELAACDDLPSFRREIEENSLDINEPGFWYCRRVGSKKMGFQERTPLMVAAMYGSIE  91

Query  597  VLKLIL  614
            VL  I+
Sbjct  92   VLTYII  97



>ref|XP_010032980.1| PREDICTED: zinc finger CCCH domain-containing protein 66 [Eucalyptus 
grandis]
 ref|XP_010032982.1| PREDICTED: zinc finger CCCH domain-containing protein 66 [Eucalyptus 
grandis]
 gb|KCW52489.1| hypothetical protein EUGRSUZ_J01888 [Eucalyptus grandis]
Length=694

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +3

Query  414  FSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAATYGSI  593
            FS LLEL+A +D+   K+ +  D   IDE   WYGR+ GSK++ LE RTPLM+AA +GS+
Sbjct  6    FSILLELSAADDLTNFKKAVEEDGYDIDESSLWYGRRIGSKKIGLEERTPLMIAAMFGSM  65

Query  594  DVLKLIL  614
             VL  I+
Sbjct  66   SVLDYII  72



>ref|XP_006350842.1| PREDICTED: zinc finger CCCH domain-containing protein 66-like 
[Solanum tuberosum]
Length=694

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +3

Query  414  FSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAATYGSI  593
            FS LLEL+A++DI   ++ +  +   I+EVG WY R+ G K+M  E RTPLMVAAT+GS 
Sbjct  41   FSLLLELSASDDIRNFQKAVEEEGHDINEVGLWYARRVGVKKMGYEERTPLMVAATFGSK  100

Query  594  DVLKLIL  614
             VL  +L
Sbjct  101  QVLNYML  107



>gb|EPS73791.1| hypothetical protein M569_00965, partial [Genlisea aurea]
Length=498

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +3

Query  423  LLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAATYGSIDVL  602
            LLELAA +D+ G +R +      ++EVG WYGR  GS +M  E RTPLM+AA YGS  VL
Sbjct  1    LLELAAVDDLAGFRREVREMGRDLNEVGLWYGRNFGSNKMGFEERTPLMMAAMYGSTSVL  60

Query  603  KLIL  614
            K I+
Sbjct  61   KYIV  64



>ref|XP_006651722.1| PREDICTED: zinc finger CCCH domain-containing protein 24-like 
[Oryza brachyantha]
Length=737

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 35/64 (55%), Positives = 47/64 (73%), Gaps = 6/64 (9%)
 Frame = +3

Query  399  ETEDTFSSLLELAANNDIEGVKRWIG-SDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVA  575
            + E+  + LLELAA++D EG++R +  + P++ DE G WYGR+K     VLEHRTPLMVA
Sbjct  35   DQEECGAGLLELAADDDAEGLRRALERAPPAAADEAGLWYGRRK-----VLEHRTPLMVA  89

Query  576  ATYG  587
            ATYG
Sbjct  90   ATYG  93



>gb|KJB35240.1| hypothetical protein B456_006G106200 [Gossypium raimondii]
Length=674

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 33/79 (42%), Positives = 49/79 (62%), Gaps = 0/79 (0%)
 Frame = +3

Query  378  NINHLTVETEDTFSSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHR  557
            N +H        FS LLEL+A+ND+ G +  I  +   IDE   WYGR+ GS++M  E R
Sbjct  3    NSSHKVDRVPQKFSYLLELSASNDLIGFRNAIEREGRDIDERSFWYGRRMGSRKMGFEER  62

Query  558  TPLMVAATYGSIDVLKLIL  614
            TP+++A+ +GS DV+  I+
Sbjct  63   TPILIASLFGSKDVVNYII  81



>gb|KGN50665.1| hypothetical protein Csa_5G207940 [Cucumis sativus]
Length=523

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +3

Query  423  LLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAATYGSIDVL  602
            LLEL+A++D+EG KR +      +DE   WYGR  GSK+M  E RTPLM+AA +GS  V+
Sbjct  35   LLELSASDDVEGFKREVEEKDLDVDEPSCWYGRGIGSKKMGFEERTPLMIAAMFGSSKVV  94

Query  603  KLIL  614
            K ++
Sbjct  95   KYLI  98



>ref|XP_006435753.1| hypothetical protein CICLE_v10030920mg [Citrus clementina]
 ref|XP_006486308.1| PREDICTED: zinc finger CCCH domain-containing protein 29-like 
[Citrus sinensis]
 gb|ESR48993.1| hypothetical protein CICLE_v10030920mg [Citrus clementina]
Length=654

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +3

Query  417  SSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAATYGSID  596
            S LLEL+A++DI   KR I      +DE   WYGR+ GSK+M  E RTP+M+AA +GS+ 
Sbjct  18   SILLELSASDDISAFKREIEEKGFDVDEPSFWYGRRIGSKKMGFEERTPIMIAAMFGSVA  77

Query  597  VLKLIL  614
            VLK ++
Sbjct  78   VLKYVI  83



>ref|XP_004148184.1| PREDICTED: zinc finger CCCH domain-containing protein 29-like 
[Cucumis sativus]
Length=683

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +3

Query  417  SSLLELAANNDIEGVKRWIGSDPSSIDEVGQWYGRQKGSKQMVLEHRTPLMVAATYGSID  596
            S LLEL+A++D+EG KR +      +DE   WYGR  GSK+M  E RTPLM+AA +GS  
Sbjct  33   SILLELSASDDVEGFKREVEEKDLDVDEPSCWYGRGIGSKKMGFEERTPLMIAAMFGSSK  92

Query  597  VLKLIL  614
            V+K ++
Sbjct  93   VVKYLI  98



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 842962938660