BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS068B03

Length=627
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010653407.1|  PREDICTED: importin subunit beta-1                 226   3e-65   Vitis vinifera
gb|KJB77043.1|  hypothetical protein B456_012G117900                    223   4e-64   Gossypium raimondii
emb|CDP06446.1|  unnamed protein product                                225   4e-64   Coffea canephora [robusta coffee]
gb|KJB77042.1|  hypothetical protein B456_012G117900                    223   6e-64   Gossypium raimondii
ref|XP_011095057.1|  PREDICTED: importin subunit beta-1-like            222   1e-63   Sesamum indicum [beniseed]
ref|XP_007026608.1|  Importin beta-1, putative isoform 1                221   3e-63   Theobroma cacao [chocolate]
ref|XP_011095056.1|  PREDICTED: importin subunit beta-1-like            217   8e-62   
gb|EYU41939.1|  hypothetical protein MIMGU_mgv1a001166mg                214   5e-61   Erythranthe guttata [common monkey flower]
gb|KDP22848.1|  hypothetical protein JCGZ_00435                         211   1e-59   Jatropha curcas
ref|NP_001154598.1|  armadillo/beta-catenin-like repeat-containin...    209   3e-59   
ref|XP_002309153.2|  hypothetical protein POPTR_0006s10420g             209   4e-59   Populus trichocarpa [western balsam poplar]
ref|XP_009629467.1|  PREDICTED: importin subunit beta-1-like            208   8e-59   Nicotiana tomentosiformis
gb|AID68439.1|  putative importin subunit beta-1                        199   9e-59   Hypericum perforatum
ref|XP_010466909.1|  PREDICTED: importin subunit beta-1-like            208   1e-58   Camelina sativa [gold-of-pleasure]
ref|XP_006359549.1|  PREDICTED: importin subunit beta-1-like            208   1e-58   Solanum tuberosum [potatoes]
ref|XP_004246782.1|  PREDICTED: importin subunit beta-1-like            207   2e-58   Solanum lycopersicum
ref|XP_002526656.1|  importin beta-1, putative                          207   2e-58   Ricinus communis
ref|XP_011019075.1|  PREDICTED: importin subunit beta-1-like            206   3e-58   Populus euphratica
ref|XP_006407728.1|  hypothetical protein EUTSA_v10020036mg             206   6e-58   
ref|XP_010464516.1|  PREDICTED: importin subunit beta-1-like            206   8e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010464517.1|  PREDICTED: importin subunit beta-1-like            205   9e-58   Camelina sativa [gold-of-pleasure]
emb|CDY53085.1|  BnaCnng24150D                                          205   9e-58   Brassica napus [oilseed rape]
ref|XP_010676800.1|  PREDICTED: importin subunit beta-1-like            205   9e-58   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY44668.1|  BnaA05g29380D                                          205   9e-58   Brassica napus [oilseed rape]
ref|XP_009146969.1|  PREDICTED: importin subunit beta-1                 205   9e-58   Brassica rapa
ref|XP_010486445.1|  PREDICTED: importin subunit beta-1-like            205   1e-57   Camelina sativa [gold-of-pleasure]
ref|XP_008370170.1|  PREDICTED: importin subunit beta-1-like            204   2e-57   
ref|XP_010486444.1|  PREDICTED: importin subunit beta-1-like            204   3e-57   Camelina sativa [gold-of-pleasure]
ref|XP_007208359.1|  hypothetical protein PRUPE_ppa001244mg             204   4e-57   Prunus persica
ref|XP_009593599.1|  PREDICTED: importin subunit beta-1-like            204   4e-57   Nicotiana tomentosiformis
ref|XP_006296779.1|  hypothetical protein CARUB_v100158150mg            203   4e-57   
ref|XP_009786524.1|  PREDICTED: importin subunit beta-1-like            203   5e-57   Nicotiana sylvestris
ref|XP_009376413.1|  PREDICTED: importin subunit beta-1-like            202   1e-56   Pyrus x bretschneideri [bai li]
ref|XP_010553116.1|  PREDICTED: importin subunit beta-1-like            201   2e-56   Tarenaya hassleriana [spider flower]
ref|XP_006299756.1|  hypothetical protein CARUB_v10015951mg             201   3e-56   Capsella rubella
ref|XP_008243147.1|  PREDICTED: importin subunit beta-1-like            201   3e-56   Prunus mume [ume]
ref|XP_009337741.1|  PREDICTED: importin subunit beta-1-like            200   5e-56   Pyrus x bretschneideri [bai li]
ref|XP_010036160.1|  PREDICTED: importin subunit beta-1-like            200   5e-56   Eucalyptus grandis [rose gum]
ref|XP_004302533.1|  PREDICTED: importin subunit beta-1-like            199   2e-55   Fragaria vesca subsp. vesca
ref|XP_010093556.1|  Importin subunit beta-1                            198   3e-55   Morus notabilis
ref|XP_011466450.1|  PREDICTED: importin subunit beta-1-like isof...    197   4e-55   Fragaria vesca subsp. vesca
ref|XP_009784457.1|  PREDICTED: importin subunit beta-1-like            198   4e-55   Nicotiana sylvestris
ref|XP_006429464.1|  hypothetical protein CICLE_v10011045mg             197   5e-55   Citrus clementina [clementine]
gb|KDO56744.1|  hypothetical protein CISIN_1g002877mg                   197   5e-55   Citrus sinensis [apfelsine]
ref|XP_004305111.1|  PREDICTED: importin subunit beta-1-like isof...    197   7e-55   Fragaria vesca subsp. vesca
gb|ACN40198.1|  unknown                                                 193   3e-53   Picea sitchensis
ref|XP_011046826.1|  PREDICTED: importin subunit beta-1-like isof...    192   5e-53   Populus euphratica
ref|XP_011046827.1|  PREDICTED: importin subunit beta-1-like isof...    192   5e-53   Populus euphratica
ref|XP_002323606.2|  hypothetical protein POPTR_0016s13160g             192   5e-53   Populus trichocarpa [western balsam poplar]
ref|NP_001154597.1|  armadillo/beta-catenin-like repeat-containin...    189   9e-52   
ref|XP_010920995.1|  PREDICTED: importin subunit beta-1-like            188   1e-51   Elaeis guineensis
ref|XP_002440917.1|  hypothetical protein SORBIDRAFT_09g016470          187   3e-51   Sorghum bicolor [broomcorn]
ref|XP_004962394.1|  PREDICTED: importin subunit beta-1-like isof...    186   5e-51   Setaria italica
ref|XP_008649562.1|  PREDICTED: importin subunit beta-1-like            183   9e-50   Zea mays [maize]
ref|XP_010937915.1|  PREDICTED: importin subunit beta-1-like            183   1e-49   Elaeis guineensis
ref|XP_006654281.1|  PREDICTED: importin subunit beta-1-like            182   1e-49   Oryza brachyantha
ref|XP_008656358.1|  PREDICTED: importin subunit beta-1-like            182   3e-49   Zea mays [maize]
ref|XP_009402393.1|  PREDICTED: importin subunit beta-1-like            181   3e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004976214.1|  PREDICTED: importin subunit beta-1-like            180   1e-48   Setaria italica
gb|EAY97668.1|  hypothetical protein OsI_19590                          180   1e-48   Oryza sativa Indica Group [Indian rice]
ref|NP_001055282.1|  Os05g0353400                                       180   1e-48   
gb|EMS63085.1|  Importin subunit beta-1                                 180   1e-48   Triticum urartu
ref|XP_010924894.1|  PREDICTED: importin subunit beta-1                 179   2e-48   Elaeis guineensis
gb|EYU25250.1|  hypothetical protein MIMGU_mgv1a026101mg                179   2e-48   Erythranthe guttata [common monkey flower]
ref|XP_006829997.1|  hypothetical protein AMTR_s00252p00011130          179   3e-48   Amborella trichopoda
gb|EMT17557.1|  Importin subunit beta-1                                 179   3e-48   
dbj|BAJ93876.1|  predicted protein                                      178   4e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EPS61387.1|  hypothetical protein M569_13410                         178   4e-48   Genlisea aurea
ref|XP_010912456.1|  PREDICTED: importin subunit beta-1-like            179   4e-48   Elaeis guineensis
dbj|BAJ93177.1|  predicted protein                                      179   4e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS49240.1|  Importin subunit beta-1                                 178   6e-48   Triticum urartu
gb|EMT02152.1|  Importin subunit beta-1                                 177   7e-48   
emb|CBI23029.3|  unnamed protein product                                178   8e-48   Vitis vinifera
ref|XP_008806225.1|  PREDICTED: importin subunit beta-1-like isof...    177   1e-47   
ref|XP_008777010.1|  PREDICTED: importin subunit beta-1-like            177   1e-47   Phoenix dactylifera
ref|XP_002515853.1|  importin beta-1, putative                          177   1e-47   
ref|XP_006491990.1|  PREDICTED: importin subunit beta-1-like            177   2e-47   Citrus sinensis [apfelsine]
gb|KDO59622.1|  hypothetical protein CISIN_1g039062mg                   177   2e-47   Citrus sinensis [apfelsine]
ref|XP_002276600.1|  PREDICTED: importin subunit beta-1                 177   2e-47   Vitis vinifera
ref|XP_006441143.1|  hypothetical protein CICLE_v10023883mg             177   2e-47   Citrus clementina [clementine]
emb|CDP05037.1|  unnamed protein product                                177   2e-47   Coffea canephora [robusta coffee]
ref|XP_010267533.1|  PREDICTED: importin subunit beta-1-like            177   2e-47   Nelumbo nucifera [Indian lotus]
ref|XP_006360205.1|  PREDICTED: importin subunit beta-1-like            177   2e-47   
ref|XP_009791536.1|  PREDICTED: importin subunit beta-1-like            177   2e-47   Nicotiana sylvestris
ref|XP_004962709.1|  PREDICTED: importin subunit beta-1-like            176   2e-47   Setaria italica
ref|XP_008645457.1|  PREDICTED: uncharacterized protein LOC100383...    176   2e-47   
ref|XP_002986725.1|  hypothetical protein SELMODRAFT_124593             176   3e-47   Selaginella moellendorffii
gb|EYU19659.1|  hypothetical protein MIMGU_mgv1a001181mg                176   3e-47   Erythranthe guttata [common monkey flower]
gb|KDP42918.1|  hypothetical protein JCGZ_23860                         176   3e-47   Jatropha curcas
ref|XP_006350520.1|  PREDICTED: importin subunit beta-1-like            176   5e-47   Solanum tuberosum [potatoes]
ref|XP_004234984.1|  PREDICTED: importin subunit beta-1                 176   5e-47   Solanum lycopersicum
gb|EMT08648.1|  Importin subunit beta-1                                 175   6e-47   
ref|XP_002526256.1|  importin beta-1, putative                          175   8e-47   Ricinus communis
emb|CAC79691.1|  Importin beta-like protein                             175   9e-47   Oryza sativa Indica Group [Indian rice]
ref|XP_001782481.1|  predicted protein                                  175   9e-47   
ref|XP_011075956.1|  PREDICTED: importin subunit beta-1-like            174   1e-46   Sesamum indicum [beniseed]
ref|XP_010053097.1|  PREDICTED: importin subunit beta-1                 174   1e-46   Eucalyptus grandis [rose gum]
ref|XP_001776522.1|  predicted protein                                  174   1e-46   
ref|XP_002442347.1|  hypothetical protein SORBIDRAFT_08g018670          174   1e-46   Sorghum bicolor [broomcorn]
gb|EMS47373.1|  Importin subunit beta-1                                 174   1e-46   Triticum urartu
ref|XP_011044673.1|  PREDICTED: importin subunit beta-1-like            174   1e-46   Populus euphratica
gb|KGN49851.1|  hypothetical protein Csa_5G139290                       174   1e-46   Cucumis sativus [cucumbers]
gb|KGN49853.1|  hypothetical protein Csa_5G139310                       174   2e-46   Cucumis sativus [cucumbers]
ref|XP_004145935.1|  PREDICTED: importin subunit beta-1-like            174   2e-46   
tpg|DAA55196.1|  TPA: hypothetical protein ZEAMMB73_213306              174   2e-46   
ref|XP_009631702.1|  PREDICTED: importin subunit beta-1-like            174   2e-46   
ref|XP_010266571.1|  PREDICTED: importin subunit beta-1-like            174   2e-46   Nelumbo nucifera [Indian lotus]
ref|XP_008806235.1|  PREDICTED: importin subunit beta-1-like isof...    174   3e-46   Phoenix dactylifera
ref|XP_009420728.1|  PREDICTED: importin subunit beta-1-like            173   3e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008673110.1|  PREDICTED: uncharacterized protein LOC100381...    174   3e-46   
gb|KDO76624.1|  hypothetical protein CISIN_1g002876mg                   172   3e-46   Citrus sinensis [apfelsine]
ref|XP_003525330.1|  PREDICTED: importin subunit beta-1-like            173   4e-46   Glycine max [soybeans]
gb|EMT25491.1|  Importin subunit beta-1                                 173   4e-46   
gb|KDO76623.1|  hypothetical protein CISIN_1g002876mg                   171   4e-46   Citrus sinensis [apfelsine]
ref|XP_009784181.1|  PREDICTED: importin subunit beta-1-like            173   5e-46   Nicotiana sylvestris
ref|XP_011024861.1|  PREDICTED: importin subunit beta-1-like            172   7e-46   Populus euphratica
ref|XP_002318437.1|  importin beta-2 family protein                     172   7e-46   Populus trichocarpa [western balsam poplar]
ref|XP_010266593.1|  PREDICTED: importin subunit beta-1-like            172   8e-46   Nelumbo nucifera [Indian lotus]
emb|CDP05039.1|  unnamed protein product                                172   8e-46   Coffea canephora [robusta coffee]
ref|XP_009588558.1|  PREDICTED: importin subunit beta-1-like            172   8e-46   Nicotiana tomentosiformis
ref|XP_002321393.2|  hypothetical protein POPTR_0015s01270g             172   9e-46   
ref|XP_010537073.1|  PREDICTED: importin subunit beta-1                 172   1e-45   Tarenaya hassleriana [spider flower]
ref|XP_009626307.1|  PREDICTED: importin subunit beta-1-like            172   1e-45   Nicotiana tomentosiformis
ref|XP_006439284.1|  hypothetical protein CICLE_v10018814mg             172   1e-45   Citrus clementina [clementine]
ref|XP_011084526.1|  PREDICTED: importin subunit beta-1 isoform X2      170   1e-45   Sesamum indicum [beniseed]
gb|EAY83565.1|  hypothetical protein OsI_38775                          171   1e-45   Oryza sativa Indica Group [Indian rice]
ref|XP_007039099.1|  ARM repeat superfamily protein                     172   1e-45   
ref|XP_004307960.1|  PREDICTED: importin subunit beta-1                 171   1e-45   Fragaria vesca subsp. vesca
ref|XP_010671409.1|  PREDICTED: importin subunit beta-1                 171   2e-45   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006584778.1|  PREDICTED: importin subunit beta-1-like            171   2e-45   Glycine max [soybeans]
ref|XP_010445840.1|  PREDICTED: importin subunit beta-1-like isof...    171   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010442912.1|  PREDICTED: importin subunit beta-1-like            171   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_008804983.1|  PREDICTED: importin subunit beta-1-like            171   2e-45   Phoenix dactylifera
ref|XP_010322221.1|  PREDICTED: importin subunit beta-1-like            171   3e-45   
ref|XP_006279475.1|  hypothetical protein CARUB_v10025866mg             170   3e-45   Capsella rubella
ref|XP_007160199.1|  hypothetical protein PHAVU_002G301300g             170   4e-45   Phaseolus vulgaris [French bean]
ref|XP_003563593.1|  PREDICTED: importin subunit beta-1                 170   4e-45   
ref|XP_009412624.1|  PREDICTED: importin subunit beta-1-like            170   4e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006401700.1|  hypothetical protein EUTSA_v10012652mg             170   4e-45   Eutrema salsugineum [saltwater cress]
dbj|BAJ94620.1|  predicted protein                                      170   5e-45   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011084524.1|  PREDICTED: importin subunit beta-1 isoform X1      170   5e-45   Sesamum indicum [beniseed]
gb|KJB52558.1|  hypothetical protein B456_008G267400                    170   6e-45   Gossypium raimondii
dbj|BAC41893.1|  putative importin beta                                 169   7e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004503585.1|  PREDICTED: importin subunit beta-1-like isof...    169   8e-45   Cicer arietinum [garbanzo]
ref|XP_003526727.1|  PREDICTED: importin subunit beta-1-like            169   8e-45   Glycine max [soybeans]
ref|XP_010922595.1|  PREDICTED: importin subunit beta-1-like            169   9e-45   Elaeis guineensis
ref|NP_200160.1|  armadillo/beta-catenin-like repeat-containing p...    169   9e-45   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001067068.1|  Os12g0568800                                       169   1e-44   
ref|XP_010482746.1|  PREDICTED: importin subunit beta-1-like            169   1e-44   Camelina sativa [gold-of-pleasure]
ref|XP_002864245.1|  hypothetical protein ARALYDRAFT_495420             169   1e-44   
ref|XP_006664116.1|  PREDICTED: importin subunit beta-1-like            169   1e-44   Oryza brachyantha
ref|XP_004300492.1|  PREDICTED: importin subunit beta-1-like            169   1e-44   Fragaria vesca subsp. vesca
gb|KEH21273.1|  importin subunit beta-like protein                      168   2e-44   Medicago truncatula
ref|XP_007220596.1|  hypothetical protein PRUPE_ppa001259mg             168   2e-44   Prunus persica
gb|KJB52557.1|  hypothetical protein B456_008G267300                    168   2e-44   Gossypium raimondii
gb|KHN19512.1|  Importin subunit beta-1                                 167   3e-44   Glycine soja [wild soybean]
ref|XP_007210373.1|  hypothetical protein PRUPE_ppa001250mg             167   4e-44   Prunus persica
gb|KHG02931.1|  Importin subunit beta-1                                 169   4e-44   Gossypium arboreum [tree cotton]
ref|XP_007136500.1|  hypothetical protein PHAVU_009G050600g             167   5e-44   Phaseolus vulgaris [French bean]
ref|XP_008239170.1|  PREDICTED: importin subunit beta-1-like            167   7e-44   Prunus mume [ume]
ref|XP_010107260.1|  Importin subunit beta-1                            167   8e-44   Morus notabilis
ref|XP_009393073.1|  PREDICTED: importin subunit beta-1                 166   2e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009419673.1|  PREDICTED: importin subunit beta-1-like            166   2e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009348518.1|  PREDICTED: importin subunit beta-1-like            166   2e-43   Pyrus x bretschneideri [bai li]
ref|XP_007039098.1|  ARM repeat superfamily protein                     166   2e-43   
ref|XP_008390322.1|  PREDICTED: importin subunit beta-1-like            166   2e-43   
ref|XP_009344039.1|  PREDICTED: importin subunit beta-1-like isof...    166   2e-43   Pyrus x bretschneideri [bai li]
ref|XP_009344041.1|  PREDICTED: importin subunit beta-1-like isof...    166   2e-43   Pyrus x bretschneideri [bai li]
ref|XP_008361287.1|  PREDICTED: importin subunit beta-1-like            166   2e-43   
ref|XP_010107256.1|  Importin subunit beta-1                            166   2e-43   Morus notabilis
ref|XP_006649919.1|  PREDICTED: importin subunit beta-1-like            166   2e-43   Oryza brachyantha
ref|XP_008376765.1|  PREDICTED: importin subunit beta-1-like            165   3e-43   Malus domestica [apple tree]
ref|XP_008234705.1|  PREDICTED: importin subunit beta-1                 165   3e-43   Prunus mume [ume]
ref|XP_009358649.1|  PREDICTED: importin subunit beta-1-like            165   4e-43   Pyrus x bretschneideri [bai li]
gb|KJB37368.1|  hypothetical protein B456_006G202100                    164   5e-43   Gossypium raimondii
gb|EAY89607.1|  hypothetical protein OsI_11135                          164   6e-43   Oryza sativa Indica Group [Indian rice]
emb|CDY35657.1|  BnaC09g29790D                                          162   3e-42   Brassica napus [oilseed rape]
ref|XP_004502681.1|  PREDICTED: importin subunit beta-1-like            162   3e-42   Cicer arietinum [garbanzo]
ref|XP_009119891.1|  PREDICTED: importin subunit beta-1                 162   3e-42   
emb|CDY14379.1|  BnaA10g06760D                                          162   3e-42   Brassica napus [oilseed rape]
gb|EAZ26573.1|  hypothetical protein OsJ_10469                          162   3e-42   Oryza sativa Japonica Group [Japonica rice]
gb|ABF95425.1|  Importin-beta N-terminal domain containing protei...    162   3e-42   Oryza sativa Japonica Group [Japonica rice]
gb|KEH35467.1|  importin beta-like protein                              161   5e-42   Medicago truncatula
gb|KHG17091.1|  Importin subunit beta-1                                 160   1e-41   Gossypium arboreum [tree cotton]
gb|KEH35465.1|  importin beta-like protein                              160   2e-41   Medicago truncatula
ref|XP_006844933.1|  hypothetical protein AMTR_s00058p00157820          159   6e-41   Amborella trichopoda
ref|XP_006844984.1|  hypothetical protein AMTR_s00058p00188470          157   1e-40   Amborella trichopoda
gb|KJB37366.1|  hypothetical protein B456_006G202000                    157   2e-40   Gossypium raimondii
gb|KJB37365.1|  hypothetical protein B456_006G202000                    157   3e-40   Gossypium raimondii
ref|XP_002990712.1|  hypothetical protein SELMODRAFT_185511             154   1e-39   
gb|EMT26929.1|  Importin subunit beta-1                                 155   1e-39   
ref|XP_002986718.1|  hypothetical protein SELMODRAFT_158150             154   2e-39   Selaginella moellendorffii
gb|EMS59943.1|  Importin subunit beta-1                                 154   2e-39   Triticum urartu
ref|XP_003575505.1|  PREDICTED: importin subunit beta-1-like            153   6e-39   Brachypodium distachyon [annual false brome]
gb|EYU31538.1|  hypothetical protein MIMGU_mgv11b018147mg               150   7e-39   Erythranthe guttata [common monkey flower]
gb|KHG13012.1|  Importin subunit beta-1                                 153   7e-39   Gossypium arboreum [tree cotton]
ref|XP_009351972.1|  PREDICTED: importin subunit beta-1                 149   1e-37   Pyrus x bretschneideri [bai li]
ref|XP_008381127.1|  PREDICTED: importin subunit beta-1-like            149   1e-37   
gb|KFK44047.1|  hypothetical protein AALP_AA1G208500                    140   2e-37   Arabis alpina [alpine rockcress]
ref|XP_003558144.1|  PREDICTED: importin subunit beta-1-like            149   2e-37   Brachypodium distachyon [annual false brome]
gb|EPS68839.1|  hypothetical protein M569_05926                         146   2e-36   Genlisea aurea
ref|XP_005847395.1|  hypothetical protein CHLNCDRAFT_134241             144   1e-35   Chlorella variabilis
ref|XP_011400526.1|  Importin subunit beta-1                            135   1e-32   Auxenochlorella protothecoides
ref|XP_004338068.1|  importin beta subunit                              134   3e-32   Acanthamoeba castellanii str. Neff
ref|XP_004160407.1|  PREDICTED: importin subunit beta-1-like            129   6e-31   
ref|XP_005651827.1|  ARM repeat-containing protein                      127   5e-30   Coccomyxa subellipsoidea C-169
gb|EMT07421.1|  Importin subunit beta-1                                 126   9e-30   
ref|XP_003061208.1|  predicted protein                                  126   2e-29   Micromonas pusilla CCMP1545
gb|KIZ03724.1|  Importin subunit beta-1                                 122   4e-29   Monoraphidium neglectum
gb|KIY99918.1|  Importin subunit beta-1                                 118   1e-27   Monoraphidium neglectum
ref|XP_007508162.1|  predicted protein                                  119   4e-27   Bathycoccus prasinos
ref|XP_002503190.1|  predicted protein                                  118   1e-26   Micromonas commoda
ref|XP_005704716.1|  protein transporter                                114   3e-25   Galdieria sulphuraria
ref|XP_009041159.1|  hypothetical protein AURANDRAFT_39138              112   8e-25   Aureococcus anophagefferens
gb|EMT22895.1|  Importin subunit beta                                   110   4e-24   
ref|XP_003295001.1|  hypothetical protein DICPUDRAFT_51827              108   3e-23   Dictyostelium purpureum
ref|XP_001690080.1|  importin beta                                      107   4e-23   Chlamydomonas reinhardtii
gb|ETO78507.1|  hypothetical protein F444_06554                         105   2e-22   Phytophthora parasitica P1976
ref|XP_008892019.1|  hypothetical protein PPTG_02597                    105   2e-22   Phytophthora parasitica INRA-310
gb|EMT08493.1|  Importin subunit beta-1                                 105   2e-22   
ref|XP_002999081.1|  importin subunit beta, putative                    105   3e-22   Phytophthora infestans T30-4
gb|EMS53622.1|  Importin subunit beta-1                                 105   4e-22   Triticum urartu
gb|EYU31542.1|  hypothetical protein MIMGU_mgv1a024097mg                102   7e-22   Erythranthe guttata [common monkey flower]
ref|XP_002953919.1|  hypothetical protein VOLCADRAFT_82561              103   1e-21   Volvox carteri f. nagariensis
ref|XP_007777620.1|  hypothetical protein W97_01524                     103   1e-21   Coniosporium apollinis CBS 100218
ref|XP_005766397.1|  hypothetical protein EMIHUDRAFT_419647             102   3e-21   Emiliania huxleyi CCMP1516
ref|XP_009519098.1|  hypothetical protein PHYSODRAFT_344537             102   3e-21   Phytophthora sojae
ref|XP_007294355.1|  importin beta-1 subunit                            101   7e-21   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
ref|XP_007602438.1|  hypothetical protein CFIO01_10550                  101   8e-21   
gb|EMT32350.1|  Importin subunit beta-1                                 100   2e-20   
dbj|GAM23184.1|  hypothetical protein SAMD00019534_063590             99.8    2e-20   Acytostelium subglobosum LB1
gb|EMT00038.1|  Importin subunit beta-1                               99.4    3e-20   
ref|XP_003716218.1|  importin subunit beta-1                          99.4    4e-20   Magnaporthe oryzae 70-15
gb|ELQ38309.1|  importin subunit beta-1                               99.0    4e-20   Magnaporthe oryzae Y34
ref|XP_009041959.1|  hypothetical protein AURANDRAFT_55562            99.0    4e-20   Aureococcus anophagefferens
ref|XP_007829703.1|  hypothetical protein PFICI_02931                 98.6    6e-20   Pestalotiopsis fici W106-1
ref|XP_008860949.1|  hypothetical protein H310_00093                  98.6    7e-20   Aphanomyces invadans
emb|CEJ02610.1|  hypothetical protein RMCBS344292_16610               92.8    8e-20   Rhizopus microsporus
ref|XP_002289979.1|  importin beta-1 subunit-like protein             97.8    1e-19   Thalassiosira pseudonana CCMP1335
ref|XP_009830123.1|  hypothetical protein H257_06557                  97.4    2e-19   Aphanomyces astaci
ref|XP_008027842.1|  hypothetical protein SETTUDRAFT_155007           96.3    3e-19   Exserohilum turcica Et28A
gb|EHK18867.1|  hypothetical protein TRIVIDRAFT_76275                 96.3    3e-19   Trichoderma virens Gv29-8
emb|CCD50099.1|  similar to importin subunit beta-1                   96.3    4e-19   Botrytis cinerea T4
ref|XP_001553289.1|  hypothetical protein BC1G_07702                  96.3    4e-19   Botrytis cinerea B05.10
gb|EME47146.1|  hypothetical protein DOTSEDRAFT_41624                 96.3    4e-19   Dothistroma septosporum NZE10
ref|XP_006961870.1|  predicted protein                                95.9    4e-19   Trichoderma reesei QM6a
gb|EMD94663.1|  hypothetical protein COCHEDRAFT_1210699               95.9    5e-19   Bipolaris maydis C5
ref|XP_007705662.1|  hypothetical protein COCSADRAFT_263844           95.9    5e-19   Bipolaris sorokiniana ND90Pr
ref|XP_007717170.1|  hypothetical protein COCCADRAFT_9118             95.9    5e-19   Bipolaris zeicola 26-R-13
ref|XP_004351151.1|  karyopherin beta 1 isoform 4                     95.9    5e-19   Cavenderia fasciculata
ref|XP_007690806.1|  hypothetical protein COCMIDRAFT_39293            95.9    5e-19   Bipolaris oryzae ATCC 44560
ref|XP_001940686.1|  importin subunit beta-1                          95.9    6e-19   Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_003842961.1|  similar to importin subunit beta-1               95.5    6e-19   Leptosphaeria maculans JN3
emb|CEP18224.1|  hypothetical protein                                 95.9    6e-19   Parasitella parasitica
ref|XP_003299231.1|  hypothetical protein PTT_10181                   95.5    6e-19   
gb|EHK45761.1|  hypothetical protein TRIATDRAFT_152543                95.5    7e-19   Trichoderma atroviride IMI 206040
gb|EJT49925.1|  hypothetical protein A1Q1_00938                       95.1    8e-19   Trichosporon asahii var. asahii CBS 2479
ref|XP_007680494.1|  hypothetical protein BAUCODRAFT_78155            95.1    9e-19   Baudoinia panamericana UAMH 10762
ref|XP_007773116.1|  karyopherin Kap95                                94.4    2e-18   Coniophora puteana RWD-64-598 SS2
ref|XP_002773454.1|  importin/karyopherin, putative                   94.4    2e-18   Perkinsus marinus ATCC 50983
ref|XP_002778966.1|  importin/karyopherin, putative                   94.4    2e-18   Perkinsus marinus ATCC 50983
gb|KFA64820.1|  hypothetical protein S40285_01384                     94.0    2e-18   Stachybotrys chlorohalonata IBT 40285
gb|KEY65732.1|  hypothetical protein S7711_05562                      94.0    2e-18   Stachybotrys chartarum IBT 7711
ref|XP_001584921.1|  hypothetical protein SS1G_14204                  94.0    2e-18   Sclerotinia sclerotiorum 1980 UF-70
gb|AAI07502.1|  Karyopherin (importin) beta 1                         89.4    3e-18   Danio rerio [leopard danio]
gb|EGU82283.1|  hypothetical protein FOXB_07112                       92.8    4e-18   Fusarium oxysporum Fo5176
gb|EIE91604.1|  hypothetical protein RO3G_16315                       93.2    4e-18   Rhizopus delemar RA 99-880
gb|EFQ32711.1|  hypothetical protein GLRG_07855                       92.8    5e-18   Colletotrichum graminicola M1.001
emb|CCT64454.1|  probable KAP95 protein                               92.8    5e-18   Fusarium fujikuroi IMI 58289
gb|EWG42059.1|  hypothetical protein FVEG_04005                       92.8    6e-18   Fusarium verticillioides 7600
gb|KEQ60136.1|  ARM repeat-containing protein                         92.8    6e-18   Aureobasidium melanogenum CBS 110374
gb|EXA47181.1|  hypothetical protein FOVG_04390                       92.8    6e-18   Fusarium oxysporum f. sp. pisi HDV247
gb|ENH73993.1|  Importin subunit beta-1                               92.8    6e-18   Fusarium oxysporum f. sp. cubense race 1
gb|EWM27265.1|  importin subunit beta-1                               92.4    7e-18   Nannochloropsis gaditana
emb|CEI92448.1|  hypothetical protein RMCBS344292_06706               92.4    7e-18   Rhizopus microsporus
emb|CEG63931.1|  hypothetical protein RMATCC62417_00997               92.4    8e-18   Rhizopus microsporus
gb|ESZ91611.1|  ARM repeat-containing protein                         92.4    8e-18   Sclerotinia borealis F-4128
ref|XP_003855290.1|  hypothetical protein MYCGRDRAFT_69066            92.0    9e-18   Zymoseptoria tritici IPO323
gb|KEZ39364.1|  hypothetical protein SAPIO_CDS10062                   91.7    1e-17   Scedosporium apiospermum
emb|CCA25069.1|  conserved unknown protein putative                   91.7    1e-17   
gb|KEQ98622.1|  hypothetical protein AUEXF2481DRAFT_2545              91.7    1e-17   
gb|KDN67135.1|  hypothetical protein CSUB01_04056                     91.7    1e-17   
ref|XP_003046744.1|  predicted protein                                91.3    2e-17   
emb|CBN74229.1|  conserved unknown protein                            90.9    2e-17   
ref|XP_006680271.1|  hypothetical protein BATDEDRAFT_17183            90.9    2e-17   
gb|KIL93216.1|  hypothetical protein FAVG1_03193                      90.9    2e-17   
ref|XP_002478319.1|  importin beta-1 subunit                          90.5    3e-17   
gb|KEQ86930.1|  ARM repeat-containing protein                         90.5    3e-17   
gb|EQB52485.1|  hypothetical protein CGLO_07891                       90.5    3e-17   
ref|XP_011328273.1|  hypothetical protein FGSG_09454                  90.5    3e-17   
ref|XP_006455581.1|  hypothetical protein AGABI2DRAFT_227003          90.5    3e-17   
emb|CEG03447.1|  unnamed protein product                              90.5    3e-17   
ref|XP_009252780.1|  hypothetical protein FPSE_01385                  90.5    3e-17   
gb|KEF56546.1|  hypothetical protein A1O9_06734                       90.5    4e-17   
ref|XP_007332703.1|  hypothetical protein AGABI1DRAFT_62890           90.5    4e-17   
ref|XP_007916210.1|  putative importin subunit beta-1 protein         90.1    4e-17   
ref|XP_010698249.1|  importin beta-1 subunit, putative                90.1    4e-17   
gb|KEQ74479.1|  ARM repeat-containing protein                         90.1    4e-17   
gb|KIW54933.1|  hypothetical protein PV05_07255                       90.1    5e-17   
gb|KDD73549.1|  hypothetical protein H632_c2062p0                     84.0    5e-17   
ref|XP_002416882.1|  importin beta-1 subunit, putative; karyopher...  89.7    6e-17   
emb|CCE30847.1|  probable KAP95 protein                               89.7    6e-17   
ref|XP_009548438.1|  hypothetical protein HETIRDRAFT_459766           89.4    8e-17   
ref|XP_005533856.1|  PREDICTED: importin subunit beta-1               89.4    9e-17   
ref|NP_001032791.3|  importin subunit beta-1                          89.0    1e-16   
ref|XP_004556581.1|  PREDICTED: importin subunit beta-1-like isof...  89.0    1e-16   
ref|XP_005753068.1|  PREDICTED: importin subunit beta-1-like          89.0    1e-16   
ref|XP_004556580.1|  PREDICTED: importin subunit beta-1-like isof...  89.0    1e-16   
gb|KDN50524.1|  hypothetical protein RSAG8_01022                      85.9    1e-16   
gb|KIV97066.1|  hypothetical protein PV10_00863                       88.6    2e-16   
ref|XP_003976463.1|  PREDICTED: importin subunit beta-1-like          88.6    2e-16   
gb|KIV97067.1|  hypothetical protein, variant                         88.2    2e-16   
gb|KGG52376.1|  karyopherin Kap95                                     88.2    2e-16   
ref|XP_007923649.1|  hypothetical protein MYCFIDRAFT_89098            88.2    2e-16   
gb|EYE98937.1|  importin beta-1 subunit                               88.2    2e-16   
emb|CAF95619.1|  unnamed protein product                              88.2    2e-16   
dbj|GAM42727.1|  karyopherin                                          88.2    2e-16   
emb|CDQ65593.1|  unnamed protein product                              88.2    2e-16   
emb|CDQ78061.1|  unnamed protein product                              88.2    2e-16   
ref|XP_004085491.1|  PREDICTED: importin subunit beta-1               88.2    2e-16   
ref|XP_008111638.1|  PREDICTED: importin subunit beta-1               88.6    2e-16   
ref|XP_001879988.1|  predicted protein                                88.2    2e-16   
ref|XP_007573929.1|  PREDICTED: importin subunit beta-1               88.2    2e-16   
ref|XP_007426045.1|  PREDICTED: importin subunit beta-1               87.8    2e-16   
ref|XP_005812531.1|  PREDICTED: importin subunit beta-1-like          87.8    2e-16   
gb|KIW18901.1|  hypothetical protein PV08_03190                       87.8    2e-16   
ref|XP_002146023.1|  importin beta-1 subunit                          87.8    3e-16   
ref|XP_001564334.1|  putative importin beta-1 subunit                 87.8    3e-16   
gb|EXX69337.1|  Kap95p                                                87.8    3e-16   
ref|XP_003442474.2|  PREDICTED: importin subunit beta-1-like          87.8    3e-16   
ref|XP_006638451.1|  PREDICTED: importin subunit beta-1-like          87.8    3e-16   
gb|EXX69338.1|  Kap95p                                                87.4    3e-16   
gb|KIM41758.1|  hypothetical protein M413DRAFT_137569                 87.4    3e-16   
emb|CDS08530.1|  hypothetical protein LRAMOSA09891                    87.4    3e-16   
ref|XP_011272543.1|  Importin subunit beta-1                          87.4    3e-16   
ref|XP_003002895.1|  importin subunit beta-1                          87.4    3e-16   
pdb|1F59|A  Chain A, Importin-Beta-Fxfg Nucleoporin Complex           86.3    3e-16   
ref|XP_009938637.1|  PREDICTED: importin subunit beta-1-like          85.1    4e-16   
gb|KIK09590.1|  hypothetical protein K443DRAFT_644903                 87.4    4e-16   
gb|KFH40997.1|  Importin subunit beta-like protein                    87.4    4e-16   
gb|KIM58066.1|  hypothetical protein SCLCIDRAFT_1218905               87.4    4e-16   
ref|XP_009963128.1|  PREDICTED: importin subunit beta-1-like          81.6    4e-16   
gb|KIV81426.1|  hypothetical protein PV11_03614                       87.0    4e-16   
gb|EPQ62617.1|  Karyopherin beta                                      87.0    4e-16   
emb|CCU82717.1|  importin beta-1 subunit                              87.0    4e-16   
gb|EFA76306.1|  hypothetical protein PPL_10069                        87.0    5e-16   
ref|XP_007230833.1|  PREDICTED: importin subunit beta-1-like          87.0    5e-16   
ref|XP_008285812.1|  PREDICTED: importin subunit beta-1               86.7    6e-16   
pdb|1GCJ|A  Chain A, N-Terminal Fragment Of Importin-Beta             85.5    6e-16   
emb|CAF87209.1|  unnamed protein product                              82.4    7e-16   
pdb|1IBR|D  Chain D, Complex Of Ran With Importin Beta                85.5    7e-16   
gb|KIW43829.1|  hypothetical protein PV06_04891                       86.7    7e-16   
gb|KGU14569.1|  importin subunit beta-1                               86.7    7e-16   
pdb|1M5N|S  Chain S, Crystal Structure Of Heat Repeats (1-11) Of ...  85.5    7e-16   
gb|KIW88243.1|  hypothetical protein Z519_11354                       86.7    7e-16   
ref|XP_001416317.1|  predicted protein                                86.7    7e-16   
gb|EMT27551.1|  Importin subunit beta-1                               85.1    8e-16   
gb|KGU33606.1|  importin subunit beta-1                               86.3    8e-16   
gb|KHC43061.1|  importin subunit beta-1                               86.3    8e-16   
gb|EEQ42934.1|  importin beta-1 subunit                               86.3    8e-16   
gb|KHC40269.1|  importin subunit beta-1                               86.3    8e-16   
gb|KGU36410.1|  importin subunit beta-1                               86.3    8e-16   
gb|KGR04227.1|  importin subunit beta-1                               86.3    8e-16   
gb|KHC75646.1|  importin subunit beta-1                               86.3    9e-16   
ref|XP_713775.1|  hypothetical protein CaO19.3681                     86.3    9e-16   
ref|XP_001793003.1|  hypothetical protein SNOG_02397                  86.3    9e-16   
emb|CDH52511.1|  arm repeat-containing protein                        86.3    9e-16   
dbj|GAD98868.1|  importin beta-1 subunit                              85.9    1e-15   
ref|XP_006889530.1|  PREDICTED: LOW QUALITY PROTEIN: importin sub...  85.9    1e-15   
ref|XP_010873015.1|  PREDICTED: importin subunit beta-1 isoform X2    85.9    1e-15   
pdb|1QGK|A  Chain A, Structure Of Importin Beta Bound To The Ibb ...  85.9    1e-15   
ref|XP_010873014.1|  PREDICTED: importin subunit beta-1 isoform X1    85.9    1e-15   
ref|XP_009855384.1|  hypothetical protein NEUTE1DRAFT_70739           85.9    1e-15   
ref|XP_001383363.2|  karyopherin-beta                                 85.9    1e-15   
gb|EUC64837.1|  karyopherin beta-1 subunit (importin 95), putative    85.9    1e-15   
gb|EKV09260.1|  Importin beta-1 subunit                               85.9    1e-15   
gb|AAH52711.1|  Karyopherin (importin) beta 1                         85.5    1e-15   
ref|XP_010592911.1|  PREDICTED: importin subunit beta-1               85.5    1e-15   
dbj|BAE27738.1|  unnamed protein product                              85.5    1e-15   
gb|EAW94809.1|  karyopherin (importin) beta 1, isoform CRA_b          85.5    1e-15   
ref|NP_001266762.1|  importin subunit beta-1                          85.5    1e-15   
ref|NP_002256.2|  importin subunit beta-1 isoform 1                   85.5    1e-15   
dbj|BAE40950.1|  unnamed protein product                              85.5    2e-15   
ref|XP_004684334.1|  PREDICTED: importin subunit beta-1               85.5    2e-15   
dbj|BAA11034.1|  scg                                                  85.5    2e-15   
ref|XP_007940187.1|  PREDICTED: importin subunit beta-1               85.5    2e-15   
ref|NP_032405.3|  importin subunit beta-1                             85.5    2e-15   
ref|XP_007367053.1|  ARM repeat-containing protein                    85.5    2e-15   
ref|XP_002748539.1|  PREDICTED: importin subunit beta-1               85.5    2e-15   
ref|XP_004311585.1|  PREDICTED: importin subunit beta-1               85.5    2e-15   
ref|XP_006109792.1|  PREDICTED: LOW QUALITY PROTEIN: karyopherin ...  85.5    2e-15   
ref|XP_008151993.1|  PREDICTED: importin subunit beta-1 isoform X1    85.5    2e-15   
ref|XP_007465196.1|  PREDICTED: importin subunit beta-1 isoform X1    85.5    2e-15   
dbj|BAG37316.1|  unnamed protein product                              85.5    2e-15   
ref|XP_003786491.1|  PREDICTED: importin subunit beta-1 isoform 1     85.5    2e-15   
dbj|GAA86811.1|  importin beta-1 subunit                              85.5    2e-15   
ref|XP_004655560.1|  PREDICTED: importin subunit beta-1 isoform X1    85.5    2e-15   
ref|XP_004457891.1|  PREDICTED: LOW QUALITY PROTEIN: importin sub...  85.5    2e-15   
ref|XP_004799020.1|  PREDICTED: importin subunit beta-1 isoform X2    85.5    2e-15   
ref|XP_005861985.1|  PREDICTED: importin subunit beta-1 isoform X2    85.5    2e-15   
ref|XP_003131576.3|  PREDICTED: importin subunit beta-1 isoformX1     85.5    2e-15   
ref|XP_004282743.1|  PREDICTED: importin subunit beta-1 isoform 1     85.5    2e-15   
gb|KIW85005.1|  hypothetical protein Z517_00393                       85.5    2e-15   
ref|XP_008269604.1|  PREDICTED: importin subunit beta-1               85.5    2e-15   
ref|NP_001180082.1|  importin subunit beta-1                          85.5    2e-15   
ref|XP_004378177.1|  PREDICTED: importin subunit beta-1               85.5    2e-15   
ref|XP_004591176.1|  PREDICTED: importin subunit beta-1               85.5    2e-15   
ref|XP_005861984.1|  PREDICTED: importin subunit beta-1 isoform X1    85.5    2e-15   
ref|XP_005654001.1|  PREDICTED: importin subunit beta-1 isoform X2    85.5    2e-15   
ref|XP_004395140.1|  PREDICTED: importin subunit beta-1 isoform 1     85.5    2e-15   
ref|XP_004799019.1|  PREDICTED: importin subunit beta-1 isoform X1    85.5    2e-15   
ref|XP_005321803.1|  PREDICTED: importin subunit beta-1 isoform X2    85.5    2e-15   
ref|XP_005075963.1|  PREDICTED: importin subunit beta-1 isoform X1    85.5    2e-15   
ref|XP_001818101.1|  importin beta-1 subunit                          85.5    2e-15   
ref|XP_008836471.1|  PREDICTED: importin subunit beta-1               85.5    2e-15   
ref|XP_006214279.1|  PREDICTED: importin subunit beta-1 isoform X3    85.5    2e-15   
ref|XP_005075964.1|  PREDICTED: importin subunit beta-1 isoform X2    85.5    2e-15   
ref|XP_004608769.1|  PREDICTED: importin subunit beta-1               85.5    2e-15   
ref|XP_005321802.1|  PREDICTED: importin subunit beta-1 isoform X1    85.5    2e-15   
gb|KIK45396.1|  hypothetical protein CY34DRAFT_801596                 85.5    2e-15   
ref|XP_005394327.1|  PREDICTED: importin subunit beta-1 isoform X1    85.5    2e-15   
ref|XP_005394328.1|  PREDICTED: importin subunit beta-1 isoform X2    85.5    2e-15   
ref|XP_003467112.2|  PREDICTED: importin subunit beta-1               85.5    2e-15   
ref|XP_004633736.1|  PREDICTED: importin subunit beta-1 isoform X1    85.5    2e-15   
ref|XP_006214278.1|  PREDICTED: importin subunit beta-1 isoform X2    85.5    2e-15   
ref|XP_001366856.1|  PREDICTED: importin subunit beta-1               85.5    2e-15   
gb|KIW31098.1|  hypothetical protein PV07_02779                       85.5    2e-15   
ref|XP_004859614.1|  PREDICTED: importin subunit beta-1               85.5    2e-15   
ref|XP_004764763.1|  PREDICTED: importin subunit beta-1               85.5    2e-15   
gb|ENH86703.1|  importin subunit beta-1                               85.1    2e-15   
ref|XP_008569202.1|  PREDICTED: importin subunit beta-1               85.1    2e-15   
ref|XP_007749244.1|  hypothetical protein A1O5_10478                  85.1    2e-15   
gb|KIX94837.1|  hypothetical protein Z520_09527                       85.1    2e-15   
ref|XP_001389806.2|  importin beta-1 subunit                          85.1    2e-15   
ref|XP_001214400.1|  conserved hypothetical protein                   85.1    2e-15   
emb|CAK37411.1|  unnamed protein product                              85.1    2e-15   
ref|XP_009267783.1|  Importin subunit beta-1                          85.1    2e-15   
emb|CDM38274.1|  Importin subunit beta-1                              85.1    2e-15   
ref|XP_003864216.1|  importin beta-1 subunit, putative                85.1    2e-15   
ref|XP_001468438.1|  putative importin beta-1 subunit                 85.1    2e-15   
emb|CCC93491.1|  putative importin beta-1 subunit                     84.7    2e-15   
ref|XP_007902543.1|  PREDICTED: importin subunit beta-1               84.7    3e-15   
dbj|GAN07620.1|  ARM repeat-containing protein                        84.7    3e-15   
ref|XP_001834149.1|  karyopherin Kap95                                84.7    3e-15   
ref|XP_007530075.1|  PREDICTED: importin subunit beta-1               84.3    4e-15   
ref|XP_005061682.1|  PREDICTED: importin subunit beta-1-like          82.4    4e-15   
emb|CBH15277.1|  importin beta-1 subunit, putative                    84.3    4e-15   
ref|XP_822543.1|  importin subunit beta-1                             84.3    4e-15   
ref|XP_003768374.1|  PREDICTED: importin subunit beta-1               84.3    4e-15   
ref|XP_001686139.1|  putative importin beta-1 subunit                 84.3    4e-15   
ref|XP_009653027.1|  importin subunit beta-1                          84.3    4e-15   
ref|XP_006832588.1|  PREDICTED: importin subunit beta-1               84.0    5e-15   
gb|KGO74068.1|  Armadillo-like helical                                84.0    5e-15   
ref|XP_003878634.1|  putative importin beta-1 subunit                 84.0    5e-15   
gb|KGO38731.1|  Armadillo-like helical                                84.0    6e-15   
gb|KDQ16929.1|  hypothetical protein BOTBODRAFT_53590                 84.0    6e-15   
gb|KIL60730.1|  hypothetical protein M378DRAFT_109989                 84.0    6e-15   
gb|EMF15100.1|  importin subunit beta-1                               83.6    6e-15   
ref|XP_003347155.1|  hypothetical protein SMAC_05454                  83.6    7e-15   
gb|KJA17840.1|  hypothetical protein HYPSUDRAFT_70338                 83.6    7e-15   
ref|XP_005828789.1|  hypothetical protein GUITHDRAFT_112227           83.2    8e-15   
ref|XP_009224369.1|  importin subunit beta-1                          83.2    9e-15   
emb|CEJ86377.1|  Putative Importin subunit beta-1                     83.2    1e-14   
gb|KFU84774.1|  Importin subunit beta-1                               82.8    1e-14   
gb|KHO00212.1|  Armadillo-type fold protein                           82.8    1e-14   
ref|XP_964876.1|  importin subunit beta-1                             82.8    1e-14   
ref|XP_001268686.1|  importin beta-1 subunit                          82.8    1e-14   
emb|CAE76196.1|  probable KAP95 protein                               82.8    1e-14   
gb|KIW70104.1|  hypothetical protein PV04_02410                       82.8    1e-14   
ref|XP_008731266.1|  hypothetical protein G647_08737                  82.8    1e-14   
ref|XP_009503728.1|  PREDICTED: importin subunit beta-1               82.0    1e-14   
emb|CCC51240.1|  putative importin beta-1 subunit                     82.4    2e-14   
ref|XP_003069002.1|  Importin-beta N-terminal domain containing p...  82.4    2e-14   
ref|XP_007754453.1|  hypothetical protein A1O7_02229                  82.4    2e-14   
ref|XP_001243673.1|  hypothetical protein CIMG_03114                  82.4    2e-14   
gb|KFV14188.1|  Importin subunit beta-1                               82.0    2e-14   
gb|KDB14144.1|  putative KAP95 protein                                82.4    2e-14   
gb|KFO62859.1|  Importin subunit beta-1                               82.0    2e-14   
gb|EHL01026.1|  putative Importin subunit beta-1                      82.0    2e-14   
ref|XP_006124255.1|  PREDICTED: importin subunit beta-1               82.0    2e-14   
ref|XP_008610561.1|  hypothetical protein SDRG_06558                  82.0    2e-14   
gb|EJK68366.1|  hypothetical protein THAOC_10458                      82.0    2e-14   
ref|XP_008085582.1|  ARM repeat-containing protein                    81.6    3e-14   
gb|KFO73073.1|  Importin subunit beta-1                               81.6    3e-14   
ref|XP_010753674.1|  PREDICTED: importin subunit beta-1               81.6    3e-14   
gb|KFW12022.1|  Importin subunit beta-1                               81.6    3e-14   
gb|EMP33797.1|  Importin subunit beta-1                               81.6    3e-14   
gb|KDO30167.1|  hypothetical protein SPRG_05359                       81.6    3e-14   
gb|KFV86567.1|  Importin subunit beta-1                               81.6    3e-14   
gb|KFO97469.1|  Importin subunit beta-1                               81.6    3e-14   
gb|KFM04566.1|  Importin subunit beta-1                               81.6    3e-14   
ref|XP_002543328.1|  conserved hypothetical protein                   81.6    3e-14   
gb|KFQ24321.1|  Importin subunit beta-1                               81.6    3e-14   
gb|EMC85358.1|  Importin subunit beta-1                               81.6    3e-14   
ref|XP_007585287.1|  putative importin beta-1 subunit protein         81.6    3e-14   
gb|KFW65958.1|  Importin subunit beta-1                               81.6    3e-14   
gb|KEY79238.1|  importin beta 1 subunit                               81.6    3e-14   
gb|EEH09716.1|  importin subunit beta-1                               81.6    3e-14   
emb|CEL55373.1|  Importin subunit beta-1 OS=Schizosaccharomyces p...  81.6    3e-14   
gb|EHB14190.1|  Importin subunit beta-1                               81.6    3e-14   



>ref|XP_010653407.1| PREDICTED: importin subunit beta-1 [Vitis vinifera]
 emb|CBI18129.3| unnamed protein product [Vitis vinifera]
Length=872

 Score =   226 bits (577),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+EIT FLL AQSADAKIRTEAE+ L QF+EQNLP FLLSL+VELSN+ KP ESRRLAG
Sbjct  1    MAVEITQFLLYAQSADAKIRTEAESNLRQFQEQNLPAFLLSLSVELSNNEKPTESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            IVLKNSLDAK+A+ KEHLVQQW A+D+S+KSQIK+LLL TL SSV +ASHTS+QVIAKIA
Sbjct  61   IVLKNSLDAKDAARKEHLVQQWVAMDISIKSQIKDLLLRTLGSSVTEASHTSAQVIAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIEIPR EWPEL+GSLL N
Sbjct  121  SIEIPRKEWPELIGSLLVN  139



>gb|KJB77043.1| hypothetical protein B456_012G117900 [Gossypium raimondii]
Length=807

 Score =   223 bits (568),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+EIT FLL+AQSADAK+RTEAEA+L QF+EQN+PVFLLSL+VELSND KPVESRRLAG
Sbjct  1    MAMEITQFLLAAQSADAKVRTEAEASLRQFQEQNMPVFLLSLSVELSNDDKPVESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            IVLKNSLDAK+A  KE LVQQW AID+S+KSQIK+ LL TL SSV +A HT++QVIAKIA
Sbjct  61   IVLKNSLDAKDAIRKEQLVQQWMAIDISIKSQIKDSLLRTLGSSVPEARHTAAQVIAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIEIPR +WPEL+GSLL N
Sbjct  121  SIEIPRKQWPELIGSLLNN  139



>emb|CDP06446.1| unnamed protein product [Coffea canephora]
Length=1157

 Score =   225 bits (573),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+EIT  LL+AQSADAK+RT+AE+ LT+F++QNLP FLLSL+VELSN+GKP+ESRRLAG
Sbjct  287  MAMEITQILLAAQSADAKVRTDAESNLTRFRDQNLPSFLLSLSVELSNEGKPMESRRLAG  346

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            IVLKNSLDAKEAS KEHLVQQW  ID S KSQIKNLLL+TL SSV+DA HT++QVIAKIA
Sbjct  347  IVLKNSLDAKEASRKEHLVQQWLTIDSSFKSQIKNLLLSTLGSSVQDAIHTAAQVIAKIA  406

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIEIPR EWPEL+GSLL N
Sbjct  407  SIEIPRKEWPELIGSLLVN  425



>gb|KJB77042.1| hypothetical protein B456_012G117900 [Gossypium raimondii]
Length=872

 Score =   223 bits (567),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+EIT FLL+AQSADAK+RTEAEA+L QF+EQN+PVFLLSL+VELSND KPVESRRLAG
Sbjct  1    MAMEITQFLLAAQSADAKVRTEAEASLRQFQEQNMPVFLLSLSVELSNDDKPVESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            IVLKNSLDAK+A  KE LVQQW AID+S+KSQIK+ LL TL SSV +A HT++QVIAKIA
Sbjct  61   IVLKNSLDAKDAIRKEQLVQQWMAIDISIKSQIKDSLLRTLGSSVPEARHTAAQVIAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIEIPR +WPEL+GSLL N
Sbjct  121  SIEIPRKQWPELIGSLLNN  139



>ref|XP_011095057.1| PREDICTED: importin subunit beta-1-like [Sesamum indicum]
Length=874

 Score =   222 bits (566),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MALEIT +LLSAQS DA IR EAE TL+QF++QNLP FLLSL+VEL+NDGKP ESRRLAG
Sbjct  1    MALEITQYLLSAQSPDANIRNEAETTLSQFRDQNLPGFLLSLSVELANDGKPTESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            I+LKNSLDAKEA+TK+ LVQQW AI++S KSQIK  LLNTL SSVR+ASHT++QV+AKIA
Sbjct  61   IILKNSLDAKEAATKDQLVQQWVAIELSFKSQIKVSLLNTLGSSVREASHTAAQVVAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIE+PR EWPELVG LLAN
Sbjct  121  SIEVPRKEWPELVGLLLAN  139



>ref|XP_007026608.1| Importin beta-1, putative isoform 1 [Theobroma cacao]
 ref|XP_007026609.1| Importin beta-1, putative isoform 1 [Theobroma cacao]
 gb|EOY07110.1| Importin beta-1, putative isoform 1 [Theobroma cacao]
 gb|EOY07111.1| Importin beta-1, putative isoform 1 [Theobroma cacao]
Length=874

 Score =   221 bits (563),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+EIT FLL+AQSADAK+RTEAE  L QF+EQNLPVFLLSL+VEL+N+ KPVESRRLAG
Sbjct  1    MAMEITQFLLAAQSADAKVRTEAEGNLRQFQEQNLPVFLLSLSVELANNEKPVESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            IVLKNSLDAK+A  KE LVQQW AID+S+KSQIK+LLL TL SSV +A HTS+QV+AKIA
Sbjct  61   IVLKNSLDAKDAIRKEQLVQQWMAIDISVKSQIKDLLLRTLGSSVPEARHTSAQVVAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIEIPR +WPEL+GSLL N
Sbjct  121  SIEIPRKQWPELIGSLLNN  139



>ref|XP_011095056.1| PREDICTED: importin subunit beta-1-like [Sesamum indicum]
Length=874

 Score =   217 bits (552),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MALEIT +LLSAQS DAK+R EAE TL+QF++QNL  FLLSL+VEL+ND KP ESRRLAG
Sbjct  1    MALEITQYLLSAQSPDAKVRNEAETTLSQFRDQNLSGFLLSLSVELANDSKPTESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            I+LKNSLDAKEA+ K+HLV+QW AID+S KSQIK+ LL+TL SSVR+ASHT++QV+AKIA
Sbjct  61   IILKNSLDAKEAARKDHLVRQWVAIDISFKSQIKHSLLSTLGSSVREASHTAAQVVAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIE+PR EWPELVG LL+N
Sbjct  121  SIEVPRKEWPELVGLLLSN  139



>gb|EYU41939.1| hypothetical protein MIMGU_mgv1a001166mg [Erythranthe guttata]
Length=874

 Score =   214 bits (546),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MALEIT +LLSAQS DAK+R +AE  L QF+ QNLP FLLSL+ ELSNDGKP ESR LAG
Sbjct  1    MALEITQYLLSAQSPDAKVRNDAETALGQFQNQNLPGFLLSLSFELSNDGKPTESRTLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKEA+ K+ LVQQW AIDV+ KSQ+KN LLNTL SS+R+ASHT+SQV+AKIA
Sbjct  61   LILKNTLDAKEAARKDVLVQQWIAIDVTFKSQVKNSLLNTLGSSIREASHTASQVVAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIE+PR EWPELVG LLAN
Sbjct  121  SIEVPRKEWPELVGLLLAN  139



>gb|KDP22848.1| hypothetical protein JCGZ_00435 [Jatropha curcas]
Length=872

 Score =   211 bits (536),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+EIT  LLSAQS DAKIR EAE  L QF+EQNLP+FLLSL+VEL+N+ KP ESRRLAG
Sbjct  1    MAMEITQILLSAQSPDAKIRNEAEVNLRQFQEQNLPLFLLSLSVELANNEKPNESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            IVLKNSLDAK+AS KEHLVQQW  I++S+KSQIK+LL+ TL SSV++A HTSSQVIAK+A
Sbjct  61   IVLKNSLDAKDASRKEHLVQQWMTIEISIKSQIKDLLMRTLASSVQEARHTSSQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIEIPR +WPEL+G LL N
Sbjct  121  SIEIPRKQWPELIGLLLNN  139



>ref|NP_001154598.1| armadillo/beta-catenin-like repeat-containing protein [Arabidopsis 
thaliana]
 gb|AEE74700.1| armadillo/beta-catenin-like repeat-containing protein [Arabidopsis 
thaliana]
Length=873

 Score =   209 bits (533),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+EIT FLL+AQSADA++RTEAE  L QF+EQNLP+FL+SL+ EL+N+ KP ESRRLAG
Sbjct  1    MAMEITQFLLAAQSADARVRTEAEGNLRQFQEQNLPLFLVSLSFELANNDKPAESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            I+LKNSLDAK+++TK+HLV+QW AIDV+LKSQIK+ LL TL SS  +A HTS+QVIAK+A
Sbjct  61   ILLKNSLDAKDSATKDHLVKQWFAIDVALKSQIKDRLLRTLGSSALEARHTSAQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIEIP+ +WPELVGSLL N
Sbjct  121  SIEIPQKQWPELVGSLLNN  139



>ref|XP_002309153.2| hypothetical protein POPTR_0006s10420g [Populus trichocarpa]
 gb|EEE92676.2| hypothetical protein POPTR_0006s10420g [Populus trichocarpa]
Length=870

 Score =   209 bits (532),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MALEIT FLL+AQS DA IRT+AEA+L QF+EQNLP+FLLSL+VEL+N+ KP+ESRRLAG
Sbjct  1    MALEITQFLLAAQSPDANIRTQAEASLRQFQEQNLPLFLLSLSVELANNVKPLESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            IVLKNSLDAK++  KEHLVQQW  I++S+KSQIK+ LL TL SS  +A HTS+QVIAK+A
Sbjct  61   IVLKNSLDAKDSVRKEHLVQQWMTIEISIKSQIKDSLLRTLGSSASEARHTSAQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIEIPR +WPEL+GSLL N
Sbjct  121  SIEIPRKQWPELIGSLLNN  139



>ref|XP_009629467.1| PREDICTED: importin subunit beta-1-like [Nicotiana tomentosiformis]
Length=874

 Score =   208 bits (530),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MAL+IT FLL+AQSADAKIR+EAE  L QF+EQNLP FLLSLAVELSNDGKP ESRRLAG
Sbjct  1    MALDITQFLLAAQSADAKIRSEAETGLGQFREQNLPGFLLSLAVELSNDGKPTESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            IVLKNSLDAKE++ KE LVQQW AID   KSQIK+LLL+TL SSVR+ASHT++QVIAK+A
Sbjct  61   IVLKNSLDAKESARKEQLVQQWQAIDAQCKSQIKSLLLSTLGSSVREASHTAAQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIEIP+ +WPEL+GSLL N
Sbjct  121  SIEIPQKQWPELIGSLLVN  139



>gb|AID68439.1| putative importin subunit beta-1, partial [Hypericum perforatum]
Length=331

 Score =   199 bits (506),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MALEIT FLLSAQS DA +RT+AE+ L QF+EQNLP+FLLSL+VEL+N  KP ESRRLAG
Sbjct  1    MALEITQFLLSAQSPDASVRTQAESNLKQFQEQNLPLFLLSLSVELANQEKPNESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            I+LKNSLDAK+A+ +E LVQQW AID+++KSQIK+LLL TL SS  +  HTS+QVIAK+A
Sbjct  61   ILLKNSLDAKDAARREQLVQQWVAIDIAIKSQIKDLLLRTLGSSDAEVGHTSAQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIEIPR  W EL+GSLL N
Sbjct  121  SIEIPRKLWLELIGSLLNN  139



>ref|XP_010466909.1| PREDICTED: importin subunit beta-1-like [Camelina sativa]
Length=873

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+EIT FLL+AQSADA+IRTEAE +L QF+EQNLP FLLSL+ EL++D KP ESRRLAG
Sbjct  1    MAMEITQFLLAAQSADARIRTEAEGSLRQFQEQNLPQFLLSLSFELASDDKPSESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            I+LKNSLDAK+++TK+HLV+QW AI+V+LKSQIK  LL TL SS+ +A HTS+QVIAK+A
Sbjct  61   ILLKNSLDAKDSATKDHLVKQWFAIEVALKSQIKEQLLRTLGSSILEARHTSAQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIEIP+ +WPELVGSLL N
Sbjct  121  SIEIPQKQWPELVGSLLNN  139



>ref|XP_006359549.1| PREDICTED: importin subunit beta-1-like [Solanum tuberosum]
Length=873

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MALEIT FLL+AQSADAKIRTE+E+ L+QF+EQNLP F LSLAVELSNDGKP ESRRLAG
Sbjct  1    MALEITQFLLAAQSADAKIRTESESNLSQFREQNLPGFFLSLAVELSNDGKPTESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            IVLKNSLDAKE   K+ LVQQW AID S KSQIK+LLL+ L SSVR+ASHT+SQVIAKI+
Sbjct  61   IVLKNSLDAKETVRKQQLVQQWLAIDSSCKSQIKSLLLSCLGSSVREASHTASQVIAKIS  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIE+P+ +WPEL+GSLL N
Sbjct  121  SIEVPQKQWPELIGSLLVN  139



>ref|XP_004246782.1| PREDICTED: importin subunit beta-1-like [Solanum lycopersicum]
Length=873

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+EIT FLL+AQSADAKIRTEAE+ L+QF+EQNLP F LSLAVELSNDGKP ESRRLAG
Sbjct  1    MAVEITQFLLAAQSADAKIRTEAESNLSQFREQNLPGFFLSLAVELSNDGKPTESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            IVLKNSLDAKE   K+ LVQQW  ID S KSQIK+LLL+ L SSVR+ASHT+SQVIAKIA
Sbjct  61   IVLKNSLDAKETVRKQQLVQQWLTIDSSCKSQIKSLLLSCLGSSVREASHTASQVIAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIE+P+ +WPEL+GSLL N
Sbjct  121  SIEVPQKQWPELIGSLLVN  139



>ref|XP_002526656.1| importin beta-1, putative [Ricinus communis]
 gb|EEF35678.1| importin beta-1, putative [Ricinus communis]
Length=872

 Score =   207 bits (526),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+EIT  LL+AQS DAK+R EAEA L QF+EQNLP+FLLSL+VEL+N+ KP ESRRLAG
Sbjct  1    MAMEITPVLLAAQSLDAKVRNEAEANLRQFQEQNLPLFLLSLSVELANNEKPNESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            IVLKNSLDAK+A  KEHLVQQW AI++S+KSQIK+LLL TL SS ++A HTS+QVIAK+A
Sbjct  61   IVLKNSLDAKDAMRKEHLVQQWMAIEISIKSQIKDLLLRTLGSSAQEARHTSAQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIEIPR +WPEL+ SLL+N
Sbjct  121  SIEIPRKQWPELIRSLLSN  139



>ref|XP_011019075.1| PREDICTED: importin subunit beta-1-like [Populus euphratica]
 ref|XP_011019076.1| PREDICTED: importin subunit beta-1-like [Populus euphratica]
Length=870

 Score =   206 bits (525),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MALEIT FLL+AQS DA IRT+AEA+L QF+EQNLP+FLLSL+VEL+N+ KP+ESR+LAG
Sbjct  1    MALEITPFLLAAQSPDANIRTQAEASLRQFQEQNLPLFLLSLSVELANNVKPLESRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            IVLKNSLDAK++  KEHLVQQW AI+ S+KSQIK+ LL TL SS  +A HTS+QVIAK+A
Sbjct  61   IVLKNSLDAKDSVRKEHLVQQWMAIEKSIKSQIKDSLLRTLGSSASEARHTSAQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIEIPR +WPEL+GSLL N
Sbjct  121  SIEIPRKQWPELIGSLLNN  139



>ref|XP_006407728.1| hypothetical protein EUTSA_v10020036mg [Eutrema salsugineum]
 ref|XP_006407729.1| hypothetical protein EUTSA_v10020036mg [Eutrema salsugineum]
 ref|XP_006407731.1| hypothetical protein EUTSA_v10020035mg [Eutrema salsugineum]
 gb|ESQ49181.1| hypothetical protein EUTSA_v10020036mg [Eutrema salsugineum]
 gb|ESQ49182.1| hypothetical protein EUTSA_v10020036mg [Eutrema salsugineum]
 gb|ESQ49184.1| hypothetical protein EUTSA_v10020035mg [Eutrema salsugineum]
Length=873

 Score =   206 bits (523),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+EIT FL++AQSADA++RTEAE +L QF+EQNLP FLLSL+ EL+N+ KP ESRRLAG
Sbjct  1    MAMEITQFLVAAQSADARVRTEAEGSLRQFQEQNLPQFLLSLSSELANNDKPSESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            I+LKNSLDAK+++ K+HLV+QW AIDV+LKS IK LLL TL SS  +A HTS+QVIAK+A
Sbjct  61   ILLKNSLDAKDSARKDHLVKQWVAIDVALKSHIKELLLRTLGSSALEARHTSAQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIEIP+ +WPELVGSLL N
Sbjct  121  SIEIPQKQWPELVGSLLTN  139



>ref|XP_010464516.1| PREDICTED: importin subunit beta-1-like [Camelina sativa]
Length=873

 Score =   206 bits (523),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+EIT FLL+AQSADA+IRTEAE +L QF+EQNLP FL+SL+ EL++D KP ESRRLAG
Sbjct  1    MAMEITQFLLAAQSADARIRTEAEGSLRQFQEQNLPQFLVSLSFELASDDKPSESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            I+LKNSLDAK+++TK+HLV+QW AI+V+LKSQIK  LL TL SS  +A HTS+QVIAK+A
Sbjct  61   ILLKNSLDAKDSATKDHLVKQWFAIEVALKSQIKEQLLRTLGSSTLEARHTSAQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIEIP+ +WPELVGSLL N
Sbjct  121  SIEIPQKQWPELVGSLLNN  139



>ref|XP_010464517.1| PREDICTED: importin subunit beta-1-like [Camelina sativa]
Length=872

 Score =   205 bits (522),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+EIT FLL+AQSADA+IRTEAE +L QF+EQNLP FLLSL+ EL+ + KP ESRRLAG
Sbjct  1    MAMEITQFLLAAQSADARIRTEAEGSLRQFQEQNLPQFLLSLSFELAKNDKPSESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            I+LKNSLDAK+++ K HLV+QW AIDV+LKSQIK LLL TL SS  +A HTS+QVIAK+A
Sbjct  61   ILLKNSLDAKDSARKGHLVKQWFAIDVALKSQIKELLLTTLGSSALEARHTSAQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIEIP+ +WPELVGSLL N
Sbjct  121  SIEIPQKQWPELVGSLLNN  139



>emb|CDY53085.1| BnaCnng24150D [Brassica napus]
Length=873

 Score =   205 bits (522),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+EIT FLL+AQSADA++RTEAE +L QF+EQNLP FLLSL+ EL+N+ KP ESRRLAG
Sbjct  1    MAMEITQFLLAAQSADARVRTEAEGSLKQFQEQNLPQFLLSLSFELANNEKPSESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            I+LKNSLDAK++  KE LV+QW AID++LKSQIK LLL T+ SSV +A HTS+QVIAK+A
Sbjct  61   ILLKNSLDAKDSGRKELLVKQWCAIDLALKSQIKELLLRTIGSSVPEARHTSAQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIE+P+ +WPELVGSLL+N
Sbjct  121  SIEVPQKQWPELVGSLLSN  139



>ref|XP_010676800.1| PREDICTED: importin subunit beta-1-like [Beta vulgaris subsp. 
vulgaris]
Length=867

 Score =   205 bits (522),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            M+++IT++LL+AQS DAK+RTEAEA+L QF+EQN   FLL+L+VELSNDGKP+ESRRLAG
Sbjct  1    MSMDITSYLLAAQSPDAKVRTEAEASLRQFQEQNSSGFLLALSVELSNDGKPIESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            IVLKNSLDAK++S KEHLVQQW +ID S+K QIK  LL TL S +++A HTSSQVIAKIA
Sbjct  61   IVLKNSLDAKDSSRKEHLVQQWVSIDASMKLQIKESLLRTLRSVIQEAWHTSSQVIAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIEIPR EWP+L+ SLL N
Sbjct  121  SIEIPRKEWPDLIASLLNN  139



>emb|CDY44668.1| BnaA05g29380D [Brassica napus]
Length=873

 Score =   205 bits (522),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+EIT FLL+AQSADA++RTEAE +L QF+EQNLP FLLSL+ EL+N+ KP ESRRLAG
Sbjct  1    MAMEITQFLLAAQSADARVRTEAEGSLKQFQEQNLPQFLLSLSFELANNEKPSESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            I+LKNSLDAK++  KE LV+QW AID++LKSQIK LLL T+ SSV +A HTS+QVIAK+A
Sbjct  61   ILLKNSLDAKDSGRKELLVKQWCAIDLALKSQIKELLLRTIGSSVPEARHTSAQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIE+P+ +WPELVGSLL+N
Sbjct  121  SIEVPQKQWPELVGSLLSN  139



>ref|XP_009146969.1| PREDICTED: importin subunit beta-1 [Brassica rapa]
Length=872

 Score =   205 bits (522),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+EIT FLL+AQSADA++RTEAE +L QF+EQNLP FLLSL+ EL+N+ KP ESRRLAG
Sbjct  1    MAMEITQFLLAAQSADARVRTEAEGSLKQFQEQNLPQFLLSLSFELANNEKPSESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            I+LKNSLDAK++  KE LV+QW AID++LKSQIK LLL T+ SSV +A HTS+QVIAK+A
Sbjct  61   ILLKNSLDAKDSGRKELLVKQWCAIDLALKSQIKELLLRTIGSSVPEARHTSAQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIE+P+ +WPELVGSLL+N
Sbjct  121  SIEVPQKQWPELVGSLLSN  139



>ref|XP_010486445.1| PREDICTED: importin subunit beta-1-like [Camelina sativa]
Length=872

 Score =   205 bits (521),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+EIT FLL+AQSADA+IRTEAE +L QF+EQNLP FLLSL+ EL+ + KP ESRRLAG
Sbjct  1    MAMEITQFLLAAQSADARIRTEAEGSLRQFQEQNLPQFLLSLSFELAKNDKPSESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            I+LKNSLDAK+++ K HLV+QW AIDV+LKSQIK LLL TL SS  +A HTS+QVIAK+A
Sbjct  61   ILLKNSLDAKDSARKGHLVKQWFAIDVALKSQIKELLLTTLGSSALEARHTSAQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIEIP+ +WPELVGSLL N
Sbjct  121  SIEIPQKQWPELVGSLLNN  139



>ref|XP_008370170.1| PREDICTED: importin subunit beta-1-like [Malus domestica]
 ref|XP_008370171.1| PREDICTED: importin subunit beta-1-like [Malus domestica]
Length=864

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+EIT FLL+AQSADA++RTEAEA L QF+EQNLP FLLSL+VEL+N+ KP ESR LAG
Sbjct  1    MAMEITQFLLAAQSADARVRTEAEANLRQFQEQNLPAFLLSLSVELANNEKPTESRTLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            +VLKNSLDAK+A TKE L +QW AID+S+ SQIK+LLL TL S V +A HTS+QVIAK+A
Sbjct  61   LVLKNSLDAKDAGTKELLTRQWMAIDISIISQIKDLLLRTLGSPVLEARHTSAQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SI+IPR +WP+L+GSLL N
Sbjct  121  SIDIPRKQWPDLIGSLLBN  139



>ref|XP_010486444.1| PREDICTED: importin subunit beta-1-like [Camelina sativa]
Length=873

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+EIT FL +AQSADA+IRTEAE +L QF+EQNLP FLLSL+ EL++D KP ESRRLAG
Sbjct  1    MAMEITQFLSAAQSADARIRTEAEGSLRQFQEQNLPQFLLSLSFELASDDKPSESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            I+LKNSLDAK+++TK+HLV+QW AI+V+LKSQIK  LL TL SS  +A HTS+QVIAK+A
Sbjct  61   ILLKNSLDAKDSATKDHLVKQWFAIEVALKSQIKEQLLRTLGSSTLEARHTSAQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIEIP+ +WPELVGSLL N
Sbjct  121  SIEIPQKQWPELVGSLLNN  139



>ref|XP_007208359.1| hypothetical protein PRUPE_ppa001244mg [Prunus persica]
 gb|EMJ09558.1| hypothetical protein PRUPE_ppa001244mg [Prunus persica]
Length=873

 Score =   204 bits (518),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+EIT FLL+AQSADA+IRTEAEA L QF+EQN+P FLLSL+VEL+N+ KP ESR LAG
Sbjct  1    MAMEITQFLLAAQSADARIRTEAEANLRQFQEQNVPSFLLSLSVELANNEKPTESRTLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            IVLKNSLDAK+A TKEHL +QW AID+S+ SQIK+LLL TL S V +A HTS+QVIAKIA
Sbjct  61   IVLKNSLDAKDAVTKEHLARQWMAIDISIISQIKDLLLRTLGSPVSEARHTSAQVIAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SI+IPR +W  L+GSLL N
Sbjct  121  SIDIPRKQWTGLIGSLLNN  139



>ref|XP_009593599.1| PREDICTED: importin subunit beta-1-like [Nicotiana tomentosiformis]
 ref|XP_009593600.1| PREDICTED: importin subunit beta-1-like [Nicotiana tomentosiformis]
 ref|XP_009593601.1| PREDICTED: importin subunit beta-1-like [Nicotiana tomentosiformis]
Length=874

 Score =   204 bits (518),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MALEIT FLL+AQSADAKIRTEAEA L+QF+EQNLP FLLSLAVELS D KP ESRRLAG
Sbjct  1    MALEITQFLLAAQSADAKIRTEAEANLSQFREQNLPGFLLSLAVELSTDVKPTESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            IVLKNSLDAKE   K+ LVQQW  ID S KSQIK+LLL+ L SSVR+ASHT++QVIAKIA
Sbjct  61   IVLKNSLDAKETVRKQQLVQQWLVIDSSYKSQIKSLLLSCLGSSVREASHTAAQVIAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIE+P+ +WPELVGSLL N
Sbjct  121  SIEVPQKQWPELVGSLLVN  139



>ref|XP_006296779.1| hypothetical protein CARUB_v100158150mg, partial [Capsella rubella]
 gb|EOA29677.1| hypothetical protein CARUB_v100158150mg, partial [Capsella rubella]
Length=806

 Score =   203 bits (517),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+EIT  LL+AQSADA++RTEAE +L QF+EQNLP FLLSL+ EL+N+ KP ESRRLAG
Sbjct  1    MAMEITQILLAAQSADARVRTEAEGSLRQFQEQNLPQFLLSLSCELANNDKPSESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            I+LKNSLDAK+++ K+HLV+QW AIDV+LKSQIK LLL TL SS  +A HTS+QVIAK+A
Sbjct  61   ILLKNSLDAKDSTRKDHLVKQWFAIDVALKSQIKELLLTTLGSSALEARHTSAQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIEIP+ +WPELV SLL N
Sbjct  121  SIEIPQKQWPELVASLLNN  139



>ref|XP_009786524.1| PREDICTED: importin subunit beta-1-like [Nicotiana sylvestris]
Length=874

 Score =   203 bits (516),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MAL+IT FLL+AQSADAKIR+EAE  L QF+EQNLP FLLSLA ELSNDGKP ESRRLAG
Sbjct  1    MALDITQFLLAAQSADAKIRSEAETGLGQFQEQNLPGFLLSLAAELSNDGKPTESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            IVLKNSLDAKE++ KE LVQQW AID   KSQIK+LLL+TL SSVR+ASHT++QVIAK+A
Sbjct  61   IVLKNSLDAKESARKEQLVQQWQAIDAQCKSQIKSLLLSTLGSSVREASHTAAQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIEIP+ +WPEL+G LL N
Sbjct  121  SIEIPQKQWPELIGLLLVN  139



>ref|XP_009376413.1| PREDICTED: importin subunit beta-1-like [Pyrus x bretschneideri]
 ref|XP_009376414.1| PREDICTED: importin subunit beta-1-like [Pyrus x bretschneideri]
Length=864

 Score =   202 bits (514),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+EIT FLL+AQSADA++RTEAEA L QF+EQNLPVFLLSL+VEL+N+ KP ESR LAG
Sbjct  1    MAMEITQFLLAAQSADARVRTEAEANLRQFQEQNLPVFLLSLSVELANNEKPTESRTLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            +VLKNSLDAK+  TKE L +QW  ID+S+ SQIK+LLL TL S V +A HTS+QVIAK+A
Sbjct  61   LVLKNSLDAKDTGTKELLTRQWMTIDISIISQIKDLLLRTLGSPVLEARHTSAQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SI+IPR +WP+L+GSLL N
Sbjct  121  SIDIPRKQWPDLIGSLLNN  139



>ref|XP_010553116.1| PREDICTED: importin subunit beta-1-like [Tarenaya hassleriana]
Length=835

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+EIT FLL+AQSADA++RT+AE +L QF+EQNLP FL+SL+ EL+N  KP ESRRLAG
Sbjct  1    MAMEITQFLLAAQSADARVRTDAEGSLRQFQEQNLPQFLVSLSFELANSEKPAESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            I+LKNSLDAK+A+ K+HLV+QW  ID ++KSQIK+LLL T+ SS  +A HTS+QVIAK+A
Sbjct  61   ILLKNSLDAKDAAMKDHLVKQWITIDTAIKSQIKDLLLRTIGSSAPEARHTSAQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIEIP  +WPEL+GSLL N
Sbjct  121  SIEIPLKQWPELIGSLLNN  139



>ref|XP_006299756.1| hypothetical protein CARUB_v10015951mg [Capsella rubella]
 gb|EOA32654.1| hypothetical protein CARUB_v10015951mg [Capsella rubella]
Length=871

 Score =   201 bits (511),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+EIT  LL+AQS DA+IRTEAE +L QF+EQNLP FLLSL+ EL+N+ KP ESRRLAG
Sbjct  1    MAMEITQILLAAQSVDARIRTEAEGSLRQFQEQNLPQFLLSLSCELANNDKPSESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            I+LKNSLDAK+++ K+HLV+QW AID++LK+QIK LLL TL SS  +A HTS+QVIAK+A
Sbjct  61   ILLKNSLDAKDSARKDHLVKQWFAIDIALKAQIKELLLTTLGSSTLEARHTSAQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIEIP+ +WPELVG LL N
Sbjct  121  SIEIPQKQWPELVGFLLNN  139



>ref|XP_008243147.1| PREDICTED: importin subunit beta-1-like [Prunus mume]
Length=873

 Score =   201 bits (511),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+EIT FLL+AQSADA+IRTEAEA L QF+EQN P FLLSL+VEL+N+ KP ESR LAG
Sbjct  1    MAMEITQFLLAAQSADARIRTEAEANLRQFQEQNAPSFLLSLSVELANNEKPTESRTLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            IVLKNSLDAK+A TKEHL +QW  ID+S+ SQIK+LLL TL S V +A HTS+QVIAKIA
Sbjct  61   IVLKNSLDAKDAVTKEHLARQWMTIDISIISQIKDLLLRTLGSPVSEARHTSAQVIAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SI+IPR +W  L+GSLL N
Sbjct  121  SIDIPRKQWTGLIGSLLNN  139



>ref|XP_009337741.1| PREDICTED: importin subunit beta-1-like [Pyrus x bretschneideri]
Length=865

 Score =   200 bits (509),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+EIT FLL+AQSADA++R EAEA + QF+EQNLP FLLSL+VEL+N+ KP ESR LAG
Sbjct  1    MAVEITQFLLAAQSADARVRIEAEANIRQFQEQNLPAFLLSLSVELANNEKPTESRTLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            +VLKN LDAK+A TKE L +QW AID+S+ SQIK+LLL TL SSV +A HTS+QVIAKIA
Sbjct  61   LVLKNLLDAKDAGTKELLTRQWIAIDISIVSQIKDLLLRTLGSSVPEARHTSAQVIAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SI+IPR +WP+L+GSLL N
Sbjct  121  SIDIPRKQWPDLIGSLLNN  139



>ref|XP_010036160.1| PREDICTED: importin subunit beta-1-like [Eucalyptus grandis]
 gb|KCW88208.1| hypothetical protein EUGRSUZ_A006001 [Eucalyptus grandis]
Length=872

 Score =   200 bits (509),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+EIT  LLSAQSADA++RTEAE +L QF+EQNLPVFLLSL+ ELSN+ KP ESRRLAG
Sbjct  1    MAMEITQILLSAQSADARVRTEAETSLKQFQEQNLPVFLLSLSFELSNNEKPTESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            I+LKNSLDAK+AS K  LVQQW  I++++KSQIK LLL TL SS ++A HTS+QVIAKIA
Sbjct  61   IILKNSLDAKDASRKNILVQQWIGIEIAMKSQIKELLLRTLASSAQEAWHTSAQVIAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIEIP+ +WPEL+ +LL N
Sbjct  121  SIEIPQKQWPELIATLLNN  139



>ref|XP_004302533.1| PREDICTED: importin subunit beta-1-like [Fragaria vesca subsp. 
vesca]
Length=870

 Score =   199 bits (506),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA +IT +LL+AQSADA IRT+AE+ L QF+EQNLP FLLSL+ EL+N+ KP+ESRRLAG
Sbjct  1    MAADITQYLLAAQSADAGIRTQAESVLRQFQEQNLPGFLLSLSDELANNEKPIESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            I+LKNSLDAK+A TKE LV+QW A+D++ KSQIK  LL TL SSVR+A HTS+QVIAK+A
Sbjct  61   IILKNSLDAKDAVTKERLVEQWMAVDIAFKSQIKERLLLTLGSSVREARHTSAQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SI+IPR +WPEL+  LL N
Sbjct  121  SIDIPRKQWPELIACLLNN  139



>ref|XP_010093556.1| Importin subunit beta-1 [Morus notabilis]
 gb|EXB54263.1| Importin subunit beta-1 [Morus notabilis]
Length=871

 Score =   198 bits (504),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+EIT FLL+AQSADA +RTEAEA L QF+EQN+  FLLSL+ EL+N+ KP ESRRLAG
Sbjct  1    MAMEITQFLLAAQSADANVRTEAEANLRQFQEQNISAFLLSLSFELANNEKPTESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            IVLKNSLDAK+A  K+ L QQW  ID+S+KSQIK++LL TL S V +A HTS+QV+AKIA
Sbjct  61   IVLKNSLDAKDAVMKQGLAQQWMQIDLSIKSQIKDVLLGTLGSPVPEARHTSAQVVAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIEIP+ +WP L+G+LLAN
Sbjct  121  SIEIPQKQWPALIGTLLAN  139



>ref|XP_011466450.1| PREDICTED: importin subunit beta-1-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=701

 Score =   197 bits (501),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+EIT  LLSAQSADA++R EAE  L+QF EQNLP FLLSL+VEL+ND KP+ESR LAG
Sbjct  1    MAMEITQCLLSAQSADARVRNEAEYNLSQFHEQNLPAFLLSLSVELANDEKPIESRTLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            IVLKN LDAK+ +TK+HL Q+W AID++ KSQIK+ LL TL S+V +A HTS+QV+AK+A
Sbjct  61   IVLKNLLDAKDPATKKHLAQKWMAIDIAFKSQIKSWLLQTLGSAVPEARHTSAQVVAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SI++P+ +WPEL+G LL N
Sbjct  121  SIDVPQKQWPELIGHLLNN  139



>ref|XP_009784457.1| PREDICTED: importin subunit beta-1-like [Nicotiana sylvestris]
 ref|XP_009784458.1| PREDICTED: importin subunit beta-1-like [Nicotiana sylvestris]
Length=874

 Score =   198 bits (503),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MALEIT FLL+AQSADAKIRTEAEA L+ F+EQNLP FLLSLAVELS D KP ESRRLAG
Sbjct  1    MALEITQFLLAAQSADAKIRTEAEANLSLFREQNLPGFLLSLAVELSTDVKPTESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            IVLKNSLDAKE   K+ LVQQW  I+ S KSQIK+LLL+ L SSVR+ASHT++QVIAKIA
Sbjct  61   IVLKNSLDAKETVRKQQLVQQWLVIESSYKSQIKSLLLSCLGSSVREASHTAAQVIAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIE+P+ +WPELVGSLL N
Sbjct  121  SIEVPQKQWPELVGSLLIN  139



>ref|XP_006429464.1| hypothetical protein CICLE_v10011045mg [Citrus clementina]
 ref|XP_006481089.1| PREDICTED: importin subunit beta-1-like [Citrus sinensis]
 gb|ESR42704.1| hypothetical protein CICLE_v10011045mg [Citrus clementina]
Length=872

 Score =   197 bits (502),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+EIT FLL+AQSADA IR EAEA L Q ++QNLP FLLSL+VEL N+ KP ESRRLAG
Sbjct  1    MAMEITQFLLAAQSADANIRNEAEANLRQLQQQNLPGFLLSLSVELVNNEKPTESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            I+LKNSLDAK+A+TKE L +QW AID+S KSQ+K+LLL TL S V +A HTS+QVIAKIA
Sbjct  61   IMLKNSLDAKDATTKEDLAKQWLAIDISYKSQVKDLLLRTLASPVPEARHTSAQVIAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIEIP+ +WPEL+ SLL N
Sbjct  121  SIEIPQKQWPELIRSLLNN  139



>gb|KDO56744.1| hypothetical protein CISIN_1g002877mg [Citrus sinensis]
Length=872

 Score =   197 bits (502),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+EIT FLL+AQSADA IR EAEA L Q ++QNLP FLLSL+VEL N+ KP ESRRLAG
Sbjct  1    MAMEITQFLLAAQSADANIRNEAEANLRQLQQQNLPGFLLSLSVELVNNEKPTESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            I+LKNSLDAK+A+TKE L +QW AID+S KSQ+K+LLL TL S V +A HTS+QVIAKIA
Sbjct  61   IMLKNSLDAKDATTKEDLAKQWLAIDISYKSQVKDLLLRTLASPVPEARHTSAQVIAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIEIP+ +WPEL+ SLL N
Sbjct  121  SIEIPQKQWPELIRSLLNN  139



>ref|XP_004305111.1| PREDICTED: importin subunit beta-1-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=868

 Score =   197 bits (501),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+EIT  LLSAQSADA++R EAE  L+QF EQNLP FLLSL+VEL+ND KP+ESR LAG
Sbjct  1    MAMEITQCLLSAQSADARVRNEAEYNLSQFHEQNLPAFLLSLSVELANDEKPIESRTLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            IVLKN LDAK+ +TK+HL Q+W AID++ KSQIK+ LL TL S+V +A HTS+QV+AK+A
Sbjct  61   IVLKNLLDAKDPATKKHLAQKWMAIDIAFKSQIKSWLLQTLGSAVPEARHTSAQVVAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SI++P+ +WPEL+G LL N
Sbjct  121  SIDVPQKQWPELIGHLLNN  139



>gb|ACN40198.1| unknown [Picea sitchensis]
Length=874

 Score =   193 bits (490),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LL+AQS D  +R  AE  L QF+EQNL  FLLSL+VELSN+ KP ESRRLAG
Sbjct  1    MAMEVTQILLNAQSPDGNVRKIAEENLRQFQEQNLAGFLLSLSVELSNNDKPPESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKNSLDAKEA+ KE  +++W A+D+S+KSQIKN LL TL+S+V DA HTSSQVIAKIA
Sbjct  61   LILKNSLDAKEAARKEEFLKRWVALDLSVKSQIKNGLLQTLSSTVPDARHTSSQVIAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            +IEIPR EWPELVG LLAN
Sbjct  121  AIEIPRQEWPELVGVLLAN  139



>ref|XP_011046826.1| PREDICTED: importin subunit beta-1-like isoform X1 [Populus euphratica]
Length=871

 Score =   192 bits (488),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+EIT FLL+AQS DA IRT+AEA+L QF+EQ+LP+FLLSL+VEL+N+ KP+ESRRLAG
Sbjct  1    MAMEITQFLLAAQSPDANIRTQAEASLRQFQEQSLPLFLLSLSVELANNEKPLESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            IVLKNSLDAK++  KEHLVQQW AI++S+K+QIK+LLL TL SS  +A HTS+QVIAK+A
Sbjct  61   IVLKNSLDAKDSVRKEHLVQQWMAIEISMKAQIKDLLLRTLGSSASEARHTSAQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIEIPR +WPEL+GSLL N
Sbjct  121  SIEIPRKQWPELIGSLLKN  139



>ref|XP_011046827.1| PREDICTED: importin subunit beta-1-like isoform X2 [Populus euphratica]
Length=871

 Score =   192 bits (487),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+EIT FLL+AQS DA IRT+AEA+L QF+EQ+LP+FLLSL+VEL+N+ KP+ESRRLAG
Sbjct  1    MAMEITQFLLAAQSPDANIRTQAEASLRQFQEQSLPLFLLSLSVELANNEKPLESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            IVLKNSLDAK++  KEHLVQQW AI++S+K+QIK+LLL TL SS  +A HTS+QVIAK+A
Sbjct  61   IVLKNSLDAKDSVRKEHLVQQWMAIEISMKAQIKDLLLRTLGSSASEARHTSAQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIEIPR +WPEL+GSLL N
Sbjct  121  SIEIPRKQWPELIGSLLKN  139



>ref|XP_002323606.2| hypothetical protein POPTR_0016s13160g [Populus trichocarpa]
 gb|EEF05367.2| hypothetical protein POPTR_0016s13160g [Populus trichocarpa]
Length=871

 Score =   192 bits (487),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+EIT FLL+AQS DA IRT+AEA+L QF+EQ+LP+FLLSL+VEL+N+ KP+ESRRLAG
Sbjct  1    MAMEITQFLLAAQSPDANIRTQAEASLRQFQEQSLPLFLLSLSVELANNEKPLESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            IVLKNSLDAK++  KEHLVQQW AI++S+K+QIK+LLL TL SS  +A HTS+QVIAK+A
Sbjct  61   IVLKNSLDAKDSVRKEHLVQQWMAIEISMKAQIKDLLLRTLGSSASEARHTSAQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIEIPR +WPEL+GSLL N
Sbjct  121  SIEIPRKQWPELIGSLLKN  139



>ref|NP_001154597.1| armadillo/beta-catenin-like repeat-containing protein [Arabidopsis 
thaliana]
 gb|AEE74699.1| armadillo/beta-catenin-like repeat-containing protein [Arabidopsis 
thaliana]
Length=871

 Score =   189 bits (479),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+EIT FLL+AQSADA++RTEAEA+L QF+EQNLP+FLLSL+ EL N+ KP ESRRLAG
Sbjct  1    MAMEITQFLLAAQSADARVRTEAEASLRQFQEQNLPLFLLSLSFELENNDKPAESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            I+LKNSLDAK+++TK+HLV+QW AIDV+LKSQIK+ LL TL SS  +A HTS+QVIAK+A
Sbjct  61   ILLKNSLDAKDSATKDHLVKQWFAIDVALKSQIKDRLLRTLGSSALEARHTSAQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIEIP+ +WPELVGSLL N
Sbjct  121  SIEIPQKQWPELVGSLLNN  139



>ref|XP_010920995.1| PREDICTED: importin subunit beta-1-like [Elaeis guineensis]
Length=872

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 110/139 (79%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+EIT  LLSAQS D +IRT AE  L QF+EQNLP FLLSL+ ELSND KP ESRRLAG
Sbjct  1    MAMEITQILLSAQSPDGQIRTVAEENLKQFQEQNLPQFLLSLSFELSNDQKPPESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            I+LKNSLDAK++  KE L Q+W ++D S+K QIK  LL TL SSV +A HTSSQVIAK+A
Sbjct  61   IILKNSLDAKDSVRKEELTQRWVSVDPSIKVQIKESLLRTLGSSVLEARHTSSQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIEIPR EW EL+G LL N
Sbjct  121  SIEIPRREWQELIGHLLNN  139



>ref|XP_002440917.1| hypothetical protein SORBIDRAFT_09g016470 [Sorghum bicolor]
 gb|EES19347.1| hypothetical protein SORBIDRAFT_09g016470 [Sorghum bicolor]
Length=870

 Score =   187 bits (475),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 113/137 (82%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            ++IT  LL+AQS DA +RT AE+ LTQF+EQNLP FLLSL++ELSND KP ESRRLAGI+
Sbjct  1    MDITQVLLAAQSPDANLRTVAESNLTQFQEQNLPNFLLSLSIELSNDEKPPESRRLAGII  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKNSLDAK+++ KE L QQW ++D S+K +IK LLL TL SSV DA HTSSQVIAK+ASI
Sbjct  61   LKNSLDAKDSAKKELLTQQWVSVDPSVKLKIKELLLVTLGSSVHDARHTSSQVIAKVASI  120

Query  575  EIPRXEWPELVGSLLAN  625
            EIPR EW +LV +LL N
Sbjct  121  EIPRREWQDLVANLLGN  137



>ref|XP_004962394.1| PREDICTED: importin subunit beta-1-like isoform X1 [Setaria italica]
 ref|XP_004962395.1| PREDICTED: importin subunit beta-1-like isoform X2 [Setaria italica]
Length=868

 Score =   186 bits (473),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            ++IT  LL+AQS DA +RT AE+ LTQF+EQNLP FLLSL++ELSND KP ESRRLAGI+
Sbjct  1    MDITQVLLAAQSPDANLRTVAESNLTQFQEQNLPNFLLSLSIELSNDEKPPESRRLAGII  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKNSLDAK+++ KE L QQW ++D S+KS+IK  LL TL SSV DA HTSSQVIAK+ASI
Sbjct  61   LKNSLDAKDSAKKELLTQQWVSVDPSIKSKIKESLLVTLGSSVHDARHTSSQVIAKVASI  120

Query  575  EIPRXEWPELVGSLLAN  625
            EIPR EW +L+  LL N
Sbjct  121  EIPRREWQDLIAQLLGN  137



>ref|XP_008649562.1| PREDICTED: importin subunit beta-1-like [Zea mays]
 gb|AFW77776.1| hypothetical protein ZEAMMB73_295612 [Zea mays]
Length=870

 Score =   183 bits (464),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 110/137 (80%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            ++IT  LL+AQS DA +RT AE  LTQF+EQNLP FLLSL++ELSND KP ESRRLAGI+
Sbjct  1    MDITQVLLAAQSPDANLRTVAEGNLTQFQEQNLPNFLLSLSIELSNDEKPPESRRLAGII  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKNSLDAK+++ KE L QQW ++D S+K +IK  LL TL SSV DA HTSSQVIAK+ASI
Sbjct  61   LKNSLDAKDSAKKELLTQQWVSVDPSIKLKIKESLLVTLGSSVHDARHTSSQVIAKVASI  120

Query  575  EIPRXEWPELVGSLLAN  625
            EIPR EW +L+  LL N
Sbjct  121  EIPRREWQDLIAKLLEN  137



>ref|XP_010937915.1| PREDICTED: importin subunit beta-1-like [Elaeis guineensis]
 ref|XP_010937916.1| PREDICTED: importin subunit beta-1-like [Elaeis guineensis]
Length=872

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 108/139 (78%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+EIT  LLSAQS D KIRT AE  L QF+EQNLP F LSL+VELSND KP ESRRLAG
Sbjct  1    MAMEITQILLSAQSPDGKIRTAAEENLKQFQEQNLPHFFLSLSVELSNDQKPPESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            I+LKNSLDAK++  KE L Q+W ++  S+K QIK  LL TL SSV +A HTSSQVIAK+A
Sbjct  61   IILKNSLDAKDSIRKEELTQRWVSVSSSIKVQIKESLLRTLGSSVSEARHTSSQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIEIPR EW +L+  LL N
Sbjct  121  SIEIPRREWQDLIRQLLNN  139



>ref|XP_006654281.1| PREDICTED: importin subunit beta-1-like [Oryza brachyantha]
Length=868

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 108/137 (79%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            + IT  LL+AQSAD  +RT AE  L QF+EQNLP FLLSL+VELS D KP ESRRLAGI+
Sbjct  1    MNITQILLAAQSADGNLRTVAEGNLKQFQEQNLPNFLLSLSVELSEDEKPPESRRLAGII  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKNSLDAK+++ KE L+QQW ++D S+K +IK  LL TL SSV DA HTSSQVIAKIASI
Sbjct  61   LKNSLDAKDSAKKELLIQQWVSLDPSIKQKIKESLLITLGSSVHDARHTSSQVIAKIASI  120

Query  575  EIPRXEWPELVGSLLAN  625
            EIPR EW EL+  LL N
Sbjct  121  EIPRREWQELIAKLLGN  137



>ref|XP_008656358.1| PREDICTED: importin subunit beta-1-like [Zea mays]
 gb|AFW82194.1| hypothetical protein ZEAMMB73_066246 [Zea mays]
Length=870

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 109/137 (80%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            ++IT  L++AQS DA +RT AE  LTQF+EQN P FLLSL++ELSND KP ESRRLAGI+
Sbjct  1    MDITQVLIAAQSPDANLRTVAEGNLTQFQEQNFPNFLLSLSIELSNDEKPPESRRLAGII  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKNSLDAK+++ KE L QQW ++D S+K +IK LLL TL SSV DA HTSSQVIAK+ASI
Sbjct  61   LKNSLDAKDSAKKELLTQQWVSVDPSIKLKIKELLLVTLGSSVHDARHTSSQVIAKVASI  120

Query  575  EIPRXEWPELVGSLLAN  625
            EI R EW +LV  LL N
Sbjct  121  EIARREWQDLVAKLLGN  137



>ref|XP_009402393.1| PREDICTED: importin subunit beta-1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009402394.1| PREDICTED: importin subunit beta-1-like [Musa acuminata subsp. 
malaccensis]
Length=870

 Score =   181 bits (460),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 111/137 (81%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +EIT  LLSAQS D +IRT AEA L QF+EQ+LP FL+SL+VELS++ KP ESRRLAGI+
Sbjct  1    MEITQILLSAQSPDGQIRTLAEANLKQFQEQSLPHFLVSLSVELSSEQKPPESRRLAGII  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKNSLDAK+   KE L+Q+W ++D S+K+QIK  LL TL S+V +A HTSSQVIAK+ASI
Sbjct  61   LKNSLDAKDTVRKEELIQRWVSVDPSIKAQIKESLLRTLGSTVSEARHTSSQVIAKVASI  120

Query  575  EIPRXEWPELVGSLLAN  625
            EIPR EW EL+G LL N
Sbjct  121  EIPRHEWQELIGQLLNN  137



>ref|XP_004976214.1| PREDICTED: importin subunit beta-1-like [Setaria italica]
Length=868

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 110/137 (80%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            ++IT  LL+AQS DA +RT AE+ L QF+EQNLP FLLSL+VELSND KP ESRRLAGI+
Sbjct  1    MDITQILLAAQSPDANLRTVAESNLKQFQEQNLPNFLLSLSVELSNDEKPPESRRLAGII  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKNSLDAK+++ KE L QQW ++D S+K +IK  LL TL SSV DA HT+SQVIAK+AS+
Sbjct  61   LKNSLDAKDSAKKELLTQQWVSMDPSIKLKIKESLLVTLGSSVHDARHTTSQVIAKVASV  120

Query  575  EIPRXEWPELVGSLLAN  625
            EIPR EW +L+  LL N
Sbjct  121  EIPRREWQDLIAKLLGN  137



>gb|EAY97668.1| hypothetical protein OsI_19590 [Oryza sativa Indica Group]
Length=868

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 108/137 (79%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            + IT  LLSAQSAD  +R  AE  L QF+EQNLP FLLSL+VELS++ KP ESRRLAGI+
Sbjct  1    MNITQILLSAQSADGNLRVVAEGNLKQFQEQNLPNFLLSLSVELSDNEKPPESRRLAGII  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKNSLDAK+++ KE L+QQW ++D S+K +IK  LL TL SSV DA HTSSQVIAK+ASI
Sbjct  61   LKNSLDAKDSAKKELLIQQWVSLDPSIKQKIKESLLITLGSSVHDARHTSSQVIAKVASI  120

Query  575  EIPRXEWPELVGSLLAN  625
            EIPR EW EL+  LL N
Sbjct  121  EIPRREWQELIAKLLGN  137



>ref|NP_001055282.1| Os05g0353400 [Oryza sativa Japonica Group]
 dbj|BAA34861.1| importin-beta1 [Oryza sativa Japonica Group]
 gb|AAV43878.1| importin beta 1 [Oryza sativa Japonica Group]
 dbj|BAF17196.1| Os05g0353400 [Oryza sativa Japonica Group]
 dbj|BAG89593.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63373.1| hypothetical protein OsJ_18185 [Oryza sativa Japonica Group]
Length=868

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 108/137 (79%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            + IT  LLSAQSAD  +R  AE  L QF+EQNLP FLLSL+VELS++ KP ESRRLAGI+
Sbjct  1    MNITQILLSAQSADGNLRVVAEGNLKQFQEQNLPNFLLSLSVELSDNEKPPESRRLAGII  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKNSLDAK+++ KE L+QQW ++D S+K +IK  LL TL SSV DA HTSSQVIAK+ASI
Sbjct  61   LKNSLDAKDSAKKELLIQQWVSLDPSIKQKIKESLLITLGSSVHDARHTSSQVIAKVASI  120

Query  575  EIPRXEWPELVGSLLAN  625
            EIPR EW EL+  LL N
Sbjct  121  EIPRREWQELIAKLLGN  137



>gb|EMS63085.1| Importin subunit beta-1 [Triticum urartu]
Length=869

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 110/137 (80%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            ++IT  LL+AQS D  +R+ AE++L  F+EQNLP FLLSL+VELSNDG+P ESRRLAGI+
Sbjct  1    MDITQILLAAQSPDGNLRSVAESSLKLFQEQNLPRFLLSLSVELSNDGRPPESRRLAGII  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKNSLDAK+ S KE L QQW ++D+S+KS+IK  LL TL SSV DA   SSQVIAK+ASI
Sbjct  61   LKNSLDAKDCSRKELLGQQWVSLDLSIKSRIKESLLLTLGSSVPDARQVSSQVIAKVASI  120

Query  575  EIPRXEWPELVGSLLAN  625
            E+PR EWP+L+  LL N
Sbjct  121  EMPRREWPDLIAKLLGN  137



>ref|XP_010924894.1| PREDICTED: importin subunit beta-1 [Elaeis guineensis]
Length=871

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LL+AQS D  IR  AE +L QF+EQNLP FLLSL+ EL+N+ KPV+SR+LAG
Sbjct  1    MAMEVTQILLNAQSVDGSIRKHAEESLKQFQEQNLPAFLLSLSSELANNEKPVDSRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  LVQ+W A+D+ +K+QIK  LL TL+S V DA  T+SQVIAKIA
Sbjct  61   LILKNALDAKEQHRKNELVQRWLALDIGVKAQIKAYLLQTLSSPVPDARSTASQVIAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P+ +WPEL+GSLL+N
Sbjct  121  GIELPQKQWPELIGSLLSN  139



>gb|EYU25250.1| hypothetical protein MIMGU_mgv1a026101mg [Erythranthe guttata]
Length=869

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 113/137 (82%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +E+T  LLSAQS D+ +R  AE TL QF+EQNLPVFLLSL+ EL+++ KPV+SRRLAG++
Sbjct  1    MEVTQVLLSAQSVDSTVRKHAEETLKQFQEQNLPVFLLSLSAELASEEKPVDSRRLAGLI  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN+LDAKE   K  LVQ+W ++DV++KSQI+  LL TL+S+V DA  T+SQVIAK+A I
Sbjct  61   LKNALDAKEQHRKYELVQRWLSLDVAVKSQIRAYLLQTLSSTVSDARSTASQVIAKVAGI  120

Query  575  EIPRXEWPELVGSLLAN  625
            E+P+ +WPEL+GSLL+N
Sbjct  121  ELPQKQWPELIGSLLSN  137



>ref|XP_006829997.1| hypothetical protein AMTR_s00252p00011130 [Amborella trichopoda]
 gb|ERM97413.1| hypothetical protein AMTR_s00252p00011130 [Amborella trichopoda]
Length=870

 Score =   179 bits (454),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 106/139 (76%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+EIT  LL+AQS D   R  AE  L QF+ QN P FLLSL+ ELSN+ KP +SRRLAG
Sbjct  1    MAMEITQILLNAQSPDGNTRKVAEENLKQFQLQNPPAFLLSLSRELSNEEKPTDSRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            I+LKNSLDAKEAS KE LV+ W  +D +LKSQIK+LL  TL SSV++A HTSSQVIAKIA
Sbjct  61   IILKNSLDAKEASKKEELVKSWVGLDHNLKSQIKDLLTLTLTSSVQEARHTSSQVIAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IEIPR EWP L+  LL N
Sbjct  121  GIEIPRKEWPGLIARLLGN  139



>gb|EMT17557.1| Importin subunit beta-1 [Aegilops tauschii]
Length=869

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 110/137 (80%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            ++IT  LL+AQS D  +R+ AE++L  F+EQNLP FLLSL+VELSNDG+P ESRRLAGI+
Sbjct  1    MDITQILLAAQSPDGNLRSVAESSLKLFQEQNLPRFLLSLSVELSNDGRPPESRRLAGII  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN+LDAK+ S KE L QQW ++D+S+KS+IK  LL TL SSV DA   SSQVIAK+ASI
Sbjct  61   LKNTLDAKDCSRKELLGQQWVSLDLSIKSRIKESLLLTLGSSVPDARQASSQVIAKVASI  120

Query  575  EIPRXEWPELVGSLLAN  625
            E+PR EWP+L+  LL N
Sbjct  121  EMPRREWPDLIAKLLGN  137



>dbj|BAJ93876.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=847

 Score =   178 bits (452),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 110/139 (79%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            M+L++T  LLSAQSAD  IR  AE +L QF+EQNLP FLLSL+ EL+N+ KP ESRRLAG
Sbjct  1    MSLDVTQILLSAQSADGSIRKHAEESLKQFQEQNLPGFLLSLSSELANNEKPEESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  L Q+W A+D  +K+Q+K LLL TL+S V  A  TSSQVIAKIA
Sbjct  61   LILKNALDAKEQHRKNELFQRWLALDAGVKAQVKALLLQTLSSPVASARSTSSQVIAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIEIP+ +WPEL+GSLL+N
Sbjct  121  SIEIPQKQWPELIGSLLSN  139



>gb|EPS61387.1| hypothetical protein M569_13410 [Genlisea aurea]
Length=806

 Score =   178 bits (451),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 110/139 (79%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LLSAQS DA +R  AE  L QF+EQNL  FLLSL+ EL+N+ KPV SR+LAG
Sbjct  1    MAMEVTQVLLSAQSVDATVRKHAEDMLKQFQEQNLASFLLSLSAELANEEKPVNSRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE S K  LVQ+W ++DV+LKSQIK  LL TL+S++ DA  T+SQVIAK A
Sbjct  61   LILKNALDAKEQSRKHELVQRWLSLDVALKSQIKACLLQTLSSTIYDARSTASQVIAKAA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P  +WPEL+GSLL+N
Sbjct  121  GIELPHKQWPELIGSLLSN  139



>ref|XP_010912456.1| PREDICTED: importin subunit beta-1-like [Elaeis guineensis]
Length=871

 Score =   179 bits (453),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LL+AQS D  IR  AE +L QF+EQNLP FLLSL+ EL+N+ KPV+SR+LAG
Sbjct  1    MAMEVTQILLNAQSVDGSIRKHAEESLKQFQEQNLPAFLLSLSSELANNEKPVDSRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  LVQ+W ++D+ +K+QIK+ LL TL+S V DA  T+SQVIAKIA
Sbjct  61   LILKNALDAKEQHRKNELVQRWLSLDMGVKAQIKSYLLQTLSSPVNDARSTASQVIAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P+ +WPEL+GSLL+N
Sbjct  121  GIELPQKQWPELIGSLLSN  139



>dbj|BAJ93177.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97660.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=872

 Score =   179 bits (453),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 110/139 (79%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            M+L++T  LLSAQSAD  IR  AE +L QF+EQNLP FLLSL+ EL+N+ KP ESRRLAG
Sbjct  1    MSLDVTQILLSAQSADGSIRKHAEESLKQFQEQNLPGFLLSLSSELANNEKPEESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  L Q+W A+D  +K+Q+K LLL TL+S V  A  TSSQVIAKIA
Sbjct  61   LILKNALDAKEQHRKNELFQRWLALDAGVKAQVKALLLQTLSSPVASARSTSSQVIAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIEIP+ +WPEL+GSLL+N
Sbjct  121  SIEIPQKQWPELIGSLLSN  139



>gb|EMS49240.1| Importin subunit beta-1 [Triticum urartu]
Length=854

 Score =   178 bits (451),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 109/139 (78%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            M+L++T  LLSAQSAD  IR  AE +L QF+EQNLP FLLSL+ EL+N+ KP ESRRLAG
Sbjct  1    MSLDVTQILLSAQSADGSIRKHAEESLKQFQEQNLPGFLLSLSSELANNEKPEESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  L Q+W A+D  +K+QIK LLL TL+S V  A  TSSQVIAKIA
Sbjct  61   LILKNALDAKEQHRKSELFQRWLALDAGVKAQIKALLLQTLSSPVASARSTSSQVIAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IEIP+ +WPEL+GSLL+N
Sbjct  121  GIEIPQKQWPELIGSLLSN  139



>gb|EMT02152.1| Importin subunit beta-1 [Aegilops tauschii]
Length=807

 Score =   177 bits (449),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 109/139 (78%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            M+L++T  LLSAQSAD  IR  AE +L QF+EQNLP FLLSL+ EL+N+ KP ESRRLAG
Sbjct  1    MSLDVTQILLSAQSADGSIRKHAEESLKQFQEQNLPGFLLSLSSELANNEKPEESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  L Q+W A+D  +K+QIK LLL TL+S V  A  TSSQVIAKIA
Sbjct  61   LILKNALDAKEQHRKSELFQRWLALDSGVKAQIKALLLQTLSSPVASARSTSSQVIAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IEIP+ +WPEL+GSLL+N
Sbjct  121  GIEIPQKQWPELIGSLLSN  139



>emb|CBI23029.3| unnamed protein product [Vitis vinifera]
Length=950

 Score =   178 bits (452),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = +2

Query  200  REEMALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRR  379
            R  MA+E+T  LL+AQS D  IR  AE +L QF++QNLP FLLSL+ EL+ND KPV+SR+
Sbjct  77   RYNMAMEVTQVLLNAQSVDGNIRKHAEESLKQFQDQNLPSFLLSLSGELANDEKPVDSRK  136

Query  380  LAGIVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIA  559
            LAG++LKN+LDAKE   K  LVQ+W ++D ++K+QIK  LL TL+S V DA  T+SQVIA
Sbjct  137  LAGLILKNALDAKEQHRKFELVQRWLSLDAAVKTQIKTCLLQTLSSPVPDARSTASQVIA  196

Query  560  KIASIEIPRXEWPELVGSLLAN  625
            KIA IE+P+ +WPEL+GSLL+N
Sbjct  197  KIAGIELPQKQWPELIGSLLSN  218



>ref|XP_008806225.1| PREDICTED: importin subunit beta-1-like isoform X1 [Phoenix dactylifera]
Length=875

 Score =   177 bits (450),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = +2

Query  197  LREEMALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESR  376
            ++ ++A+E+T  LL+AQS D  IR  AE +L QF+EQN+P FLLSL+ EL+N+ KPV+SR
Sbjct  1    MKHKIAMEVTQILLNAQSVDGSIRKHAEESLKQFQEQNIPAFLLSLSSELANNEKPVDSR  60

Query  377  RLAGIVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVI  556
            +LAG++LKN+LDAKE   K  LVQ+W ++D+ +K+QIK  LL TL+S V DA  T+SQVI
Sbjct  61   KLAGLILKNALDAKEQHRKNELVQRWLSLDIGVKAQIKAYLLQTLSSPVPDARSTASQVI  120

Query  557  AKIASIEIPRXEWPELVGSLLAN  625
            AKIA IE+P+ +WPEL+GSLL+N
Sbjct  121  AKIAGIELPQKQWPELIGSLLSN  143



>ref|XP_008777010.1| PREDICTED: importin subunit beta-1-like [Phoenix dactylifera]
Length=871

 Score =   177 bits (450),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LL+AQS D  IR  AE +L QF+EQNLP FLLSL+ EL+N+ KPV+SR+LAG
Sbjct  1    MAMEVTQILLNAQSVDGSIRKHAEESLKQFQEQNLPAFLLSLSSELANNEKPVDSRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  LVQ+W ++D+ +K+QIK  LL TL+S V DA  T+SQVIAKIA
Sbjct  61   LILKNALDAKEQHRKNELVQRWLSLDMGVKAQIKAYLLQTLSSPVPDARSTASQVIAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P+ +WPEL+GSLL+N
Sbjct  121  GIELPQKQWPELIGSLLSN  139



>ref|XP_002515853.1| importin beta-1, putative [Ricinus communis]
 gb|EEF46522.1| importin beta-1, putative [Ricinus communis]
Length=897

 Score =   177 bits (450),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 110/139 (79%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LL+AQS D  +R  AE +L QF+EQNLP FLLSL+ EL+ND KPV+SR+LAG
Sbjct  1    MAMEVTQALLNAQSVDGNVRKHAEESLKQFQEQNLPGFLLSLSGELANDDKPVDSRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  LVQ+W ++D + KSQIK  LL TL+S V DA  T+SQVIAKIA
Sbjct  61   LILKNALDAKEQHRKYELVQRWLSLDAAAKSQIKTCLLKTLSSLVSDARSTASQVIAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P+ +WPEL+GSLL+N
Sbjct  121  GIELPQKQWPELIGSLLSN  139



>ref|XP_006491990.1| PREDICTED: importin subunit beta-1-like [Citrus sinensis]
Length=871

 Score =   177 bits (448),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LL+AQS D  +R  AE +L QF+EQNLP FLLSL+ EL+ND KPV+SR+LAG
Sbjct  1    MAMEVTQVLLNAQSIDGTVRKHAEESLKQFQEQNLPSFLLSLSGELANDDKPVDSRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  LVQ+W ++D ++K+QIK  LLNTL S+V DA  TSSQVIAK+A
Sbjct  61   LILKNALDAKEQHRKFELVQRWLSLDANVKTQIKTCLLNTLTSTVADARSTSSQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P+ +WPEL+ SLL+N
Sbjct  121  GIELPQKQWPELIVSLLSN  139



>gb|KDO59622.1| hypothetical protein CISIN_1g039062mg [Citrus sinensis]
Length=871

 Score =   177 bits (448),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LL+AQS D  +R  AE +L QF+EQNLP FLLSL+ EL+ND KPV+SR+LAG
Sbjct  1    MAMEVTQVLLNAQSIDGTVRKHAEESLKQFQEQNLPSFLLSLSGELANDDKPVDSRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  LVQ+W ++D ++K+QIK  LLNTL S+V DA  TSSQVIAK+A
Sbjct  61   LILKNALDAKEQHRKFELVQRWLSLDANVKTQIKTCLLNTLTSTVADARSTSSQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P+ +WPEL+ SLL+N
Sbjct  121  GIELPQKQWPELIVSLLSN  139



>ref|XP_002276600.1| PREDICTED: importin subunit beta-1 [Vitis vinifera]
Length=871

 Score =   177 bits (448),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LL+AQS D  IR  AE +L QF++QNLP FLLSL+ EL+ND KPV+SR+LAG
Sbjct  1    MAMEVTQVLLNAQSVDGNIRKHAEESLKQFQDQNLPSFLLSLSGELANDEKPVDSRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  LVQ+W ++D ++K+QIK  LL TL+S V DA  T+SQVIAKIA
Sbjct  61   LILKNALDAKEQHRKFELVQRWLSLDAAVKTQIKTCLLQTLSSPVPDARSTASQVIAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P+ +WPEL+GSLL+N
Sbjct  121  GIELPQKQWPELIGSLLSN  139



>ref|XP_006441143.1| hypothetical protein CICLE_v10023883mg [Citrus clementina]
 gb|ESR54383.1| hypothetical protein CICLE_v10023883mg [Citrus clementina]
Length=871

 Score =   177 bits (448),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LL+AQS D  +R  AE +L QF+EQNLP FLLSL+ EL+ND KPV+SR+LAG
Sbjct  1    MAMEVTQVLLNAQSIDGTVRKHAEESLKQFQEQNLPSFLLSLSGELANDDKPVDSRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  LVQ+W ++D ++K+QIK  LLNTL S+V DA  TSSQVIAK+A
Sbjct  61   LILKNALDAKEQHRKFELVQRWLSLDANVKTQIKTCLLNTLTSTVADARSTSSQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P+ +WPEL+ SLL+N
Sbjct  121  GIELPQKQWPELIVSLLSN  139



>emb|CDP05037.1| unnamed protein product [Coffea canephora]
Length=924

 Score =   177 bits (449),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 113/143 (79%), Gaps = 0/143 (0%)
 Frame = +2

Query  197  LREEMALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESR  376
             R+ MA+E+T  LL+AQS D+ +R  AE +L QF+EQNL VFLLSL+ EL+ + KPV+SR
Sbjct  50   FRDSMAMEVTQVLLNAQSVDSTVRKHAEESLRQFQEQNLSVFLLSLSGELAGEDKPVDSR  109

Query  377  RLAGIVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVI  556
            +LAG++LKN+LDAKE   K  LVQ+W A+DV +K+QIK  LL  L+S V DA  T+SQVI
Sbjct  110  KLAGLILKNALDAKEQHRKYELVQKWLALDVGVKTQIKTCLLQILSSPVPDARSTASQVI  169

Query  557  AKIASIEIPRXEWPELVGSLLAN  625
            AKIA+IE+P+ +WPEL+GSLL+N
Sbjct  170  AKIAAIELPQKQWPELIGSLLSN  192



>ref|XP_010267533.1| PREDICTED: importin subunit beta-1-like [Nelumbo nucifera]
 ref|XP_010267534.1| PREDICTED: importin subunit beta-1-like [Nelumbo nucifera]
 ref|XP_010267535.1| PREDICTED: importin subunit beta-1-like [Nelumbo nucifera]
 ref|XP_010267536.1| PREDICTED: importin subunit beta-1-like [Nelumbo nucifera]
Length=872

 Score =   177 bits (448),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LL+AQ+ D  +R  AE +L QF+EQNLP FLLSL+ ELSND KPV+SR+LAG
Sbjct  1    MAMEVTQILLNAQAVDGTVRKHAEESLKQFQEQNLPSFLLSLSGELSNDDKPVDSRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  LVQ+W ++D ++K+QIK+ LL TL+S V DA  T+SQVIAKIA
Sbjct  61   LILKNALDAKEQHRKLELVQRWLSLDTTVKAQIKSCLLQTLSSPVPDARSTASQVIAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P  +WPEL+G+LL+N
Sbjct  121  GIELPHNQWPELIGALLSN  139



>ref|XP_006360205.1| PREDICTED: importin subunit beta-1-like, partial [Solanum tuberosum]
Length=886

 Score =   177 bits (448),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 115/146 (79%), Gaps = 0/146 (0%)
 Frame = +2

Query  188  VSHLREEMALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPV  367
            + + R  +A+E+T  LL+AQS D+ +R  AE TL QF+EQNLP FLLSL+ EL+++ KPV
Sbjct  10   ICNFRNHIAMEVTQVLLNAQSVDSTVRKHAEETLKQFQEQNLPGFLLSLSGELASEEKPV  69

Query  368  ESRRLAGIVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSS  547
            +SR+LAG++LKN+LDAKE   K  LVQ+W ++DV++K+QIK  LL TL+S   DA  T+S
Sbjct  70   DSRKLAGLILKNALDAKEQHRKYELVQRWLSLDVAVKTQIKTCLLQTLSSPAPDARSTAS  129

Query  548  QVIAKIASIEIPRXEWPELVGSLLAN  625
            QVIAK+A IE+P+ +WPEL+GSLL+N
Sbjct  130  QVIAKVAGIELPQKQWPELIGSLLSN  155



>ref|XP_009791536.1| PREDICTED: importin subunit beta-1-like [Nicotiana sylvestris]
Length=870

 Score =   177 bits (448),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T FLL+AQS D+  R  AE TL QF+EQNLP FLLSL+ EL+++ KPV+SR+LAG
Sbjct  1    MAMEVTQFLLNAQSVDSTARKHAEETLKQFQEQNLPGFLLSLSGELASEDKPVDSRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            +VLKN+LDAKE   K  LVQ+W ++DV++K+QIK  LL TL+S   DA  T+SQVIAK+A
Sbjct  61   LVLKNALDAKEQHRKYELVQRWLSLDVTVKTQIKACLLQTLSSPAPDARSTASQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P+ +WPEL+GSLL+N
Sbjct  121  GIELPQKQWPELIGSLLSN  139



>ref|XP_004962709.1| PREDICTED: importin subunit beta-1-like [Setaria italica]
Length=872

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 107/139 (77%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            M+L++T  LLSAQSAD  IR  AE +L QF+EQNLP FLLSL+ EL+N+ KP ESRRLAG
Sbjct  1    MSLDVTQVLLSAQSADGAIRKHAEESLKQFQEQNLPGFLLSLSTELANEEKPEESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  L Q+W A+D   K+QIK LLL TL S V  A  T+SQVIAK+A
Sbjct  61   LILKNALDAKEQHRKSELFQRWLALDAGAKAQIKGLLLQTLTSPVASARSTASQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IEIP+ +WPEL+GSLL+N
Sbjct  121  GIEIPQKQWPELIGSLLSN  139



>ref|XP_008645457.1| PREDICTED: uncharacterized protein LOC100383778 isoform X1 [Zea 
mays]
 ref|XP_008645461.1| PREDICTED: uncharacterized protein LOC100383778 isoform X1 [Zea 
mays]
 tpg|DAA47086.1| TPA: hypothetical protein ZEAMMB73_372195 [Zea mays]
Length=872

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 107/139 (77%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            M+L++T  LLSAQSAD  +R  AE +L QF+EQNLP FLLSL+ EL+N+ KP ESRRLAG
Sbjct  1    MSLDVTQVLLSAQSADGAVRKHAEESLKQFQEQNLPGFLLSLSSELANEEKPEESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  L Q+W A+D   K+QIK LLL TL S V  A  T+SQVIAK+A
Sbjct  61   LILKNALDAKEQHRKNELFQRWLALDAGAKAQIKGLLLQTLTSPVASARSTASQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IEIP+ +WPEL+GSLLAN
Sbjct  121  GIEIPQKQWPELIGSLLAN  139



>ref|XP_002986725.1| hypothetical protein SELMODRAFT_124593 [Selaginella moellendorffii]
 gb|EFJ12288.1| hypothetical protein SELMODRAFT_124593 [Selaginella moellendorffii]
Length=870

 Score =   176 bits (446),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MALE+T  LL+AQSAD  +R  AE  L QF+EQNLP+FL+SL++EL+N  KP ESRRLAG
Sbjct  1    MALEVTPILLNAQSADKDVRKFAEDNLKQFEEQNLPLFLVSLSIELANSAKPAESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKNSLDAK+A  K  L Q+W A+D + K+QIK  L+ +L + V DASHT++QVIAK+A
Sbjct  61   LILKNSLDAKDAQRKHELAQKWLALDAAAKAQIKASLMESLAAPVLDASHTAAQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            +IEIP+ +WPEL+G LL+N
Sbjct  121  AIEIPQQQWPELIGLLLSN  139



>gb|EYU19659.1| hypothetical protein MIMGU_mgv1a001181mg [Erythranthe guttata]
Length=871

 Score =   176 bits (446),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LLSAQ+ D+ +R  AE TL QF+EQNLP FLLSL+ EL+N+ KPVESR+LAG
Sbjct  1    MAMEVTQVLLSAQAVDSTVRKHAEETLKQFQEQNLPGFLLSLSGELANEEKPVESRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  LVQ+W ++DV+LKSQIK  LL TL+S+  DA  T+SQVIAK+A
Sbjct  61   LILKNALDAKEQHRKYELVQRWLSLDVALKSQIKACLLQTLSSTASDARSTASQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P+ +WPEL+ SLL+N
Sbjct  121  GIELPQKQWPELILSLLSN  139



>gb|KDP42918.1| hypothetical protein JCGZ_23860 [Jatropha curcas]
Length=869

 Score =   176 bits (446),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 110/137 (80%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +E+T  LL+AQS D  +R  AE +L QF+EQNLP+FL SL+ EL+ND KPV+SR+LAG++
Sbjct  1    MEVTQVLLNAQSIDGNVRKHAEESLKQFQEQNLPLFLFSLSGELANDEKPVDSRKLAGLI  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN+LDAKE   K  LVQ+W ++D ++KSQIK  LLNTL+S V DA  T+SQV+AKIA I
Sbjct  61   LKNALDAKEQHRKFELVQRWLSLDAAIKSQIKTSLLNTLSSPVSDARSTASQVVAKIAGI  120

Query  575  EIPRXEWPELVGSLLAN  625
            E+P+ +WPELVGSLL+N
Sbjct  121  ELPQKQWPELVGSLLSN  137



>ref|XP_006350520.1| PREDICTED: importin subunit beta-1-like [Solanum tuberosum]
Length=871

 Score =   176 bits (445),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LL+AQS D+ +R  +E TL QF+EQNLP FLLSL+ EL+N+ KPV+SR+LAG
Sbjct  1    MAMEVTQILLNAQSVDSTVRKHSEETLKQFQEQNLPGFLLSLSGELANEEKPVDSRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  LVQ+W ++D+++K+QIK  LL TL+S V DA  T+SQVIAK+A
Sbjct  61   LILKNALDAKEQHRKFELVQRWLSLDMAVKAQIKTCLLQTLSSPVPDAHSTASQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P+ +WPEL+GSLL+N
Sbjct  121  GIELPQKQWPELIGSLLSN  139



>ref|XP_004234984.1| PREDICTED: importin subunit beta-1 [Solanum lycopersicum]
Length=871

 Score =   176 bits (445),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LL+AQS D+ +R  +E TL QF+EQNLP FLLSL+ EL+N+ KPV+SR+LAG
Sbjct  1    MAMEVTQILLNAQSVDSTVRKHSEETLKQFQEQNLPGFLLSLSGELANEEKPVDSRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  LVQ+W ++D+++K+QIK  LL TL+S V DA  T+SQVIAK+A
Sbjct  61   LILKNALDAKEQHRKFELVQRWLSLDMAVKAQIKTCLLQTLSSPVPDAHSTASQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P+ +WPEL+GSLL+N
Sbjct  121  GIELPQKQWPELIGSLLSN  139



>gb|EMT08648.1| Importin subunit beta-1 [Aegilops tauschii]
Length=872

 Score =   175 bits (444),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 108/139 (78%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            M+L++T  LLSAQSAD  IR  AE +L QF+EQNLP FLLSL+ EL+ + KP ESRRLAG
Sbjct  1    MSLDVTQILLSAQSADGSIRKHAEESLKQFQEQNLPGFLLSLSTELATNEKPEESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  L Q+W A+D  +K+Q+K LLL TL+S V  A  TSSQVIAKIA
Sbjct  61   LILKNALDAKEQHRKNELFQRWLALDAGVKAQVKALLLQTLSSPVASARSTSSQVIAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IEIP+ +WPEL+GSLL+N
Sbjct  121  GIEIPQKQWPELIGSLLSN  139



>ref|XP_002526256.1| importin beta-1, putative [Ricinus communis]
 gb|EEF36125.1| importin beta-1, putative [Ricinus communis]
Length=871

 Score =   175 bits (443),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LL+AQS D  +R  AE +L QF+EQNLP FLLSL+ EL+ND KPV+SR+LAG
Sbjct  1    MAMEVTQVLLNAQSIDGNVRKHAEESLKQFQEQNLPSFLLSLSGELANDEKPVDSRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  LVQ+W ++D ++KSQIK  LL TL+S + DA  T+SQVIAK+A
Sbjct  61   LILKNALDAKEQHRKLELVQRWLSLDNNVKSQIKAFLLKTLSSPIADARSTASQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P+ +WPEL+GSLL+N
Sbjct  121  GIELPQKQWPELIGSLLSN  139



>emb|CAC79691.1| Importin beta-like protein [Oryza sativa Indica Group]
Length=864

 Score =   175 bits (443),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = +2

Query  233  LLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIVLKNSLD  412
            LLSAQSAD  +R  AE  L QF+EQNLP FLLSL+VELS++ KP ESRRLAGI+LKNSLD
Sbjct  3    LLSAQSADGNLRVVAEGNLKQFQEQNLPNFLLSLSVELSDNEKPPESRRLAGIILKNSLD  62

Query  413  AKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASIEIPRXE  592
            AK+++ KE L+QQW ++D S+K +IK  LL TL SSV DA HTSSQVIAK+ASIEIPR E
Sbjct  63   AKDSAKKELLIQQWVSLDPSIKQKIKESLLITLGSSVHDARHTSSQVIAKVASIEIPRRE  122

Query  593  WPELVGSLLAN  625
            W +L+  LL N
Sbjct  123  WQQLIAKLLGN  133



>ref|XP_001782481.1| predicted protein [Physcomitrella patens]
 gb|EDQ52700.1| predicted protein [Physcomitrella patens]
Length=875

 Score =   175 bits (443),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 110/139 (79%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MALE+T  LL+AQS D  +R  AE  L Q++EQNL  FL+SL+ EL+ND KP ESRRLAG
Sbjct  1    MALEVTQILLNAQSPDGTVRKIAEDNLKQYQEQNLSAFLVSLSHELANDDKPPESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKNSLDAKE+S K  LV +W A+D ++K+QIK  L  TL+S V DA HT++QVIAKIA
Sbjct  61   LILKNSLDAKESSRKHELVTRWVALDSTVKAQIKPALSQTLSSMVADARHTAAQVIAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            +IE+P+ +WPELVGSLLAN
Sbjct  121  AIELPQGDWPELVGSLLAN  139



>ref|XP_011075956.1| PREDICTED: importin subunit beta-1-like [Sesamum indicum]
Length=869

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +E+T  LLSAQ+ D+ +R  AE TL QF+EQNLP FLLSL+ EL+++ KPV+SR+LAG++
Sbjct  1    MEVTQVLLSAQAVDSTVRKHAEETLKQFQEQNLPGFLLSLSAELASEEKPVDSRKLAGLI  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN+LDAKE   K  LVQ+W ++DV++KSQIK  LL TL+S+V DA  T+SQVIAK+A I
Sbjct  61   LKNALDAKEQHRKYELVQRWLSLDVAVKSQIKACLLQTLSSTVADARSTASQVIAKVAGI  120

Query  575  EIPRXEWPELVGSLLAN  625
            E+P+ +WPEL+GSLL+N
Sbjct  121  ELPQKQWPELIGSLLSN  137



>ref|XP_010053097.1| PREDICTED: importin subunit beta-1 [Eucalyptus grandis]
 ref|XP_010053098.1| PREDICTED: importin subunit beta-1 [Eucalyptus grandis]
 gb|KCW77347.1| hypothetical protein EUGRSUZ_D01707 [Eucalyptus grandis]
 gb|KCW77348.1| hypothetical protein EUGRSUZ_D01707 [Eucalyptus grandis]
Length=872

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 107/139 (77%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LL+AQS D  +R  AE  L QF+EQNLP F LSLA EL+N+ KP ESR+LAG
Sbjct  1    MAMEVTQILLNAQSIDGSVRKHAEDNLKQFQEQNLPGFFLSLAGELANEEKPAESRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  LVQ+W A+D ++K+QIKN L+ TL+S   DA  T+SQVIAK+A
Sbjct  61   LILKNALDAKEQHRKYELVQRWLALDAAVKAQIKNCLIKTLSSPSHDARSTASQVIAKLA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P+ EWPEL+G+LL N
Sbjct  121  GIELPQKEWPELIGTLLTN  139



>ref|XP_001776522.1| predicted protein [Physcomitrella patens]
 gb|EDQ58655.1| predicted protein [Physcomitrella patens]
Length=874

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 109/139 (78%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MALE+T  LL+AQS D  +R  AE  L QF+E NL  FL+SL+ EL+N+ KP ESRRLAG
Sbjct  1    MALEVTQILLNAQSPDGTVRKIAEDNLKQFQEHNLSAFLVSLSHELANNDKPPESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKNSLDAKE++ K+ LV +W A+D S+K+QIK  L  TL S V DA HTS+QVIAKIA
Sbjct  61   LILKNSLDAKESARKQELVTRWVALDPSVKAQIKTALSQTLASVVADARHTSAQVIAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            +IE+P+ EWPELVGSLLAN
Sbjct  121  AIELPQGEWPELVGSLLAN  139



>ref|XP_002442347.1| hypothetical protein SORBIDRAFT_08g018670 [Sorghum bicolor]
 gb|EES16185.1| hypothetical protein SORBIDRAFT_08g018670 [Sorghum bicolor]
Length=872

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 106/139 (76%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            M+L++T  LLSAQSAD  IR  AE +L QF+EQNLP FLLSL+ EL+N+ KP ESRRLAG
Sbjct  1    MSLDVTQVLLSAQSADGAIRKHAEESLKQFQEQNLPGFLLSLSSELANEEKPEESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  L Q+W A+D   K+QIK LLL TL S V  A  T+SQVIAK+A
Sbjct  61   LILKNALDAKEQHRKNELFQRWLALDAGAKAQIKGLLLQTLTSPVASARSTASQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IEIP+ +WPEL+GSLL N
Sbjct  121  GIEIPQKQWPELIGSLLIN  139



>gb|EMS47373.1| Importin subunit beta-1 [Triticum urartu]
Length=872

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 108/139 (78%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            M+L++T  LLSAQSAD  IR  AE +L QF+EQNLP FLLSL+ EL+ + KP ESRRLAG
Sbjct  1    MSLDVTQILLSAQSADGLIRKHAEESLKQFQEQNLPGFLLSLSTELATNEKPEESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  L Q+W A+D  +K+Q+K LLL TL+S V  A  TSSQVIAKIA
Sbjct  61   LILKNALDAKEQHRKNELFQRWLALDAGVKAQVKALLLQTLSSPVASARSTSSQVIAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IEIP+ +WPEL+GSLL+N
Sbjct  121  GIEIPQKQWPELIGSLLSN  139



>ref|XP_011044673.1| PREDICTED: importin subunit beta-1-like [Populus euphratica]
 ref|XP_011044674.1| PREDICTED: importin subunit beta-1-like [Populus euphratica]
Length=871

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 108/139 (78%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LL+AQS D  +R  AE +L QF+EQNLP FL SL+ EL+ND KPV+SR+LAG
Sbjct  1    MAMEVTQVLLNAQSIDGNVRKHAEESLKQFQEQNLPGFLFSLSGELANDEKPVDSRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  LVQ+W ++D ++K QIK  LL TL S V DA  T+SQVIAKIA
Sbjct  61   LILKNALDAKEQHRKLELVQRWLSLDSNVKGQIKAFLLKTLASPVPDARSTASQVIAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P+ +WPEL+GSLLAN
Sbjct  121  GIELPQRQWPELIGSLLAN  139



>gb|KGN49851.1| hypothetical protein Csa_5G139290 [Cucumis sativus]
Length=871

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MALE+T  LL+AQS DA +R +AE +L QF+EQNLP FLLSL+ EL ++ KPV+SR+LAG
Sbjct  1    MALEVTQVLLNAQSIDATVRKQAEDSLRQFQEQNLPSFLLSLSNELGSEEKPVDSRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  LVQ+W ++D ++K+QIK  LLNTL+S+V DA  T+SQVIAKIA
Sbjct  61   LILKNALDAKEQHRKFELVQRWLSLDGNVKTQIKACLLNTLSSAVADARSTASQVIAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P  +WPEL+GSLL N
Sbjct  121  GIELPHKQWPELIGSLLLN  139



>gb|KGN49853.1| hypothetical protein Csa_5G139310 [Cucumis sativus]
Length=871

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MALE+T  LL+AQS DA +R +AE +L QF+EQNLP FLLSL+ EL ++ KPV+SR+LAG
Sbjct  1    MALEVTQVLLNAQSIDATVRKQAEDSLRQFQEQNLPSFLLSLSNELGSEEKPVDSRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  LVQ+W ++D ++K+QIK  LLNTL+S+V DA  T+SQVIAKIA
Sbjct  61   LILKNALDAKEQHRKFELVQRWLSLDGNVKTQIKACLLNTLSSAVADARSTASQVIAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P  +WPEL+GSLL N
Sbjct  121  GIELPHKQWPELIGSLLLN  139



>ref|XP_004145935.1| PREDICTED: importin subunit beta-1-like [Cucumis sativus]
Length=871

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MALE+T  LL+AQS DA +R +AE +L QF+EQNLP FLLSL+ EL ++ KPV+SR+LAG
Sbjct  1    MALEVTQVLLNAQSIDATVRKQAEDSLRQFQEQNLPSFLLSLSNELGSEEKPVDSRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  LVQ+W ++D ++K+QIK  LLNTL+S+V DA  T+SQVIAKIA
Sbjct  61   LILKNALDAKEQHRKFELVQRWLSLDGNVKTQIKACLLNTLSSAVADARSTASQVIAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P  +WPEL+GSLL N
Sbjct  121  GIELPHKQWPELIGSLLLN  139



>tpg|DAA55196.1| TPA: hypothetical protein ZEAMMB73_213306 [Zea mays]
Length=872

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 107/139 (77%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            M+L++T  LLSAQSAD  IR  AE +L QF+EQNLP FLLSL+ E++++ KP ESRRLAG
Sbjct  1    MSLDVTQVLLSAQSADGAIRKHAEESLMQFQEQNLPGFLLSLSSEMASEEKPEESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  L Q+W A+D   K+ IK LLL TL SSV  A  T+SQVIAK+A
Sbjct  61   LILKNALDAKEQHRKNELFQRWLALDTGAKAHIKGLLLQTLTSSVASARSTASQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IEIP+ +WPEL+GSLLAN
Sbjct  121  GIEIPQKQWPELIGSLLAN  139



>ref|XP_009631702.1| PREDICTED: importin subunit beta-1-like [Nicotiana tomentosiformis]
Length=869

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 109/137 (80%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +E+T FLL+AQS D+ +R  AE TL QF+EQNLP FLLSL+ EL++D KPV+ R+LAG+V
Sbjct  1    MEVTQFLLNAQSVDSAVRKHAEETLKQFQEQNLPGFLLSLSGELASDDKPVDGRKLAGLV  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN+LDAKE   K  LVQ W A+D ++K+QIK  LL TL+S V DA  T+SQVIAK+A I
Sbjct  61   LKNALDAKEQHRKFELVQGWLALDAAVKNQIKTCLLQTLSSPVSDAHSTASQVIAKVAGI  120

Query  575  EIPRXEWPELVGSLLAN  625
            E+P+ +WPELVGSLL++
Sbjct  121  ELPQKQWPELVGSLLSS  137



>ref|XP_010266571.1| PREDICTED: importin subunit beta-1-like [Nelumbo nucifera]
Length=873

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 109/139 (78%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LL+AQ+ D  +R  AE +L QF+EQNLP FLLSL+ EL+ND KPV+SR+LAG
Sbjct  1    MAMEVTQVLLNAQAVDGTVRKHAEESLKQFQEQNLPSFLLSLSGELANDDKPVDSRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  LVQ+W ++D S+K+QIK  LL TL+S V DA  T+SQVIAKIA
Sbjct  61   LILKNALDAKEQHRKFELVQRWLSLDSSVKAQIKTCLLQTLSSPVPDARSTASQVIAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P  +WPEL+ +LLAN
Sbjct  121  GIELPHNQWPELIDALLAN  139



>ref|XP_008806235.1| PREDICTED: importin subunit beta-1-like isoform X2 [Phoenix dactylifera]
Length=869

 Score =   174 bits (440),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 109/137 (80%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +E+T  LL+AQS D  IR  AE +L QF+EQN+P FLLSL+ EL+N+ KPV+SR+LAG++
Sbjct  1    MEVTQILLNAQSVDGSIRKHAEESLKQFQEQNIPAFLLSLSSELANNEKPVDSRKLAGLI  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN+LDAKE   K  LVQ+W ++D+ +K+QIK  LL TL+S V DA  T+SQVIAKIA I
Sbjct  61   LKNALDAKEQHRKNELVQRWLSLDIGVKAQIKAYLLQTLSSPVPDARSTASQVIAKIAGI  120

Query  575  EIPRXEWPELVGSLLAN  625
            E+P+ +WPEL+GSLL+N
Sbjct  121  ELPQKQWPELIGSLLSN  137



>ref|XP_009420728.1| PREDICTED: importin subunit beta-1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009420737.1| PREDICTED: importin subunit beta-1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009420745.1| PREDICTED: importin subunit beta-1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009420753.1| PREDICTED: importin subunit beta-1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009420761.1| PREDICTED: importin subunit beta-1-like [Musa acuminata subsp. 
malaccensis]
Length=869

 Score =   173 bits (439),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 109/137 (80%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +E+T  LL+AQS D  +R  AE +L QF+EQN P FLLSL+ EL+N+ KPV+SR+LAG++
Sbjct  1    MEVTQILLNAQSVDGTVRKHAEESLKQFQEQNFPTFLLSLSSELANNDKPVDSRKLAGLI  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN+LDAKE   K  LVQ+W ++DV++K+Q+K  LL TL+S V DA  T+SQVIAKIA I
Sbjct  61   LKNALDAKEQHRKNELVQRWLSLDVAVKAQVKACLLQTLSSPVPDARSTASQVIAKIAGI  120

Query  575  EIPRXEWPELVGSLLAN  625
            E+P+ +WPEL+GSLL+N
Sbjct  121  ELPQKQWPELIGSLLSN  137



>ref|XP_008673110.1| PREDICTED: uncharacterized protein LOC100381984 isoform X1 [Zea 
mays]
Length=962

 Score =   174 bits (440),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 107/139 (77%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            M+L++T  LLSAQSAD  IR  AE +L QF+EQNLP FLLSL+ E++++ KP ESRRLAG
Sbjct  91   MSLDVTQVLLSAQSADGAIRKHAEESLMQFQEQNLPGFLLSLSSEMASEEKPEESRRLAG  150

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  L Q+W A+D   K+ IK LLL TL SSV  A  T+SQVIAK+A
Sbjct  151  LILKNALDAKEQHRKNELFQRWLALDTGAKAHIKGLLLQTLTSSVASARSTASQVIAKVA  210

Query  569  SIEIPRXEWPELVGSLLAN  625
             IEIP+ +WPEL+GSLLAN
Sbjct  211  GIEIPQKQWPELIGSLLAN  229



>gb|KDO76624.1| hypothetical protein CISIN_1g002876mg [Citrus sinensis]
Length=657

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 109/139 (78%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            M+ E+T  LL+AQS D  +R +AE +L Q++EQNLP FLLSLA EL ND KPVESR+LAG
Sbjct  1    MSAEVTQILLNAQSVDGTVRKQAEESLKQYQEQNLPGFLLSLAGELVNDEKPVESRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  LVQ+W ++D S+K+QIK+ +L TL+S   DA  T+SQV+AK+A
Sbjct  61   LILKNALDAKEQHRKFELVQRWLSLDSSVKAQIKSFILKTLSSPAHDARSTASQVVAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P  +WPEL+G+LL+N
Sbjct  121  GIELPHKQWPELIGALLSN  139



>ref|XP_003525330.1| PREDICTED: importin subunit beta-1-like [Glycine max]
 gb|KHM99874.1| Importin subunit beta-1 [Glycine soja]
Length=870

 Score =   173 bits (439),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 107/139 (77%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LL+AQ+ D  +R +AE +L QF+EQNLP FL SLA EL+ND KP ESR+LAG
Sbjct  1    MAMEVTQILLNAQAVDGTLRKQAEESLKQFQEQNLPSFLFSLAGELANDDKPAESRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K   VQ+W ++D +LKSQIK  LL TL+S   DA  T+SQVIAK+A
Sbjct  61   LILKNALDAKEQHRKIEFVQRWLSLDPTLKSQIKAFLLRTLSSPSLDARSTASQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P  +WPEL+GSLL+N
Sbjct  121  GIELPHKQWPELIGSLLSN  139



>gb|EMT25491.1| Importin subunit beta-1 [Aegilops tauschii]
Length=868

 Score =   173 bits (439),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 108/137 (79%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            ++IT  LL+AQS D  +R+ AE  + QF+EQNL  FLLSL+VELSND +P ESRRLAGI+
Sbjct  1    MDITQILLAAQSPDGNLRSAAEGNIKQFQEQNLSNFLLSLSVELSNDERPPESRRLAGII  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKNSLDAK+++ KE L+QQW ++D S+K QIK  LL TL SSV DA  TSSQVIAKIASI
Sbjct  61   LKNSLDAKDSAKKELLIQQWVSLDPSIKLQIKESLLITLGSSVGDARQTSSQVIAKIASI  120

Query  575  EIPRXEWPELVGSLLAN  625
            EIPR EW +L+  LL+N
Sbjct  121  EIPRREWQDLIAKLLSN  137



>gb|KDO76623.1| hypothetical protein CISIN_1g002876mg [Citrus sinensis]
Length=653

 Score =   171 bits (434),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 109/139 (78%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            M+ E+T  LL+AQS D  +R +AE +L Q++EQNLP FLLSLA EL ND KPVESR+LAG
Sbjct  1    MSAEVTQILLNAQSVDGTVRKQAEESLKQYQEQNLPGFLLSLAGELVNDEKPVESRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  LVQ+W ++D S+K+QIK+ +L TL+S   DA  T+SQV+AK+A
Sbjct  61   LILKNALDAKEQHRKFELVQRWLSLDSSVKAQIKSFILKTLSSPAHDARSTASQVVAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P  +WPEL+G+LL+N
Sbjct  121  GIELPHKQWPELIGALLSN  139



>ref|XP_009784181.1| PREDICTED: importin subunit beta-1-like [Nicotiana sylvestris]
Length=871

 Score =   173 bits (438),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LL+AQS D+ +R  AE TL QF+EQNLP FLLSL+ EL+++ KPV+SR+LAG
Sbjct  1    MAMEVTQVLLNAQSVDSTVRKHAEETLKQFQEQNLPGFLLSLSGELASEEKPVDSRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  LVQ+W ++D+++K+QIK  LL TL+S   DA  T+SQVIAK+A
Sbjct  61   LILKNALDAKEQHRKFELVQRWLSLDMAVKAQIKTCLLQTLSSLASDARSTASQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIE+P+ +WPEL+GSLL+N
Sbjct  121  SIELPQKQWPELIGSLLSN  139



>ref|XP_011024861.1| PREDICTED: importin subunit beta-1-like [Populus euphratica]
Length=871

 Score =   172 bits (437),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 108/139 (78%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LL+AQS D  +R  AE +L QF+EQNLP FLLSL+ EL+ND KPV+SR+LAG
Sbjct  1    MAMEVTQVLLNAQSIDGNVRKHAEESLKQFQEQNLPSFLLSLSGELANDEKPVDSRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  LVQ+W ++D + K QIK  LL TL S V DA  T+SQVIAKIA
Sbjct  61   LILKNALDAKEQHRKLELVQRWLSLDNNAKGQIKACLLKTLASPVPDARSTASQVIAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P+ +WPEL+GSLL+N
Sbjct  121  GIELPQRQWPELIGSLLSN  139



>ref|XP_002318437.1| importin beta-2 family protein [Populus trichocarpa]
 gb|EEE96657.1| importin beta-2 family protein [Populus trichocarpa]
Length=871

 Score =   172 bits (436),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 108/139 (78%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LL+AQS D  +R  AE +L QF+EQNLP FLLSL+ EL+ND KPV+SR+LAG
Sbjct  1    MAMEVTQVLLNAQSIDGNVRKHAEESLKQFQEQNLPSFLLSLSGELANDEKPVDSRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  LVQ+W ++D + K QIK  LL TL S V DA  T+SQVIAKIA
Sbjct  61   LILKNALDAKEQHRKLELVQRWLSLDNNAKGQIKACLLKTLASPVPDARSTASQVIAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P+ +WPEL+GSLL+N
Sbjct  121  GIELPQRQWPELIGSLLSN  139



>ref|XP_010266593.1| PREDICTED: importin subunit beta-1-like [Nelumbo nucifera]
Length=873

 Score =   172 bits (436),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 109/139 (78%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LL+AQ+ D  +R  AE +L QF+EQNLP FLLSL+ EL+ND KPV+SR+LAG
Sbjct  1    MAMEVTQVLLNAQAVDGTVRKHAEESLKQFQEQNLPSFLLSLSGELANDDKPVDSRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  LVQ+W ++D S+K+QIK  LL TL+S V DA  T+SQVIAKIA
Sbjct  61   LILKNALDAKEQHRKFELVQRWLSLDSSVKAQIKTCLLQTLSSPVPDARSTASQVIAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P  +WPEL+ +LL+N
Sbjct  121  GIELPHNQWPELIDALLSN  139



>emb|CDP05039.1| unnamed protein product [Coffea canephora]
Length=943

 Score =   172 bits (437),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 112/143 (78%), Gaps = 0/143 (0%)
 Frame = +2

Query  197  LREEMALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESR  376
            L   MA+E+T  LL+AQS D+ +R  AE +L QF+EQNL VFLLSL+ EL+ + KPV+SR
Sbjct  69   LGGNMAMEVTQVLLNAQSVDSTVRKHAEESLRQFQEQNLSVFLLSLSGELAGEDKPVDSR  128

Query  377  RLAGIVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVI  556
            +LAG++LKN+LDAKE   K  LVQ+W  +D+ +K+QIK  LL TL+S V DA  T+SQVI
Sbjct  129  KLAGLILKNALDAKEQHRKYELVQRWLTLDMGVKTQIKACLLQTLSSPVHDARSTASQVI  188

Query  557  AKIASIEIPRXEWPELVGSLLAN  625
            AK+A+IE+P+ +WPEL+GSLL+N
Sbjct  189  AKVAAIELPQKQWPELIGSLLSN  211



>ref|XP_009588558.1| PREDICTED: importin subunit beta-1-like [Nicotiana tomentosiformis]
 ref|XP_009588566.1| PREDICTED: importin subunit beta-1-like [Nicotiana tomentosiformis]
Length=870

 Score =   172 bits (436),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LL+AQS D+  R  AE TL QF+EQNLP FLLSL+ EL+++ KPV+SR+LAG
Sbjct  1    MAMEVTQLLLNAQSVDSTARKHAEETLKQFQEQNLPGFLLSLSGELASEDKPVDSRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  LV++W ++DV++K+QIK  LL TL+S   DA  T+SQVIAK+A
Sbjct  61   LILKNALDAKEQHRKYELVKRWLSLDVTVKTQIKTCLLQTLSSPAPDARSTASQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P+ +WPEL+GSLL+N
Sbjct  121  GIELPQKQWPELIGSLLSN  139



>ref|XP_002321393.2| hypothetical protein POPTR_0015s01270g [Populus trichocarpa]
 gb|EEF05520.2| hypothetical protein POPTR_0015s01270g [Populus trichocarpa]
Length=871

 Score =   172 bits (436),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 108/139 (78%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LL+AQS D  +R  AE +L QF+EQNLP FL SL+ EL+ND KPV+SR+LAG
Sbjct  1    MAMEVTQVLLNAQSIDGNVRKHAEESLKQFQEQNLPGFLFSLSGELANDEKPVDSRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  LVQ+W ++D ++K QIK  LL TL S V DA  T+SQVIAKIA
Sbjct  61   LILKNALDAKEQHRKLELVQRWLSLDNNVKGQIKVFLLKTLASPVPDARSTASQVIAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P+ +WPEL+GSLL+N
Sbjct  121  GIELPQRQWPELIGSLLSN  139



>ref|XP_010537073.1| PREDICTED: importin subunit beta-1 [Tarenaya hassleriana]
Length=871

 Score =   172 bits (435),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 107/139 (77%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MALE+T  LL+AQS D  +R  AE +L QF+EQNL  FLLSLA EL+ND KP+ESR+LAG
Sbjct  1    MALEVTQLLLNAQSIDGTVRKHAEESLKQFQEQNLAGFLLSLAGELANDEKPIESRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            +VLKN+LDAKE   K  L Q+W ++D + KSQIK  LL TL+SSV DA  T+SQVIAK+A
Sbjct  61   LVLKNALDAKEQHRKYELAQRWLSLDTTTKSQIKTFLLKTLSSSVPDARSTASQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P  +WPEL+ SLL+N
Sbjct  121  GIELPLKQWPELIVSLLSN  139



>ref|XP_009626307.1| PREDICTED: importin subunit beta-1-like [Nicotiana tomentosiformis]
Length=871

 Score =   172 bits (435),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LL+AQS D+ +R  AE TL QF+EQNLP FLLSL+ EL+++ KPV+SR+LAG
Sbjct  1    MAMEVTQVLLNAQSVDSTVRKHAEETLKQFQEQNLPGFLLSLSGELASEEKPVDSRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  LVQ+W ++D+++K+QIK  LL TL+S   DA  T+SQVIAK+A
Sbjct  61   LILKNALDAKEQHRKFELVQRWLSLDMAVKAQIKTCLLQTLSSLASDARSTASQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P+ +WPEL+GSLL+N
Sbjct  121  GIELPQKQWPELIGSLLSN  139



>ref|XP_006439284.1| hypothetical protein CICLE_v10018814mg [Citrus clementina]
 ref|XP_006476338.1| PREDICTED: importin subunit beta-1-like [Citrus sinensis]
 gb|ESR52524.1| hypothetical protein CICLE_v10018814mg [Citrus clementina]
 gb|KDO76622.1| hypothetical protein CISIN_1g002876mg [Citrus sinensis]
Length=872

 Score =   172 bits (435),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 109/139 (78%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            M+ E+T  LL+AQS D  +R +AE +L Q++EQNLP FLLSLA EL ND KPVESR+LAG
Sbjct  1    MSAEVTQILLNAQSVDGTVRKQAEESLKQYQEQNLPGFLLSLAGELVNDEKPVESRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  LVQ+W ++D S+K+QIK+ +L TL+S   DA  T+SQV+AK+A
Sbjct  61   LILKNALDAKEQHRKFELVQRWLSLDSSVKAQIKSFILKTLSSPAHDARSTASQVVAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P  +WPEL+G+LL+N
Sbjct  121  GIELPHKQWPELIGALLSN  139



>ref|XP_011084526.1| PREDICTED: importin subunit beta-1 isoform X2 [Sesamum indicum]
Length=719

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 108/137 (79%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +++T  LLSAQ  D+ IR  AE TL QF+EQN P FL+SL+ EL+N+ KPVESR+LAG++
Sbjct  1    MDVTEVLLSAQVVDSTIRKHAEETLKQFQEQNFPGFLISLSGELANEEKPVESRKLAGLI  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN LDAKE   K  LVQ+W ++DV++KSQIK  LL TL+S+  DA  T+SQVIAK+A I
Sbjct  61   LKNRLDAKEQHRKYELVQRWLSLDVAVKSQIKACLLQTLSSASPDARSTASQVIAKVAGI  120

Query  575  EIPRXEWPELVGSLLAN  625
            E+P+ +WPEL+GSLL+N
Sbjct  121  ELPQKQWPELIGSLLSN  137



>gb|EAY83565.1| hypothetical protein OsI_38775 [Oryza sativa Indica Group]
Length=762

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 106/139 (76%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            M+L+IT  LLSAQS D   R  AE +L QF+EQNLP FL SL+ EL+N+ KP ESRRLAG
Sbjct  1    MSLDITQVLLSAQSPDGATRKLAEESLKQFQEQNLPGFLFSLSNELANEEKPEESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  L Q+W A+DV +K+QIK LLL TL+S V  A  TSSQVIAK+A
Sbjct  61   LILKNALDAKEQHRKNELFQRWLALDVGVKAQIKGLLLQTLSSPVASARSTSSQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IEIP+ +WPEL+ SLL+N
Sbjct  121  GIEIPQKQWPELIASLLSN  139



>ref|XP_007039099.1| ARM repeat superfamily protein [Theobroma cacao]
 gb|EOY23600.1| ARM repeat superfamily protein [Theobroma cacao]
Length=892

 Score =   172 bits (435),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 115/152 (76%), Gaps = 3/152 (2%)
 Frame = +2

Query  179  YLEVSHLREEM---ALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELS  349
            YL V +    M   A+E+T  LL+AQS D  +R  AE +L QF+EQNLP FLLSL+ EL+
Sbjct  10   YLSVPYQLLSMNIRAMEVTQVLLNAQSIDGAVRKNAEESLKQFQEQNLPAFLLSLSGELA  69

Query  350  NDGKPVESRRLAGIVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRD  529
            N+ KPVE+R+LAG++LKN+LDAKE   K  LVQ+W ++D + KSQIK  +L TL+S+V D
Sbjct  70   NEEKPVETRKLAGLILKNALDAKEQHRKYELVQRWLSLDANAKSQIKACVLKTLSSAVAD  129

Query  530  ASHTSSQVIAKIASIEIPRXEWPELVGSLLAN  625
            A  T+SQVIAK+A IE+P+ +WPEL+GSLL+N
Sbjct  130  ARSTASQVIAKVAGIELPQKQWPELIGSLLSN  161



>ref|XP_004307960.1| PREDICTED: importin subunit beta-1 [Fragaria vesca subsp. vesca]
 ref|XP_011470207.1| PREDICTED: importin subunit beta-1 [Fragaria vesca subsp. vesca]
Length=870

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MALE+T  LL+AQ+ D  +R +AE +L Q +EQ+LP+FLLSL+ EL+N+ KPVESR+LAG
Sbjct  1    MALEVTQVLLNAQAIDGTVRKQAEESLKQLQEQDLPLFLLSLSRELANEEKPVESRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  LVQ+W A+D S K+QIK  LL TL+S V DA  T+SQVIAK+A
Sbjct  61   LILKNALDAKEQHRKSDLVQRWLALDPSAKNQIKMCLLQTLSSLVADARSTTSQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P+ +WPEL+GSLL+N
Sbjct  121  GIELPQKQWPELIGSLLSN  139



>ref|XP_010671409.1| PREDICTED: importin subunit beta-1 [Beta vulgaris subsp. vulgaris]
Length=870

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 106/139 (76%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            M +EIT  LL+AQS D  +R  AE +L QF+EQN P FLLSLA EL+++ KP ESR+LAG
Sbjct  1    MVMEITQLLLNAQSVDGNVRKHAEDSLKQFQEQNNPSFLLSLAGELASEEKPAESRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K   VQ+W A+DV LK+QIK  LL +L+S V DA  T+SQV+AK+A
Sbjct  61   LILKNALDAKEQHRKFEFVQRWLALDVGLKNQIKTCLLQSLSSPVHDARSTASQVVAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P+ +WPELVGSLL N
Sbjct  121  GIELPQKQWPELVGSLLGN  139



>ref|XP_006584778.1| PREDICTED: importin subunit beta-1-like [Glycine max]
 gb|KHN16717.1| Importin subunit beta-1 [Glycine soja]
Length=870

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 107/139 (77%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LL+AQ+ D  +R +AE +L QF+EQNLP FL SLA EL+ND KP ESR+LAG
Sbjct  1    MAMEVTQILLNAQAVDGTLRKQAEESLKQFQEQNLPSFLFSLAGELANDEKPAESRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K   VQ+W ++D +LK+QIK  LL TL+S   DA  T+SQVIAK+A
Sbjct  61   LILKNALDAKEQHRKIEFVQRWLSLDPTLKAQIKAFLLRTLSSPSLDARSTASQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P  +WPEL+GSLL+N
Sbjct  121  GIELPHKQWPELIGSLLSN  139



>ref|XP_010445840.1| PREDICTED: importin subunit beta-1-like isoform X1 [Camelina 
sativa]
 ref|XP_010445842.1| PREDICTED: importin subunit beta-1-like isoform X2 [Camelina 
sativa]
Length=870

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 108/139 (78%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  L++AQS D  +R  AE +L QF+EQNL  FLLSLA EL+ND KPV+SR+LAG
Sbjct  1    MAMEVTQLLINAQSIDGTVRKHAEESLKQFQEQNLAGFLLSLAGELANDDKPVDSRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            +VLKN+LDAKE   K  LVQ+W A+D+S KSQI+  LL TL+S V D   T+SQVIAK+A
Sbjct  61   LVLKNALDAKEQHRKYELVQRWLALDMSTKSQIRAFLLKTLSSPVPDVRSTASQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P+ +WPEL+ SLL+N
Sbjct  121  GIELPQKQWPELIVSLLSN  139



>ref|XP_010442912.1| PREDICTED: importin subunit beta-1-like [Camelina sativa]
Length=870

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 108/139 (78%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  L++AQS D  +R  AE +L QF+EQNL  FLLSLA EL+ND KPV+SR+LAG
Sbjct  1    MAMEVTQLLINAQSIDGTVRKHAEESLKQFQEQNLAGFLLSLAGELANDEKPVDSRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            +VLKN+LDAKE   K  LVQ+W A+D+S KSQI+  LL TL+S V D   T+SQVIAK+A
Sbjct  61   LVLKNALDAKEQHRKYELVQRWLALDMSTKSQIRAFLLKTLSSPVPDVRSTASQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P+ +WPELV SLL+N
Sbjct  121  GIELPQKQWPELVVSLLSN  139



>ref|XP_008804983.1| PREDICTED: importin subunit beta-1-like [Phoenix dactylifera]
Length=875

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 109/139 (78%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+EIT  LLSAQS DA +RT AE  L QF+EQNLP+FLLSL+ ELS++ KP ESRRLAG
Sbjct  1    MAMEITQILLSAQSPDADVRTVAEKNLKQFQEQNLPIFLLSLSAELSSEKKPRESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            I+LKNSLDAK+   K  L Q+W  ID S+K+QIK  L  TL SSV +A HTSSQVI KIA
Sbjct  61   IILKNSLDAKDLIRKGELTQRWVNIDASVKTQIKQSLFRTLGSSVSEAGHTSSQVIGKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIEIPR +WPEL+G LL+N
Sbjct  121  SIEIPRKQWPELIGHLLSN  139



>ref|XP_010322221.1| PREDICTED: importin subunit beta-1-like [Solanum lycopersicum]
 ref|XP_010322222.1| PREDICTED: importin subunit beta-1-like [Solanum lycopersicum]
Length=868

 Score =   171 bits (432),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 110/137 (80%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +E+T  LL+AQS D+ +R  AE TL QF+EQNLP FLLSL+ EL+++ KPV+SR+LAG++
Sbjct  1    MEVTQVLLNAQSVDSTVRKHAEETLKQFQEQNLPGFLLSLSGELASEDKPVDSRKLAGLI  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN+LDAKE   K  LVQ+W ++DV++K+QIK  LL TL+S   DA  T+SQVIAK+A I
Sbjct  61   LKNALDAKEQHRKYELVQRWLSLDVAVKTQIKACLLQTLSSQALDARSTASQVIAKVAGI  120

Query  575  EIPRXEWPELVGSLLAN  625
            E+P+ +WPEL+GSLL+N
Sbjct  121  ELPQKQWPELIGSLLSN  137



>ref|XP_006279475.1| hypothetical protein CARUB_v10025866mg [Capsella rubella]
 gb|EOA12373.1| hypothetical protein CARUB_v10025866mg [Capsella rubella]
Length=870

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 107/139 (77%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  L++AQS D  +R  AE +  QF+EQNL  FLLSLA EL+ND KPV+SR+LAG
Sbjct  1    MAMEVTQLLINAQSIDGTVRKHAEESFKQFQEQNLAGFLLSLAGELANDEKPVDSRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKNSLDAKE   K  LVQ+W A+D+S KSQIK  LL TL+S V D   T+SQVIAK+A
Sbjct  61   LILKNSLDAKEQHRKYELVQRWLALDMSSKSQIKAFLLKTLSSPVPDVRSTASQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P+ +WPEL+ SLL+N
Sbjct  121  GIELPQKQWPELIVSLLSN  139



>ref|XP_007160199.1| hypothetical protein PHAVU_002G301300g [Phaseolus vulgaris]
 gb|ESW32193.1| hypothetical protein PHAVU_002G301300g [Phaseolus vulgaris]
Length=870

 Score =   170 bits (431),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 106/139 (76%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LL+AQ+ D  +R +AE  L QF+EQNLP FL SLA EL+ND KP ESR+LAG
Sbjct  1    MAMEVTQILLNAQAVDGALRKQAEENLKQFQEQNLPSFLFSLAGELANDDKPAESRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K   VQ+W A+D +LK+QIK  LL TL+S   +A  T+SQVIAK+A
Sbjct  61   LILKNALDAKEQHRKIEFVQRWLALDPTLKAQIKAFLLRTLSSPSLEARSTASQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P  +WPEL+GSLL+N
Sbjct  121  GIELPHKQWPELIGSLLSN  139



>ref|XP_003563593.1| PREDICTED: importin subunit beta-1 [Brachypodium distachyon]
 ref|XP_010227484.1| PREDICTED: importin subunit beta-1 [Brachypodium distachyon]
Length=872

 Score =   170 bits (431),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 108/139 (78%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            M+L++T  LLSAQSAD  IR  AE +L QF+EQNLP FL SL+ EL++D KP ESRRLAG
Sbjct  1    MSLDVTQILLSAQSADGAIRKHAEESLKQFQEQNLPGFLFSLSSELASDEKPEESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  L Q+W A+D  +K+QIK LLL TL+S V +A  TSSQVIAK+A
Sbjct  61   LILKNALDAKEEHRKSELFQRWLALDAGVKAQIKALLLQTLSSPVANARSTSSQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IEIP+ +WPEL+ SLL++
Sbjct  121  GIEIPQKQWPELIVSLLSS  139



>ref|XP_009412624.1| PREDICTED: importin subunit beta-1-like [Musa acuminata subsp. 
malaccensis]
Length=872

 Score =   170 bits (431),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+EIT  LLSAQS D   RT AEA L QF+EQNLP+FLLSL+VELS++ KP ESRRLAG
Sbjct  1    MAMEITQVLLSAQSPDGHTRTLAEANLKQFQEQNLPLFLLSLSVELSSEQKPPESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            I+LKNSLDAK+A  KE L Q+W ++D S+KSQIK+ LL TL SSV DA  TSSQVIAK+A
Sbjct  61   IILKNSLDAKDAVRKEELTQRWVSVDPSIKSQIKDSLLRTLGSSVSDARQTSSQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIE+PR EW EL+G LL N
Sbjct  121  SIEVPRREWQELIGLLLNN  139



>ref|XP_006401700.1| hypothetical protein EUTSA_v10012652mg [Eutrema salsugineum]
 gb|ESQ43153.1| hypothetical protein EUTSA_v10012652mg [Eutrema salsugineum]
Length=868

 Score =   170 bits (431),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 107/137 (78%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +E+T  L++AQS D  +R  AE +L QF+EQNL  FLLSLA EL+ND KPV+SR+LAG+V
Sbjct  1    MEVTQLLINAQSIDGTVRKHAEESLKQFQEQNLAGFLLSLAGELANDDKPVDSRKLAGLV  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN+LDAKE   K  LVQ+W ++D+S KSQI+  LL TL+S V D   T+SQVIAK+A I
Sbjct  61   LKNALDAKEQHRKYELVQRWLSLDMSTKSQIRAFLLKTLSSPVPDVRSTASQVIAKVAGI  120

Query  575  EIPRXEWPELVGSLLAN  625
            E+P+ +WPEL+GSLL+N
Sbjct  121  ELPQKQWPELIGSLLSN  137



>dbj|BAJ94620.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=869

 Score =   170 bits (430),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 106/137 (77%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            ++IT  LL+AQS D  +R+ AE +L  F+EQNLP FLLSL+VELSND +P ESRRLAGI+
Sbjct  1    MDITQILLAAQSPDGNLRSVAEGSLKLFQEQNLPRFLLSLSVELSNDERPPESRRLAGII  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN LDAK+ S KE L QQW ++D+S+KS+IK  LL TL SSV DA   SSQVIAK+ASI
Sbjct  61   LKNLLDAKDCSRKELLAQQWVSLDLSIKSRIKESLLLTLGSSVPDARQASSQVIAKVASI  120

Query  575  EIPRXEWPELVGSLLAN  625
            E+PR EW +L+  LL N
Sbjct  121  EMPRREWQDLIAKLLGN  137



>ref|XP_011084524.1| PREDICTED: importin subunit beta-1 isoform X1 [Sesamum indicum]
 ref|XP_011084525.1| PREDICTED: importin subunit beta-1 isoform X1 [Sesamum indicum]
Length=869

 Score =   170 bits (430),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 108/137 (79%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +++T  LLSAQ  D+ IR  AE TL QF+EQN P FL+SL+ EL+N+ KPVESR+LAG++
Sbjct  1    MDVTEVLLSAQVVDSTIRKHAEETLKQFQEQNFPGFLISLSGELANEEKPVESRKLAGLI  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN LDAKE   K  LVQ+W ++DV++KSQIK  LL TL+S+  DA  T+SQVIAK+A I
Sbjct  61   LKNRLDAKEQHRKYELVQRWLSLDVAVKSQIKACLLQTLSSASPDARSTASQVIAKVAGI  120

Query  575  EIPRXEWPELVGSLLAN  625
            E+P+ +WPEL+GSLL+N
Sbjct  121  ELPQKQWPELIGSLLSN  137



>gb|KJB52558.1| hypothetical protein B456_008G267400 [Gossypium raimondii]
Length=868

 Score =   170 bits (430),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 107/137 (78%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +E+T  LL+AQS D  +R  AE +L QF+EQNLPVFL+SL+ EL+N+ KPVE+R+LAG+V
Sbjct  1    MEVTQVLLNAQSIDGAVRKNAEDSLKQFQEQNLPVFLVSLSGELANEEKPVETRKLAGLV  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN+LDAKE   K  LVQ+W ++D + KSQIK  LL TL S V DA  T+SQVIAK+A I
Sbjct  61   LKNALDAKEQHRKFELVQRWLSLDGNAKSQIKACLLTTLTSPVSDARSTASQVIAKVAGI  120

Query  575  EIPRXEWPELVGSLLAN  625
            E+P  +WPEL+GSLL+N
Sbjct  121  ELPHKQWPELIGSLLSN  137



>dbj|BAC41893.1| putative importin beta [Arabidopsis thaliana]
Length=808

 Score =   169 bits (428),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 108/139 (78%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  L++AQS D  +R  AE +L QF+EQNL  FLLSLA EL+ND KPV+SR+LAG
Sbjct  1    MAMEVTQLLINAQSIDGTVRKHAEESLKQFQEQNLAGFLLSLAGELANDEKPVDSRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            +VLKN+LDAKE   K  LVQ+W A+D+S KSQI+  LL TL++ V D   T+SQVIAK+A
Sbjct  61   LVLKNALDAKEQHRKYELVQRWLALDMSTKSQIRAFLLKTLSAPVPDVRSTASQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P+ +WPEL+ SLL+N
Sbjct  121  GIELPQKQWPELIVSLLSN  139



>ref|XP_004503585.1| PREDICTED: importin subunit beta-1-like isoform X1 [Cicer arietinum]
 ref|XP_004503586.1| PREDICTED: importin subunit beta-1-like isoform X2 [Cicer arietinum]
Length=870

 Score =   169 bits (429),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 106/139 (76%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LL+AQ+ D  +R  AE +L QF+EQNLP FL SLA EL+ND KP ESR+LAG
Sbjct  1    MAMEVTQILLNAQAVDGAVRKLAEDSLKQFQEQNLPSFLFSLAGELANDEKPPESRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAK+   K   VQ+W A+D +LK+QIK  LL TL+S   DA  T+SQVIAK+A
Sbjct  61   LILKNALDAKDQPRKIEFVQRWLALDPTLKAQIKAFLLRTLSSPSLDARSTASQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P  +WPELVGSLL+N
Sbjct  121  GIELPHKQWPELVGSLLSN  139



>ref|XP_003526727.1| PREDICTED: importin subunit beta-1-like [Glycine max]
 gb|KHN23347.1| Importin subunit beta-1 [Glycine soja]
Length=871

 Score =   169 bits (429),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LLSAQS D  +R  AE +L QF+EQNLP FL+SL+ EL+++ KPV+SR+LAG
Sbjct  1    MAMEVTQVLLSAQSIDGNVRKHAEDSLRQFQEQNLPGFLVSLSGELASEDKPVDSRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAK+ S K+ LVQ+W ++D   K+Q+K+ LL TL+S V DA  T++QVIAK+A
Sbjct  61   LILKNALDAKDESRKQELVQRWLSLDPVAKTQVKSCLLQTLSSLVPDARSTATQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P+ +WPEL+GSLL+N
Sbjct  121  GIELPQKQWPELIGSLLSN  139



>ref|XP_010922595.1| PREDICTED: importin subunit beta-1-like [Elaeis guineensis]
Length=875

 Score =   169 bits (429),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 108/139 (78%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+EIT  LL AQS DA +RT AE  L Q +EQNLP+FLLSL+ ELS+D KP+ESRRLAG
Sbjct  1    MAMEITQILLLAQSPDANVRTVAEKNLKQLQEQNLPIFLLSLSAELSSDQKPLESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            IVLKNSLDAK+   K  L Q W  ID ++K+QIK  L  TL +SV +A HTSSQVIAKIA
Sbjct  61   IVLKNSLDAKDIIRKGELTQHWVNIDPTIKTQIKQSLFQTLGTSVSEAGHTSSQVIAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIEIPR +WPEL+G LL+N
Sbjct  121  SIEIPRKQWPELIGHLLSN  139



>ref|NP_200160.1| armadillo/beta-catenin-like repeat-containing protein [Arabidopsis 
thaliana]
 sp|Q9FJD4.1|IMB1_ARATH RecName: Full=Importin subunit beta-1; AltName: Full=Karyopherin 
subunit beta-1; Short=ATKPNB1 [Arabidopsis thaliana]
 dbj|BAB09724.1| importin beta [Arabidopsis thaliana]
 gb|AED96362.1| armadillo/beta-catenin-like repeat-containing protein [Arabidopsis 
thaliana]
Length=870

 Score =   169 bits (428),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 108/139 (78%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  L++AQS D  +R  AE +L QF+EQNL  FLLSLA EL+ND KPV+SR+LAG
Sbjct  1    MAMEVTQLLINAQSIDGTVRKHAEESLKQFQEQNLAGFLLSLAGELANDEKPVDSRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            +VLKN+LDAKE   K  LVQ+W A+D+S KSQI+  LL TL++ V D   T+SQVIAK+A
Sbjct  61   LVLKNALDAKEQHRKYELVQRWLALDMSTKSQIRAFLLKTLSAPVPDVRSTASQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P+ +WPEL+ SLL+N
Sbjct  121  GIELPQKQWPELIVSLLSN  139



>ref|NP_001067068.1| Os12g0568800 [Oryza sativa Japonica Group]
 dbj|BAA34862.1| importin-beta2 [Oryza sativa Japonica Group]
 gb|ABA99642.2| Importin-beta N-terminal domain containing protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF30087.1| Os12g0568800 [Oryza sativa Japonica Group]
 gb|EAZ20917.1| hypothetical protein OsJ_36558 [Oryza sativa Japonica Group]
Length=872

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 105/139 (76%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            M+L+IT  LLSAQS D   R  AE +L QF+EQNLP FL SL+ EL+N+ KP ESRRLAG
Sbjct  1    MSLDITQVLLSAQSPDGATRKLAEESLKQFQEQNLPGFLFSLSNELANEEKPEESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  L Q+W A+DV +K+QIK  LL TL+S V  A  TSSQVIAK+A
Sbjct  61   LILKNALDAKEQHRKNELFQRWLALDVGVKAQIKGFLLQTLSSPVASARSTSSQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IEIP+ +WPEL+ SLL+N
Sbjct  121  GIEIPQKQWPELIASLLSN  139



>ref|XP_010482746.1| PREDICTED: importin subunit beta-1-like [Camelina sativa]
Length=870

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 108/139 (78%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            M++E+T  L++AQS D  +R  AE +L QF+EQNL  FLLSLA EL+ND KPV+SR+LAG
Sbjct  1    MSMEVTQLLINAQSIDGTVRKHAEESLKQFQEQNLAGFLLSLAGELANDEKPVDSRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            +VLKN+LDAKE   K  LVQ+W A+D+S KSQI+  LL TL+S V D   T+SQVIAK+A
Sbjct  61   LVLKNALDAKEQHRKYELVQRWLALDMSTKSQIRAFLLKTLSSPVPDVRSTASQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P+ +WPEL+ SLL+N
Sbjct  121  GIELPQKQWPELIVSLLSN  139



>ref|XP_002864245.1| hypothetical protein ARALYDRAFT_495420 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40504.1| hypothetical protein ARALYDRAFT_495420 [Arabidopsis lyrata subsp. 
lyrata]
Length=870

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 108/139 (78%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  L++AQS D  +R  AE +L QF+EQNL  FLLSLA EL+ND KPV+SR+LAG
Sbjct  1    MAMEVTQLLINAQSIDGTVRKHAEESLKQFQEQNLAGFLLSLAGELANDEKPVDSRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            +VLKN+LDAKE   K  LVQ+W A+D+S KSQI+  LL TL++ V D   T+SQVIAK+A
Sbjct  61   LVLKNALDAKEQHRKYELVQRWLALDMSTKSQIRAFLLKTLSAPVPDVRSTASQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P+ +WPEL+ SLL+N
Sbjct  121  GIELPQKQWPELIVSLLSN  139



>ref|XP_006664116.1| PREDICTED: importin subunit beta-1-like [Oryza brachyantha]
Length=872

 Score =   169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 105/139 (76%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            M+L+IT  LLSAQS D   R  AE +L QF+EQNLP FL SL+ EL+N+ KP ESRRLAG
Sbjct  1    MSLDITQVLLSAQSPDGTTRKLAEESLKQFQEQNLPGFLFSLSNELANEEKPEESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  L Q+W A+D  +K+QIK LLL TL+S V  A  TSSQVIAK+A
Sbjct  61   LILKNALDAKEQHRKNELFQRWLALDAGVKAQIKGLLLQTLSSPVASARSTSSQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IEIP+ +WPEL+ SLL+N
Sbjct  121  GIEIPQKQWPELIASLLSN  139



>ref|XP_004300492.1| PREDICTED: importin subunit beta-1-like [Fragaria vesca subsp. 
vesca]
Length=872

 Score =   169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 105/139 (76%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+EIT FLL+AQ+ D  +R  AE  + QF+EQNLP FL SLA EL+ND KPVESR+LAG
Sbjct  1    MAMEITQFLLNAQAVDGNVRKHAEENIRQFQEQNLPGFLFSLAAELANDDKPVESRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  L Q+W A+D + K+QI+  LL TL+S   DA  T+SQVIAK+A
Sbjct  61   LILKNALDAKEQHRKFELAQRWIALDPNAKAQIRACLLKTLSSPAHDARSTASQVIAKLA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P  +WPEL+ +LL+N
Sbjct  121  GIELPIKQWPELIEALLSN  139



>gb|KEH21273.1| importin subunit beta-like protein [Medicago truncatula]
Length=868

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 105/138 (76%), Gaps = 0/138 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LL+AQ+ D  +R +AE  L QF+EQNLP FL SLA EL+ND KP ESRRLAG
Sbjct  1    MAMEVTQILLNAQAVDGAVRKQAEDNLKQFQEQNLPSFLFSLAGELANDEKPPESRRLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LD+KE   K   VQ+W A+D + K+QIK LLL TL+S   DA  T+SQV+AK+A
Sbjct  61   LILKNALDSKEQHKKIEFVQRWLAMDQAYKAQIKALLLRTLSSPSPDARSTASQVVAKVA  120

Query  569  SIEIPRXEWPELVGSLLA  622
             IE+P  +WPEL+GSLL+
Sbjct  121  GIELPHKQWPELIGSLLS  138



>ref|XP_007220596.1| hypothetical protein PRUPE_ppa001259mg [Prunus persica]
 gb|EMJ21795.1| hypothetical protein PRUPE_ppa001259mg [Prunus persica]
Length=869

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 110/137 (80%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +E+T  LL+AQ+ D  +R  AE +L QF+EQ+LP+FLLSL+ EL+N+ +PVESR+LAG++
Sbjct  1    MEVTQVLLNAQAIDGTVRKHAEESLKQFQEQDLPLFLLSLSRELANEERPVESRKLAGLI  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN+LDAKE   K  LVQ+W A++ S+K+QIK  LL TL+S V DA  T+SQVIAK+A I
Sbjct  61   LKNALDAKEQHRKLDLVQRWLALETSVKTQIKMCLLQTLSSPVSDARSTTSQVIAKVAGI  120

Query  575  EIPRXEWPELVGSLLAN  625
            E+P+ +WPEL+GSLL+N
Sbjct  121  ELPQKQWPELIGSLLSN  137



>gb|KJB52557.1| hypothetical protein B456_008G267300 [Gossypium raimondii]
Length=868

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 107/137 (78%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +E+T  L +AQS D  +R  AE +L QF+EQNLP FLLSL+ EL+N+ KP+E+R+LAG++
Sbjct  1    MEVTQVLFNAQSIDGTVRKNAEESLKQFQEQNLPGFLLSLSGELANEEKPIETRKLAGLI  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN+LDAKE   K  LVQ+W ++D + KSQIK  LL TL+S V DA  T+SQVIAK+A I
Sbjct  61   LKNALDAKEQHRKFELVQRWLSLDATAKSQIKACLLQTLSSPVFDAHSTTSQVIAKVAGI  120

Query  575  EIPRXEWPELVGSLLAN  625
            E+P+ +WPEL+GSLL+N
Sbjct  121  ELPQKQWPELIGSLLSN  137



>gb|KHN19512.1| Importin subunit beta-1 [Glycine soja]
Length=871

 Score =   167 bits (424),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LLSAQS D  +R  AE +L QF+EQNLP FL+SL+ EL+++ KPV+SR+LAG
Sbjct  1    MAMEVTQVLLSAQSIDGNVRKHAEDSLRQFQEQNLPGFLVSLSGELASEDKPVDSRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAK+ + K+ LVQ+W ++D   K+Q+K+ LL TL+S V DA  T++QVIAK+A
Sbjct  61   LILKNALDAKDENRKQELVQRWLSLDPVAKTQVKSCLLQTLSSLVPDARSTATQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P+ +WPEL+GSLL+N
Sbjct  121  GIELPQKQWPELIGSLLSN  139



>ref|XP_007210373.1| hypothetical protein PRUPE_ppa001250mg [Prunus persica]
 gb|EMJ11572.1| hypothetical protein PRUPE_ppa001250mg [Prunus persica]
Length=872

 Score =   167 bits (424),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 106/139 (76%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LL+AQ+ D  +R  AE  L QF+EQNLP FLLSLA EL+ND KPVESR+LAG
Sbjct  1    MAMEVTQILLNAQAVDGNVRKHAEENLRQFQEQNLPSFLLSLAGELANDDKPVESRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  L Q+W ++D S+K+QIK  LL TL+S   DA  T+SQVIAK+A
Sbjct  61   LILKNALDAKEQHRKFELGQRWLSLDPSVKAQIKACLLKTLSSPAHDARSTASQVIAKLA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P  +WPEL+ +LL+N
Sbjct  121  GIELPLKQWPELIEALLSN  139



>gb|KHG02931.1| Importin subunit beta-1 [Gossypium arboreum]
Length=1675

 Score =   169 bits (428),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 108/139 (78%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LL+AQS D  +R  AE +L QF+EQNLPVFL+SL+ EL+N+ KPVE+R+LAG
Sbjct  806  MAMEVTQVLLNAQSIDGAVRKNAEDSLKQFQEQNLPVFLVSLSGELANEEKPVETRKLAG  865

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            +VLKN+L AKE   K  LVQ+W ++D + KSQIK  LL TL S V DA  T+SQVIAK+A
Sbjct  866  LVLKNALVAKEQHRKFELVQRWLSLDGNAKSQIKACLLKTLTSPVLDARSTASQVIAKVA  925

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P  +WPEL+GSLL+N
Sbjct  926  GIELPHKQWPELIGSLLSN  944


 Score =   167 bits (422),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 106/137 (77%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +E+T  L +AQS D  +R  AE +L QF+EQNLP FLLSL+ EL+N+ KP+E+R+LAG++
Sbjct  1    MEVTQVLFNAQSIDGTVRKNAEESLKQFQEQNLPGFLLSLSGELANEEKPIETRKLAGLI  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN+LDAKE   K  LVQ+W  +D + KSQIK  LL TL+S V DA  T+SQVIAK+A I
Sbjct  61   LKNALDAKEQHRKFELVQRWLLLDATAKSQIKACLLQTLSSPVFDARSTTSQVIAKVAGI  120

Query  575  EIPRXEWPELVGSLLAN  625
            E+P+ +WPEL+GSLL+N
Sbjct  121  ELPQKQWPELIGSLLSN  137



>ref|XP_007136500.1| hypothetical protein PHAVU_009G050600g [Phaseolus vulgaris]
 ref|XP_007136501.1| hypothetical protein PHAVU_009G050600g [Phaseolus vulgaris]
 gb|ESW08494.1| hypothetical protein PHAVU_009G050600g [Phaseolus vulgaris]
 gb|ESW08495.1| hypothetical protein PHAVU_009G050600g [Phaseolus vulgaris]
Length=871

 Score =   167 bits (423),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LL+AQS D  +R  AE TL QF+EQNLP FL+SL+ EL+++ KPV+SR+LAG
Sbjct  1    MAMEVTQVLLNAQSIDGNVRKHAEDTLRQFQEQNLPGFLVSLSGELASEDKPVDSRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAK+ S K+ LVQ+W ++D   K+Q+K+ LL TL+S   DA  T++QVIAK+A
Sbjct  61   LILKNALDAKDESRKQELVQRWLSLDPVAKTQVKSCLLQTLSSLALDARSTATQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P+ +WPEL+GSLL+N
Sbjct  121  GIELPQKQWPELIGSLLSN  139



>ref|XP_008239170.1| PREDICTED: importin subunit beta-1-like [Prunus mume]
Length=856

 Score =   167 bits (422),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 106/139 (76%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LL+AQ+ D  +R  AE  L QF+EQNLP FLLSLA EL+ND KPVESR+LAG
Sbjct  1    MAMEVTQILLNAQAVDGNVRKHAEENLRQFQEQNLPSFLLSLAGELANDDKPVESRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  L Q+W ++D S+K+QIK  LL TL+S   DA  T+SQV+AK+A
Sbjct  61   LILKNALDAKEQHRKFELGQRWLSLDPSVKAQIKACLLKTLSSPAHDARSTASQVVAKLA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P  +WPEL+ +LL+N
Sbjct  121  GIELPLKQWPELIEALLSN  139



>ref|XP_010107260.1| Importin subunit beta-1 [Morus notabilis]
 gb|EXC14454.1| Importin subunit beta-1 [Morus notabilis]
Length=872

 Score =   167 bits (422),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 105/139 (76%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LL+AQ+ D  +R  AE  L QF+EQNLP+FLLSLA EL+ND KP ESR+LAG
Sbjct  1    MAMEVTQILLNAQAVDGTVRKHAEENLKQFQEQNLPIFLLSLAGELANDEKPAESRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  L+Q+W ++D  +K+QIK  LL TL S   DA  T+SQVIAK+A
Sbjct  61   LILKNALDAKEHHRKIELMQRWLSLDQPVKAQIKAFLLKTLTSPALDARSTASQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P  +WPEL+ +LL+N
Sbjct  121  GIELPHKQWPELIEALLSN  139



>ref|XP_009393073.1| PREDICTED: importin subunit beta-1 [Musa acuminata subsp. malaccensis]
 ref|XP_009393074.1| PREDICTED: importin subunit beta-1 [Musa acuminata subsp. malaccensis]
Length=871

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 107/139 (77%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LL+AQS D  IR  AE +L QF+EQNL  FLLSL+ EL ++ KPV+SR+LAG
Sbjct  1    MAMEVTQILLNAQSVDGSIRKHAEESLKQFQEQNLSAFLLSLSNELVSNEKPVDSRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            +VLKN+LDAKE   K  L Q+W ++D+++K+Q+K  LL TL S V DA  T+SQVIAKIA
Sbjct  61   LVLKNALDAKEQHRKSELAQRWLSLDIAVKAQVKACLLQTLASPVPDARSTASQVIAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P+  WPEL+GSLL+N
Sbjct  121  GIELPQKLWPELIGSLLSN  139



>ref|XP_009419673.1| PREDICTED: importin subunit beta-1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009419674.1| PREDICTED: importin subunit beta-1-like [Musa acuminata subsp. 
malaccensis]
Length=868

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +EIT  LLSAQS+D +IRT AEA L QF+EQNLP+FLLSL+VELS++ KP ESRRLAGI+
Sbjct  1    MEITQVLLSAQSSDGQIRTVAEANLKQFQEQNLPLFLLSLSVELSSEQKPPESRRLAGII  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKNSLDAK+A  KE L Q+W ++D S+K++IK   L TL SSV +A HTSSQVIAK+ASI
Sbjct  61   LKNSLDAKDAVRKEELTQKWVSVDASIKAKIKESWLQTLGSSVSEARHTSSQVIAKVASI  120

Query  575  EIPRXEWPELVGSLLAN  625
            EIPR EW +L+G LL N
Sbjct  121  EIPRCEWLDLIGRLLKN  137



>ref|XP_009348518.1| PREDICTED: importin subunit beta-1-like [Pyrus x bretschneideri]
Length=868

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 107/137 (78%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +E+T  LL+AQS D  +R +AE +L  F+EQ+ P FLLSL+ EL+N+ KPVESR+LAG++
Sbjct  1    MEVTQVLLNAQSIDGTVRNQAEESLKHFQEQDPPSFLLSLSRELANEEKPVESRKLAGLI  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN+LDAKE   K  LVQ+W A++ S+K+QIK  LL TL SSV DA  T+SQVIAK+A I
Sbjct  61   LKNALDAKEQPRKLELVQRWLALETSVKAQIKMFLLQTLASSVADARSTTSQVIAKVAGI  120

Query  575  EIPRXEWPELVGSLLAN  625
            E+P  +WPEL+GSLL+N
Sbjct  121  ELPMKQWPELIGSLLSN  137



>ref|XP_007039098.1| ARM repeat superfamily protein [Theobroma cacao]
 gb|EOY23599.1| ARM repeat superfamily protein [Theobroma cacao]
Length=868

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 107/137 (78%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +E+T  LL+AQS D  +R  AE +L QF+EQNLP FLLSL+VEL+N+ KPVE+R+LAG++
Sbjct  1    MEVTQVLLNAQSIDGAVRKTAEESLKQFQEQNLPGFLLSLSVELANEEKPVETRKLAGLI  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN+LDAKE   K  LVQ+W ++D + KSQIK  LL TL+S V DA  T+SQVIAK+A I
Sbjct  61   LKNALDAKEQHRKFELVQRWLSLDTNAKSQIKACLLKTLSSPVSDARSTASQVIAKVAGI  120

Query  575  EIPRXEWPELVGSLLAN  625
            E+P+ +WPEL+  LL+N
Sbjct  121  ELPQKQWPELISLLLSN  137



>ref|XP_008390322.1| PREDICTED: importin subunit beta-1-like [Malus domestica]
Length=872

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 107/139 (77%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  L++AQ+ D  +R  AE +L QF+EQNLP FLLSLA EL+ND KPVESR+LAG
Sbjct  1    MAMEVTQILINAQAVDGNVRKHAEDSLRQFQEQNLPSFLLSLAGELANDEKPVESRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  L Q+W ++D S+K+QIK  LL TL+S   DA  T+SQV+AK+A
Sbjct  61   LILKNALDAKEQHRKFELGQRWLSLDPSVKAQIKACLLKTLSSPAHDARSTASQVVAKLA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P  +WPEL+ +LL+N
Sbjct  121  GIELPLKQWPELIEALLSN  139



>ref|XP_009344039.1| PREDICTED: importin subunit beta-1-like isoform X1 [Pyrus x bretschneideri]
Length=887

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 107/139 (77%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  L++AQ+ D  +R  AE +L QF+EQNLP FLLSLA EL+ND KPVESR+LAG
Sbjct  1    MAMEVTQILINAQAVDGNVRKHAEDSLRQFQEQNLPSFLLSLAGELANDEKPVESRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  L Q+W ++D S+K+QIK  LL TL+S   DA  T+SQV+AK+A
Sbjct  61   LILKNALDAKEQHRKFELGQRWLSLDPSVKAQIKACLLKTLSSPAHDARSTASQVVAKLA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P  +WPEL+ +LL+N
Sbjct  121  GIELPLKQWPELIEALLSN  139



>ref|XP_009344041.1| PREDICTED: importin subunit beta-1-like isoform X2 [Pyrus x bretschneideri]
Length=872

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 107/139 (77%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  L++AQ+ D  +R  AE +L QF+EQNLP FLLSLA EL+ND KPVESR+LAG
Sbjct  1    MAMEVTQILINAQAVDGNVRKHAEDSLRQFQEQNLPSFLLSLAGELANDEKPVESRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  L Q+W ++D S+K+QIK  LL TL+S   DA  T+SQV+AK+A
Sbjct  61   LILKNALDAKEQHRKFELGQRWLSLDPSVKAQIKACLLKTLSSPAHDARSTASQVVAKLA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P  +WPEL+ +LL+N
Sbjct  121  GIELPLKQWPELIEALLSN  139



>ref|XP_008361287.1| PREDICTED: importin subunit beta-1-like [Malus domestica]
Length=872

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 107/139 (77%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LL+AQ+ D  +R  AE +L QF+EQNLP FLLSLA EL+ND KPVESR+LAG
Sbjct  1    MAMEVTQILLNAQAVDGNVRKHAEDSLRQFQEQNLPSFLLSLAGELANDEKPVESRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  L Q+W ++D S+K+QI+  LL TL+S   DA  T+SQV+AK+A
Sbjct  61   LILKNALDAKEQHRKFELGQRWLSLDPSVKAQIRACLLKTLSSPAHDARSTASQVVAKLA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P  +WPEL+ +LL+N
Sbjct  121  GIELPLKQWPELIEALLSN  139



>ref|XP_010107256.1| Importin subunit beta-1 [Morus notabilis]
 gb|EXC14450.1| Importin subunit beta-1 [Morus notabilis]
Length=871

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 106/139 (76%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LL+AQ+ D+ +R  AE  L QF+EQNLP+FLLSLA EL+ND KP ESR+LAG
Sbjct  1    MAMEVTQILLNAQAMDSTVRKHAEENLKQFQEQNLPIFLLSLAGELANDEKPAESRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  L+Q+W ++D  +K+QIK  LL TL S   DA  T+SQVIAK+A
Sbjct  61   LILKNALDAKEHHRKIELMQRWLSLDQPVKAQIKAYLLKTLTSPALDARSTASQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P  +WPEL+ +LL+N
Sbjct  121  GIELPHKQWPELIEALLSN  139



>ref|XP_006649919.1| PREDICTED: importin subunit beta-1-like [Oryza brachyantha]
Length=870

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            ++IT  LL+AQS D +IRT AE  L QF+EQN P FL +L+ ELSND KP ESRRLAGI+
Sbjct  1    MDITQVLLAAQSHDGQIRTVAEGNLEQFQEQNFPQFLQTLSAELSNDEKPPESRRLAGIL  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKNSLDAK++S KE  VQ+W  +D ++KSQ+K  LL TL S V +A  +SSQVIAK+A+I
Sbjct  61   LKNSLDAKDSSRKEEFVQRWINVDPAIKSQVKGSLLMTLGSLVFEARSSSSQVIAKVAAI  120

Query  575  EIPRXEWPELVGSLLAN  625
            EIP   WPEL+ +LL+N
Sbjct  121  EIPHQGWPELIVNLLSN  137



>ref|XP_008376765.1| PREDICTED: importin subunit beta-1-like [Malus domestica]
 ref|XP_008376766.1| PREDICTED: importin subunit beta-1-like [Malus domestica]
Length=868

 Score =   165 bits (418),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 106/137 (77%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +E+T  LL+AQS D  +R +AE +L QF+EQ+ P FLLSL+ EL+N+ KPVESR+LAG++
Sbjct  1    MEVTQVLLNAQSIDGTVRNQAEESLKQFQEQDPPTFLLSLSRELANEEKPVESRKLAGLI  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN+LDAKE   K  L+Q+W A++ S K+QIK  LL TL S V DA  T+SQVIAK+A I
Sbjct  61   LKNALDAKEQPRKLELIQRWLALETSAKAQIKMFLLQTLASPVADARSTTSQVIAKVAGI  120

Query  575  EIPRXEWPELVGSLLAN  625
            E+P  +WPEL+GSLL+N
Sbjct  121  ELPMKQWPELIGSLLSN  137



>ref|XP_008234705.1| PREDICTED: importin subunit beta-1 [Prunus mume]
Length=869

 Score =   165 bits (417),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 109/137 (80%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +E+T  LL+AQ+ D  IR  AE +L QF+EQ+LP+FLLSL+ EL+N+ +PVESR+LAG++
Sbjct  1    MEVTQVLLNAQAIDGTIRKHAEESLKQFQEQDLPLFLLSLSRELANEERPVESRKLAGLI  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN+LDAKE   K  LVQ+W A++ S+K+QIK  LL TL+S V DA  T+SQVIAK+A I
Sbjct  61   LKNALDAKEQHRKLDLVQRWLALETSVKTQIKMCLLQTLSSPVSDARSTTSQVIAKVAGI  120

Query  575  EIPRXEWPELVGSLLAN  625
            E+P+ +W EL+GSLL+N
Sbjct  121  ELPQKQWQELIGSLLSN  137



>ref|XP_009358649.1| PREDICTED: importin subunit beta-1-like [Pyrus x bretschneideri]
Length=872

 Score =   165 bits (417),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 106/139 (76%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LL+AQ+ D  +R  AE +L QF+EQNLP FL SLA EL+ND KPVESR+LAG
Sbjct  1    MAMEVTQILLNAQAVDGNVRKHAEDSLRQFQEQNLPSFLFSLAGELANDEKPVESRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  L Q+W ++D S+K+QI+  LL TL+S   DA  T+SQV+AK+A
Sbjct  61   LILKNALDAKEQHRKFELGQRWLSLDPSVKAQIRACLLKTLSSPAHDAQSTASQVVAKLA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P  +WPEL+ +LL+N
Sbjct  121  GIELPLKQWPELIEALLSN  139



>gb|KJB37368.1| hypothetical protein B456_006G202100 [Gossypium raimondii]
Length=868

 Score =   164 bits (416),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 107/137 (78%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +E+T  LL+AQS D  +R  AE +L QF+EQNLP FLLSL+ EL+N+ KPVE+R+LAG++
Sbjct  1    MEVTQVLLNAQSIDGTVRKNAEESLKQFQEQNLPGFLLSLSGELANEEKPVETRKLAGLI  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN+LDAKE   K  LVQ+W ++D + KSQIK  LL TL+S V DA  T+SQ IAK+A I
Sbjct  61   LKNALDAKEEHRKFELVQRWLSLDGNAKSQIKASLLTTLSSIVSDARSTASQAIAKVAGI  120

Query  575  EIPRXEWPELVGSLLAN  625
            E+P+ +WPEL+GSLL+N
Sbjct  121  ELPQKQWPELIGSLLSN  137



>gb|EAY89607.1| hypothetical protein OsI_11135 [Oryza sativa Indica Group]
Length=870

 Score =   164 bits (415),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            ++IT  LL+AQS D ++RT AE  L QF++QN P FL +L+VELSND KP ESRRLAGI+
Sbjct  1    MDITQVLLAAQSHDGQLRTVAEENLKQFQQQNFPHFLQTLSVELSNDEKPPESRRLAGIL  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKNSLDAKE++ KE  VQ+W  +D ++KSQ+K  LL TL S V +A  +SSQVIAK+A+I
Sbjct  61   LKNSLDAKESTRKEEFVQRWMNVDPAIKSQVKESLLITLGSPVFEARRSSSQVIAKVAAI  120

Query  575  EIPRXEWPELVGSLLAN  625
            EIP   WPEL+ +LL N
Sbjct  121  EIPHQGWPELIVNLLTN  137



>emb|CDY35657.1| BnaC09g29790D [Brassica napus]
Length=868

 Score =   162 bits (411),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 104/137 (76%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +E+T  LL+AQS D  +R  AE  L  F+ QNL  FLLSLA EL+ND KPV+SR+LAG+V
Sbjct  1    MEVTQLLLNAQSIDGTVRKHAEENLKLFQSQNLAGFLLSLAGELANDEKPVDSRKLAGLV  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN+LDAKE   K  LVQ+W ++D++ K+QI+  LL TL+S V D   T+SQVIAK+A I
Sbjct  61   LKNALDAKEQHRKYELVQRWLSLDMATKTQIRAFLLKTLSSPVPDVRSTASQVIAKVAGI  120

Query  575  EIPRXEWPELVGSLLAN  625
            E+P+ +WPELVGSLL+N
Sbjct  121  ELPQNQWPELVGSLLSN  137



>ref|XP_004502681.1| PREDICTED: importin subunit beta-1-like [Cicer arietinum]
Length=869

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 110/137 (80%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +E+T  LL+AQS D  +R  AE +L QF+EQNLP FL+SL+ EL+++ KPV+SR+LAG++
Sbjct  1    MEVTQALLNAQSIDGTVRKHAEESLRQFQEQNLPGFLVSLSGELASEDKPVDSRKLAGLI  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN+LDAK+ + K  LVQ+W ++D S K+Q+K+ LL TL+S V DA  T++QV+AK+A I
Sbjct  61   LKNALDAKDENRKRELVQRWLSLDQSAKTQVKSCLLQTLSSLVLDARSTATQVVAKVAGI  120

Query  575  EIPRXEWPELVGSLLAN  625
            E+P+ +WPEL+GSLL+N
Sbjct  121  ELPQKQWPELIGSLLSN  137



>ref|XP_009119891.1| PREDICTED: importin subunit beta-1 [Brassica rapa]
Length=868

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 104/137 (76%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +E+T  LL+AQS D  +R  AE  L  F+ QNL  FLLSLA EL+ND KPV+SR+LAG+V
Sbjct  1    MEVTQLLLNAQSIDGTVRKHAEENLKLFQSQNLAGFLLSLAGELANDEKPVDSRKLAGLV  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN+LDAKE   K  LVQ+W ++D++ K+QI+  LL TL+S V D   T+SQVIAK+A I
Sbjct  61   LKNALDAKEQHRKYELVQRWLSLDMATKTQIRAFLLKTLSSPVPDVRSTASQVIAKVAGI  120

Query  575  EIPRXEWPELVGSLLAN  625
            E+P+ +WPELVGSLL+N
Sbjct  121  ELPQNQWPELVGSLLSN  137



>emb|CDY14379.1| BnaA10g06760D [Brassica napus]
Length=868

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 104/137 (76%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +E+T  LL+AQS D  +R  AE  L  F+ QNL  FLLSLA EL+ND KPV+SR+LAG+V
Sbjct  1    MEVTQLLLNAQSIDGTVRKHAEENLKLFQSQNLAGFLLSLAGELANDEKPVDSRKLAGLV  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN+LDAKE   K  LVQ+W ++D++ K+QI+  LL TL+S V D   T+SQVIAK+A I
Sbjct  61   LKNALDAKEQHRKYELVQRWLSLDMATKTQIRAFLLKTLSSPVPDVRSTASQVIAKVAGI  120

Query  575  EIPRXEWPELVGSLLAN  625
            E+P+ +WPELVGSLL+N
Sbjct  121  ELPQNQWPELVGSLLSN  137



>gb|EAZ26573.1| hypothetical protein OsJ_10469 [Oryza sativa Japonica Group]
Length=841

 Score =   162 bits (409),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 104/137 (76%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            ++IT  LL+AQS D ++RT AE  L QF++QN P FL +L+VELSND  P ESRRLAGI+
Sbjct  1    MDITQVLLAAQSHDGQLRTVAEENLKQFQQQNFPHFLQTLSVELSNDENPPESRRLAGIL  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKNSLDAKE++ KE  VQ+W  +D ++KSQ+K  LL TL S V +A  +SSQVIAK+A+I
Sbjct  61   LKNSLDAKESTRKEEFVQRWMNVDPAIKSQVKESLLITLGSPVFEARRSSSQVIAKVAAI  120

Query  575  EIPRXEWPELVGSLLAN  625
            EIP   WPEL+ +LL N
Sbjct  121  EIPHQGWPELIVNLLTN  137



>gb|ABF95425.1| Importin-beta N-terminal domain containing protein, expressed 
[Oryza sativa Japonica Group]
Length=870

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 104/137 (76%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            ++IT  LL+AQS D ++RT AE  L QF++QN P FL +L+VELSND  P ESRRLAGI+
Sbjct  1    MDITQVLLAAQSHDGQLRTVAEENLKQFQQQNFPHFLQTLSVELSNDENPPESRRLAGIL  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKNSLDAKE++ KE  VQ+W  +D ++KSQ+K  LL TL S V +A  +SSQVIAK+A+I
Sbjct  61   LKNSLDAKESTRKEEFVQRWMNVDPAIKSQVKESLLITLGSPVFEARRSSSQVIAKVAAI  120

Query  575  EIPRXEWPELVGSLLAN  625
            EIP   WPEL+ +LL N
Sbjct  121  EIPHQGWPELIVNLLTN  137



>gb|KEH35467.1| importin beta-like protein [Medicago truncatula]
Length=869

 Score =   161 bits (408),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 109/137 (80%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +E+T  LL+AQS D  +R  AE +L QF+EQNLP FL+SL+ EL+++ KPV+SR+LAG++
Sbjct  1    MEVTQALLNAQSIDGTVRKHAEESLRQFQEQNLPGFLVSLSGELASEDKPVDSRKLAGLI  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN+LDAK+ + K  LVQ+W ++D + K+Q+K  LL TL+S V DA  T++QV+AKIA I
Sbjct  61   LKNALDAKDENRKRELVQRWLSLDTAAKAQVKACLLQTLSSLVLDARSTATQVVAKIAGI  120

Query  575  EIPRXEWPELVGSLLAN  625
            E+P+ +WPEL+GSLL+N
Sbjct  121  ELPQKQWPELIGSLLSN  137



>gb|KHG17091.1| Importin subunit beta-1 [Gossypium arboreum]
Length=868

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 106/137 (77%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +E+T  LL+AQS D  +R  AE +L QF+EQNLP FLLSL+ EL+N+ KPVE+R+LAG++
Sbjct  1    MEVTQVLLNAQSIDGTVRKNAEESLKQFQEQNLPGFLLSLSGELANEEKPVETRKLAGLI  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN+LDAKE   K  LVQ+W ++  + KSQIK  LL TL+S V DA  T+SQ IAK+A I
Sbjct  61   LKNALDAKEEHRKFELVQRWLSLYGNAKSQIKASLLTTLSSIVSDARSTASQAIAKVAGI  120

Query  575  EIPRXEWPELVGSLLAN  625
            E+P+ +WPEL+GSLL+N
Sbjct  121  ELPQKQWPELIGSLLSN  137



>gb|KEH35465.1| importin beta-like protein [Medicago truncatula]
Length=868

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 108/137 (79%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +E+T  LL+AQS D  IR  AE  L QF+EQNLP FL+SL+ EL+++ KPV+SR+LAG++
Sbjct  1    MEVTQALLNAQSIDGTIRKHAEENLQQFQEQNLPGFLVSLSGELASEDKPVDSRKLAGLI  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN+LDAK+ + K  LVQ+W ++D + K+Q+K  LL TL+S V DA  T++QV+AKIA I
Sbjct  61   LKNALDAKDENRKWELVQRWLSLDTAAKAQVKACLLQTLSSLVLDARSTATQVVAKIAGI  120

Query  575  EIPRXEWPELVGSLLAN  625
            E+P+ +WPEL+GSLL+N
Sbjct  121  ELPQKQWPELIGSLLSN  137



>ref|XP_006844933.1| hypothetical protein AMTR_s00058p00157820 [Amborella trichopoda]
 gb|ERN06608.1| hypothetical protein AMTR_s00058p00157820 [Amborella trichopoda]
Length=875

 Score =   159 bits (401),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 107/139 (77%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LL+AQS D KIR  AE +L QF +QNLP FL SL+ EL N+ KPVESR+LAG
Sbjct  1    MAMEVTQILLNAQSVDGKIRKHAEESLKQFHDQNLPGFLFSLSAELGNNDKPVESRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAKE   K  LVQ+W ++D ++K+QIK  LL TL+SS  DA  T+SQVIAKIA
Sbjct  61   LILKNALDAKEQLKKAELVQRWLSLDTTVKAQIKACLLQTLSSSSSDARSTASQVIAKIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P  +WP+L+ SLL+N
Sbjct  121  GIELPHDQWPDLIRSLLSN  139



>ref|XP_006844984.1| hypothetical protein AMTR_s00058p00188470 [Amborella trichopoda]
 gb|ERN06659.1| hypothetical protein AMTR_s00058p00188470 [Amborella trichopoda]
Length=875

 Score =   157 bits (398),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 106/139 (76%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MALE+T  LL+AQS D  +R +AE TL QF + NL  FL+SL+ EL+N+ KP+ESR+LAG
Sbjct  1    MALEVTQILLNAQSVDGTLRKQAEETLNQFLQTNLQSFLISLSAELANNDKPIESRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKN+LDAK+   K  L ++W +ID S+K QIK  LL TL+S + DA  TSSQV+AK+A
Sbjct  61   LMLKNALDAKDHIRKAELARRWLSIDKSVKDQIKVCLLQTLSSPIADARSTSSQVVAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            +IE+P+ +WPEL+ +LL N
Sbjct  121  TIELPQNQWPELISTLLLN  139



>gb|KJB37366.1| hypothetical protein B456_006G202000 [Gossypium raimondii]
Length=838

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 104/137 (76%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +E+T  LL+AQS D  +R  AE +L  F+EQNL VFLL L+ EL ++ KPVE+R+LAG++
Sbjct  1    MEVTQVLLNAQSIDGAVRKNAEESLKHFQEQNLTVFLLLLSGELVSEEKPVETRKLAGLI  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN+LDAK+   K  LVQ+W ++D + KSQIK  LL TL+S V DA  T+SQVIAK+A I
Sbjct  61   LKNALDAKDQQRKVELVQRWLSLDGNAKSQIKAGLLKTLSSPVSDARSTASQVIAKVAGI  120

Query  575  EIPRXEWPELVGSLLAN  625
            E+P  +WPELVGSLL+N
Sbjct  121  ELPHKQWPELVGSLLSN  137



>gb|KJB37365.1| hypothetical protein B456_006G202000 [Gossypium raimondii]
 gb|KJB37367.1| hypothetical protein B456_006G202000 [Gossypium raimondii]
Length=868

 Score =   157 bits (396),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 104/137 (76%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +E+T  LL+AQS D  +R  AE +L  F+EQNL VFLL L+ EL ++ KPVE+R+LAG++
Sbjct  1    MEVTQVLLNAQSIDGAVRKNAEESLKHFQEQNLTVFLLLLSGELVSEEKPVETRKLAGLI  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN+LDAK+   K  LVQ+W ++D + KSQIK  LL TL+S V DA  T+SQVIAK+A I
Sbjct  61   LKNALDAKDQQRKVELVQRWLSLDGNAKSQIKAGLLKTLSSPVSDARSTASQVIAKVAGI  120

Query  575  EIPRXEWPELVGSLLAN  625
            E+P  +WPELVGSLL+N
Sbjct  121  ELPHKQWPELVGSLLSN  137



>ref|XP_002990712.1| hypothetical protein SELMODRAFT_185511 [Selaginella moellendorffii]
 gb|EFJ08161.1| hypothetical protein SELMODRAFT_185511 [Selaginella moellendorffii]
Length=806

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 104/139 (75%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LL+AQSAD  +R  AE  L QF++QNL  FL+SL+ EL++D KP ESR+LAG
Sbjct  1    MAMEVTQVLLNAQSADGSVRKLAEDNLRQFQDQNLAAFLVSLSGELASDDKPPESRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKNSLDAK+A  +  L  +W  +D + ++QIK  L+ TL + V +A HT++QVIAK+A
Sbjct  61   LILKNSLDAKDAGRRAELGDRWLLLDSAARAQIKAALVATLAAPVAEARHTAAQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            +IE+PR  WPEL+  LLAN
Sbjct  121  AIELPRQAWPELIPGLLAN  139



>gb|EMT26929.1| Importin subunit beta-1 [Aegilops tauschii]
Length=869

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 98/137 (72%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            ++IT  LL+ QS D +IR  AE  + QF+EQ+ P FL +L+ ELSND KP  SRRLAGI+
Sbjct  1    MDITEVLLATQSHDGQIRNVAEGNIKQFEEQSFPQFLQALSAELSNDSKPPVSRRLAGIL  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKNSLDA +   KE   Q+W ++D ++KSQ+K  LL TL S V DA  +SSQVIAKIASI
Sbjct  61   LKNSLDANDLVRKEKCTQRWRSVDPAIKSQVKGSLLMTLGSPVSDAHRSSSQVIAKIASI  120

Query  575  EIPRXEWPELVGSLLAN  625
            EIP   WPEL+ SLL N
Sbjct  121  EIPLQGWPELIISLLGN  137



>ref|XP_002986718.1| hypothetical protein SELMODRAFT_158150 [Selaginella moellendorffii]
 gb|EFJ12281.1| hypothetical protein SELMODRAFT_158150 [Selaginella moellendorffii]
Length=875

 Score =   154 bits (390),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 104/139 (75%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LL+AQSAD  +R  AE  L QF++QNL  FL+SL+ EL++D KP ESR+LAG
Sbjct  1    MAMEVTQVLLNAQSADGSVRKLAEDNLRQFQDQNLAAFLVSLSGELASDDKPPESRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKNSLDAK+A  +  L  +W  +D + ++QIK  L+ TL + V +A HT++QVIAK+A
Sbjct  61   LILKNSLDAKDAGRRAELGDRWLLLDSAARAQIKAALVATLAAPVAEARHTAAQVIAKVA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            +IE+PR  WPEL+  LLAN
Sbjct  121  AIELPRQAWPELIPGLLAN  139



>gb|EMS59943.1| Importin subunit beta-1 [Triticum urartu]
Length=869

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 98/137 (72%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            ++IT  LL+ QS D +IR  AE  + QF+EQ+ P FLL+L+ EL+ D KP  SRRLAGI+
Sbjct  1    MDITEVLLATQSHDGQIRNVAEGNIKQFEEQSFPQFLLALSAELAKDNKPPVSRRLAGIL  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKNSLDA +   KE   Q+W ++D ++KSQ+K  LL TL S V DA  +SSQVIAKIASI
Sbjct  61   LKNSLDANDLVRKEKCTQRWISVDPAIKSQVKGSLLMTLGSPVSDAHRSSSQVIAKIASI  120

Query  575  EIPRXEWPELVGSLLAN  625
            EIP   WPEL+ SLL N
Sbjct  121  EIPLQGWPELIVSLLGN  137



>ref|XP_003575505.1| PREDICTED: importin subunit beta-1-like [Brachypodium distachyon]
Length=868

 Score =   153 bits (386),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 107/137 (78%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            ++IT  LL+AQS D  +R  AE  + QF+EQNLP FLLSL+VELS+D +P ESRRLAGI+
Sbjct  1    MDITQILLAAQSPDGNLRAVAEGNIKQFQEQNLPNFLLSLSVELSSDERPPESRRLAGII  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKNSLDAK+++ KE L QQW ++D  +KS+IK+ LL TL SSV DA  TSSQVIAK+ASI
Sbjct  61   LKNSLDAKDSAKKELLTQQWVSLDPLIKSRIKDSLLITLGSSVADARQTSSQVIAKVASI  120

Query  575  EIPRXEWPELVGSLLAN  625
            EIPR EW +L+  LL N
Sbjct  121  EIPRKEWQDLIAKLLNN  137



>gb|EYU31538.1| hypothetical protein MIMGU_mgv11b018147mg [Erythranthe guttata]
Length=541

 Score =   150 bits (380),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 97/139 (70%), Gaps = 11/139 (8%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MALE T  LL AQS DA++RT A    +   E N PV  LSL+VELSND KP ESR+LAG
Sbjct  1    MALETTMHLLCAQSPDAQVRTYAMTLFSHLVELNPPVIFLSLSVELSNDAKPTESRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LK+ LD K           W AIDVS KS+IK+ +L+TL S + +AS  +SQV+AKIA
Sbjct  61   VLLKHLLDFK-----------WAAIDVSTKSRIKSSVLHTLGSCISEASDIASQVVAKIA  109

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIEIPR EWPELVGSL+ N
Sbjct  110  SIEIPRKEWPELVGSLITN  128



>gb|KHG13012.1| Importin subunit beta-1 [Gossypium arboreum]
Length=868

 Score =   153 bits (386),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 103/137 (75%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +E+T  LL+AQS D  +R  AE +L  F+EQNL  FLL L+ EL ++ KPVE+R+L+G++
Sbjct  1    MEVTQVLLNAQSIDGAVRKNAEESLKHFQEQNLTGFLLLLSGELVSEEKPVETRKLSGLI  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN+LDAK+   K  LVQ+W ++D + KSQIK  LL TL+S V DA  T+SQVIAK+A I
Sbjct  61   LKNALDAKDQQRKVELVQRWLSLDGNAKSQIKAGLLKTLSSPVSDARSTASQVIAKVAGI  120

Query  575  EIPRXEWPELVGSLLAN  625
            E+P  +WPELVGSLL+N
Sbjct  121  ELPHKQWPELVGSLLSN  137



>ref|XP_009351972.1| PREDICTED: importin subunit beta-1 [Pyrus x bretschneideri]
 ref|XP_009351973.1| PREDICTED: importin subunit beta-1 [Pyrus x bretschneideri]
Length=868

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +E+T  LL+AQS D  +R  AE +L QF+EQ+L  FLLSL+ EL+N+ KPVESR+LAG++
Sbjct  1    MEVTQVLLNAQSIDGAVRNHAEESLKQFQEQDLSSFLLSLSRELANEEKPVESRKLAGLI  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN+LDAKE   K  LVQ+W A++ S+K+QIK  LL  L S V DA  T+SQVIAK+A I
Sbjct  61   LKNALDAKEQPRKLELVQRWLALETSVKAQIKMFLLQILTSPVADARSTTSQVIAKVAGI  120

Query  575  EIPRXEWPELVGSLLAN  625
            E+P  +WPEL+GSLL+N
Sbjct  121  ELPMKQWPELIGSLLSN  137



>ref|XP_008381127.1| PREDICTED: importin subunit beta-1-like [Malus domestica]
Length=868

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +E+T  LL+AQS D  +R  AE +L QF+EQ+L  FLLSL+ EL+N+ KPVESR+LAG++
Sbjct  1    MEVTQVLLNAQSIDGAVRNHAEESLKQFQEQDLSSFLLSLSRELANEEKPVESRKLAGLI  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN+LDAKE   K  LVQ+W A++ S+K+QIK  LL  L S V DA  T+SQVIAK+A I
Sbjct  61   LKNALDAKEQPRKLELVQRWLALETSVKAQIKMFLLQILTSPVADARSTTSQVIAKVAGI  120

Query  575  EIPRXEWPELVGSLLAN  625
            E+P  +WPEL+GSLL+N
Sbjct  121  ELPMKQWPELIGSLLSN  137



>gb|KFK44047.1| hypothetical protein AALP_AA1G208500 [Arabis alpina]
Length=208

 Score =   140 bits (353),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 102/139 (73%), Gaps = 16/139 (12%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T F ++AQS DA++R  AE +L QF+E +   FLLSL+ EL+ND KP+ESR+LAG
Sbjct  1    MAMEMTQFFVAAQSDDARVRNGAERSLVQFQEHHH--FLLSLSFELANDHKPLESRQLAG  58

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            I+LKNSL            +QW A++  +KSQIK+LLL TL SS   ASHT++QVIAK+A
Sbjct  59   ILLKNSLS-----------KQWIALNTVIKSQIKDLLLTTLASS---ASHTAAQVIAKVA  104

Query  569  SIEIPRXEWPELVGSLLAN  625
            SIEI   +WP+LV SLL+N
Sbjct  105  SIEISLKQWPQLVKSLLSN  123



>ref|XP_003558144.1| PREDICTED: importin subunit beta-1-like [Brachypodium distachyon]
Length=869

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 99/137 (72%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            ++IT  LL+ QS D +IR  AE  + QF+EQN P FL +L+ ELS+D KP  SRRLAGI+
Sbjct  1    MDITEVLLATQSHDGQIRNAAEGNIKQFEEQNFPHFLQALSAELSDDNKPPVSRRLAGIL  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKNSLDA ++  KE   Q+W  +D ++KS++K  LL TL S V +A  +SSQVIAK+ASI
Sbjct  61   LKNSLDANDSKRKEICTQRWINVDPAIKSRVKGSLLMTLGSVVFEAQRSSSQVIAKVASI  120

Query  575  EIPRXEWPELVGSLLAN  625
            EIP   WPEL+ +LL+N
Sbjct  121  EIPLQGWPELIINLLSN  137



>gb|EPS68839.1| hypothetical protein M569_05926, partial [Genlisea aurea]
Length=871

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 105/139 (76%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA+E+T  LL+AQS D+  R  AE TL QF+E+NL  FLLSL+ EL+++ KPV SR+LAG
Sbjct  2    MAMEVTQVLLNAQSVDSTARKNAEDTLKQFQERNLSSFLLSLSAELASEEKPVNSRKLAG  61

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            ++LKNSL A     K  L ++W ++DV+LKSQIK  LL TL+S+V DA  T+SQVIAK+A
Sbjct  62   LILKNSLSANGPYLKFELAKRWLSLDVALKSQIKACLLQTLSSTVYDARSTASQVIAKVA  121

Query  569  SIEIPRXEWPELVGSLLAN  625
             IE+P   WPEL+GSLL+N
Sbjct  122  GIELPHKHWPELIGSLLSN  140



>ref|XP_005847395.1| hypothetical protein CHLNCDRAFT_134241 [Chlorella variabilis]
 gb|EFN55293.1| hypothetical protein CHLNCDRAFT_134241 [Chlorella variabilis]
Length=853

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 98/137 (72%), Gaps = 1/137 (1%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +++T  L +AQSADA +R +AE TL   ++Q      + L+ EL++  KPV++RRLAG++
Sbjct  1    MQLTALLQAAQSADAAVRNQAEQTLNSLQQQQYAELCVGLSAELADSSKPVDARRLAGLI  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN+LDAKE + K  LVQQW A D  +K Q+K  LL TL +   DA HT++ VIAK+A+I
Sbjct  61   LKNTLDAKEDARKAALVQQWVASDAGMKKQVKQNLLATLGTQ-GDAGHTAALVIAKVAAI  119

Query  575  EIPRXEWPELVGSLLAN  625
            E+PR EWPEL+ +LLAN
Sbjct  120  EVPRSEWPELIQALLAN  136



>ref|XP_011400526.1| Importin subunit beta-1 [Auxenochlorella protothecoides]
 gb|KFM27543.1| Importin subunit beta-1 [Auxenochlorella protothecoides]
Length=845

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 92/142 (65%), Gaps = 9/142 (6%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            L+IT+ L SAQS DA  R  AE  L   +E   P F+LSLA EL +  KPV SRRLAG+V
Sbjct  5    LDITSLLDSAQSPDAATRNAAEGQLKGLQESQFPSFVLSLAAELGSGDKPVSSRRLAGLV  64

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNS---------SVRDASHTSS  547
            LKN+LDAKEAS +  L ++W ++D  ++SQ+K  LL T+++          V DA HT+ 
Sbjct  65   LKNALDAKEASRQAGLSERWMSLDAGVRSQVKQSLLATMHAEVIIRDWGDGVADARHTAG  124

Query  548  QVIAKIASIEIPRXEWPELVGS  613
             VIAK+ +IEIP   WPEL+ S
Sbjct  125  LVIAKVGAIEIPAGSWPELIPS  146



>ref|XP_004338068.1| importin beta subunit [Acanthamoeba castellanii str. Neff]
 gb|ELR16055.1| importin beta subunit [Acanthamoeba castellanii str. Neff]
Length=851

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 99/135 (73%), Gaps = 0/135 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            ++++  LL+AQS D ++R  AE  L   ++ NLP FL +L +EL++  K   SRRLAG++
Sbjct  1    MDLSQILLNAQSPDREVRAGAEKQLAAAEQHNLPSFLHALCLELASADKNPHSRRLAGLI  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN+LDAK+ + K+  +QQW A+D + K+QIK  ++ TL  SV++A HT++QV+AKIA I
Sbjct  61   LKNALDAKDETRKQQRIQQWLALDAAAKAQIKAGVVKTLADSVKEARHTAAQVLAKIAVI  120

Query  575  EIPRXEWPELVGSLL  619
            E+PR +WP+L+ SL+
Sbjct  121  ELPRDQWPDLIESLM  135



>ref|XP_004160407.1| PREDICTED: importin subunit beta-1-like [Cucumis sativus]
Length=616

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MALE+T  LL+AQS DA +R +AE +L QF+EQNLP FLLSL+ EL ++ KPV+SR+LAG
Sbjct  1    MALEVTQVLLNAQSIDATVRKQAEDSLRQFQEQNLPSFLLSLSNELGSEEKPVDSRKLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRD  529
            ++LKN+LDAKE   K  LVQ+W ++D ++K+QIK  LLNTL+S+V D
Sbjct  61   LILKNALDAKEQHRKFELVQRWLSLDGNVKTQIKACLLNTLSSTVGD  107



>ref|XP_005651827.1| ARM repeat-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE27283.1| ARM repeat-containing protein [Coccomyxa subellipsoidea C-169]
Length=875

 Score =   127 bits (320),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 94/138 (68%), Gaps = 0/138 (0%)
 Frame = +2

Query  212  ALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGI  391
            A+++T  L +AQSADA  R +AE  L QF+ QN   +L+SLA ELS +     +R++AG+
Sbjct  4    AVDLTAVLQNAQSADANARQQAEGQLQQFQLQNYAAYLVSLATELSKEQADASTRQIAGV  63

Query  392  VLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIAS  571
            +LKNS DA   + K  L  +W      +KSQI+ LLL TL S V+ A HT++ VIAK+A+
Sbjct  64   ILKNSFDAPSDARKAELAARWGEQVDPVKSQIRQLLLGTLGSEVQIARHTAALVIAKVAA  123

Query  572  IEIPRXEWPELVGSLLAN  625
            IE+P+ +WP+L+ +LLAN
Sbjct  124  IELPKGQWPDLIPTLLAN  141



>gb|EMT07421.1| Importin subunit beta-1 [Aegilops tauschii]
Length=771

 Score =   126 bits (317),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 86/135 (64%), Gaps = 0/135 (0%)
 Frame = +2

Query  221  ITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIVLK  400
            IT+ L  AQ  D  +R EAEA L Q +E+N P FLL L+ ELS +  P E R LAG +LK
Sbjct  4    ITHILKDAQDPDDNVRLEAEAKLKQLEERNRPNFLLCLSAELSREASPPECRCLAGTILK  63

Query  401  NSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASIEI  580
            NS++ K +     L++QW ++D  +K++IK  LL TL SS   A H SSQ+I ++A IEI
Sbjct  64   NSVEGKYSEHNSILIKQWISLDPRIKTEIKESLLMTLGSSAPQARHASSQIIGRLAYIEI  123

Query  581  PRXEWPELVGSLLAN  625
            P   W +L+G LL N
Sbjct  124  PSRGWQDLIGRLLGN  138



>ref|XP_003061208.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54858.1| predicted protein [Micromonas pusilla CCMP1545]
Length=883

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 92/136 (68%), Gaps = 0/136 (0%)
 Frame = +2

Query  218  EITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIVL  397
            +IT  L + QS DA  R  AEA L   +E N P FL SLA E++N+ KP  +R+LAG++L
Sbjct  3    DITAILQATQSHDANARVAAEAQLKAAQESNFPGFLTSLAGEIANEQKPPTTRQLAGLLL  62

Query  398  KNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASIE  577
            KNSLDA++ + K  LV++W   D ++++QIK  + NTL+SS     HTS+QV+AKIA  E
Sbjct  63   KNSLDARDENRKAELVEKWLQQDPTIRNQIKGAVWNTLSSSDPTVRHTSAQVVAKIAGAE  122

Query  578  IPRXEWPELVGSLLAN  625
            IP  +WP+LV +L  N
Sbjct  123  IPAKQWPDLVQNLQNN  138



>gb|KIZ03724.1| Importin subunit beta-1 [Monoraphidium neglectum]
Length=520

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 93/137 (68%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +E+T  LL AQ  D  +R +AE  +  F+EQN   FL SLA EL+N  KP ESRRLAGIV
Sbjct  8    IEVTRLLLHAQDPDPGVRGQAEQQIQYFQEQNYSGFLGSLAYELANAEKPPESRRLAGIV  67

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN+LDAK+ + K  LV +W  ++ SL++ I+  LL  L+   ++   T +  +AK+A+I
Sbjct  68   LKNNLDAKDDARKAALVSRWETVEASLRASIRGALLQALSMEPQEVRGTVALALAKVAAI  127

Query  575  EIPRXEWPELVGSLLAN  625
            E+PR +WP+L+ +LLAN
Sbjct  128  ELPRRDWPDLIPALLAN  144



>gb|KIY99918.1| Importin subunit beta-1 [Monoraphidium neglectum]
Length=433

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 92/138 (67%), Gaps = 0/138 (0%)
 Frame = +2

Query  212  ALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGI  391
            ++E+T  LL AQ  D  +R +AE  +  F+EQN   FL SLA EL+N  KP ESRRLAGI
Sbjct  8    SIEVTRLLLHAQDPDPGVRGQAEQQIQYFQEQNYAGFLGSLAYELANAEKPPESRRLAGI  67

Query  392  VLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIAS  571
            VLKN+LDAK+ + K  LV +W A++  L++ I+  LL  L    ++   T + V+AK+A+
Sbjct  68   VLKNNLDAKDDARKAALVSRWEAVEPPLRASIRGALLQALAMEPQEVRGTVALVVAKVAA  127

Query  572  IEIPRXEWPELVGSLLAN  625
            IE+PR  W ELV +L+AN
Sbjct  128  IELPRGGWGELVPALMAN  145



>ref|XP_007508162.1| predicted protein [Bathycoccus prasinos]
 emb|CCO20653.1| predicted protein [Bathycoccus prasinos]
Length=884

 Score =   119 bits (298),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 92/134 (69%), Gaps = 1/134 (1%)
 Frame = +2

Query  218  EITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIVL  397
            +IT  L++ Q+ D  +R++AE  L Q KE N  ++L SLA EL ++ KP E RRLAG++L
Sbjct  3    DITQILVNTQNPDQTVRSQAEQQLEQAKEANFSLYLSSLAKELGDESKPSEVRRLAGLIL  62

Query  398  KNSLDAKEASTKEHLVQQW-TAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            KNS+D++   TK+ L Q+W   +D + + +IK+++   L+S V++  HT++QV+AK A+ 
Sbjct  63   KNSIDSRSYQTKKSLQQKWLNQVDQNQRMEIKSMIFQALSSPVQEIRHTAAQVVAKFAAA  122

Query  575  EIPRXEWPELVGSL  616
            EIP  +WPEL+  L
Sbjct  123  EIPAKQWPELIPQL  136



>ref|XP_002503190.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64448.1| predicted protein [Micromonas sp. RCC299]
Length=876

 Score =   118 bits (296),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 61/136 (45%), Positives = 89/136 (65%), Gaps = 0/136 (0%)
 Frame = +2

Query  218  EITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIVL  397
            +IT  L +  S DA  R  AEA L Q +EQNL  FL SLA E++ + KP++SRRLAG++L
Sbjct  3    DITAVLSATTSPDAATREAAEAQLKQAQEQNLGAFLQSLANEVATEAKPLDSRRLAGLIL  62

Query  398  KNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASIE  577
            KN+LDA++ + K    ++W  +D ++++ +K  + N L S V++  HT +QVIAKIA  E
Sbjct  63   KNALDARDETVKADKQEKWVTMDANIRNTVKGCVWNQLGSPVQEIRHTCAQVIAKIAGAE  122

Query  578  IPRXEWPELVGSLLAN  625
            +P+  WP LV  L  N
Sbjct  123  MPKALWPSLVTDLQNN  138



>ref|XP_005704716.1| protein transporter [Galdieria sulphuraria]
 gb|EME28196.1| protein transporter [Galdieria sulphuraria]
Length=863

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 92/137 (67%), Gaps = 1/137 (1%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +++T  LL AQSAD K+R EAE +L Q +E N P F  SLA EL++  KP   R+LAG+V
Sbjct  1    MDVTQLLLHAQSADFKLRYEAEQSLKQLEETNFPTFAASLATELADQSKPPSVRQLAGLV  60

Query  395  LKNSLDAKEASTKEHLVQQWTAI-DVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIAS  571
            LKN  DA+ +  +E L ++W A+ D   + ++K LLL TL+S V++A HT++QV+A +A 
Sbjct  61   LKNKFDARSSVRREELAKRWAAVEDTESRHKVKALLLQTLSSEVQEARHTAAQVVAALAV  120

Query  572  IEIPRXEWPELVGSLLA  622
            IE+P   W EL+  LL 
Sbjct  121  IELPLGLWNELIEILLG  137



>ref|XP_009041159.1| hypothetical protein AURANDRAFT_39138 [Aureococcus anophagefferens]
 gb|EGB04174.1| hypothetical protein AURANDRAFT_39138 [Aureococcus anophagefferens]
Length=770

 Score =   112 bits (281),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 89/139 (64%), Gaps = 1/139 (1%)
 Frame = +2

Query  212  ALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGI  391
             +++   LL+AQS D  +R  AE  L  ++ Q+LP F++ LA EL+ +G    SR+LAG+
Sbjct  3    GMDLGTILLNAQSQDLNVRNLAEQQLAHWEAQSLPQFMIGLANELAGEGHNESSRQLAGL  62

Query  392  VLKNSLDAKEASTKEHLVQQW-TAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
             LKN L A++A+T     ++W T +DV+ + QIK   LN L S    A+HT +QV+AKI 
Sbjct  63   HLKNLLSARDANTAAEKKRRWYTVVDVNSRLQIKAACLNALKSPALGAAHTGAQVVAKIG  122

Query  569  SIEIPRXEWPELVGSLLAN  625
            +IE+   +WPEL+G LL N
Sbjct  123  AIELQGKQWPELLGHLLKN  141



>gb|EMT22895.1| Importin subunit beta [Aegilops tauschii]
Length=776

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 84/135 (62%), Gaps = 0/135 (0%)
 Frame = +2

Query  221  ITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIVLK  400
            IT  L  AQ  D  IR  AE  L Q +E+N P FLLSL+ ELS+D  P E R LAGI+LK
Sbjct  64   ITQILKDAQDPDNNIRLVAECKLKQLQERNRPNFLLSLSAELSSDASPPECRCLAGIMLK  123

Query  401  NSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASIEI  580
            NS++ K +     L++QW  +D  +KSQIK  LL TL S    A H SSQ+I ++A IEI
Sbjct  124  NSVEGKYSEDNSILIEQWNNLDQRIKSQIKESLLITLGSLAPQARHASSQIIGRLAYIEI  183

Query  581  PRXEWPELVGSLLAN  625
            P   W +L+G LL N
Sbjct  184  PSQGWQDLIGRLLRN  198



>ref|XP_003295001.1| hypothetical protein DICPUDRAFT_51827 [Dictyostelium purpureum]
 gb|EGC28472.1| hypothetical protein DICPUDRAFT_51827 [Dictyostelium purpureum]
Length=840

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 84/137 (61%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +E+   L+ A + D  +R  AE  LT    QN P+F+ SL  EL N+ +  + R+LAGIV
Sbjct  1    MELLQALVGASNPDPNVRQAAENFLTTASNQNFPLFIHSLTSELINEEREPKIRQLAGIV  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKNS+ +K     E L++QW +ID + ++ IKN LL  L+S + DA HT++ VI+ I  I
Sbjct  61   LKNSIYSKSQERNEVLIKQWVSIDAAARNVIKNDLLRGLSSPIYDARHTAAIVISHIGLI  120

Query  575  EIPRXEWPELVGSLLAN  625
            EIP   W EL+ SL  N
Sbjct  121  EIPHSLWEELIPSLFKN  137



>ref|XP_001690080.1| importin beta [Chlamydomonas reinhardtii]
 gb|EDP09818.1| importin beta, partial [Chlamydomonas reinhardtii]
Length=832

 Score =   107 bits (268),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 56/137 (41%), Positives = 86/137 (63%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            ++++  L +    DA IR +AE  L Q K+ N P +L S+  EL N+ +P + R+ AG+ 
Sbjct  5    VDLSAALAATFRPDANIRQQAEQHLDQLKQTNFPSYLASITNELGNEERPDDVRQAAGLQ  64

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKNS+DAK+A+ +  L+ +W + D  LK  I+++LL  L+S   D   T++ VIAKIA I
Sbjct  65   LKNSVDAKDAARRTDLMNKWMSTDAQLKQHIRDVLLRCLHSPKGDVRKTTALVIAKIAGI  124

Query  575  EIPRXEWPELVGSLLAN  625
            ++   EWP L+ SLL N
Sbjct  125  DLQAKEWPNLIPSLLNN  141



>gb|ETO78507.1| hypothetical protein F444_06554 [Phytophthora parasitica P1976]
Length=858

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 89/137 (65%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            ++I+  LL+ QS D ++R +AE  L    +Q +  F+++L   L+++   V  R+ AG+ 
Sbjct  1    MDISAALLNTQSPDLQLRKQAEEFLNNALQQQMGQFMVTLVQALASEEFAVVGRQAAGLY  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN LDAK+ + ++  +  W A+D +L++QIK+  L  L SS   A HTS+Q++AKI SI
Sbjct  61   LKNVLDAKDDALQQQKINAWMAMDAALRTQIKDGSLGVLQSSDPVARHTSAQLVAKIGSI  120

Query  575  EIPRXEWPELVGSLLAN  625
            E+P+ EWP L+ SLL N
Sbjct  121  ELPQKEWPTLLESLLQN  137



>ref|XP_008892019.1| hypothetical protein PPTG_02597 [Phytophthora parasitica INRA-310]
 gb|ETI49689.1| hypothetical protein F443_06491 [Phytophthora parasitica P1569]
 gb|ETK89731.1| hypothetical protein L915_06366 [Phytophthora parasitica]
 gb|ETL43128.1| hypothetical protein L916_06304 [Phytophthora parasitica]
 gb|ETL96311.1| hypothetical protein L917_06174 [Phytophthora parasitica]
 gb|ETM49476.1| hypothetical protein L914_06296 [Phytophthora parasitica]
 gb|ETN22792.1| hypothetical protein PPTG_02597 [Phytophthora parasitica INRA-310]
 gb|ETP19612.1| hypothetical protein F441_06495 [Phytophthora parasitica CJ01A1]
 gb|ETP47548.1| hypothetical protein F442_06534 [Phytophthora parasitica P10297]
Length=858

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 89/137 (65%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            ++I+  LL+ QS D ++R +AE  L    +Q +  F+++L   L+++   V  R+ AG+ 
Sbjct  1    MDISAALLNTQSPDLQLRKQAEEFLNNALQQQMGQFMVTLVQALASEEFAVVGRQAAGLY  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN LDAK+ + ++  +  W A+D +L++QIK+  L  L SS   A HTS+Q++AKI SI
Sbjct  61   LKNVLDAKDDALQQQKINAWMAMDAALRTQIKDGSLGVLQSSDPVARHTSAQLVAKIGSI  120

Query  575  EIPRXEWPELVGSLLAN  625
            E+P+ EWP L+ SLL N
Sbjct  121  ELPQKEWPTLLESLLQN  137



>gb|EMT08493.1| Importin subunit beta-1 [Aegilops tauschii]
Length=1060

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 83/135 (61%), Gaps = 0/135 (0%)
 Frame = +2

Query  221  ITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIVLK  400
            IT  L  AQ  D  IR  AE  L Q +E+N   FLLSL+ ELS++  P E R LAGI+LK
Sbjct  4    ITPILKDAQDPDNNIRLAAEGKLKQLQERNRSNFLLSLSAELSSEASPPECRCLAGIILK  63

Query  401  NSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASIEI  580
            NS++ K +     L++QW  +D  +KSQIK  LL TL SS   A H SSQ+I ++A IE 
Sbjct  64   NSVEGKYSEDNSLLIKQWNNLDPCIKSQIKESLLITLGSSAPQARHASSQIIGRLAYIET  123

Query  581  PRXEWPELVGSLLAN  625
            P   W +L+G LL N
Sbjct  124  PSERWQDLIGRLLGN  138



>ref|XP_002999081.1| importin subunit beta, putative [Phytophthora infestans T30-4]
 gb|EEY69227.1| importin subunit beta, putative [Phytophthora infestans T30-4]
Length=858

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 89/137 (65%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            ++I+  LL+ QS D ++R +AE  L    +Q +  F+++L   LS++   V  R+ AG+ 
Sbjct  1    MDISAALLNTQSPDLQLRKQAEEFLNNALQQQMGQFMVTLVQALSSEEFAVVGRQAAGLY  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN LDAK+ + ++  +  W A+D +L++QIK+  L  L S+   A HTS+Q++AKI SI
Sbjct  61   LKNVLDAKDDALQQQKINAWMAMDTALRTQIKDGSLGVLQSNDPVARHTSAQLVAKIGSI  120

Query  575  EIPRXEWPELVGSLLAN  625
            E+P+ EWP L+ SLL N
Sbjct  121  ELPQKEWPTLLESLLQN  137



>gb|EMS53622.1| Importin subunit beta-1 [Triticum urartu]
Length=829

 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 83/135 (61%), Gaps = 0/135 (0%)
 Frame = +2

Query  221  ITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIVLK  400
            IT  L  AQ  D  IR  AE  L Q +E+N   FLLSL+ ELS++  P E R LAGI+LK
Sbjct  4    ITPILKDAQDPDNNIRLAAEGKLKQLQERNRSNFLLSLSAELSSEASPPECRCLAGIILK  63

Query  401  NSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASIEI  580
            NS++ K +     L++QW  +D  +KSQIK  LL TL SS   A H SSQ+I ++A IE 
Sbjct  64   NSVEGKYSEDNSLLIKQWNNLDPCIKSQIKESLLITLGSSAPQARHASSQIIGRLAYIET  123

Query  581  PRXEWPELVGSLLAN  625
            P   W +L+G LL N
Sbjct  124  PSERWQDLIGRLLRN  138



>gb|EYU31542.1| hypothetical protein MIMGU_mgv1a024097mg [Erythranthe guttata]
Length=506

 Score =   102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 73/109 (67%), Gaps = 11/109 (10%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MALEIT +LL+AQS DA +RT A    +Q  + N P  LLSL+VELSND K  ESR++AG
Sbjct  1    MALEITEYLLAAQSPDAGVRTHAMTLFSQLVDLNPPAILLSLSVELSNDAKSTESRKIAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDAS  535
            ++LKN LD K           W AIDVS KS+IK+ +L+TL S + +A+
Sbjct  61   VLLKNLLDFK-----------WAAIDVSTKSRIKSSVLHTLGSCISEAN  98



>ref|XP_002953919.1| hypothetical protein VOLCADRAFT_82561 [Volvox carteri f. nagariensis]
 gb|EFJ44948.1| hypothetical protein VOLCADRAFT_82561 [Volvox carteri f. nagariensis]
Length=857

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 85/137 (62%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            ++++  L S  S DA IR +AE  L Q KE N P +L S+  EL N+ +  + R+ A + 
Sbjct  5    IDLSAALASTFSHDASIRQQAEQHLDQLKETNFPGYLASITNELGNEDRADDIRQAAALQ  64

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKNS+DAK+A  ++ L+ +W   D +LK  I+++LL  L+S   D   T++ VIAKIA+I
Sbjct  65   LKNSVDAKDAVRRQDLMAKWQGTDAALKQHIRDVLLRCLHSPKGDVRKTTALVIAKIANI  124

Query  575  EIPRXEWPELVGSLLAN  625
            ++    WP L+ +LL N
Sbjct  125  DMQSKAWPALIPTLLNN  141



>ref|XP_007777620.1| hypothetical protein W97_01524 [Coniosporium apollinis CBS 100218]
 gb|EON62303.1| hypothetical protein W97_01524 [Coniosporium apollinis CBS 100218]
Length=897

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 83/138 (60%), Gaps = 1/138 (1%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +++   L    S D  +RT AE  LTQ  E +   +L +LA EL+N+  P   R+ A + 
Sbjct  1    MDVNQVLEGTLSPDVTVRTNAEQQLTQAAEADFSGYLTTLAQELANEQAPSHIRQAAALA  60

Query  395  LKNSLDAKEASTKEHLVQQW-TAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIAS  571
            LKNS  A+E +    + Q+W T ID ++KS +KNL L TL+S    A   ++Q +A IA+
Sbjct  61   LKNSFSAREYARLRQVQQRWLTQIDANIKSSVKNLTLKTLSSPDARAGQAAAQFLASIAA  120

Query  572  IEIPRXEWPELVGSLLAN  625
            IEIPR +WPEL+ +L+ N
Sbjct  121  IEIPRQQWPELMPTLVQN  138



>ref|XP_005766397.1| hypothetical protein EMIHUDRAFT_419647 [Emiliania huxleyi CCMP1516]
 ref|XP_005784582.1| hypothetical protein EMIHUDRAFT_415245 [Emiliania huxleyi CCMP1516]
 gb|EOD13968.1| hypothetical protein EMIHUDRAFT_419647 [Emiliania huxleyi CCMP1516]
 gb|EOD32153.1| hypothetical protein EMIHUDRAFT_415245 [Emiliania huxleyi CCMP1516]
Length=897

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/161 (37%), Positives = 93/161 (58%), Gaps = 24/161 (15%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNL------------------------PVF  322
            +++T+ LL+AQS D  IR +AE  L   K+QNL                        P+ 
Sbjct  1    MDVTSVLLAAQSHDQAIRQQAEQQLESAKQQNLARRSLRCSRLCTRLTAALSPSPSQPLL  60

Query  323  LLSLAVELSNDGKPVESRRLAGIVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLL  502
            +  +A EL+N+GK +  R+ AG+VLKN L  ++ + ++ L Q W   D + K QIKN +L
Sbjct  61   MSLMATELANEGKELRIRQAAGLVLKNCLTPRDGTKQQQLAQLWLQTDANAKQQIKNTVL  120

Query  503  NTLNSSVRDASHTSSQVIAKIASIEIPRXEWPELVGSLLAN  625
             TL SSV+ A HT++Q ++ +A+I++P  +WPEL+  L+ N
Sbjct  121  GTLGSSVKAARHTAAQAVSAMATIDLPHNQWPELIQGLVTN  161



>ref|XP_009519098.1| hypothetical protein PHYSODRAFT_344537 [Phytophthora sojae]
 gb|EGZ23810.1| hypothetical protein PHYSODRAFT_344537 [Phytophthora sojae]
Length=858

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 87/137 (64%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            ++I+  LL+ QS D  +R +AE  L    +Q +  F+++L   L+++   V  R+ AG+ 
Sbjct  1    MDISAALLNTQSPDLTLRKQAEEFLNNALQQQMGQFMVTLVQALASEEFAVVGRQAAGLY  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN LDAK+ + ++  +  W A+D +L++QIK+  L  L S+   A HTS+Q++AKI SI
Sbjct  61   LKNVLDAKDDALQQQKINAWMAMDPALRTQIKDGSLGVLQSNDPVARHTSAQLVAKIGSI  120

Query  575  EIPRXEWPELVGSLLAN  625
            E+P  EWP L+ SLL N
Sbjct  121  ELPNKEWPTLLESLLQN  137



>ref|XP_007294355.1| importin beta-1 subunit [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
 gb|EKD15250.1| importin beta-1 subunit [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
Length=871

 Score =   101 bits (251),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 82/137 (60%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +++ + LL+  S DA IR  AEA LTQ  E N   +L +L  EL+N+      R  AGI 
Sbjct  1    MDVNSVLLNTFSTDASIRGTAEAQLTQAAETNFSGYLTTLVQELANEEAQGPVRAAAGIA  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN+  A+E +    L ++W  +D   K+++K L L  L S+   A   S+QV+A IA+I
Sbjct  61   LKNAFTAREYARISELAEKWIQLDPDTKTRVKELTLQALASNNAQAGAASAQVVASIAAI  120

Query  575  EIPRXEWPELVGSLLAN  625
            E+PR +WPEL+ +L+ N
Sbjct  121  ELPRNQWPELMSTLVRN  137



>ref|XP_007602438.1| hypothetical protein CFIO01_10550 [Colletotrichum fioriniae PJ7]
 gb|EXF73900.1| hypothetical protein CFIO01_10550 [Colletotrichum fioriniae PJ7]
Length=876

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 81/137 (59%), Gaps = 1/137 (1%)
 Frame = +2

Query  218  EITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIVL  397
            EI   L ++ S DA +R  AE  LTQ  + N P++L +L  EL+ND      R  AG+ L
Sbjct  5    EINQVLANSLSPDANLRNAAEQQLTQAADNNFPLYLATLVQELANDNADGSIRAAAGLAL  64

Query  398  KNSLDAKEASTKEHLVQQW-TAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            KN+  A++ +  + L  +W    D   K+Q+KNL L TL SS   A   ++QVI+ IASI
Sbjct  65   KNAFTARDFARHQELQAKWLQQTDEETKTQVKNLTLQTLGSSNSQAGQAAAQVISSIASI  124

Query  575  EIPRXEWPELVGSLLAN  625
            E+PR +W +L+G L+ N
Sbjct  125  ELPRSQWQDLMGILVKN  141



>gb|EMT32350.1| Importin subunit beta-1 [Aegilops tauschii]
Length=886

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 93/148 (63%), Gaps = 10/148 (7%)
 Frame = +2

Query  212  ALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGI  391
            ++++ + L  A + D  IR+  E  L + + ++LP FLL L+ EL  +G P ESR LA I
Sbjct  4    SIDVNDALTHASNPDNNIRSIGEDMLKRLQNRDLPNFLLYLSSELVREGIPEESRVLAAI  63

Query  392  VLKNSLDAKEASTKE-H---LVQQWTAIDVSLKSQIKNLLLNTL--NSSVRDASHTSS--  547
             LKNSLD+K+ + K+ H   L  +W ++D S++ +IKN LL TL  +S    + H SS  
Sbjct  64   TLKNSLDSKDPALKDAHKDLLCLKWLSVDKSIRLEIKNNLLMTLEIDSRPSHSRHPSSKV  123

Query  548  --QVIAKIASIEIPRXEWPELVGSLLAN  625
              +VIA++A +EIPR +W +LVG L+ N
Sbjct  124  IAEVIARVACMEIPRNQWLDLVGKLMDN  151



>dbj|GAM23184.1| hypothetical protein SAMD00019534_063590 [Acytostelium subglobosum 
LB1]
Length=829

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 87/137 (64%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +++   L +A   D  IR  AE  +    +Q+ P FL +L++EL N+ +  + R++AGI+
Sbjct  1    MDLNTLLTNANEGDINIRQPAEQQILAASQQDFPGFLNALSLELRNNDRSSKVRQMAGIL  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            +KNS+ +   +T +   +QW A+  + K++IKN LLNTL S   +A HT++QV++KIA +
Sbjct  61   MKNSICSNNPTTNDLYAKQWLALPENAKNEIKNNLLNTLPSPNFEARHTAAQVVSKIALV  120

Query  575  EIPRXEWPELVGSLLAN  625
            E+P+ +W  L+  LL N
Sbjct  121  ELPQGQWGTLIPMLLEN  137



>gb|EMT00038.1| Importin subunit beta-1 [Aegilops tauschii]
Length=886

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 86/139 (62%), Gaps = 5/139 (4%)
 Frame = +2

Query  221  ITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIVLK  400
            I   L +A   D  +R+ AE  L Q  + +L  FLL L+ +LS +  P ES  LAGI+LK
Sbjct  5    IDILLANACQGDDNLRSIAEGKLKQLHDLDLSNFLLGLSSQLSREETPEESSILAGIILK  64

Query  401  NSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAK----IA  568
            NSLD+ E +  +   ++W ++D S++SQIK  LL TL S+  D+   SS++IAK    +A
Sbjct  65   NSLDSGEPALDDLGSRKWLSLDPSIQSQIKENLLLTLESNC-DSRRRSSKIIAKVIAWVA  123

Query  569  SIEIPRXEWPELVGSLLAN  625
             IEIPR +W EL+G L+ N
Sbjct  124  CIEIPRNQWEELIGKLVGN  142



>ref|XP_003716218.1| importin subunit beta-1 [Magnaporthe oryzae 70-15]
 gb|EHA49899.1| importin subunit beta-1 [Magnaporthe oryzae 70-15]
Length=876

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 83/137 (61%), Gaps = 1/137 (1%)
 Frame = +2

Query  218  EITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIVL  397
            +IT  L ++ SADA +R  AE  LTQ  E N  ++L +L  EL+N+  P   R  AGI +
Sbjct  5    DITTVLTNSLSADANLRHAAEQQLTQAAETNFSLYLATLVTELANENAPGHIRAAAGIAV  64

Query  398  KNSLDAKEASTKEHLVQQW-TAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            KN+  A+E S +  L Q+W    D   ++++K+L L TL+S+   A   ++QVIA IA I
Sbjct  65   KNAFTAREFSRQTELQQKWLQQTDDETRAKVKSLTLQTLSSTNSQAGQAAAQVIASIAGI  124

Query  575  EIPRXEWPELVGSLLAN  625
            E+PR +W +L+  L+ N
Sbjct  125  ELPRGQWADLMNILVTN  141



>gb|ELQ38309.1| importin subunit beta-1 [Magnaporthe oryzae Y34]
 gb|ELQ61593.1| importin subunit beta-1 [Magnaporthe oryzae P131]
Length=876

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 83/137 (61%), Gaps = 1/137 (1%)
 Frame = +2

Query  218  EITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIVL  397
            +IT  L ++ SADA +R  AE  LTQ  E N  ++L +L  EL+N+  P   R  AGI +
Sbjct  5    DITTVLTNSLSADANLRHAAEQQLTQAAETNFSLYLATLVTELANENAPGHIRAAAGIAV  64

Query  398  KNSLDAKEASTKEHLVQQW-TAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            KN+  A+E S +  L Q+W    D   ++++K+L L TL+S+   A   ++QVIA IA I
Sbjct  65   KNAFTAREFSRQTELQQKWLQQTDDETRAKVKSLTLQTLSSTNSQAGQAAAQVIASIAGI  124

Query  575  EIPRXEWPELVGSLLAN  625
            E+PR +W +L+  L+ N
Sbjct  125  ELPRGQWADLMNILVTN  141



>ref|XP_009041959.1| hypothetical protein AURANDRAFT_55562 [Aureococcus anophagefferens]
 gb|EGB03348.1| hypothetical protein AURANDRAFT_55562 [Aureococcus anophagefferens]
Length=865

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 87/137 (64%), Gaps = 1/137 (1%)
 Frame = +2

Query  218  EITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIVL  397
            E+++ LL+AQS D   R  AE  L Q++ Q+L  F+++LA EL+ +G    SR+LAG+ L
Sbjct  3    ELSSILLNAQSQDVNARNSAEQQLKQWETQSLAQFMVALAQELAGEGLDGNSRQLAGLHL  62

Query  398  KNSLDAKEASTKEHLVQQW-TAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            KN L A+++       ++W + +D   +++IK L L  L S V  A+H+ +QV+AKI +I
Sbjct  63   KNLLFARDSYIASEKKKRWYSTVDAHSRARIKALSLEALRSQVEQAAHSGAQVVAKIGAI  122

Query  575  EIPRXEWPELVGSLLAN  625
            E+   +WPEL+  LL N
Sbjct  123  ELQEKQWPELLSQLLRN  139



>ref|XP_007829703.1| hypothetical protein PFICI_02931 [Pestalotiopsis fici W106-1]
 gb|ETS84906.1| hypothetical protein PFICI_02931 [Pestalotiopsis fici W106-1]
Length=876

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 85/137 (62%), Gaps = 1/137 (1%)
 Frame = +2

Query  218  EITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIVL  397
            +I   L ++ S D+  RT AE  L+Q  E N P++L +L   L+++    + R  AG+ L
Sbjct  6    DINTILRNSLSPDSATRTAAEQQLSQASENNFPLYLATLVQALADESAEGQIRVAAGLAL  65

Query  398  KNSLDAKEASTKEHLVQQW-TAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            KN+  A+E S ++ L  +W    D   K+++K+L L TL+S+   A   ++QVIA +A+I
Sbjct  66   KNAFSAREFSRQQELQAKWLQQTDAETKTRVKSLALTTLSSTNSQAGQAAAQVIASVATI  125

Query  575  EIPRXEWPELVGSLLAN  625
            E+PR EWP+L+G+L+ N
Sbjct  126  ELPRNEWPDLLGTLVQN  142



>ref|XP_008860949.1| hypothetical protein H310_00093 [Aphanomyces invadans]
 gb|ETW09538.1| hypothetical protein H310_00093 [Aphanomyces invadans]
Length=851

 Score = 98.6 bits (244),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 85/137 (62%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            ++I N LL+  S DA +R +AE  L Q   +N    +++L+  L+ +  P   R+ AG+ 
Sbjct  1    MDIPNALLATTSPDANLRKQAEDALNQAVNENAGQLMVTLSQALAAEDFPTPGRQQAGLF  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN LDAK+ + +E  +QQW ++   ++  IK   L +L S    A+HT++QV+AKI SI
Sbjct  61   LKNILDAKDYALQELKIQQWYSLADDIRGAIKQFALASLKSPDTVAAHTAAQVVAKIGSI  120

Query  575  EIPRXEWPELVGSLLAN  625
            ++P+ +WP+L+  L+ N
Sbjct  121  DVPQKQWPDLLRILVEN  137



>emb|CEJ02610.1| hypothetical protein RMCBS344292_16610 [Rhizopus microsporus]
Length=162

 Score = 92.8 bits (229),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 78/137 (57%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            ++ T  L+++ S D  IR EA   L    + N P +  SL   L+N+     +R  AG+ 
Sbjct  1    MDATTLLVNSLSNDRAIREEATRQLELLAQDNYPTYAGSLCQILANESADDAARMSAGLA  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKNSL AK+ + KE   Q+W ++ V L++QIK  +L  L S  +     + QVIA IA I
Sbjct  61   LKNSLTAKDFARKEEFSQRWLSMPVDLRNQIKQGVLQGLASPKKSVGSIAGQVIAAIAEI  120

Query  575  EIPRXEWPELVGSLLAN  625
            E+P   WP+L+ ++LAN
Sbjct  121  ELPLNAWPDLITTMLAN  137



>ref|XP_002289979.1| importin beta-1 subunit-like protein [Thalassiosira pseudonana 
CCMP1335]
 gb|EED93516.1| importin beta-1 subunit-like protein, partial [Thalassiosira 
pseudonana CCMP1335]
Length=801

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 86/139 (62%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  MALEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAG  388
            MA ++T  LLS Q+ D  IR  AEA L   ++ NL  F L+LA ELS +GK V +R+LAG
Sbjct  1    MATDLTTTLLSCQNPDPTIRQAAEAALATAEQTNLADFFLALATELSTEGKDVTTRQLAG  60

Query  389  IVLKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIA  568
            +  KN L AK+ + +     +W A+    ++ IK+ +++ + S V  A HT++Q  A+IA
Sbjct  61   LHFKNLLVAKDDALQSQKHNKWKALPQEQRAVIKSTMMSAIRSPVPIARHTAAQACAEIA  120

Query  569  SIEIPRXEWPELVGSLLAN  625
            ++E+P  EWPE +  L+ N
Sbjct  121  TVELPYKEWPEFLAILMEN  139



>ref|XP_009830123.1| hypothetical protein H257_06557 [Aphanomyces astaci]
 gb|ETV80199.1| hypothetical protein H257_06557 [Aphanomyces astaci]
Length=851

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 87/137 (64%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            ++I N LL+  S DA +R +AE  L Q   +N    +++L+  L+ +  P   R+ AG+ 
Sbjct  1    MDIPNALLATTSPDANLRKQAEDALNQAVNENAGQLMVTLSQALAAEDFPTPGRQQAGLF  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN LDAK+ + +E  +QQW ++   +++ IK   L++L +    A+HT++QV+AKI SI
Sbjct  61   LKNILDAKDYALQELKIQQWYSLADDVRNAIKQYALSSLKAQDAIAAHTAAQVVAKIGSI  120

Query  575  EIPRXEWPELVGSLLAN  625
            ++P+ +WP+L+  L+ N
Sbjct  121  DVPQKQWPDLLRILVEN  137



>ref|XP_008027842.1| hypothetical protein SETTUDRAFT_155007 [Setosphaeria turcica 
Et28A]
 gb|EOA85464.1| hypothetical protein SETTUDRAFT_155007 [Setosphaeria turcica 
Et28A]
Length=872

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 79/137 (58%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            ++I   L    +ADA IR  AE  L Q  + N P +L  L  EL+N+    + R+ A + 
Sbjct  1    MDINQVLEGTYAADASIRNSAEQQLQQAADSNFPQYLTVLGGELANEQAAPQIRQAAALA  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN+  A+E +    + ++W  +D  +K Q+K + L+TL +  +     ++Q IA +A+I
Sbjct  61   LKNAFTAREYARLRQVQERWLGLDPQIKQQVKQMALSTLATPNKGVGSAAAQFIASVAAI  120

Query  575  EIPRXEWPELVGSLLAN  625
            EIPR +WPEL+ +L+ N
Sbjct  121  EIPRNQWPELMTTLVEN  137



>gb|EHK18867.1| hypothetical protein TRIVIDRAFT_76275 [Trichoderma virens Gv29-8]
Length=876

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 83/137 (61%), Gaps = 1/137 (1%)
 Frame = +2

Query  218  EITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIVL  397
            EI   L ++ S DA +R  AE  LTQ  E N P++L +L  EL+N+      R  AGI L
Sbjct  5    EINTVLANSLSPDANLRNAAEQQLTQAAESNFPLYLATLVQELANEQAESSIRAAAGIAL  64

Query  398  KNSLDAKEASTKEHLVQQW-TAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            KN+  A++ + ++ L  +W    D   K+++K L L TL+SS   A + ++QVI+ IA+I
Sbjct  65   KNAFTARDFARQQELQTKWLQGTDDETKNRVKQLTLQTLSSSNARAGNAAAQVISSIAAI  124

Query  575  EIPRXEWPELVGSLLAN  625
            E+PR +WP+L+  L+ N
Sbjct  125  ELPRNQWPDLLSFLVKN  141



>emb|CCD50099.1| similar to importin subunit beta-1 [Botrytis cinerea T4]
Length=862

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 84/137 (61%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +++ + LL++ +AD   R  AE  LTQ  E N   +L++L  +L+N+      R  AGI 
Sbjct  1    MDVGSVLLNSLAADNATRIAAEQQLTQASEANFSGYLVTLVEQLANEESQGSIRAAAGIA  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN+  A+E + +  L  +W  +D   + ++K+L L  L+S+   A  T++QVI+ IA+I
Sbjct  61   LKNAFTAREYALQRELQDKWLQVDPDTRKRVKDLTLQALSSNNNQAGQTAAQVISSIATI  120

Query  575  EIPRXEWPELVGSLLAN  625
            E+PR +WPEL+ +L+ N
Sbjct  121  ELPRDQWPELMPALVRN  137



>ref|XP_001553289.1| hypothetical protein BC1G_07702 [Botrytis cinerea B05.10]
 gb|EMR87332.1| putative importin subunit beta-1 protein [Botrytis cinerea BcDW1]
Length=871

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 84/137 (61%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +++ + LL++ +AD   R  AE  LTQ  E N   +L++L  +L+N+      R  AGI 
Sbjct  1    MDVGSVLLNSLAADNATRIAAEQQLTQASEANFSGYLVTLVEQLANEESQGSIRAAAGIA  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN+  A+E + +  L  +W  +D   + ++K+L L  L+S+   A  T++QVI+ IA+I
Sbjct  61   LKNAFTAREYALQRELQDKWLQVDPDTRKRVKDLTLQALSSNNNQAGQTAAQVISSIATI  120

Query  575  EIPRXEWPELVGSLLAN  625
            E+PR +WPEL+ +L+ N
Sbjct  121  ELPRDQWPELMPALVRN  137



>gb|EME47146.1| hypothetical protein DOTSEDRAFT_41624 [Dothistroma septosporum 
NZE10]
Length=870

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 83/138 (60%), Gaps = 1/138 (1%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +++   L    + DA IR +AE  L    EQ+ P +LL+L+ EL+ND      R  AG+ 
Sbjct  1    MDVDQVLTGTINPDANIRAQAEQQLLSAAEQDFPGYLLTLSRELANDQADSSVRMAAGLA  60

Query  395  LKNSLDAKEASTKEHLVQQW-TAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIAS  571
            LKNS  A++ +    + ++W   ID ++K ++K L L TL S+   A  +++Q IA IA+
Sbjct  61   LKNSFSARDFARLREVQRRWLEQIDPNVKQEVKTLSLQTLGSNDTRAGQSAAQFIASIAA  120

Query  572  IEIPRXEWPELVGSLLAN  625
            IE+PR +WPEL+ +L+ N
Sbjct  121  IELPREQWPELMPTLVEN  138



>ref|XP_006961870.1| predicted protein [Trichoderma reesei QM6a]
 gb|EGR53057.1| predicted protein [Trichoderma reesei QM6a]
 gb|ETS00059.1| ARM repeat-containing protein, partial [Trichoderma reesei RUT 
C-30]
Length=878

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 82/137 (60%), Gaps = 1/137 (1%)
 Frame = +2

Query  218  EITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIVL  397
            EI   L ++ S DA +R  AE  LTQ  E N P++L +L  EL+N+      R  AGI L
Sbjct  5    EINTVLANSLSPDANLRNAAEQQLTQAAESNFPLYLATLVQELANEQADGSIRAAAGIAL  64

Query  398  KNSLDAKEASTKEHLVQQW-TAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            KN+  A++ + ++ L  +W    D   K+++K L L TL+SS   A   ++QVI+ IA+I
Sbjct  65   KNAFTARDFARQQELQSKWLQGTDDETKNRVKQLTLQTLSSSNAQAGTAAAQVISSIAAI  124

Query  575  EIPRXEWPELVGSLLAN  625
            E+PR +WP+L+  L+ N
Sbjct  125  ELPRNQWPDLLSFLVKN  141



>gb|EMD94663.1| hypothetical protein COCHEDRAFT_1210699 [Bipolaris maydis C5]
 gb|ENI01625.1| hypothetical protein COCC4DRAFT_64415 [Bipolaris maydis ATCC 
48331]
Length=872

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 78/137 (57%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            ++I   L    +ADA IR  AE  L Q  + N P +L  L  EL+N+    + R+ A + 
Sbjct  1    MDINQVLEGTYAADASIRNSAEQQLQQAADSNFPQYLTVLGGELANEQAAPQIRQAAALA  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN+  A+E +    + ++W  +D  +K Q+K + L TL +  +     ++Q IA +A+I
Sbjct  61   LKNAFTAREYARLRQVQERWLGLDPQIKQQVKAMALGTLATPNKGVGSAAAQFIASVAAI  120

Query  575  EIPRXEWPELVGSLLAN  625
            EIPR +WPEL+ +L+ N
Sbjct  121  EIPRNQWPELMTTLVEN  137



>ref|XP_007705662.1| hypothetical protein COCSADRAFT_263844 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD58558.1| hypothetical protein COCSADRAFT_263844 [Bipolaris sorokiniana 
ND90Pr]
Length=872

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 78/137 (57%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            ++I   L    +ADA IR  AE  L Q  + N P +L  L  EL+N+    + R+ A + 
Sbjct  1    MDINQVLEGTYAADASIRNSAEQQLQQAADSNFPQYLTVLGGELANEQAAPQIRQAAALA  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN+  A+E +    + ++W  +D  +K Q+K + L TL +  +     ++Q IA +A+I
Sbjct  61   LKNAFTAREYARLRQVQERWLGLDPQIKQQVKAMALGTLATPNKGVGSAAAQFIASVAAI  120

Query  575  EIPRXEWPELVGSLLAN  625
            EIPR +WPEL+ +L+ N
Sbjct  121  EIPRNQWPELMTTLVEN  137



>ref|XP_007717170.1| hypothetical protein COCCADRAFT_9118 [Bipolaris zeicola 26-R-13]
 gb|EUC28515.1| hypothetical protein COCCADRAFT_9118 [Bipolaris zeicola 26-R-13]
 gb|EUN24604.1| hypothetical protein COCVIDRAFT_39854 [Bipolaris victoriae FI3]
Length=872

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 78/137 (57%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            ++I   L    +ADA IR  AE  L Q  + N P +L  L  EL+N+    + R+ A + 
Sbjct  1    MDINQVLEGTYAADASIRNSAEQQLQQAADSNFPQYLTVLGGELANEQAAPQIRQAAALA  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKN+  A+E +    + ++W  +D  +K Q+K + L TL +  +     ++Q IA +A+I
Sbjct  61   LKNAFTAREYARLRQVQERWLGLDPQIKQQVKAMALGTLATPNKGVGSAAAQFIASVAAI  120

Query  575  EIPRXEWPELVGSLLAN  625
            EIPR +WPEL+ +L+ N
Sbjct  121  EIPRNQWPELMTTLVEN  137



>ref|XP_004351151.1| karyopherin beta 1 isoform 4 [Dictyostelium fasciculatum]
 gb|EGG14643.1| karyopherin beta 1 isoform 4 [Dictyostelium fasciculatum]
Length=827

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 87/137 (64%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  LEITNFLLSAQSADAKIRTEAEATLTQFKEQNLPVFLLSLAVELSNDGKPVESRRLAGIV  394
            +++   L +A+  D   R +AE  L    +++   FL +LA+EL+N+ +    R+LAGI+
Sbjct  1    MDLVTILTNARDHDEAKRRDAEERLAAASQKDFGGFLHALALELANNDRQATLRQLAGII  60

Query  395  LKNSLDAKEASTKEHLVQQWTAIDVSLKSQIKNLLLNTLNSSVRDASHTSSQVIAKIASI  574
            LKNS+ + +A+  E   +QW A+  + K++++ LL NTL+S   ++ HT++QVIAK+A I
Sbjct  61   LKNSIYSNDANRYEVCQKQWIAVPENTKNEVRVLLTNTLHSQTYESRHTAAQVIAKLALI  120

Query  575  EIPRXEWPELVGSLLAN  625
            ++P   W  LV SL+ N
Sbjct  121  DLPTGSWQNLVPSLIEN  137



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250