BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS066B12

Length=621
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009769232.1|  PREDICTED: protein HOTHEAD-like isoform X1         315   2e-100   Nicotiana sylvestris
ref|XP_009769233.1|  PREDICTED: protein HOTHEAD-like isoform X2         315   2e-100   Nicotiana sylvestris
ref|XP_009600671.1|  PREDICTED: protein HOTHEAD-like isoform X1         314   2e-100   Nicotiana tomentosiformis
ref|XP_009600672.1|  PREDICTED: protein HOTHEAD-like isoform X2         314   2e-100   Nicotiana tomentosiformis
ref|XP_009789768.1|  PREDICTED: protein HOTHEAD-like isoform X1         310   2e-98    Nicotiana sylvestris
ref|XP_009789770.1|  PREDICTED: protein HOTHEAD-like isoform X2         309   2e-98    Nicotiana sylvestris
ref|XP_004236390.1|  PREDICTED: protein HOTHEAD                         301   1e-96    Solanum lycopersicum
ref|XP_009623734.1|  PREDICTED: protein HOTHEAD-like                    305   1e-96    Nicotiana tomentosiformis
ref|XP_006342983.1|  PREDICTED: protein HOTHEAD-like isoform X1         304   1e-96    Solanum tuberosum [potatoes]
ref|XP_006342984.1|  PREDICTED: protein HOTHEAD-like isoform X2         304   2e-96    Solanum tuberosum [potatoes]
ref|XP_011080131.1|  PREDICTED: protein HOTHEAD-like                    302   2e-95    Sesamum indicum [beniseed]
gb|EYU21373.1|  hypothetical protein MIMGU_mgv1a025036mg                297   3e-95    Erythranthe guttata [common monkey flower]
ref|XP_006357462.1|  PREDICTED: protein HOTHEAD-like                    301   3e-95    Solanum tuberosum [potatoes]
ref|XP_004241869.1|  PREDICTED: protein HOTHEAD                         299   2e-94    Solanum lycopersicum
gb|KJB70233.1|  hypothetical protein B456_011G064300                    291   4e-94    Gossypium raimondii
emb|CDO97913.1|  unnamed protein product                                296   1e-93    Coffea canephora [robusta coffee]
ref|XP_010654524.1|  PREDICTED: protein HOTHEAD                         293   3e-92    Vitis vinifera
emb|CBI35951.3|  unnamed protein product                                293   4e-92    Vitis vinifera
gb|KJB70232.1|  hypothetical protein B456_011G064300                    290   4e-92    Gossypium raimondii
gb|KDP40771.1|  hypothetical protein JCGZ_24770                         292   7e-92    Jatropha curcas
ref|XP_002527404.1|  glucose-methanol-choline (gmc) oxidoreductas...    292   8e-92    Ricinus communis
ref|XP_007024513.1|  Glucose-methanol-choline (GMC) oxidoreductas...    291   1e-91    
gb|ADN34109.1|  glucose-methanol-choline oxidoreductase                 290   1e-91    Cucumis melo subsp. melo
gb|KJB70230.1|  hypothetical protein B456_011G064300                    290   4e-91    Gossypium raimondii
ref|XP_011000798.1|  PREDICTED: protein HOTHEAD                         290   4e-91    Populus euphratica
ref|XP_008462353.1|  PREDICTED: protein HOTHEAD-like                    290   4e-91    Cucumis melo [Oriental melon]
gb|KDO65207.1|  hypothetical protein CISIN_1g007210mg                   287   5e-91    Citrus sinensis [apfelsine]
ref|XP_006369296.1|  adhesion of calyx edges family protein             289   1e-90    Populus trichocarpa [western balsam poplar]
ref|XP_004155973.1|  PREDICTED: protein HOTHEAD-like                    289   1e-90    
gb|KJB56894.1|  hypothetical protein B456_009G142000                    288   3e-90    Gossypium raimondii
ref|XP_004141804.1|  PREDICTED: protein HOTHEAD-like                    288   3e-90    Cucumis sativus [cucumbers]
gb|EPS62089.1|  hypothetical protein M569_12703                         283   3e-90    Genlisea aurea
ref|XP_011072517.1|  PREDICTED: protein HOTHEAD isoform X3              288   3e-90    Sesamum indicum [beniseed]
ref|XP_011072519.1|  PREDICTED: protein HOTHEAD isoform X4              287   4e-90    Sesamum indicum [beniseed]
ref|XP_011072516.1|  PREDICTED: protein HOTHEAD isoform X2              288   4e-90    Sesamum indicum [beniseed]
ref|XP_011072515.1|  PREDICTED: protein HOTHEAD isoform X1              287   8e-90    Sesamum indicum [beniseed]
ref|XP_006466014.1|  PREDICTED: protein HOTHEAD-like                    287   1e-89    Citrus sinensis [apfelsine]
ref|XP_009367557.1|  PREDICTED: protein HOTHEAD-like                    286   1e-89    Pyrus x bretschneideri [bai li]
ref|XP_009341036.1|  PREDICTED: protein HOTHEAD                         286   1e-89    Pyrus x bretschneideri [bai li]
ref|XP_006385367.1|  adhesion of calyx edges family protein             285   2e-89    
ref|XP_006426568.1|  hypothetical protein CICLE_v10025184mg             286   2e-89    Citrus clementina [clementine]
gb|KDO65206.1|  hypothetical protein CISIN_1g007210mg                   286   2e-89    Citrus sinensis [apfelsine]
ref|XP_008391329.1|  PREDICTED: protein HOTHEAD                         286   2e-89    Malus domestica [apple tree]
gb|KHG30455.1|  Protein HOTHEAD -like protein                           285   3e-89    Gossypium arboreum [tree cotton]
ref|XP_011012903.1|  PREDICTED: protein HOTHEAD-like                    284   7e-89    Populus euphratica
emb|CAN78644.1|  hypothetical protein VITISV_031743                     290   3e-88    Vitis vinifera
gb|KHG10360.1|  Protein HOTHEAD -like protein                           282   6e-88    Gossypium arboreum [tree cotton]
gb|ABN08391.1|  ABC transporter related; Choline dehydrogenase          276   4e-87    Medicago truncatula
ref|XP_007217778.1|  hypothetical protein PRUPE_ppa016983mg             278   7e-87    
ref|XP_003531615.1|  PREDICTED: protein HOTHEAD-like                    278   1e-86    Glycine max [soybeans]
ref|XP_007135552.1|  hypothetical protein PHAVU_010G139000g             279   1e-86    Phaseolus vulgaris [French bean]
ref|XP_004297554.1|  PREDICTED: protein HOTHEAD                         278   2e-86    Fragaria vesca subsp. vesca
ref|XP_010062628.1|  PREDICTED: protein HOTHEAD                         278   2e-86    
ref|XP_008228294.1|  PREDICTED: protein HOTHEAD                         278   2e-86    Prunus mume [ume]
dbj|BAD94191.1|  hypothetical protein                                   269   2e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007150522.1|  hypothetical protein PHAVU_005G159400g             277   3e-86    Phaseolus vulgaris [French bean]
ref|XP_008447607.1|  PREDICTED: protein HOTHEAD-like                    276   9e-86    Cucumis melo [Oriental melon]
ref|XP_006390607.1|  hypothetical protein EUTSA_v10018308mg             276   1e-85    Eutrema salsugineum [saltwater cress]
ref|XP_004146822.1|  PREDICTED: protein HOTHEAD-like                    276   1e-85    Cucumis sativus [cucumbers]
ref|XP_003597604.1|  Protein HOTHEAD                                    275   2e-85    Medicago truncatula
gb|KFK41737.1|  hypothetical protein AALP_AA2G166100                    275   2e-85    Arabis alpina [alpine rockcress]
ref|XP_009127961.1|  PREDICTED: protein HOTHEAD-like                    275   3e-85    Brassica rapa
emb|CDY48027.1|  BnaA02g16200D                                          275   3e-85    Brassica napus [oilseed rape]
ref|XP_004486827.1|  PREDICTED: protein HOTHEAD-like                    275   4e-85    Cicer arietinum [garbanzo]
ref|XP_003546687.1|  PREDICTED: protein HOTHEAD-like                    274   7e-85    Glycine max [soybeans]
ref|XP_009104835.1|  PREDICTED: protein HOTHEAD                         273   1e-84    Brassica rapa
emb|CDX68250.1|  BnaA07g22900D                                          273   1e-84    
emb|CDY11136.1|  BnaC06g23880D                                          273   1e-84    Brassica napus [oilseed rape]
dbj|BAA77842.1|  ACE                                                    273   2e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003543593.1|  PREDICTED: protein HOTHEAD-like                    272   3e-84    Glycine max [soybeans]
ref|XP_004510377.1|  PREDICTED: protein HOTHEAD-like                    272   5e-84    Cicer arietinum [garbanzo]
gb|KEH18350.1|  glucose-methanol-choline (GMC) oxidoreductase fam...    271   5e-84    Medicago truncatula
ref|XP_006302040.1|  hypothetical protein CARUB_v10020023mg             271   7e-84    
ref|XP_006302041.1|  hypothetical protein CARUB_v10020023mg             271   8e-84    Capsella rubella
ref|NP_565050.1|  embryo sac development arrest 17                      271   1e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002887465.1|  hypothetical protein ARALYDRAFT_895153             270   2e-83    Arabidopsis lyrata subsp. lyrata
emb|CDX82122.1|  BnaC02g21680D                                          270   3e-83    
ref|XP_010471340.1|  PREDICTED: protein HOTHEAD-like                    269   5e-83    Camelina sativa [gold-of-pleasure]
ref|XP_003529733.1|  PREDICTED: protein HOTHEAD-like isoform X1         268   9e-83    
gb|KHN39304.1|  Protein HOTHEAD                                         268   1e-82    Glycine soja [wild soybean]
gb|EPS62021.1|  hypothetical protein M569_12771                         266   4e-82    Genlisea aurea
ref|XP_010924991.1|  PREDICTED: protein HOTHEAD-like                    266   4e-82    Elaeis guineensis
ref|XP_009394110.1|  PREDICTED: protein HOTHEAD-like                    266   8e-82    
ref|XP_010428198.1|  PREDICTED: LOW QUALITY PROTEIN: protein HOTH...    266   8e-82    
ref|XP_010685404.1|  PREDICTED: protein HOTHEAD-like                    266   2e-81    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010242221.1|  PREDICTED: protein HOTHEAD-like isoform X2         264   2e-81    
ref|XP_010242219.1|  PREDICTED: protein HOTHEAD-like isoform X1         264   4e-81    Nelumbo nucifera [Indian lotus]
gb|KJB70231.1|  hypothetical protein B456_011G064300                    263   8e-81    Gossypium raimondii
ref|XP_010685403.1|  PREDICTED: protein HOTHEAD                         260   1e-79    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008795416.1|  PREDICTED: protein HOTHEAD-like isoform X2         258   5e-79    Phoenix dactylifera
ref|XP_008795415.1|  PREDICTED: protein HOTHEAD-like isoform X1         258   5e-79    Phoenix dactylifera
ref|XP_010537564.1|  PREDICTED: protein HOTHEAD                         259   6e-79    
ref|XP_010106238.1|  hypothetical protein L484_005099                   258   6e-79    
gb|ACG29139.1|  protein HOTHEAD precursor                               258   9e-79    Zea mays [maize]
gb|ACF81814.1|  unknown                                                 258   1e-78    Zea mays [maize]
ref|NP_001130910.1|  protein HOTHEAD precursor                          258   1e-78    Zea mays [maize]
ref|XP_010906842.1|  PREDICTED: protein HOTHEAD-like                    257   2e-78    Elaeis guineensis
ref|XP_010262118.1|  PREDICTED: protein HOTHEAD-like                    257   2e-78    Nelumbo nucifera [Indian lotus]
ref|XP_002462276.1|  hypothetical protein SORBIDRAFT_02g023010          257   3e-78    Sorghum bicolor [broomcorn]
ref|XP_006853836.1|  hypothetical protein AMTR_s00036p00060130          255   7e-78    
ref|XP_004956668.1|  PREDICTED: protein HOTHEAD-like                    255   8e-78    Setaria italica
ref|XP_009389850.1|  PREDICTED: protein HOTHEAD-like                    253   4e-77    Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT05881.1|  Protein HOTHEAD                                         253   6e-77    
gb|EAZ08804.1|  hypothetical protein OsI_31066                          253   8e-77    Oryza sativa Indica Group [Indian rice]
ref|NP_001062996.1|  Os09g0363900                                       253   9e-77    
dbj|BAJ90011.1|  predicted protein                                      252   2e-76    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006660570.1|  PREDICTED: protein HOTHEAD-like                    251   3e-76    Oryza brachyantha
gb|EMS45416.1|  Protein HOTHEAD                                         253   3e-76    Triticum urartu
ref|XP_010238105.1|  PREDICTED: protein HOTHEAD-like                    249   2e-75    Brachypodium distachyon [annual false brome]
ref|XP_008809962.1|  PREDICTED: protein HOTHEAD-like                    248   4e-75    
emb|CDM82692.1|  unnamed protein product                                248   5e-75    Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ87395.1|  predicted protein                                      248   5e-75    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS57763.1|  Protein HOTHEAD                                         249   2e-74    Triticum urartu
ref|XP_004973380.1|  PREDICTED: protein HOTHEAD-like isoform X2         246   4e-74    Setaria italica
ref|XP_002445466.1|  hypothetical protein SORBIDRAFT_07g019920          246   4e-74    Sorghum bicolor [broomcorn]
ref|XP_003574447.1|  PREDICTED: protein HOTHEAD-like                    245   5e-74    Brachypodium distachyon [annual false brome]
ref|NP_001147913.1|  protein HOTHEAD precursor                          244   2e-73    
ref|NP_001061757.1|  Os08g0401500                                       241   3e-72    
gb|KDO63592.1|  hypothetical protein CISIN_1g0081631mg                  231   5e-72    Citrus sinensis [apfelsine]
gb|EMT10900.1|  Protein HOTHEAD                                         240   2e-71    
dbj|BAK04452.1|  predicted protein                                      239   2e-71    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EYU36945.1|  hypothetical protein MIMGU_mgv1a007376mg                233   3e-71    Erythranthe guttata [common monkey flower]
ref|XP_004976549.1|  PREDICTED: protein HOTHEAD-like                    237   1e-70    Setaria italica
ref|NP_001053612.1|  Os04g0573100                                       236   2e-70    
ref|XP_006857945.1|  hypothetical protein AMTR_s00069p00163110          234   6e-70    
ref|XP_009616548.1|  PREDICTED: protein HOTHEAD-like                    234   7e-70    Nicotiana tomentosiformis
ref|XP_009800461.1|  PREDICTED: protein HOTHEAD                         234   8e-70    Nicotiana sylvestris
ref|XP_006659383.1|  PREDICTED: protein HOTHEAD-like                    234   1e-69    Oryza brachyantha
ref|XP_008246185.1|  PREDICTED: protein HOTHEAD-like                    222   1e-69    Prunus mume [ume]
ref|XP_011072078.1|  PREDICTED: protein HOTHEAD-like                    229   1e-69    
gb|EPS58737.1|  hypothetical protein M569_16076                         226   1e-69    Genlisea aurea
ref|XP_008803247.1|  PREDICTED: protein HOTHEAD-like                    234   1e-69    Phoenix dactylifera
ref|XP_006652668.1|  PREDICTED: protein HOTHEAD-like                    233   3e-69    Oryza brachyantha
ref|XP_006358855.1|  PREDICTED: protein HOTHEAD-like                    231   8e-69    Solanum tuberosum [potatoes]
ref|XP_006440518.1|  hypothetical protein CICLE_v10019427mg             231   9e-69    
gb|AFW72795.1|  hypothetical protein ZEAMMB73_541586                    221   9e-69    
tpg|DAA36392.1|  TPA: hypothetical protein ZEAMMB73_775461              231   1e-68    
ref|XP_010055593.1|  PREDICTED: protein HOTHEAD                         231   1e-68    Eucalyptus grandis [rose gum]
ref|XP_006440517.1|  hypothetical protein CICLE_v10019427mg             231   1e-68    Citrus clementina [clementine]
ref|XP_006477371.1|  PREDICTED: protein HOTHEAD-like isoform X5         231   2e-68    
ref|XP_006440515.1|  hypothetical protein CICLE_v10019611mg             230   2e-68    
gb|AES94124.2|  glucose-methanol-choline (GMC) oxidoreductase fam...    229   2e-68    Medicago truncatula
ref|XP_004511612.1|  PREDICTED: protein HOTHEAD-like                    230   3e-68    Cicer arietinum [garbanzo]
ref|XP_004245659.1|  PREDICTED: protein HOTHEAD                         230   3e-68    Solanum lycopersicum
ref|XP_006477369.1|  PREDICTED: protein HOTHEAD-like isoform X3         230   4e-68    
ref|XP_006477367.1|  PREDICTED: protein HOTHEAD-like isoform X1         230   4e-68    
ref|XP_003611166.1|  Choline dehydrogenase                              230   4e-68    
gb|KJB25745.1|  hypothetical protein B456_004G207200                    222   5e-68    Gossypium raimondii
ref|XP_008348797.1|  PREDICTED: protein HOTHEAD-like                    222   5e-68    
gb|KHN34438.1|  Protein HOTHEAD                                         229   5e-68    Glycine soja [wild soybean]
ref|XP_002282510.2|  PREDICTED: protein HOTHEAD                         229   5e-68    Vitis vinifera
ref|NP_001146691.1|  uncharacterized protein LOC100280292 precursor     230   6e-68    Zea mays [maize]
ref|XP_003581546.1|  PREDICTED: protein HOTHEAD                         229   9e-68    Brachypodium distachyon [annual false brome]
ref|XP_003525734.1|  PREDICTED: protein HOTHEAD-like                    229   1e-67    Glycine max [soybeans]
ref|XP_010255566.1|  PREDICTED: protein HOTHEAD-like                    228   1e-67    Nelumbo nucifera [Indian lotus]
emb|CDP09821.1|  unnamed protein product                                228   1e-67    Coffea canephora [robusta coffee]
gb|KJB25741.1|  hypothetical protein B456_004G207200                    221   2e-67    Gossypium raimondii
ref|XP_010272578.1|  PREDICTED: protein HOTHEAD-like                    228   2e-67    Nelumbo nucifera [Indian lotus]
gb|EYU39000.1|  hypothetical protein MIMGU_mgv1a003421mg                228   2e-67    Erythranthe guttata [common monkey flower]
gb|KJB25748.1|  hypothetical protein B456_004G207200                    221   2e-67    Gossypium raimondii
ref|XP_002446965.1|  hypothetical protein SORBIDRAFT_06g025960          228   4e-67    
ref|XP_004515792.1|  PREDICTED: protein HOTHEAD-like                    227   5e-67    Cicer arietinum [garbanzo]
gb|KJB25747.1|  hypothetical protein B456_004G207200                    220   6e-67    Gossypium raimondii
ref|XP_008358316.1|  PREDICTED: protein HOTHEAD-like                    220   7e-67    
ref|XP_011029158.1|  PREDICTED: protein HOTHEAD                         226   8e-67    Populus euphratica
gb|KHN34994.1|  Protein HOTHEAD                                         226   8e-67    Glycine soja [wild soybean]
gb|KDO63602.1|  hypothetical protein CISIN_1g0092411mg                  225   8e-67    Citrus sinensis [apfelsine]
gb|KDO63601.1|  hypothetical protein CISIN_1g0092411mg                  224   9e-67    Citrus sinensis [apfelsine]
gb|KJB25742.1|  hypothetical protein B456_004G207200                    221   1e-66    Gossypium raimondii
ref|XP_007040104.1|  Glucose-methanol-choline oxidoreductase fami...    226   1e-66    
ref|XP_002298074.1|  glucose-methanol-choline oxidoreductase fami...    225   2e-66    Populus trichocarpa [western balsam poplar]
gb|KHN14126.1|  Protein HOTHEAD                                         225   2e-66    Glycine soja [wild soybean]
gb|AFK39106.1|  unknown                                                 221   2e-66    Medicago truncatula
gb|KDO63598.1|  hypothetical protein CISIN_1g0081631mg                  217   2e-66    Citrus sinensis [apfelsine]
ref|XP_006477365.1|  PREDICTED: protein HOTHEAD-like isoform X1         224   2e-66    
ref|XP_006477366.1|  PREDICTED: protein HOTHEAD-like isoform X2         224   2e-66    
gb|KHG29300.1|  Protein HOTHEAD -like protein                           224   3e-66    Gossypium arboreum [tree cotton]
ref|XP_010919202.1|  PREDICTED: protein HOTHEAD-like                    225   3e-66    Elaeis guineensis
gb|ACR38765.1|  unknown                                                 217   3e-66    Zea mays [maize]
gb|KJB52037.1|  hypothetical protein B456_008G243300                    224   3e-66    Gossypium raimondii
ref|XP_006590534.1|  PREDICTED: protein HOTHEAD-like isoform X1         225   3e-66    Glycine max [soybeans]
ref|XP_006590535.1|  PREDICTED: protein HOTHEAD-like isoform X2         224   5e-66    Glycine max [soybeans]
ref|XP_010108049.1|  Protein HOTHEAD                                    224   6e-66    
ref|NP_001154469.1|  embryo sac development arrest 17                   224   6e-66    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007155569.1|  hypothetical protein PHAVU_003G213000g             224   8e-66    Phaseolus vulgaris [French bean]
ref|XP_003611165.1|  Choline dehydrogenase                              223   1e-65    Medicago truncatula
ref|XP_003549865.1|  PREDICTED: protein HOTHEAD-like                    223   1e-65    Glycine max [soybeans]
ref|XP_008245837.1|  PREDICTED: protein HOTHEAD-like                    223   1e-65    Prunus mume [ume]
ref|XP_004973379.1|  PREDICTED: protein HOTHEAD-like isoform X1         224   2e-65    
gb|KJB25740.1|  hypothetical protein B456_004G207200                    221   3e-65    Gossypium raimondii
ref|XP_004300752.1|  PREDICTED: protein HOTHEAD                         222   4e-65    Fragaria vesca subsp. vesca
ref|XP_009377909.1|  PREDICTED: protein HOTHEAD                         222   5e-65    Pyrus x bretschneideri [bai li]
ref|XP_007209039.1|  hypothetical protein PRUPE_ppa003422mg             221   5e-65    Prunus persica
gb|KHG26487.1|  Protein HOTHEAD                                         221   6e-65    Gossypium arboreum [tree cotton]
gb|ACN31684.1|  unknown                                                 221   6e-65    Zea mays [maize]
gb|KHG26488.1|  Protein HOTHEAD                                         221   6e-65    Gossypium arboreum [tree cotton]
ref|NP_001149739.1|  protein HOTHEAD precursor                          221   1e-64    
gb|EPS60348.1|  hypothetical protein M569_14454                         220   1e-64    Genlisea aurea
ref|XP_008437197.1|  PREDICTED: protein HOTHEAD                         220   2e-64    Cucumis melo [Oriental melon]
ref|NP_001168618.1|  uncharacterized protein LOC100382402               217   5e-64    
gb|AAF65820.1|AF251031_1  putative mandelonitrile lyase                 219   5e-64    Oryza sativa [red rice]
gb|KDP25523.1|  hypothetical protein JCGZ_20679                         218   1e-63    Jatropha curcas
ref|XP_006440516.1|  hypothetical protein CICLE_v10019427mg             218   2e-63    
ref|XP_004983866.1|  PREDICTED: protein HOTHEAD-like                    217   2e-63    Setaria italica
ref|XP_004159980.1|  PREDICTED: protein HOTHEAD-like                    217   2e-63    
ref|XP_004143995.1|  PREDICTED: protein HOTHEAD-like                    217   2e-63    Cucumis sativus [cucumbers]
ref|XP_010533726.1|  PREDICTED: protein HOTHEAD                         217   3e-63    Tarenaya hassleriana [spider flower]
ref|XP_002467623.1|  hypothetical protein SORBIDRAFT_01g031110          217   3e-63    Sorghum bicolor [broomcorn]
tpg|DAA46009.1|  TPA: hypothetical protein ZEAMMB73_516201              217   3e-63    
gb|EMT00670.1|  Protein HOTHEAD                                         216   5e-63    
gb|EAY79265.1|  hypothetical protein OsI_34381                          216   5e-63    Oryza sativa Indica Group [Indian rice]
ref|XP_006661974.1|  PREDICTED: protein HOTHEAD-like                    216   5e-63    Oryza brachyantha
ref|NP_001065107.1|  Os10g0524500                                       216   5e-63    
tpg|DAA46010.1|  TPA: hypothetical protein ZEAMMB73_516201              217   5e-63    
ref|XP_002454481.1|  hypothetical protein SORBIDRAFT_04g031910          216   8e-63    Sorghum bicolor [broomcorn]
ref|XP_006647683.1|  PREDICTED: protein HOTHEAD-like                    215   1e-62    Oryza brachyantha
ref|XP_009413011.1|  PREDICTED: protein HOTHEAD                         215   1e-62    Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAK07510.1|  predicted protein                                      215   1e-62    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY57073.1|  BnaCnng31540D                                          206   2e-62    Brassica napus [oilseed rape]
ref|XP_010234930.1|  PREDICTED: protein HOTHEAD-like isoform X2         214   4e-62    
ref|XP_003574225.1|  PREDICTED: protein HOTHEAD-like isoform X1         214   6e-62    Brachypodium distachyon [annual false brome]
ref|XP_010533369.1|  PREDICTED: protein HOTHEAD-like                    205   1e-61    Tarenaya hassleriana [spider flower]
ref|XP_002468629.1|  hypothetical protein SORBIDRAFT_01g049320          213   2e-61    Sorghum bicolor [broomcorn]
gb|EAY87068.1|  hypothetical protein OsI_08464                          212   2e-61    Oryza sativa Indica Group [Indian rice]
gb|EEE57571.1|  hypothetical protein OsJ_07923                          211   3e-61    Oryza sativa Japonica Group [Japonica rice]
dbj|BAK04607.1|  predicted protein                                      211   4e-61    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010676567.1|  PREDICTED: protein HOTHEAD-like isoform X2         211   5e-61    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010676566.1|  PREDICTED: protein HOTHEAD-like isoform X1         211   6e-61    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004987208.1|  PREDICTED: protein HOTHEAD-like                    211   1e-60    
ref|XP_003562180.2|  PREDICTED: protein HOTHEAD-like                    211   1e-60    
emb|CDY58608.1|  BnaCnng33370D                                          209   2e-60    Brassica napus [oilseed rape]
ref|XP_007029314.1|  Glucose-methanol-choline oxidoreductase fami...    209   3e-60    
ref|XP_009397840.1|  PREDICTED: protein HOTHEAD-like isoform X2         209   3e-60    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009397839.1|  PREDICTED: protein HOTHEAD-like isoform X1         209   3e-60    
ref|XP_009110637.1|  PREDICTED: protein HOTHEAD                         209   3e-60    Brassica rapa
ref|XP_004955148.1|  PREDICTED: protein HOTHEAD-like                    209   3e-60    Setaria italica
ref|XP_010235819.1|  PREDICTED: protein HOTHEAD-like                    208   4e-60    
gb|AAF88098.1|AC025417_26  T12C24.11                                    208   4e-60    Arabidopsis thaliana [mouse-ear cress]
gb|AAF79648.1|AC025416_22  F5O11.31                                     208   4e-60    Arabidopsis thaliana [mouse-ear cress]
gb|EMT29817.1|  hypothetical protein F775_42853                         204   8e-60    
ref|NP_172718.2|  glucose-methanol-choline (GMC) oxidoreductase-l...    207   9e-60    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007029322.1|  Glucose-methanol-choline oxidoreductase fami...    207   2e-59    
gb|EAY88296.1|  hypothetical protein OsI_09753                          207   2e-59    Oryza sativa Indica Group [Indian rice]
emb|CBI31862.3|  unnamed protein product                                206   2e-59    Vitis vinifera
ref|NP_001173240.1|  Os03g0118700                                       207   2e-59    
ref|XP_010482540.1|  PREDICTED: protein HOTHEAD-like isoform X1         207   3e-59    Camelina sativa [gold-of-pleasure]
ref|XP_006417220.1|  hypothetical protein EUTSA_v10007216mg             206   3e-59    Eutrema salsugineum [saltwater cress]
ref|XP_010482541.1|  PREDICTED: protein HOTHEAD-like isoform X2         206   3e-59    
ref|XP_010480446.1|  PREDICTED: protein HOTHEAD-like                    204   3e-59    
ref|XP_010482542.1|  PREDICTED: protein HOTHEAD-like isoform X3         206   3e-59    
ref|XP_002892695.1|  predicted protein                                  206   3e-59    Arabidopsis lyrata subsp. lyrata
ref|XP_006303946.1|  hypothetical protein CARUB_v10008714mg             206   3e-59    Capsella rubella
ref|XP_010662553.1|  PREDICTED: protein HOTHEAD-like                    205   3e-59    
ref|XP_002267848.2|  PREDICTED: protein HOTHEAD-like                    206   3e-59    Vitis vinifera
gb|AAL47442.1|  At1g12570/T12C24_9                                      206   4e-59    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006281639.1|  hypothetical protein CARUB_v10027769mg             206   4e-59    Capsella rubella
ref|XP_010458683.1|  PREDICTED: protein HOTHEAD-like                    206   5e-59    Camelina sativa [gold-of-pleasure]
ref|XP_010494342.1|  PREDICTED: protein HOTHEAD-like                    206   5e-59    Camelina sativa [gold-of-pleasure]
ref|XP_010444136.1|  PREDICTED: protein HOTHEAD-like isoform X1         205   8e-59    Camelina sativa [gold-of-pleasure]
ref|XP_010442706.1|  PREDICTED: protein HOTHEAD-like isoform X1         205   9e-59    Camelina sativa [gold-of-pleasure]
ref|XP_010442707.1|  PREDICTED: protein HOTHEAD-like isoform X2         205   9e-59    
ref|XP_010444144.1|  PREDICTED: protein HOTHEAD-like isoform X2         205   9e-59    
ref|XP_006649283.1|  PREDICTED: protein HOTHEAD-like                    204   2e-58    
gb|KFK26803.1|  hypothetical protein AALP_AA8G295400                    204   2e-58    Arabis alpina [alpine rockcress]
ref|XP_006401883.1|  hypothetical protein EUTSA_v10013065mg             204   3e-58    Eutrema salsugineum [saltwater cress]
gb|KFK26802.1|  hypothetical protein AALP_AA8G295400                    204   3e-58    Arabis alpina [alpine rockcress]
gb|KJB25744.1|  hypothetical protein B456_004G207200                    202   7e-58    Gossypium raimondii
emb|CDY31926.1|  BnaC09g28180D                                          199   8e-58    Brassica napus [oilseed rape]
ref|XP_010061679.1|  PREDICTED: protein HOTHEAD-like                    201   2e-57    Eucalyptus grandis [rose gum]
dbj|BAD29242.1|  putative mandelonitrile lyase                          202   2e-57    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009132573.1|  PREDICTED: protein HOTHEAD-like isoform X2         201   4e-57    Brassica rapa
ref|XP_009132572.1|  PREDICTED: protein HOTHEAD-like isoform X1         201   5e-57    Brassica rapa
ref|NP_001119417.1|  Glucose-methanol-choline (GMC) oxidoreductas...    200   5e-57    
gb|EMT19121.1|  Protein HOTHEAD                                         202   6e-57    
gb|KJB39382.1|  hypothetical protein B456_007G009900                    200   6e-57    Gossypium raimondii
ref|XP_002865884.1|  glucose-methanol-choline oxidoreductase fami...    200   7e-57    Arabidopsis lyrata subsp. lyrata
ref|NP_200008.1|  Glucose-methanol-choline (GMC) oxidoreductase f...    200   1e-56    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007038557.1|  Glucose-methanol-choline (GMC) oxidoreductas...    199   1e-56    
emb|CDY27093.1|  BnaA02g11130D                                          199   1e-56    Brassica napus [oilseed rape]
ref|XP_009127264.1|  PREDICTED: protein HOTHEAD-like isoform X2         199   1e-56    
ref|XP_009127263.1|  PREDICTED: protein HOTHEAD-like isoform X1         199   2e-56    
emb|CDX91616.1|  BnaC02g15440D                                          199   2e-56    
emb|CDY32608.1|  BnaC03g15760D                                          199   2e-56    
ref|XP_010555645.1|  PREDICTED: protein HOTHEAD-like isoform X1         198   3e-56    
ref|XP_007038559.1|  Glucose-methanol-choline (GMC) oxidoreductas...    198   3e-56    
ref|XP_009106994.1|  PREDICTED: protein HOTHEAD-like                    198   4e-56    
emb|CDY00506.1|  BnaA10g07670D                                          198   4e-56    
emb|CDY31927.1|  BnaC09g28170D                                          197   7e-56    
ref|XP_002510860.1|  glucose-methanol-choline (gmc) oxidoreductas...    197   8e-56    
ref|XP_009400095.1|  PREDICTED: protein HOTHEAD-like                    197   1e-55    
ref|XP_009341287.1|  PREDICTED: protein HOTHEAD-like                    196   2e-55    
ref|XP_006606089.1|  PREDICTED: protein HOTHEAD-like                    195   3e-55    
ref|XP_002864141.1|  hypothetical protein ARALYDRAFT_918231             194   3e-55    
gb|KHN15686.1|  Protein HOTHEAD                                         195   3e-55    
gb|KDP22341.1|  hypothetical protein JCGZ_26172                         195   5e-55    
emb|CDX91615.1|  BnaC02g15450D                                          195   5e-55    
gb|AAN60330.1|  unknown                                                 193   6e-55    
ref|XP_010442705.1|  PREDICTED: protein HOTHEAD-like                    194   7e-55    
ref|NP_567032.1|  Glucose-methanol-choline (GMC) oxidoreductase f...    194   1e-54    
ref|XP_010444097.1|  PREDICTED: protein HOTHEAD-like isoform X1         194   1e-54    
ref|XP_010482538.1|  PREDICTED: protein HOTHEAD-like                    193   2e-54    
emb|CDY27094.1|  BnaA02g11140D                                          194   2e-54    
gb|KJB25739.1|  hypothetical protein B456_004G207200                    193   2e-54    
ref|XP_002862494.1|  hypothetical protein ARALYDRAFT_920642             191   2e-54    
ref|XP_009132575.1|  PREDICTED: protein HOTHEAD-like isoform X1         192   3e-54    
ref|XP_006340529.1|  PREDICTED: protein HOTHEAD-like                    192   4e-54    
emb|CDY32609.1|  BnaC03g15770D                                          189   5e-54    
ref|XP_008234308.1|  PREDICTED: protein HOTHEAD-like                    192   5e-54    
ref|XP_010442702.1|  PREDICTED: protein HOTHEAD-like isoform X1         192   6e-54    
emb|CDY38885.1|  BnaA03g12940D                                          192   9e-54    
ref|XP_010693456.1|  PREDICTED: protein HOTHEAD-like                    191   1e-53    
ref|XP_009127265.1|  PREDICTED: protein HOTHEAD-like                    191   1e-53    
ref|XP_009588000.1|  PREDICTED: protein HOTHEAD-like isoform X3         191   1e-53    
ref|XP_004496619.1|  PREDICTED: protein HOTHEAD-like isoform X2         191   2e-53    
ref|XP_009587997.1|  PREDICTED: protein HOTHEAD-like isoform X1         191   2e-53    
emb|CDY32611.1|  BnaC03g15790D                                          190   2e-53    
ref|XP_006293262.1|  hypothetical protein CARUB_v10019598mg             191   2e-53    
ref|XP_009587999.1|  PREDICTED: protein HOTHEAD-like isoform X2         191   2e-53    
ref|XP_004496618.1|  PREDICTED: protein HOTHEAD-like isoform X1         191   2e-53    
ref|XP_006401884.1|  hypothetical protein EUTSA_v10015625mg             189   4e-53    
ref|XP_008378163.1|  PREDICTED: protein HOTHEAD-like                    189   5e-53    
emb|CDY27249.1|  BnaA09g35530D                                          181   6e-53    
ref|XP_002878059.1|  glucose-methanol-choline oxidoreductase fami...    189   7e-53    
ref|XP_006290809.1|  hypothetical protein CARUB_v10016915mg             189   7e-53    
ref|XP_011470413.1|  PREDICTED: protein HOTHEAD-like                    189   8e-53    
ref|XP_003557066.1|  PREDICTED: protein HOTHEAD-like isoform X1         189   1e-52    
ref|XP_006607079.1|  PREDICTED: protein HOTHEAD-like isoform X2         189   1e-52    
gb|KHN02790.1|  Protein HOTHEAD                                         189   1e-52    
ref|XP_009779701.1|  PREDICTED: protein HOTHEAD-like isoform X2         188   1e-52    
ref|XP_009779700.1|  PREDICTED: protein HOTHEAD-like isoform X1         188   1e-52    
ref|XP_010427413.1|  PREDICTED: protein HOTHEAD-like                    188   2e-52    
ref|XP_004240746.1|  PREDICTED: protein HOTHEAD isoform X2              187   2e-52    
ref|XP_010427412.1|  PREDICTED: protein HOTHEAD-like                    188   2e-52    
ref|XP_010681121.1|  PREDICTED: protein HOTHEAD-like                    188   2e-52    
gb|AES62586.2|  glucose-methanol-choline (GMC) oxidoreductase fam...    188   2e-52    
ref|XP_004240745.1|  PREDICTED: protein HOTHEAD isoform X1              187   3e-52    
dbj|BAB11043.1|  mandelonitrile lyase-like protein                      187   4e-52    
ref|XP_006282155.1|  hypothetical protein CARUB_v10028412mg             187   4e-52    
ref|XP_009132577.1|  PREDICTED: protein HOTHEAD-like                    187   5e-52    
ref|XP_007029324.1|  Glucose-methanol-choline oxidoreductase fami...    187   6e-52    
emb|CDY67702.1|  BnaCnng56000D                                          182   8e-52    
ref|XP_010504490.1|  PREDICTED: protein HOTHEAD-like isoform X2         186   9e-52    
ref|XP_006421826.1|  hypothetical protein CICLE_v10006541mg             186   1e-51    
gb|ABE66240.1|  glucose-methanol-choline oxidoreductase family pr...    179   1e-51    
ref|XP_010504489.1|  PREDICTED: protein HOTHEAD-like isoform X1         186   1e-51    
gb|EYU25043.1|  hypothetical protein MIMGU_mgv1a003898mg                185   2e-51    
ref|XP_010504487.1|  PREDICTED: protein HOTHEAD-like                    185   2e-51    
ref|XP_009132574.1|  PREDICTED: protein HOTHEAD-like isoform X3         185   3e-51    
emb|CDY67701.1|  BnaCnng55990D                                          185   3e-51    
ref|XP_009116301.1|  PREDICTED: protein HOTHEAD-like                    184   4e-51    
ref|XP_002509694.1|  glucose-methanol-choline (gmc) oxidoreductas...    184   4e-51    
ref|XP_009116302.1|  PREDICTED: protein HOTHEAD-like                    184   5e-51    
ref|XP_009116304.1|  PREDICTED: protein HOTHEAD-like isoform X2         183   6e-51    
ref|XP_009116303.1|  PREDICTED: protein HOTHEAD-like isoform X1         184   9e-51    
ref|XP_011076493.1|  PREDICTED: protein HOTHEAD                         183   1e-50    
ref|XP_010516205.1|  PREDICTED: protein HOTHEAD-like                    183   1e-50    
emb|CDP05260.1|  unnamed protein product                                182   1e-50    
ref|XP_007143363.1|  hypothetical protein PHAVU_007G066200g             183   1e-50    
gb|EYU25042.1|  hypothetical protein MIMGU_mgv1a025723mg                182   1e-50    
ref|XP_010555646.1|  PREDICTED: protein HOTHEAD-like isoform X2         183   1e-50    
ref|XP_010516203.1|  PREDICTED: protein HOTHEAD-like isoform X1         183   2e-50    
emb|CDX72176.1|  BnaC08g26980D                                          182   3e-50    
gb|EPS68877.1|  hypothetical protein M569_05889                         182   3e-50    
gb|KFK34849.1|  glucose-methanol-choline oxidoreductase family pr...    182   4e-50    
gb|KJB52883.1|  hypothetical protein B456_008G281500                    180   1e-49    
ref|NP_200006.1|  Glucose-methanol-choline (GMC) oxidoreductase f...    179   3e-49    
dbj|BAB11041.1|  mandelonitrile lyase-like protein                      179   3e-49    
emb|CDY27250.1|  BnaA09g35520D                                          179   4e-49    
ref|XP_010444103.1|  PREDICTED: protein HOTHEAD-like isoform X2         178   6e-49    
ref|XP_003592335.1|  Choline dehydrogenase                              178   7e-49    
ref|XP_006401885.1|  hypothetical protein EUTSA_v10015735mg             172   1e-48    
emb|CAB87405.1|  ADHESION OF CALYX EDGES-like protein                   177   2e-48    
ref|XP_009132576.1|  PREDICTED: protein HOTHEAD-like isoform X2         177   2e-48    
ref|XP_006282021.1|  hypothetical protein CARUB_v10028260mg             177   3e-48    
ref|XP_010442703.1|  PREDICTED: protein HOTHEAD-like isoform X2         176   3e-48    
ref|XP_010504485.1|  PREDICTED: protein HOTHEAD-like isoform X3         176   3e-48    
emb|CDY38884.1|  BnaA03g12950D                                          176   4e-48    
ref|XP_010504483.1|  PREDICTED: protein HOTHEAD-like isoform X1         176   4e-48    
gb|EMT33181.1|  Protein HOTHEAD                                         177   7e-48    
gb|EMS47461.1|  Protein HOTHEAD                                         170   1e-47    
ref|XP_002864140.1|  predicted protein                                  174   2e-47    
ref|XP_001752366.1|  predicted protein                                  174   3e-47    
ref|XP_010419173.1|  PREDICTED: protein HOTHEAD-like                    173   3e-47    
ref|XP_006292250.1|  hypothetical protein CARUB_v10018458mg             174   3e-47    
ref|XP_002991176.1|  hypothetical protein SELMODRAFT_429523             172   1e-46    
ref|XP_006377084.1|  hypothetical protein POPTR_0012s13760g             171   1e-46    
gb|KJB72815.1|  hypothetical protein B456_011G199100                    172   1e-46    
gb|ABK22756.1|  unknown                                                 165   4e-46    
ref|XP_010516202.1|  PREDICTED: protein HOTHEAD-like                    169   2e-45    
ref|XP_010516204.1|  PREDICTED: protein HOTHEAD-like isoform X2         169   2e-45    
ref|XP_001766599.1|  predicted protein                                  168   4e-45    
ref|XP_002969136.1|  hypothetical protein SELMODRAFT_90809              167   4e-45    
ref|XP_002973926.1|  hypothetical protein SELMODRAFT_100252             167   4e-45    
ref|XP_002991236.1|  hypothetical protein SELMODRAFT_429577             167   1e-44    
ref|XP_002311915.2|  hypothetical protein POPTR_0008s01010g             163   5e-44    
ref|XP_001765687.1|  predicted protein                                  164   1e-43    
ref|XP_010687278.1|  PREDICTED: (R)-mandelonitrile lyase-like           162   4e-43    
ref|XP_010537546.1|  PREDICTED: (R)-mandelonitrile lyase-like           162   4e-43    
emb|CDY48033.1|  BnaA02g16260D                                          156   9e-43    
gb|KFK41745.1|  hypothetical protein AALP_AA2G166800                    161   1e-42    
ref|XP_011033018.1|  PREDICTED: (R)-mandelonitrile lyase-like           160   1e-42    
ref|XP_006390599.1|  hypothetical protein EUTSA_v10018360mg             160   1e-42    
ref|XP_010504486.1|  PREDICTED: protein HOTHEAD-like isoform X4         160   2e-42    
ref|XP_008451901.1|  PREDICTED: (R)-mandelonitrile lyase 1-like         159   4e-42    
gb|KDP27710.1|  hypothetical protein JCGZ_19833                         159   5e-42    
ref|XP_006494824.1|  PREDICTED: (R)-mandelonitrile lyase-like iso...    159   7e-42    
ref|XP_006494825.1|  PREDICTED: (R)-mandelonitrile lyase-like iso...    159   7e-42    
emb|CDO97767.1|  unnamed protein product                                158   9e-42    
emb|CDY59931.1|  BnaC06g43850D                                          158   1e-41    
ref|XP_009105958.1|  PREDICTED: (R)-mandelonitrile lyase-like           158   1e-41    
emb|CDX96446.1|  BnaA07g30570D                                          158   1e-41    
ref|XP_010504484.1|  PREDICTED: protein HOTHEAD-like isoform X2         158   1e-41    
gb|ABE65766.1|  mandelonitrile lyase                                    158   1e-41    
ref|XP_010416081.1|  PREDICTED: (R)-mandelonitrile lyase-like           158   2e-41    
ref|NP_177448.1|  Glucose-methanol-choline (GMC) oxidoreductase f...    158   2e-41    
ref|XP_010428211.1|  PREDICTED: (R)-mandelonitrile lyase-like           157   2e-41    
ref|XP_004149078.1|  PREDICTED: (R)-mandelonitrile lyase 2-like         157   2e-41    
ref|XP_002888905.1|  hypothetical protein ARALYDRAFT_476435             157   2e-41    
ref|XP_010471352.1|  PREDICTED: (R)-mandelonitrile lyase-like           157   2e-41    
emb|CDX82114.1|  BnaC02g21760D                                          157   2e-41    
ref|XP_006438707.1|  hypothetical protein CICLE_v10031316mg             157   2e-41    
gb|KDO41647.1|  hypothetical protein CISIN_1g008715mg                   157   2e-41    
ref|XP_006427723.1|  hypothetical protein CICLE_v10025302mg             157   3e-41    
ref|XP_006483143.1|  PREDICTED: protein HOTHEAD-like                    157   3e-41    
gb|EMT20235.1|  (R)-mandelonitrile lyase 2                              155   3e-41    
ref|NP_001169073.1|  uncharacterized protein LOC100382914 precursor     157   3e-41    
ref|XP_006302030.1|  hypothetical protein CARUB_v10020012mg             157   4e-41    
ref|XP_006342873.1|  PREDICTED: (R)-mandelonitrile lyase-like           157   4e-41    
ref|XP_010103164.1|  (R)-mandelonitrile lyase 2                         156   4e-41    
ref|XP_010913841.1|  PREDICTED: (R)-mandelonitrile lyase-like           157   4e-41    
ref|XP_010103169.1|  (R)-mandelonitrile lyase 3                         155   4e-41    
ref|XP_009127967.1|  PREDICTED: LOW QUALITY PROTEIN: (R)-mandelon...    156   5e-41    
ref|XP_010663346.1|  PREDICTED: (R)-mandelonitrile lyase-like iso...    156   6e-41    
ref|XP_010318442.1|  PREDICTED: (R)-mandelonitrile lyase-like           156   6e-41    
gb|EYU45927.1|  hypothetical protein MIMGU_mgv1a003962mg                156   6e-41    
gb|EPS61959.1|  hypothetical protein M569_12833                         155   7e-41    
ref|XP_002277531.1|  PREDICTED: (R)-mandelonitrile lyase-like iso...    156   7e-41    
ref|XP_010034069.1|  PREDICTED: (R)-mandelonitrile lyase-like           156   7e-41    
ref|XP_008802001.1|  PREDICTED: (R)-mandelonitrile lyase-like           156   8e-41    
ref|XP_009391169.1|  PREDICTED: (R)-mandelonitrile lyase-like           155   1e-40    
gb|EMS54514.1|  (R)-mandelonitrile lyase 2                              153   1e-40    
ref|XP_004965686.1|  PREDICTED: (R)-mandelonitrile lyase-like           155   1e-40    
ref|XP_004167383.1|  PREDICTED: (R)-mandelonitrile lyase 3-like         155   1e-40    
ref|XP_010259761.1|  PREDICTED: (R)-mandelonitrile lyase-like           155   2e-40    
gb|ABK41611.1|  putative mandelonitrile lyase                           145   2e-40    
ref|XP_004149079.1|  PREDICTED: (R)-mandelonitrile lyase 3-like         155   2e-40    
gb|KJB56398.1|  hypothetical protein B456_009G117900                    155   2e-40    
gb|ABK25456.1|  unknown                                                 155   2e-40    
ref|XP_011072721.1|  PREDICTED: (R)-mandelonitrile lyase-like           154   3e-40    
ref|XP_003560382.1|  PREDICTED: (R)-mandelonitrile lyase-like           154   3e-40    
ref|XP_008380352.1|  PREDICTED: (R)-mandelonitrile lyase-like           153   6e-40    
ref|XP_009333989.1|  PREDICTED: (R)-mandelonitrile lyase-like           153   7e-40    
ref|XP_008229448.1|  PREDICTED: (R)-mandelonitrile lyase-like           153   8e-40    
ref|XP_002437392.1|  hypothetical protein SORBIDRAFT_10g026110          151   1e-39    
ref|XP_008451913.1|  PREDICTED: (R)-mandelonitrile lyase 3-like         152   1e-39    
ref|XP_009801182.1|  PREDICTED: (R)-mandelonitrile lyase-like           152   1e-39    
ref|XP_008353646.1|  PREDICTED: (R)-mandelonitrile lyase-like           152   2e-39    
ref|XP_002985169.1|  hypothetical protein SELMODRAFT_424302             151   3e-39    
ref|XP_007023096.1|  Glucose-methanol-choline (GMC) oxidoreductas...    151   3e-39    
ref|XP_002969832.1|  hypothetical protein SELMODRAFT_410833             151   3e-39    
ref|XP_004303845.1|  PREDICTED: (R)-mandelonitrile lyase-like           151   4e-39    
ref|XP_006656318.1|  PREDICTED: (R)-mandelonitrile lyase-like           151   4e-39    
ref|XP_006851096.1|  hypothetical protein AMTR_s00025p00245990          151   4e-39    
gb|KGN61116.1|  hypothetical protein Csa_2G055040                       151   4e-39    
ref|XP_009339536.1|  PREDICTED: (R)-mandelonitrile lyase-like           150   5e-39    
ref|XP_002964256.1|  hypothetical protein SELMODRAFT_81946              150   5e-39    
dbj|BAD94653.1|  hypothetical protein                                   140   7e-39    
gb|KHN39364.1|  (R)-mandelonitrile lyase-like                           150   7e-39    
ref|XP_003529712.1|  PREDICTED: (R)-mandelonitrile lyase-like           150   7e-39    
ref|XP_008451945.1|  PREDICTED: (R)-mandelonitrile lyase 1-like         149   8e-39    
ref|XP_004163173.1|  PREDICTED: (R)-mandelonitrile lyase 1-like         150   8e-39    
ref|XP_008452041.1|  PREDICTED: (R)-mandelonitrile lyase 1-like         150   9e-39    
ref|XP_007226647.1|  hypothetical protein PRUPE_ppa022070mg             150   1e-38    
ref|XP_008452076.1|  PREDICTED: (R)-mandelonitrile lyase 1-like         150   1e-38    
ref|XP_008223528.1|  PREDICTED: (R)-mandelonitrile lyase 1-like         149   1e-38    
ref|XP_004149088.1|  PREDICTED: (R)-mandelonitrile lyase 1-like         149   1e-38    
ref|XP_010110903.1|  (R)-mandelonitrile lyase-like protein              149   2e-38    
ref|XP_007135843.1|  hypothetical protein PHAVU_010G162900g             149   2e-38    
gb|KGN61111.1|  hypothetical protein Csa_2G050000                       149   2e-38    
ref|XP_004170004.1|  PREDICTED: (R)-mandelonitrile lyase 1-like         149   2e-38    
ref|XP_009614027.1|  PREDICTED: (R)-mandelonitrile lyase-like           149   2e-38    
ref|XP_002980351.1|  hypothetical protein SELMODRAFT_112603             148   2e-38    
gb|KDO82941.1|  hypothetical protein CISIN_1g0098732mg                  141   3e-38    
gb|KGN61121.1|  hypothetical protein Csa_2G057070                       148   5e-38    
ref|XP_003604138.1|  Mandelonitrile lyase                               147   7e-38    
ref|XP_002981619.1|  hypothetical protein SELMODRAFT_421074             147   7e-38    
ref|XP_004149082.1|  PREDICTED: (R)-mandelonitrile lyase 1-like         147   1e-37    
ref|XP_004150332.1|  PREDICTED: (R)-mandelonitrile lyase 1-like         147   1e-37    
ref|XP_004167384.1|  PREDICTED: (R)-mandelonitrile lyase 1-like         147   1e-37    
ref|XP_002315048.2|  glucose-methanol-choline oxidoreductase fami...    146   2e-37    
ref|XP_006403027.1|  hypothetical protein EUTSA_v10005870mg             146   2e-37    
gb|EAZ37866.1|  hypothetical protein OsJ_22211                          146   2e-37    
gb|KCW64951.1|  hypothetical protein EUGRSUZ_G02495                     145   2e-37    
ref|XP_009117924.1|  PREDICTED: protein HOTHEAD-like                    146   2e-37    
gb|EAZ01933.1|  hypothetical protein OsI_23959                          145   2e-37    
emb|CDX81617.1|  BnaC08g39840D                                          146   2e-37    
ref|NP_001174936.1|  Os06g0656000                                       146   2e-37    
ref|XP_011013275.1|  PREDICTED: (R)-mandelonitrile lyase-like           146   3e-37    
gb|KGN61113.1|  hypothetical protein Csa_2G055010                       140   3e-37    
ref|XP_010066905.1|  PREDICTED: (R)-mandelonitrile lyase-like iso...    145   3e-37    



>ref|XP_009769232.1| PREDICTED: protein HOTHEAD-like isoform X1 [Nicotiana sylvestris]
Length=601

 Score =   315 bits (806),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            FRGGFILEKIA+P SRG I L  TN +DNP+ITFNYFSHP DLK+CV+GIRIVEKI KSK
Sbjct  426  FRGGFILEKIATPLSRGNISLVTTNADDNPSITFNYFSHPRDLKRCVDGIRIVEKIAKSK  485

Query  184  RFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVGK  363
             F+N+TQCDKETLD+LLN+S QANVNLIP+HTN+TQSLEQFCKDTVITIWHYHGGCHVGK
Sbjct  486  HFTNYTQCDKETLDKLLNMSVQANVNLIPKHTNNTQSLEQFCKDTVITIWHYHGGCHVGK  545

Query  364  VVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            V+ PDYRVLG HRLRV+DGST  ESPGTNPQAT++MMGRYMGVKILR RLG  AG+
Sbjct  546  VIAPDYRVLGVHRLRVIDGSTFEESPGTNPQATVMMMGRYMGVKILRERLGRAAGL  601



>ref|XP_009769233.1| PREDICTED: protein HOTHEAD-like isoform X2 [Nicotiana sylvestris]
Length=600

 Score =   315 bits (806),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            FRGGFILEKIA+P SRG I L  TN +DNP+ITFNYFSHP DLK+CV+GIRIVEKI KSK
Sbjct  425  FRGGFILEKIATPLSRGNISLVTTNADDNPSITFNYFSHPRDLKRCVDGIRIVEKIAKSK  484

Query  184  RFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVGK  363
             F+N+TQCDKETLD+LLN+S QANVNLIP+HTN+TQSLEQFCKDTVITIWHYHGGCHVGK
Sbjct  485  HFTNYTQCDKETLDKLLNMSVQANVNLIPKHTNNTQSLEQFCKDTVITIWHYHGGCHVGK  544

Query  364  VVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            V+ PDYRVLG HRLRV+DGST  ESPGTNPQAT++MMGRYMGVKILR RLG  AG+
Sbjct  545  VIAPDYRVLGVHRLRVIDGSTFEESPGTNPQATVMMMGRYMGVKILRERLGRAAGL  600



>ref|XP_009600671.1| PREDICTED: protein HOTHEAD-like isoform X1 [Nicotiana tomentosiformis]
Length=597

 Score =   314 bits (805),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            FRGGFILEKIA+P SRG I L  TN +DNP+ITFNYFSHP DLK+CV+GIRIVEKI KSK
Sbjct  422  FRGGFILEKIATPLSRGNISLVTTNADDNPSITFNYFSHPRDLKRCVDGIRIVEKIAKSK  481

Query  184  RFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVGK  363
             F+N+TQCDKETLD+LLN+S QANVNLIP+HTN+TQSLEQFCKDTVITIWHYHGGCHVGK
Sbjct  482  HFTNYTQCDKETLDKLLNMSVQANVNLIPKHTNNTQSLEQFCKDTVITIWHYHGGCHVGK  541

Query  364  VVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            V+ PDYRVLG HRLRV+DGST  ESPGTNPQAT++MMGRYMGVKILR RLG  AG+
Sbjct  542  VIAPDYRVLGVHRLRVIDGSTFEESPGTNPQATVMMMGRYMGVKILRERLGRTAGL  597



>ref|XP_009600672.1| PREDICTED: protein HOTHEAD-like isoform X2 [Nicotiana tomentosiformis]
Length=596

 Score =   314 bits (805),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            FRGGFILEKIA+P SRG I L  TN +DNP+ITFNYFSHP DLK+CV+GIRIVEKI KSK
Sbjct  421  FRGGFILEKIATPLSRGNISLVTTNADDNPSITFNYFSHPRDLKRCVDGIRIVEKIAKSK  480

Query  184  RFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVGK  363
             F+N+TQCDKETLD+LLN+S QANVNLIP+HTN+TQSLEQFCKDTVITIWHYHGGCHVGK
Sbjct  481  HFTNYTQCDKETLDKLLNMSVQANVNLIPKHTNNTQSLEQFCKDTVITIWHYHGGCHVGK  540

Query  364  VVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            V+ PDYRVLG HRLRV+DGST  ESPGTNPQAT++MMGRYMGVKILR RLG  AG+
Sbjct  541  VIAPDYRVLGVHRLRVIDGSTFEESPGTNPQATVMMMGRYMGVKILRERLGRTAGL  596



>ref|XP_009789768.1| PREDICTED: protein HOTHEAD-like isoform X1 [Nicotiana sylvestris]
Length=600

 Score =   310 bits (793),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFIL KIA+P S G+I LK+TN++D P++TFNYFSHP DLK+CVNGIRI+EK+VKS
Sbjct  424  AFRGGFILAKIATPLSTGKISLKSTNIDDIPSVTFNYFSHPRDLKRCVNGIRIMEKLVKS  483

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K F+N+TQCDKETLD+LLNIS QAN+NLIP+HTNDT+SLEQFCKDTVITIWHYHGGCHVG
Sbjct  484  KHFTNYTQCDKETLDKLLNISVQANINLIPKHTNDTESLEQFCKDTVITIWHYHGGCHVG  543

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV  DY+V+  HRLRV+DGST TESPGTNPQATL+MMGRYMGV+ILR RLG  AG+
Sbjct  544  KVVTSDYKVINVHRLRVIDGSTFTESPGTNPQATLMMMGRYMGVQILRERLGRAAGL  600



>ref|XP_009789770.1| PREDICTED: protein HOTHEAD-like isoform X2 [Nicotiana sylvestris]
Length=599

 Score =   309 bits (792),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFIL KIA+P S G+I LK+TN++D P++TFNYFSHP DLK+CVNGIRI+EK+VKS
Sbjct  423  AFRGGFILAKIATPLSTGKISLKSTNIDDIPSVTFNYFSHPRDLKRCVNGIRIMEKLVKS  482

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K F+N+TQCDKETLD+LLNIS QAN+NLIP+HTNDT+SLEQFCKDTVITIWHYHGGCHVG
Sbjct  483  KHFTNYTQCDKETLDKLLNISVQANINLIPKHTNDTESLEQFCKDTVITIWHYHGGCHVG  542

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV  DY+V+  HRLRV+DGST TESPGTNPQATL+MMGRYMGV+ILR RLG  AG+
Sbjct  543  KVVTSDYKVINVHRLRVIDGSTFTESPGTNPQATLMMMGRYMGVQILRERLGRAAGL  599



>ref|XP_004236390.1| PREDICTED: protein HOTHEAD [Solanum lycopersicum]
Length=478

 Score =   301 bits (771),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 157/176 (89%), Gaps = 0/176 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFILEKIA P SRG I L  TN +DNP+ITFNYFSHP DLK+CV+GIRIVEKI KS
Sbjct  302  AFKGGFILEKIALPLSRGNISLVTTNPDDNPSITFNYFSHPRDLKRCVDGIRIVEKIAKS  361

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K F+NFTQC+KETLDRLLN+S QANVNLIP+HT++T+SLEQFCKDTVITIWHYHGGC VG
Sbjct  362  KHFTNFTQCNKETLDRLLNMSVQANVNLIPKHTHNTESLEQFCKDTVITIWHYHGGCQVG  421

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAG  528
            KV+ P+++VLG HRLRV+DGST  ESPGTNPQAT++MMGRYMGVKILR RLG  AG
Sbjct  422  KVIAPNHKVLGVHRLRVIDGSTFKESPGTNPQATVMMMGRYMGVKILRERLGKAAG  477



>ref|XP_009623734.1| PREDICTED: protein HOTHEAD-like [Nicotiana tomentosiformis]
Length=598

 Score =   305 bits (780),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFIL KIA+P S G+I LK+TN++D P++TFNYFSHP DLK+CVNGIRI+EK+VKS
Sbjct  422  AFRGGFILGKIATPLSTGKISLKSTNIDDIPSVTFNYFSHPRDLKRCVNGIRIMEKLVKS  481

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K F+N+TQCDKETLD+LLN+S QAN+NLIP++TNDT+SLEQFCKDTVITIWHYHGGCHVG
Sbjct  482  KHFTNYTQCDKETLDKLLNMSVQANINLIPKNTNDTESLEQFCKDTVITIWHYHGGCHVG  541

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV  DYRV+  H+LRV+DGST TESPGTNPQATL+MMGRYMGV+ILR RLG  AG+
Sbjct  542  KVVTSDYRVINVHKLRVIDGSTFTESPGTNPQATLMMMGRYMGVQILRERLGRAAGL  598



>ref|XP_006342983.1| PREDICTED: protein HOTHEAD-like isoform X1 [Solanum tuberosum]
Length=593

 Score =   304 bits (779),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKIA P SRG I L  TN +DNP+ITFNYFSHP DLK+CV+GIRI+EKI KS
Sbjct  417  AFRGGFILEKIALPLSRGNISLVTTNPDDNPSITFNYFSHPRDLKRCVDGIRIMEKIAKS  476

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K F+NFTQC+KETLDRLLN+S QANVNLIP+HT++T+SLEQFCKDTVITIWHYHGGC VG
Sbjct  477  KHFTNFTQCNKETLDRLLNMSVQANVNLIPKHTHNTESLEQFCKDTVITIWHYHGGCQVG  536

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KV+ PD++VLG HRLRV+DGST  ESPGTNPQAT++MMGRYMGVKILR RLG  AG+
Sbjct  537  KVIAPDHKVLGVHRLRVIDGSTFKESPGTNPQATVMMMGRYMGVKILRERLGKAAGL  593



>ref|XP_006342984.1| PREDICTED: protein HOTHEAD-like isoform X2 [Solanum tuberosum]
Length=591

 Score =   304 bits (779),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKIA P SRG I L  TN +DNP+ITFNYFSHP DLK+CV+GIRI+EKI KS
Sbjct  415  AFRGGFILEKIALPLSRGNISLVTTNPDDNPSITFNYFSHPRDLKRCVDGIRIMEKIAKS  474

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K F+NFTQC+KETLDRLLN+S QANVNLIP+HT++T+SLEQFCKDTVITIWHYHGGC VG
Sbjct  475  KHFTNFTQCNKETLDRLLNMSVQANVNLIPKHTHNTESLEQFCKDTVITIWHYHGGCQVG  534

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KV+ PD++VLG HRLRV+DGST  ESPGTNPQAT++MMGRYMGVKILR RLG  AG+
Sbjct  535  KVIAPDHKVLGVHRLRVIDGSTFKESPGTNPQATVMMMGRYMGVKILRERLGKAAGL  591



>ref|XP_011080131.1| PREDICTED: protein HOTHEAD-like [Sesamum indicum]
Length=600

 Score =   302 bits (773),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF GGFILEKIA P S+GQI L NTN++DNP+ITFNYFSHP D+ +CV+GIRI+EKI++S
Sbjct  424  AFMGGFILEKIARPLSKGQISLTNTNIDDNPSITFNYFSHPADVAQCVDGIRIIEKILQS  483

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K F+N+T+ DKET ++LLN+S +ANVNLIP+HTNDT+SLEQFCKDTVITIWHYHGGCHVG
Sbjct  484  KHFTNYTKMDKETTEKLLNMSVEANVNLIPKHTNDTKSLEQFCKDTVITIWHYHGGCHVG  543

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVVGPDYRVLG  RLRVVDGST  +SPGTNPQAT++MMGRYMGVKILR RLG   GV
Sbjct  544  KVVGPDYRVLGVERLRVVDGSTFYDSPGTNPQATVMMMGRYMGVKILRERLGKAGGV  600



>gb|EYU21373.1| hypothetical protein MIMGU_mgv1a025036mg, partial [Erythranthe 
guttata]
Length=462

 Score =   297 bits (760),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 133/177 (75%), Positives = 157/177 (89%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFILEKIA P S+G+I L NT +EDNP++TFNYFSHPDDL +CV+GIR+VEK++KS
Sbjct  286  AFKGGFILEKIAMPLSKGEIKLSNTVIEDNPSVTFNYFSHPDDLARCVDGIRVVEKMLKS  345

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K FS + Q D++T+D+LLN+S  ANVNLIPRHTNDT SLEQFCKDTVITIWHYHGGCHVG
Sbjct  346  KHFSEYAQLDQDTVDKLLNMSVHANVNLIPRHTNDTSSLEQFCKDTVITIWHYHGGCHVG  405

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV PD+RV+G  RLRV+DGST  +SPGTNPQAT++MMGRYMGVKILR RLG +AGV
Sbjct  406  KVVDPDHRVIGVDRLRVIDGSTFKDSPGTNPQATVMMMGRYMGVKILRERLGKEAGV  462



>ref|XP_006357462.1| PREDICTED: protein HOTHEAD-like [Solanum tuberosum]
Length=599

 Score =   301 bits (771),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKIA+P S G I LK+T ++D+P++TFNYFSHP DLK+CV+GIRI+EKIVKS
Sbjct  423  AFRGGFILEKIATPLSTGHISLKSTEIDDSPSVTFNYFSHPRDLKRCVDGIRIMEKIVKS  482

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K F+ + QCDK+TLD+LLN+S QAN+NLIP+HTNDT+SLEQFCKDTVITIWHYHGGC VG
Sbjct  483  KHFTTYAQCDKDTLDKLLNMSVQANINLIPKHTNDTESLEQFCKDTVITIWHYHGGCQVG  542

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV PDYRV+  +RLRV+DGST  ESPGTNPQAT+LMMGRYMGVKILR RLG  AG+
Sbjct  543  KVVTPDYRVMNVNRLRVIDGSTFNESPGTNPQATVLMMGRYMGVKILRERLGRAAGL  599



>ref|XP_004241869.1| PREDICTED: protein HOTHEAD [Solanum lycopersicum]
Length=597

 Score =   299 bits (766),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 157/177 (89%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKIA+P S G I LK+T V+D+P++TFNYFSHP DLK+CV+GIRIVE+IVKS
Sbjct  421  AFRGGFILEKIATPLSTGHISLKSTKVDDSPSVTFNYFSHPRDLKRCVDGIRIVEQIVKS  480

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K F+ + QCDK+TLD+LLN+S QAN+NLIP+HTNDT+SLEQFCKDTV TIWHYHGGC VG
Sbjct  481  KHFTTYAQCDKDTLDKLLNMSVQANINLIPKHTNDTESLEQFCKDTVTTIWHYHGGCQVG  540

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV PDYRV+  +RLRV+DGST  ESPGTNPQAT+LMMGRYMGVKILR RLG  AG+
Sbjct  541  KVVTPDYRVMNVNRLRVIDGSTFNESPGTNPQATVLMMGRYMGVKILRERLGRAAGL  597



>gb|KJB70233.1| hypothetical protein B456_011G064300 [Gossypium raimondii]
Length=355

 Score =   291 bits (744),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFILEKIA P S G + L NTN+++NP++TFNYF HP DL++CVNGIR+  K+++S
Sbjct  179  AFKGGFILEKIAMPLSTGHLNLINTNIDNNPSVTFNYFGHPRDLRRCVNGIRMAAKVIQS  238

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
             RF+NFT+CDK T++RLLN+S +AN+N IP+HTNDT+SLEQFCKDTVITIWHYHGGCHVG
Sbjct  239  DRFTNFTKCDKPTVERLLNMSVKANINFIPKHTNDTKSLEQFCKDTVITIWHYHGGCHVG  298

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV P+++VLGT RLR+VDGST +ESPGTNPQ T+LMMGRYMGVKILR RLG  AGV
Sbjct  299  KVVDPNHKVLGTRRLRIVDGSTFSESPGTNPQGTVLMMGRYMGVKILRRRLGKAAGV  355



>emb|CDO97913.1| unnamed protein product [Coffea canephora]
Length=597

 Score =   296 bits (759),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 155/176 (88%), Gaps = 0/176 (0%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            F+GGFILEKIA P S G+I L NTNV+DNP+ITFNYFSHP DL+KCVNGIRI+EKIV S 
Sbjct  422  FKGGFILEKIARPLSTGKISLINTNVDDNPSITFNYFSHPRDLQKCVNGIRIMEKIVNSN  481

Query  184  RFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVGK  363
            RF+N +QC KET+++LLN+S QANVNLIP+ TNDT+ LEQFCKDTV+TIWHYHGGCHVGK
Sbjct  482  RFTNISQCKKETIEKLLNMSVQANVNLIPKQTNDTKFLEQFCKDTVVTIWHYHGGCHVGK  541

Query  364  VVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            VVGPDY+VLG  RLRVVDGS   +SPGTNPQAT++MMGRYMGVKILR RLG  AG+
Sbjct  542  VVGPDYKVLGVQRLRVVDGSIFRDSPGTNPQATVMMMGRYMGVKILRKRLGRAAGI  597



>ref|XP_010654524.1| PREDICTED: protein HOTHEAD [Vitis vinifera]
Length=591

 Score =   293 bits (750),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF GGFILEKIASP S+G + L NTNV+DNP+ITFNYFSHP DL++CV GIR++EKIV++
Sbjct  415  AFMGGFILEKIASPFSKGHLKLINTNVDDNPSITFNYFSHPYDLQRCVEGIRMMEKIVRT  474

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + F N+TQCD  TLD+LLN+S +AN+NL+P+HTNDT+S+EQFCKDTVITIWHYHGGCHVG
Sbjct  475  QHFMNYTQCDDTTLDKLLNMSVKANINLVPKHTNDTKSMEQFCKDTVITIWHYHGGCHVG  534

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV   Y+VLG HRLRV+DGST  ESPGTNPQAT++MMGRYMG+KILR RLG  AGV
Sbjct  535  KVVDHKYKVLGVHRLRVIDGSTFRESPGTNPQATVMMMGRYMGLKILRERLGAAAGV  591



>emb|CBI35951.3| unnamed protein product [Vitis vinifera]
Length=593

 Score =   293 bits (750),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF GGFILEKIASP S+G + L NTNV+DNP+ITFNYFSHP DL++CV GIR++EKIV++
Sbjct  417  AFMGGFILEKIASPFSKGHLKLINTNVDDNPSITFNYFSHPYDLQRCVEGIRMMEKIVRT  476

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + F N+TQCD  TLD+LLN+S +AN+NL+P+HTNDT+S+EQFCKDTVITIWHYHGGCHVG
Sbjct  477  QHFMNYTQCDDTTLDKLLNMSVKANINLVPKHTNDTKSMEQFCKDTVITIWHYHGGCHVG  536

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV   Y+VLG HRLRV+DGST  ESPGTNPQAT++MMGRYMG+KILR RLG  AGV
Sbjct  537  KVVDHKYKVLGVHRLRVIDGSTFRESPGTNPQATVMMMGRYMGLKILRERLGAAAGV  593



>gb|KJB70232.1| hypothetical protein B456_011G064300 [Gossypium raimondii]
Length=498

 Score =   290 bits (742),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFILEKIA P S G + L NTN+++NP++TFNYF HP DL++CVNGIR+  K+++S
Sbjct  322  AFKGGFILEKIAMPLSTGHLNLINTNIDNNPSVTFNYFGHPRDLRRCVNGIRMAAKVIQS  381

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
             RF+NFT+CDK T++RLLN+S +AN+N IP+HTNDT+SLEQFCKDTVITIWHYHGGCHVG
Sbjct  382  DRFTNFTKCDKPTVERLLNMSVKANINFIPKHTNDTKSLEQFCKDTVITIWHYHGGCHVG  441

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV P+++VLGT RLR+VDGST +ESPGTNPQ T+LMMGRYMGVKILR RLG  AGV
Sbjct  442  KVVDPNHKVLGTRRLRIVDGSTFSESPGTNPQGTVLMMGRYMGVKILRRRLGKAAGV  498



>gb|KDP40771.1| hypothetical protein JCGZ_24770 [Jatropha curcas]
Length=594

 Score =   292 bits (748),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 156/178 (88%), Gaps = 1/178 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFILEK+ASP S G++ L NTNV+DNP+ITFNYF HP DLK+CVNGIR+  KIV+S
Sbjct  417  AFKGGFILEKLASPISTGELRLINTNVDDNPSITFNYFKHPKDLKRCVNGIRMATKIVQS  476

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + F+NFT+CDK+T++++LN S  ANVNLIPRH NDT+SLEQFCKDTVITIWHYHGGCHVG
Sbjct  477  EYFTNFTKCDKQTVEKILNKSVIANVNLIPRHPNDTKSLEQFCKDTVITIWHYHGGCHVG  536

Query  361  KVVGP-DYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV P DY+VLG  RLR+VDGST  ESPGTNPQAT+LMMGRYMG+KILR RLG  AGV
Sbjct  537  KVVSPVDYKVLGVQRLRIVDGSTFDESPGTNPQATVLMMGRYMGLKILRERLGEAAGV  594



>ref|XP_002527404.1| glucose-methanol-choline (gmc) oxidoreductase, putative [Ricinus 
communis]
 gb|EEF34970.1| glucose-methanol-choline (gmc) oxidoreductase, putative [Ricinus 
communis]
Length=597

 Score =   292 bits (748),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 157/177 (89%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFILEK+ASP S GQ+ L NTNV+DNP++TFNYF HP+DL+ CVNG+R+  KIV+S
Sbjct  421  AFKGGFILEKLASPISTGQLSLINTNVDDNPSVTFNYFKHPEDLRSCVNGVRMATKIVQS  480

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + F+NFTQCDK+T++++LNIS  ANVNLIP+H NDT+S+EQFC+DTVI+IWHYHGGCHVG
Sbjct  481  EHFTNFTQCDKQTMEKILNISVVANVNLIPKHPNDTKSIEQFCQDTVISIWHYHGGCHVG  540

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV PD++VLG  RLR+VDGST  ESPGTNPQAT+LMMGRYMG+KILR RLG +AG 
Sbjct  541  KVVSPDHKVLGVDRLRIVDGSTFDESPGTNPQATVLMMGRYMGLKILRDRLGKEAGA  597



>ref|XP_007024513.1| Glucose-methanol-choline (GMC) oxidoreductase family protein 
[Theobroma cacao]
 gb|EOY27135.1| Glucose-methanol-choline (GMC) oxidoreductase family protein 
[Theobroma cacao]
Length=591

 Score =   291 bits (746),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFILEKIASP S G + L NTN++DNP++TFNYF HP DL++CV+GIR+  K+++S
Sbjct  415  AFKGGFILEKIASPISTGHLNLVNTNIDDNPSVTFNYFGHPHDLQRCVDGIRMAAKVIQS  474

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
             RF+NFT+CDK T+++LLN+S +AN+NLIP+HTNDT+ L+QFCKDTVITIWHYHGGCHVG
Sbjct  475  DRFTNFTKCDKPTVEKLLNMSVKANINLIPKHTNDTKFLQQFCKDTVITIWHYHGGCHVG  534

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV PD+RVLGT+RLR+VDGST +ESPGTNPQ T+LMMGRYMGVKILR RLG  AGV
Sbjct  535  KVVHPDHRVLGTNRLRIVDGSTFSESPGTNPQGTVLMMGRYMGVKILRRRLGRAAGV  591



>gb|ADN34109.1| glucose-methanol-choline oxidoreductase [Cucumis melo subsp. 
melo]
Length=554

 Score =   290 bits (743),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 155/176 (88%), Gaps = 0/176 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGF+LEKIA+P SRGQ+ L NTNV+DNPA+TFNYF HP DL +CV GIR+V KIV+S
Sbjct  378  AFKGGFVLEKIANPISRGQLSLINTNVDDNPAVTFNYFGHPYDLHRCVEGIRMVTKIVES  437

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K F+NFTQCDKETLD+LLNIS +AN+NLIP+HTNDT+SLEQFCKDTVITIWHYHGGC V 
Sbjct  438  KCFTNFTQCDKETLDKLLNISVKANINLIPKHTNDTKSLEQFCKDTVITIWHYHGGCLVD  497

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAG  528
            KVV  D +VLG  RLR+VDGST +ESPGTNPQAT++MMGRYMG+KIL  RLG KAG
Sbjct  498  KVVSHDLKVLGVTRLRIVDGSTFSESPGTNPQATVMMMGRYMGLKILMDRLGKKAG  553



>gb|KJB70230.1| hypothetical protein B456_011G064300 [Gossypium raimondii]
Length=592

 Score =   290 bits (743),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFILEKIA P S G + L NTN+++NP++TFNYF HP DL++CVNGIR+  K+++S
Sbjct  416  AFKGGFILEKIAMPLSTGHLNLINTNIDNNPSVTFNYFGHPRDLRRCVNGIRMAAKVIQS  475

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
             RF+NFT+CDK T++RLLN+S +AN+N IP+HTNDT+SLEQFCKDTVITIWHYHGGCHVG
Sbjct  476  DRFTNFTKCDKPTVERLLNMSVKANINFIPKHTNDTKSLEQFCKDTVITIWHYHGGCHVG  535

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV P+++VLGT RLR+VDGST +ESPGTNPQ T+LMMGRYMGVKILR RLG  AGV
Sbjct  536  KVVDPNHKVLGTRRLRIVDGSTFSESPGTNPQGTVLMMGRYMGVKILRRRLGKAAGV  592



>ref|XP_011000798.1| PREDICTED: protein HOTHEAD [Populus euphratica]
Length=591

 Score =   290 bits (743),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 155/177 (88%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI++P S G++ L NTNVEDNP++TFNYF HP DL++CV+GIR+  K+V+S
Sbjct  415  AFRGGFILEKISNPVSTGKLKLINTNVEDNPSVTFNYFKHPHDLQRCVDGIRMATKMVQS  474

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + F+NFTQCDK+T D++LN+S  ANVNL+P+HTNDT+SLEQFCKDTVITIWHYHGGCHVG
Sbjct  475  EHFTNFTQCDKQTTDKILNMSVSANVNLVPKHTNDTKSLEQFCKDTVITIWHYHGGCHVG  534

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV  DY VLG +RLR+VDGS   ESPGTNPQAT+LMMGRYMG+KILR RLG  AGV
Sbjct  535  KVVNRDYNVLGVNRLRIVDGSVFDESPGTNPQATILMMGRYMGLKILRDRLGKAAGV  591



>ref|XP_008462353.1| PREDICTED: protein HOTHEAD-like [Cucumis melo]
Length=588

 Score =   290 bits (742),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 155/176 (88%), Gaps = 0/176 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGF+LEKIA+P SRGQ+ L NTNV+DNPA+TFNYF HP DL +CV GIR+V KIV+S
Sbjct  412  AFKGGFVLEKIANPISRGQLSLINTNVDDNPAVTFNYFGHPYDLHRCVEGIRMVTKIVES  471

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K F+NFTQCDKETLD+LLNIS +AN+NLIP+HTNDT+SLEQFCKDTVITIWHYHGGC V 
Sbjct  472  KCFTNFTQCDKETLDKLLNISVKANINLIPKHTNDTKSLEQFCKDTVITIWHYHGGCLVD  531

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAG  528
            KVV  D +VLG  RLR+VDGST +ESPGTNPQAT++MMGRYMG+KIL  RLG KAG
Sbjct  532  KVVSHDLKVLGVTRLRIVDGSTFSESPGTNPQATVMMMGRYMGLKILMDRLGKKAG  587



>gb|KDO65207.1| hypothetical protein CISIN_1g007210mg [Citrus sinensis]
Length=485

 Score =   287 bits (734),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 155/177 (88%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFILEKIASP S G++ L NTNV+DNP+++FNYFSHP DLK+CV+G+R+  KIV+S
Sbjct  309  AFKGGFILEKIASPISTGELSLINTNVDDNPSVSFNYFSHPLDLKRCVDGVRMAAKIVQS  368

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K F N+TQCD+++++ +LN S +ANVNL+P+HTNDT+SLEQFCKDTVITIWHYHGGCHVG
Sbjct  369  KHFLNYTQCDQKSVEAILNASVRANVNLVPKHTNDTKSLEQFCKDTVITIWHYHGGCHVG  428

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV  +Y+VLG  RLRVVDGST  ESPGTNPQ T+LMMGRYMGVKILR RLG  AGV
Sbjct  429  KVVSTEYKVLGIDRLRVVDGSTYDESPGTNPQGTVLMMGRYMGVKILRQRLGKAAGV  485



>ref|XP_006369296.1| adhesion of calyx edges family protein [Populus trichocarpa]
 gb|ERP65865.1| adhesion of calyx edges family protein [Populus trichocarpa]
Length=591

 Score =   289 bits (740),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 155/177 (88%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFILEKIA+P S GQ+ L +TNVEDNP++TFNYF HP DL++CV+GIR+  K+V+S
Sbjct  415  AFKGGFILEKIANPISTGQLRLISTNVEDNPSVTFNYFKHPRDLQRCVDGIRMATKMVQS  474

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + F NFTQCDK+T D++LN+S  ANVNL+P+HTNDT+SLEQFCKDTVITIWHYHGGCHVG
Sbjct  475  EHFRNFTQCDKQTTDKILNMSVSANVNLVPKHTNDTKSLEQFCKDTVITIWHYHGGCHVG  534

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV  DY+VLG +RLR+VDGS   ESPGTNPQAT++MMGRYMG+KILR RLG  AGV
Sbjct  535  KVVNSDYKVLGVNRLRIVDGSVFDESPGTNPQATVMMMGRYMGLKILRDRLGKGAGV  591



>ref|XP_004155973.1| PREDICTED: protein HOTHEAD-like [Cucumis sativus]
Length=587

 Score =   289 bits (739),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 154/176 (88%), Gaps = 0/176 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGF+LEKIA P SRGQ+ L NTNV+DNPA+TFNYF HP DL +CV GIR+V KIV+S
Sbjct  411  AFKGGFVLEKIAYPISRGQLSLINTNVDDNPAVTFNYFGHPYDLHRCVEGIRMVAKIVES  470

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K F+NFTQCD+ETLD+LLNIS +AN+NLIP+HTNDT+SLEQFCKDTVITIWHYHGGC V 
Sbjct  471  KCFTNFTQCDEETLDKLLNISVKANINLIPKHTNDTKSLEQFCKDTVITIWHYHGGCLVD  530

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAG  528
            KVV  D +VLG  RLR+VDGSTL+ESPGTNPQAT++MMGRYMG+KIL  RLG K G
Sbjct  531  KVVSHDLKVLGVTRLRIVDGSTLSESPGTNPQATVMMMGRYMGLKILMDRLGKKGG  586



>gb|KJB56894.1| hypothetical protein B456_009G142000 [Gossypium raimondii]
Length=593

 Score =   288 bits (737),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 155/177 (88%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFILEKIA P S G + L NTN++DNP++TFNYF HP DL++CVNGIR+  K+++S
Sbjct  417  AFKGGFILEKIARPISTGHLNLVNTNIDDNPSVTFNYFHHPHDLQRCVNGIRMAAKVIQS  476

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K F+NFT+CDK T+++LLN+S +AN+NLIP+HTNDT+SLEQFCKDTVITIWHYHGGCHVG
Sbjct  477  KHFTNFTRCDKPTVEKLLNMSVKANINLIPKHTNDTKSLEQFCKDTVITIWHYHGGCHVG  536

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV PD +VLGT+RLR+VDGST  ESPGTNPQ T+LMMGRYMGVKILR RLG  A V
Sbjct  537  KVVDPDLKVLGTNRLRIVDGSTFNESPGTNPQGTVLMMGRYMGVKILRRRLGKAAHV  593



>ref|XP_004141804.1| PREDICTED: protein HOTHEAD-like [Cucumis sativus]
 gb|KGN45528.1| Glucose-methanol-choline (Gmc) oxidoreductase [Cucumis sativus]
Length=588

 Score =   288 bits (736),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 154/176 (88%), Gaps = 0/176 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGF+LEKIA P SRGQ+ L NTNV+DNPA+TFNYF HP DL +CV GIR+V KIV+S
Sbjct  412  AFKGGFVLEKIAYPISRGQLSLINTNVDDNPAVTFNYFGHPYDLHRCVEGIRMVAKIVES  471

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K F+NFTQCD+ETLD+LLNIS +AN+NLIP+HTNDT+SLEQFCKDTVITIWHYHGGC V 
Sbjct  472  KCFTNFTQCDEETLDKLLNISVKANINLIPKHTNDTKSLEQFCKDTVITIWHYHGGCLVD  531

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAG  528
            KVV  D +VLG  RLR+VDGSTL+ESPGTNPQAT++MMGRYMG+KIL  RLG K G
Sbjct  532  KVVSHDLKVLGVTRLRIVDGSTLSESPGTNPQATVMMMGRYMGLKILMDRLGKKGG  587



>gb|EPS62089.1| hypothetical protein M569_12703, partial [Genlisea aurea]
Length=439

 Score =   283 bits (725),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 155/177 (88%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFILEK+A+P S+G I LKNTNV+DNP+ITFNYF HP DL +CV+GIRIVEK+++S
Sbjct  263  AFQGGFILEKLATPLSKGGISLKNTNVDDNPSITFNYFKHPADLARCVDGIRIVEKMLQS  322

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K FS +  C+K+T+ +L+N+S  ANVNLIPRHTNDT+SLEQFC+DTV+TIWHYHGGCHVG
Sbjct  323  KHFSGYLDCEKDTVQKLINMSVTANVNLIPRHTNDTESLEQFCRDTVLTIWHYHGGCHVG  382

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            +VV  DY+V+G  RLRVVDGST  ESPGTNPQAT++MMGRY+GVKILR RLG  AG+
Sbjct  383  RVVDRDYKVIGVERLRVVDGSTFRESPGTNPQATVMMMGRYVGVKILRERLGRGAGM  439



>ref|XP_011072517.1| PREDICTED: protein HOTHEAD isoform X3 [Sesamum indicum]
Length=582

 Score =   288 bits (736),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 154/177 (87%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFILEKIA P S GQI L N N++DNP+ITFNYFSHP DL +CV+GIR+VEK++KS
Sbjct  406  AFKGGFILEKIARPLSTGQISLINKNIDDNPSITFNYFSHPADLARCVDGIRVVEKMLKS  465

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K F+ + Q DK+ +++LLN+S +ANVNLIP+HTNDT+SLEQFCKDT+ITIWHYHGGCHVG
Sbjct  466  KHFAPYAQYDKDVVEKLLNLSVEANVNLIPKHTNDTKSLEQFCKDTLITIWHYHGGCHVG  525

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV  DY+VLG   LRV+DGST TESPGTNPQAT++MMGRYMGVKILR RLG  AGV
Sbjct  526  KVVSSDYKVLGVKGLRVIDGSTFTESPGTNPQATVMMMGRYMGVKILRERLGKAAGV  582



>ref|XP_011072519.1| PREDICTED: protein HOTHEAD isoform X4 [Sesamum indicum]
Length=579

 Score =   287 bits (735),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 154/177 (87%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFILEKIA P S GQI L N N++DNP+ITFNYFSHP DL +CV+GIR+VEK++KS
Sbjct  403  AFKGGFILEKIARPLSTGQISLINKNIDDNPSITFNYFSHPADLARCVDGIRVVEKMLKS  462

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K F+ + Q DK+ +++LLN+S +ANVNLIP+HTNDT+SLEQFCKDT+ITIWHYHGGCHVG
Sbjct  463  KHFAPYAQYDKDVVEKLLNLSVEANVNLIPKHTNDTKSLEQFCKDTLITIWHYHGGCHVG  522

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV  DY+VLG   LRV+DGST TESPGTNPQAT++MMGRYMGVKILR RLG  AGV
Sbjct  523  KVVSSDYKVLGVKGLRVIDGSTFTESPGTNPQATVMMMGRYMGVKILRERLGKAAGV  579



>ref|XP_011072516.1| PREDICTED: protein HOTHEAD isoform X2 [Sesamum indicum]
Length=591

 Score =   288 bits (736),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 154/177 (87%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFILEKIA P S GQI L N N++DNP+ITFNYFSHP DL +CV+GIR+VEK++KS
Sbjct  415  AFKGGFILEKIARPLSTGQISLINKNIDDNPSITFNYFSHPADLARCVDGIRVVEKMLKS  474

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K F+ + Q DK+ +++LLN+S +ANVNLIP+HTNDT+SLEQFCKDT+ITIWHYHGGCHVG
Sbjct  475  KHFAPYAQYDKDVVEKLLNLSVEANVNLIPKHTNDTKSLEQFCKDTLITIWHYHGGCHVG  534

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV  DY+VLG   LRV+DGST TESPGTNPQAT++MMGRYMGVKILR RLG  AGV
Sbjct  535  KVVSSDYKVLGVKGLRVIDGSTFTESPGTNPQATVMMMGRYMGVKILRERLGKAAGV  591



>ref|XP_011072515.1| PREDICTED: protein HOTHEAD isoform X1 [Sesamum indicum]
Length=597

 Score =   287 bits (734),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 154/177 (87%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFILEKIA P S GQI L N N++DNP+ITFNYFSHP DL +CV+GIR+VEK++KS
Sbjct  421  AFKGGFILEKIARPLSTGQISLINKNIDDNPSITFNYFSHPADLARCVDGIRVVEKMLKS  480

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K F+ + Q DK+ +++LLN+S +ANVNLIP+HTNDT+SLEQFCKDT+ITIWHYHGGCHVG
Sbjct  481  KHFAPYAQYDKDVVEKLLNLSVEANVNLIPKHTNDTKSLEQFCKDTLITIWHYHGGCHVG  540

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV  DY+VLG   LRV+DGST TESPGTNPQAT++MMGRYMGVKILR RLG  AGV
Sbjct  541  KVVSSDYKVLGVKGLRVIDGSTFTESPGTNPQATVMMMGRYMGVKILRERLGKAAGV  597



>ref|XP_006466014.1| PREDICTED: protein HOTHEAD-like [Citrus sinensis]
Length=612

 Score =   287 bits (735),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 155/177 (88%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFILEKIASP S G++ L NTNV+DNP+++FNYFSHP DLK+CV+G+R+  KIV+S
Sbjct  436  AFKGGFILEKIASPISTGELSLMNTNVDDNPSVSFNYFSHPLDLKRCVDGVRMAAKIVQS  495

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K F N+TQCD+++++ +LN S +ANVNL+P+HTNDT+SLEQFCKDTVITIWHYHGGCHVG
Sbjct  496  KHFLNYTQCDQKSVEAILNASVRANVNLVPKHTNDTKSLEQFCKDTVITIWHYHGGCHVG  555

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV  +Y+VLG  RLRVVDGST  ESPGTNPQ T+LMMGRYMGVKILR RLG  AGV
Sbjct  556  KVVSTEYKVLGIDRLRVVDGSTYDESPGTNPQGTVLMMGRYMGVKILRQRLGKAAGV  612



>ref|XP_009367557.1| PREDICTED: protein HOTHEAD-like [Pyrus x bretschneideri]
Length=591

 Score =   286 bits (732),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFILEKIASP S+G + L NTNV+DNP++TFNYFSHP DL++CV+GIR+  K+V+S
Sbjct  415  AFKGGFILEKIASPLSKGDLSLVNTNVDDNPSVTFNYFSHPYDLQRCVDGIRMATKVVQS  474

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + F+N+T+CD++T++++LN+S +ANVNLIP+HTNDT+SLEQFCKDTVITIWHYHGGCHVG
Sbjct  475  EPFTNYTKCDRQTVEKVLNMSVKANVNLIPKHTNDTKSLEQFCKDTVITIWHYHGGCHVG  534

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
             VV P+++VLG  R+RVVDGST +ESPGTNPQAT++MMGRY GVKI+R RLG  AG+
Sbjct  535  TVVSPEHKVLGVDRVRVVDGSTFSESPGTNPQATVMMMGRYFGVKIVRERLGTAAGI  591



>ref|XP_009341036.1| PREDICTED: protein HOTHEAD [Pyrus x bretschneideri]
Length=591

 Score =   286 bits (732),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFILEKIASP S+G + L NTNV+DNP++TFNYFSHP DL++CV+GIR+  K+V+S
Sbjct  415  AFKGGFILEKIASPLSKGDLSLVNTNVDDNPSVTFNYFSHPYDLQRCVDGIRMATKVVQS  474

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + F+N+T+CD++T++++LN+S +ANVNLIP+HTNDT+SLEQFCKDTVITIWHYHGGCHVG
Sbjct  475  EPFTNYTKCDRQTVEKVLNMSVKANVNLIPKHTNDTKSLEQFCKDTVITIWHYHGGCHVG  534

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
             VV P+++VLG  R+RVVDGST +ESPGTNPQAT++MMGRY GVKI+R RLG  AG+
Sbjct  535  TVVSPEHKVLGVDRVRVVDGSTFSESPGTNPQATVMMMGRYFGVKIVRERLGTAAGI  591



>ref|XP_006385367.1| adhesion of calyx edges family protein [Populus trichocarpa]
 gb|ERP63164.1| adhesion of calyx edges family protein [Populus trichocarpa]
Length=554

 Score =   285 bits (729),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 126/177 (71%), Positives = 155/177 (88%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI++P S G++ L NTNVEDNP++TFNYF HP DL++CV+GIR+  K+V+S
Sbjct  371  AFRGGFILEKISNPISTGKLKLINTNVEDNPSVTFNYFKHPHDLQRCVDGIRMATKMVQS  430

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + F+NFTQCDK+T D++LN+S  ANVNLIP+HTNDT+SLEQFCKDTV++IWHYHGGCHVG
Sbjct  431  EHFTNFTQCDKQTTDKILNMSVSANVNLIPKHTNDTKSLEQFCKDTVLSIWHYHGGCHVG  490

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV  +++VL  HRLR+VDGS   ESPGTNPQAT+LMMGRYMG+KILR RLG  AG+
Sbjct  491  KVVDREHKVLAVHRLRIVDGSVFDESPGTNPQATILMMGRYMGLKILRDRLGKAAGL  547



>ref|XP_006426568.1| hypothetical protein CICLE_v10025184mg [Citrus clementina]
 gb|ESR39808.1| hypothetical protein CICLE_v10025184mg [Citrus clementina]
Length=612

 Score =   286 bits (733),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 155/177 (88%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFILEKIASP S G++ L NTNV+DNP+++FNYFSHP DLK+CV+G+R+  KIV+S
Sbjct  436  AFKGGFILEKIASPISTGELSLINTNVDDNPSVSFNYFSHPLDLKRCVDGVRMAAKIVQS  495

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K F N+TQCD+++++ +LN S +ANVNL+P+HTNDT+SLEQFCKDTVITIWHYHGGCHVG
Sbjct  496  KHFLNYTQCDQKSVEAILNASVRANVNLVPKHTNDTKSLEQFCKDTVITIWHYHGGCHVG  555

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV  +Y+VLG  RLRVVDGST  ESPGTNPQ T+LMMGRYMGVKILR RLG  AGV
Sbjct  556  KVVSTEYKVLGIDRLRVVDGSTYDESPGTNPQGTVLMMGRYMGVKILRQRLGKAAGV  612



>gb|KDO65206.1| hypothetical protein CISIN_1g007210mg [Citrus sinensis]
Length=612

 Score =   286 bits (733),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 155/177 (88%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFILEKIASP S G++ L NTNV+DNP+++FNYFSHP DLK+CV+G+R+  KIV+S
Sbjct  436  AFKGGFILEKIASPISTGELSLINTNVDDNPSVSFNYFSHPLDLKRCVDGVRMAAKIVQS  495

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K F N+TQCD+++++ +LN S +ANVNL+P+HTNDT+SLEQFCKDTVITIWHYHGGCHVG
Sbjct  496  KHFLNYTQCDQKSVEAILNASVRANVNLVPKHTNDTKSLEQFCKDTVITIWHYHGGCHVG  555

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV  +Y+VLG  RLRVVDGST  ESPGTNPQ T+LMMGRYMGVKILR RLG  AGV
Sbjct  556  KVVSTEYKVLGIDRLRVVDGSTYDESPGTNPQGTVLMMGRYMGVKILRQRLGKAAGV  612



>ref|XP_008391329.1| PREDICTED: protein HOTHEAD [Malus domestica]
Length=592

 Score =   286 bits (731),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKIASP S+G + L NTNV+DNP++TFNYFSHP DL++CV+GIR+  K+V+S
Sbjct  416  AFRGGFILEKIASPLSKGDLSLVNTNVDDNPSVTFNYFSHPYDLQRCVDGIRMATKVVQS  475

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + F+N+T+CD++T +++L++S +ANVNLIP+HTNDT+SLEQFCKDTVITIWHYHGGCHVG
Sbjct  476  EHFTNYTKCDRQTAEKVLDMSVKANVNLIPKHTNDTKSLEQFCKDTVITIWHYHGGCHVG  535

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
             VV P+++VLG  R+RVVDGST +ESPGTNPQAT++MMGRY GVKI+R RLG  AG+
Sbjct  536  TVVSPEHKVLGVDRVRVVDGSTFSESPGTNPQATVMMMGRYFGVKIVRERLGTAAGI  592



>gb|KHG30455.1| Protein HOTHEAD -like protein [Gossypium arboreum]
Length=592

 Score =   285 bits (730),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 155/177 (88%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFILEKIA P S G + L NTN+++NP++TFNYF HP DL +CVNGIR+  K+++S
Sbjct  416  AFKGGFILEKIAMPLSTGHLNLINTNIDNNPSVTFNYFGHPRDLGRCVNGIRMAAKVIQS  475

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
             RF+NFT+CDK T+++LLN+S +AN+NLIP+HTNDT+SLEQFCKDTVITIWHYHGGC VG
Sbjct  476  DRFTNFTKCDKPTVEKLLNMSVKANINLIPKHTNDTKSLEQFCKDTVITIWHYHGGCLVG  535

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV P+++VLGT RLR+VDGST +ESPGTNPQ T+LMMGRYMGVKILR RLG  AGV
Sbjct  536  KVVDPNHKVLGTRRLRIVDGSTFSESPGTNPQGTVLMMGRYMGVKILRRRLGKAAGV  592



>ref|XP_011012903.1| PREDICTED: protein HOTHEAD-like [Populus euphratica]
Length=590

 Score =   284 bits (727),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 151/176 (86%), Gaps = 0/176 (0%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            F GGFILEKIASP S GQ+ L +TNVEDNP++TFNYF HP DL++CV+GIR+  K+ +S+
Sbjct  415  FEGGFILEKIASPISTGQLRLISTNVEDNPSVTFNYFKHPRDLQRCVDGIRMATKMAQSE  474

Query  184  RFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVGK  363
             F NFTQCDK+T D++LN+S  ANVNL+P+HTNDT+SLEQFCKDTVITIWHYHGGCHVGK
Sbjct  475  HFRNFTQCDKQTTDKILNMSVSANVNLVPKHTNDTKSLEQFCKDTVITIWHYHGGCHVGK  534

Query  364  VVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            VV  DY VLG +RLR+VDGS   ESPGTNPQAT++MMGRYMG+K+LR RLG  AGV
Sbjct  535  VVNRDYNVLGVNRLRIVDGSVFDESPGTNPQATVMMMGRYMGLKLLRDRLGKGAGV  590



>emb|CAN78644.1| hypothetical protein VITISV_031743 [Vitis vinifera]
Length=927

 Score =   290 bits (741),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 154/175 (88%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF GGFILEKIASP S+G + L NTNV+DNP+ITFNYFSHP DL++CV GIR++EKIV++
Sbjct  435  AFMGGFILEKIASPFSKGHLKLINTNVDDNPSITFNYFSHPYDLQRCVEGIRMMEKIVRT  494

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + F N+TQCD  TLD+LLN+S +AN+NL+P+HTNDT+S+EQFCKDTVITIWHYHGGCHVG
Sbjct  495  QHFMNYTQCDDTTLDKLLNMSVKANINLVPKHTNDTKSMEQFCKDTVITIWHYHGGCHVG  554

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKA  525
            KVV   Y+VLG HRLRV+DGST  ESPGTNPQAT++MMGRYMG+KILR RLG  A
Sbjct  555  KVVDHKYKVLGVHRLRVIDGSTFRESPGTNPQATVMMMGRYMGLKILRERLGAAA  609



>gb|KHG10360.1| Protein HOTHEAD -like protein [Gossypium arboreum]
Length=593

 Score =   282 bits (721),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 154/175 (88%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFILEKIA P S G + L NTN++DNP++TFNYF +P DL++CV+GIR+  K+++S
Sbjct  417  AFKGGFILEKIARPISTGHLNLVNTNIDDNPSVTFNYFHNPHDLQRCVDGIRMAAKVIQS  476

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K F+NFT+CDK T+++LLN+S +AN+NLIP+HTNDT+SLEQFCKDTVITIWHYHGGCHVG
Sbjct  477  KHFTNFTRCDKPTVEKLLNMSVKANINLIPKHTNDTKSLEQFCKDTVITIWHYHGGCHVG  536

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKA  525
            KVV P+ +VLGT+RLR+VDGST  ESPGTNPQ T+LMMGRYMGVKILR RLG  A
Sbjct  537  KVVNPELKVLGTNRLRIVDGSTFNESPGTNPQGTVLMMGRYMGVKILRRRLGKAA  591



>gb|ABN08391.1| ABC transporter related; Choline dehydrogenase [Medicago truncatula]
Length=441

 Score =   276 bits (705),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 152/177 (86%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFIL K+A+P S G + L NTNV+DNPA+TFNYFSHP DL +CV GIR+  K+V+S
Sbjct  265  AFKGGFILSKVANPWSTGDLKLINTNVDDNPAVTFNYFSHPYDLHRCVEGIRLATKVVQS  324

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + F+N T C+K+T ++LLN + +AN+NLIP+H NDT+SLEQFC+DTVITIWHYHGGCHVG
Sbjct  325  QHFTNLTLCEKQTTEQLLNNTVKANINLIPKHVNDTESLEQFCRDTVITIWHYHGGCHVG  384

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KV+  D++VLG +RLRV+DGST TESPGTNPQAT++MMGRYMGVKILR RLG  AGV
Sbjct  385  KVIDSDHKVLGVNRLRVIDGSTFTESPGTNPQATVMMMGRYMGVKILRDRLGKLAGV  441



>ref|XP_007217778.1| hypothetical protein PRUPE_ppa016983mg, partial [Prunus persica]
 gb|EMJ18977.1| hypothetical protein PRUPE_ppa016983mg, partial [Prunus persica]
Length=564

 Score =   278 bits (712),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 155/177 (88%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFILEKIA+P S+G + L NTNV+DNP++TFNYFSHP DL++CV+GIR+  K+V+S
Sbjct  388  AFKGGFILEKIANPISKGDLSLVNTNVDDNPSVTFNYFSHPYDLQRCVDGIRVATKVVQS  447

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + F+N+T+C+K+T++++LN+S +ANVNLIP+HTNDT+SLEQFCKDTVITIWHYHGG HVG
Sbjct  448  EHFTNYTRCNKQTVEKVLNMSVEANVNLIPKHTNDTKSLEQFCKDTVITIWHYHGGAHVG  507

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
             VV P ++VLG  R+RVVD ST +ESPGTNPQAT++MMGRY G KILR RLG  AG+
Sbjct  508  TVVSPQHKVLGVDRVRVVDSSTFSESPGTNPQATVMMMGRYFGAKILRERLGRAAGI  564



>ref|XP_003531615.1| PREDICTED: protein HOTHEAD-like [Glycine max]
 gb|KHN11285.1| Protein HOTHEAD [Glycine soja]
Length=591

 Score =   278 bits (712),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 148/176 (84%), Gaps = 0/176 (0%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            F+GGFIL K+A+P S G++ L NTNV DNP +TFNYFSHP DL +CV GIR+  K+V+SK
Sbjct  416  FKGGFILSKVANPWSVGELRLNNTNVNDNPVVTFNYFSHPYDLHRCVKGIRLAIKVVQSK  475

Query  184  RFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVGK  363
             F+N+T CDK+T + LLN++ +ANVN IP+H NDT S+ QFCKDTVITIWHYHGGCHVGK
Sbjct  476  HFTNYTLCDKKTTEELLNLTVKANVNFIPKHPNDTASIAQFCKDTVITIWHYHGGCHVGK  535

Query  364  VVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            VV PDY+VLG  RLRVVDGST  ESPGTNPQAT++MMGRYMG+KILRHRLG  AG+
Sbjct  536  VVSPDYKVLGVDRLRVVDGSTFDESPGTNPQATVMMMGRYMGLKILRHRLGKLAGI  591



>ref|XP_007135552.1| hypothetical protein PHAVU_010G139000g [Phaseolus vulgaris]
 gb|ESW07546.1| hypothetical protein PHAVU_010G139000g [Phaseolus vulgaris]
Length=626

 Score =   279 bits (714),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 151/177 (85%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFIL K+A+P S G++ L NTNV+DNPA+TFNYFSHP DL++CV GIR+  K+V+S
Sbjct  450  AFKGGFILSKVANPWSVGELKLVNTNVKDNPAVTFNYFSHPYDLERCVKGIRLAIKVVQS  509

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K F+N+T CDK+T + LLN++ +ANVN IP+H  DT+SL+QFCKDTVITIWHYHGGCHVG
Sbjct  510  KHFTNYTMCDKKTAEELLNLTVKANVNFIPKHVKDTKSLKQFCKDTVITIWHYHGGCHVG  569

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV PDY VLG  RLRVVDGST  ESPGTNPQAT++MMGRYMG+KILR RLG  AG+
Sbjct  570  KVVNPDYMVLGVDRLRVVDGSTFDESPGTNPQATVMMMGRYMGLKILRDRLGKLAGI  626



>ref|XP_004297554.1| PREDICTED: protein HOTHEAD [Fragaria vesca subsp. vesca]
Length=594

 Score =   278 bits (712),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 155/177 (88%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFIL+KIA+P S+G + L NTNV+DNP ++FNYFSHP DLK+CV+GIRI  K+ +S
Sbjct  418  AFKGGFILQKIANPISKGDLRLHNTNVDDNPDVSFNYFSHPYDLKRCVDGIRIATKVAQS  477

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + F+N+T+ DK+T++++LN+S +ANVNLIP++ NDT+SLEQFCKDTVITIWHYHGGCHVG
Sbjct  478  EHFTNYTRVDKQTVEKILNLSVKANVNLIPKNINDTKSLEQFCKDTVITIWHYHGGCHVG  537

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
             VV PD +VLG  R+RVVDGST +ESPGTNPQAT+LMMGRYMG+KILR RLG  AG+
Sbjct  538  TVVSPDNKVLGVDRVRVVDGSTFSESPGTNPQATVLMMGRYMGLKILRDRLGRAAGI  594



>ref|XP_010062628.1| PREDICTED: protein HOTHEAD [Eucalyptus grandis]
 gb|KCW69757.1| hypothetical protein EUGRSUZ_F03132 [Eucalyptus grandis]
Length=570

 Score =   278 bits (710),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 154/176 (88%), Gaps = 0/176 (0%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            FRGGFILEK+A+PSS+G++ L NTNV+DNP ITFNYFSHP DL++CV+GIR+  K+V+SK
Sbjct  395  FRGGFILEKLANPSSKGELRLINTNVDDNPWITFNYFSHPHDLERCVDGIRLATKVVQSK  454

Query  184  RFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVGK  363
             F+  T+ DK+T ++LLNIS +ANVNLIP+HTNDT+SLEQFC+DTVITIWHYHGGCHVGK
Sbjct  455  YFTELTRVDKQTTEKLLNISVKANVNLIPKHTNDTKSLEQFCRDTVITIWHYHGGCHVGK  514

Query  364  VVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            VV  + +VLG  +LRVVDGST +ESPGTNPQAT++MMGRYMG KILR+RLG  A V
Sbjct  515  VVDHENKVLGVDQLRVVDGSTFSESPGTNPQATVMMMGRYMGAKILRNRLGRAAAV  570



>ref|XP_008228294.1| PREDICTED: protein HOTHEAD [Prunus mume]
Length=588

 Score =   278 bits (711),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 154/177 (87%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFILEKIA+P S+G + L NTNV+DNP++TFNYFSHP DL++CV+GIR+  K+V+S
Sbjct  412  AFKGGFILEKIANPISKGDLSLVNTNVDDNPSVTFNYFSHPYDLQRCVDGIRVATKVVQS  471

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + F+N+T+C+K+T+D++LN S +ANVNLIP+HTNDT+SLEQFCKDTVITIWHYHGG HVG
Sbjct  472  EHFTNYTRCNKQTVDKVLNSSVEANVNLIPKHTNDTKSLEQFCKDTVITIWHYHGGAHVG  531

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
             VV P ++VLG  R+RVVD ST +ESPGTNPQAT++MMGRY G KILR RLG  AG+
Sbjct  532  TVVSPQHKVLGVDRVRVVDSSTFSESPGTNPQATVMMMGRYFGAKILRKRLGRAAGI  588



>dbj|BAD94191.1| hypothetical protein [Arabidopsis thaliana]
Length=294

 Score =   269 bits (687),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 146/177 (82%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF G FILEK+  P SRG + L NTNV+DNP++TFNYF HP DL++CV  IR+V K+V S
Sbjct  118  AFNGSFILEKLTYPISRGHLSLVNTNVDDNPSVTFNYFKHPVDLQRCVEAIRLVSKVVTS  177

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
             RF N+TQCDK+ + ++L++S +AN+NL P+  NDT+S+ QFCKDTV+TIWHYHGGC VG
Sbjct  178  NRFLNYTQCDKQNVHKMLSLSVKANINLRPKQLNDTKSMAQFCKDTVVTIWHYHGGCLVG  237

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV P+ +VLG  RLRV+DGST  ESPGTNPQAT++MMGRYMGVKILR RLGNKAGV
Sbjct  238  KVVSPNRKVLGVDRLRVIDGSTFDESPGTNPQATMMMMGRYMGVKILRERLGNKAGV  294



>ref|XP_007150522.1| hypothetical protein PHAVU_005G159400g [Phaseolus vulgaris]
 gb|ESW22516.1| hypothetical protein PHAVU_005G159400g [Phaseolus vulgaris]
Length=578

 Score =   277 bits (709),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 151/172 (88%), Gaps = 0/172 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFIL K+ASP S G++ L NTNVEDNPA+TFNYFSHP DLK+CV GIR+  K+V+S
Sbjct  406  AFKGGFILSKVASPWSTGELRLINTNVEDNPAVTFNYFSHPYDLKRCVEGIRLAIKVVQS  465

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            +  SN+T CD+ET +++LNIS QAN+NLIP+H NDT+SLEQFC+D+VITIWHYHGGCHVG
Sbjct  466  QHVSNYTICDRETAEKMLNISVQANINLIPKHPNDTKSLEQFCRDSVITIWHYHGGCHVG  525

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLG  516
            KVV  +++VLG  RLRVVDGST +ESPGTNPQAT++MMGRYMG+KILR RLG
Sbjct  526  KVVDSEHKVLGVDRLRVVDGSTFSESPGTNPQATVMMMGRYMGLKILRDRLG  577



>ref|XP_008447607.1| PREDICTED: protein HOTHEAD-like [Cucumis melo]
Length=595

 Score =   276 bits (707),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 151/177 (85%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFILEKIA+P S GQ+ L NTNV+DNP++TFNYF+HP DL +C++GIR   KIV+S
Sbjct  419  AFQGGFILEKIANPLSTGQLTLANTNVDDNPSVTFNYFNHPYDLHRCIDGIRTAAKIVQS  478

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K F  +T+   ET+++LLN + +ANVNLIP+HTNDT+SLEQFC+DTVITIWHYHGGCHVG
Sbjct  479  KHFREYTKNTGETIEKLLNATVKANVNLIPKHTNDTKSLEQFCRDTVITIWHYHGGCHVG  538

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV PD +VLG  RLRVVDGST  ESPGTNPQAT++MMGRYMG+KIL+ RLG  AG+
Sbjct  539  KVVSPDLKVLGVSRLRVVDGSTFNESPGTNPQATVMMMGRYMGLKILKDRLGKTAGI  595



>ref|XP_006390607.1| hypothetical protein EUTSA_v10018308mg [Eutrema salsugineum]
 gb|ESQ27893.1| hypothetical protein EUTSA_v10018308mg [Eutrema salsugineum]
Length=600

 Score =   276 bits (706),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 150/177 (85%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF G FILEK+A P SRG + L NTNV+DNP++TFNYFSHP DL++CV  IR+V K+V S
Sbjct  424  AFNGSFILEKLAYPISRGHLSLVNTNVDDNPSVTFNYFSHPVDLQRCVEAIRLVSKVVTS  483

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            KRF N+TQCDK+ + ++L++S +AN+NL P+  NDT+S+ QFCKDTV+TIWHYHGGC VG
Sbjct  484  KRFLNYTQCDKQNVHKMLSLSVKANINLRPKQVNDTRSMAQFCKDTVVTIWHYHGGCLVG  543

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV PD +VLG +RLRV+DGST  ESPGTNPQAT++MMGRYMGVKILR RLGNKAGV
Sbjct  544  KVVSPDRKVLGVNRLRVIDGSTFDESPGTNPQATVMMMGRYMGVKILRERLGNKAGV  600



>ref|XP_004146822.1| PREDICTED: protein HOTHEAD-like [Cucumis sativus]
 ref|XP_004164890.1| PREDICTED: protein HOTHEAD-like [Cucumis sativus]
 gb|KGN59821.1| hypothetical protein Csa_3G848300 [Cucumis sativus]
Length=595

 Score =   276 bits (705),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 151/177 (85%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFILEKIA+P S GQ+ L NTNV+DNP++TFNYF+HP DL +C++GIR   K+V+S
Sbjct  419  AFQGGFILEKIANPLSTGQLTLANTNVDDNPSVTFNYFNHPYDLHRCIDGIRTAAKVVQS  478

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K F  +T+   ET+++LLN + +ANVNLIP+HTNDT+SLEQFC+DTVITIWHYHGGCHVG
Sbjct  479  KHFREYTKNTGETIEKLLNATVKANVNLIPKHTNDTKSLEQFCRDTVITIWHYHGGCHVG  538

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV PD +VLG  RLRVVDGST  ESPGTNPQAT++MMGRYMG+KIL+ RLG  AG+
Sbjct  539  KVVSPDLKVLGVSRLRVVDGSTFDESPGTNPQATVMMMGRYMGLKILKDRLGKTAGI  595



>ref|XP_003597604.1| Protein HOTHEAD [Medicago truncatula]
 gb|AES67855.1| glucose-methanol-choline (GMC) oxidoreductase family protein 
[Medicago truncatula]
Length=594

 Score =   275 bits (704),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 152/177 (86%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFIL K+A+P S G + L NTNV+DNPA+TFNYFSHP DL +CV GIR+  K+V+S
Sbjct  418  AFKGGFILSKVANPWSTGDLKLINTNVDDNPAVTFNYFSHPYDLHRCVEGIRLATKVVQS  477

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + F+N T C+K+T ++LLN + +AN+NLIP+H NDT+SLEQFC+DTVITIWHYHGGCHVG
Sbjct  478  QHFTNLTLCEKQTTEQLLNNTVKANINLIPKHVNDTESLEQFCRDTVITIWHYHGGCHVG  537

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KV+  D++VLG +RLRV+DGST TESPGTNPQAT++MMGRYMGVKILR RLG  AGV
Sbjct  538  KVIDSDHKVLGVNRLRVIDGSTFTESPGTNPQATVMMMGRYMGVKILRDRLGKLAGV  594



>gb|KFK41737.1| hypothetical protein AALP_AA2G166100 [Arabis alpina]
Length=594

 Score =   275 bits (704),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 149/177 (84%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF G FILEK+A P SRG + L NTNV+DNP++TFNYF HP DL++CV GIR+V K+V S
Sbjct  418  AFNGSFILEKLAYPISRGHLSLVNTNVDDNPSVTFNYFKHPVDLERCVEGIRLVSKVVTS  477

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            KRF N+TQCDK  + ++L++S +AN+NL P+  NDT+S+ QFCKDTV+TIWHYHGGC VG
Sbjct  478  KRFLNYTQCDKLNVHKMLSLSVKANINLRPKQVNDTKSMAQFCKDTVVTIWHYHGGCLVG  537

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV PD++VLG  RLR++DGST  ESPGTNPQAT++MMGRYMGVKILR RLGNKAGV
Sbjct  538  KVVSPDHKVLGVDRLRIIDGSTFKESPGTNPQATIMMMGRYMGVKILRERLGNKAGV  594



>ref|XP_009127961.1| PREDICTED: protein HOTHEAD-like [Brassica rapa]
Length=594

 Score =   275 bits (703),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 149/177 (84%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF G FILEK+A P SRG + L NTNV+DNP++TFNYF HP DL++CV  IR+V K+V S
Sbjct  418  AFNGSFILEKLAYPISRGHLSLLNTNVDDNPSVTFNYFKHPVDLQRCVEAIRLVSKVVTS  477

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            KRF N+TQCDK+ + ++L++S +AN+NL P+  NDT+S+ QFCKDTV+TIWHYHGGC VG
Sbjct  478  KRFLNYTQCDKQNVHKMLSLSVKANINLRPKQVNDTKSMAQFCKDTVVTIWHYHGGCLVG  537

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV PD +VLG +RLRV+DGST  ESPGTNPQAT++MMGRYMGVKILR RLGNKAGV
Sbjct  538  KVVSPDRKVLGVNRLRVIDGSTFDESPGTNPQATVMMMGRYMGVKILRERLGNKAGV  594



>emb|CDY48027.1| BnaA02g16200D [Brassica napus]
Length=594

 Score =   275 bits (703),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 149/177 (84%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF G FILEK+A P SRG + L NTNV+DNP++TFNYF HP DL++CV  IR+V K+V S
Sbjct  418  AFNGSFILEKLAYPISRGHLSLLNTNVDDNPSVTFNYFKHPVDLQRCVEAIRLVSKVVTS  477

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            KRF N+TQCDK+ + ++L++S +AN+NL P+  NDT+S+ QFCKDTV+TIWHYHGGC VG
Sbjct  478  KRFLNYTQCDKQNVHKMLSLSVKANINLRPKQVNDTKSMAQFCKDTVVTIWHYHGGCLVG  537

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV PD +VLG +RLRV+DGST  ESPGTNPQAT++MMGRYMGVKILR RLGNKAGV
Sbjct  538  KVVSPDRKVLGVNRLRVIDGSTFDESPGTNPQATVMMMGRYMGVKILRERLGNKAGV  594



>ref|XP_004486827.1| PREDICTED: protein HOTHEAD-like [Cicer arietinum]
Length=583

 Score =   275 bits (702),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 151/177 (85%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFIL K+ASP S G + L NTNVEDNPA+TFNYF+HP DL++CV GIR+  K+V+S
Sbjct  407  AFKGGFILSKVASPWSTGNLKLINTNVEDNPAVTFNYFNHPYDLQRCVEGIRLATKVVQS  466

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + F+N T  D+ET ++ LN++ +AN+NLIP+H NDT+SLEQFC+DTVITIWHYHGGCHVG
Sbjct  467  QHFTNLTLSDRETAEQFLNMTVKANINLIPKHVNDTKSLEQFCRDTVITIWHYHGGCHVG  526

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KV+  DY+VLG +R+RV+DGST TESPGTNPQAT++MMGRYMG+KILR R+G   GV
Sbjct  527  KVIDSDYKVLGLNRIRVIDGSTFTESPGTNPQATVMMMGRYMGLKILRDRMGKFVGV  583



>ref|XP_003546687.1| PREDICTED: protein HOTHEAD-like [Glycine max]
 gb|KHN32691.1| Protein HOTHEAD [Glycine soja]
Length=585

 Score =   274 bits (700),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 154/177 (87%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFIL K+A+P S G++ LKNTNVEDNPA+TFNYFSHP DL++CV GIR+  K+V+S
Sbjct  409  AFRGGFILSKVANPWSTGELKLKNTNVEDNPAVTFNYFSHPYDLRRCVEGIRLAIKVVQS  468

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            +  +N+T C++ET +++LN+S +AN+NLIP+  NDT+S+EQFC+D+VITIWHYHGGCHVG
Sbjct  469  EHVTNYTLCERETAEKMLNLSVKANINLIPKRPNDTKSVEQFCRDSVITIWHYHGGCHVG  528

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV  +++VLG  RLRVVDGST +ESPGTNPQAT++MMGRYMG+KILR RLG  AG+
Sbjct  529  KVVNSEHKVLGVDRLRVVDGSTFSESPGTNPQATVMMMGRYMGLKILRDRLGKLAGI  585



>ref|XP_009104835.1| PREDICTED: protein HOTHEAD [Brassica rapa]
Length=602

 Score =   273 bits (699),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 148/177 (84%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF G FILEK+A P SRG + L NTNV+DNP++TFNYF HP DL++CV  IR+V K+V S
Sbjct  426  AFNGSFILEKLAYPISRGHLSLLNTNVDDNPSVTFNYFKHPVDLQRCVEAIRLVSKVVTS  485

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            KRF N+TQCDK+ +  +L++S +AN+NL P+  NDT+S+ QFCKDTV+TIWHYHGGC VG
Sbjct  486  KRFLNYTQCDKQNVHEMLSLSVKANINLRPKQVNDTKSMAQFCKDTVVTIWHYHGGCLVG  545

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV PD +VLG +RLRV+DGST  ESPGTNPQAT++MMGRYMGVKILR RLGNKAGV
Sbjct  546  KVVSPDRKVLGVNRLRVIDGSTFDESPGTNPQATVMMMGRYMGVKILRKRLGNKAGV  602



>emb|CDX68250.1| BnaA07g22900D [Brassica napus]
Length=602

 Score =   273 bits (699),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 148/177 (84%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF G FILEK+A P SRG + L NTNV+DNP++TFNYF HP DL++CV  IR+V K+V S
Sbjct  426  AFNGSFILEKLAYPISRGHLSLLNTNVDDNPSVTFNYFKHPVDLQRCVEAIRLVSKVVTS  485

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            KRF N+TQCDK+ +  +L++S +AN+NL P+  NDT+S+ QFCKDTV+TIWHYHGGC VG
Sbjct  486  KRFLNYTQCDKQNVHEMLSLSVKANINLRPKQVNDTKSMAQFCKDTVVTIWHYHGGCLVG  545

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV PD +VLG +RLRV+DGST  ESPGTNPQAT++MMGRYMGVKILR RLGNKAGV
Sbjct  546  KVVSPDRKVLGVNRLRVIDGSTFDESPGTNPQATVMMMGRYMGVKILRKRLGNKAGV  602



>emb|CDY11136.1| BnaC06g23880D [Brassica napus]
Length=602

 Score =   273 bits (699),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 148/177 (84%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF G FILEK+A P SRG + L NTNV+DNP++TFNYF HP DL++CV  IR+V K+V S
Sbjct  426  AFNGSFILEKLAYPISRGHLSLLNTNVDDNPSVTFNYFKHPVDLQRCVEAIRLVSKVVTS  485

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            KRF N+TQCDK+ +  +L++S +AN+NL P+  NDT+S+ QFCKDTV+TIWHYHGGC VG
Sbjct  486  KRFLNYTQCDKQNVHEMLSLSVKANINLRPKQVNDTKSMAQFCKDTVVTIWHYHGGCLVG  545

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV PD +VLG +RLRV+DGST  ESPGTNPQAT++MMGRYMGVKILR RLGNKAGV
Sbjct  546  KVVSPDRKVLGVNRLRVIDGSTFDESPGTNPQATVMMMGRYMGVKILRKRLGNKAGV  602



>dbj|BAA77842.1| ACE [Arabidopsis thaliana]
Length=594

 Score =   273 bits (697),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 148/177 (84%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF G FILEK+A P SRG + L NTNV+DNP++TFNYF HP DL++CV  IR+V K+V S
Sbjct  418  AFNGSFILEKLAYPISRGHLSLVNTNVDDNPSVTFNYFKHPVDLQRCVEAIRLVSKVVTS  477

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            KRF N+TQCDK+ + ++L++S +AN+NL P+  NDT+S+ QFCKDTV+TIWHYHGGC VG
Sbjct  478  KRFLNYTQCDKQNVHKMLSLSVKANINLRPKQLNDTKSMAQFCKDTVVTIWHYHGGCLVG  537

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV P+ +VLG  RLRV+DGST  ESPGTNPQAT++MMGRYMGVKILR RLGNKAGV
Sbjct  538  KVVSPNRKVLGVDRLRVIDGSTFDESPGTNPQATMMMMGRYMGVKILRERLGNKAGV  594



>ref|XP_003543593.1| PREDICTED: protein HOTHEAD-like [Glycine max]
 gb|KHN30046.1| Protein HOTHEAD [Glycine soja]
Length=585

 Score =   272 bits (696),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 153/177 (86%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFIL K+A+P S G++ L NTNVEDNPA+TFNYFSHP DLK+CV GIR+  K+V++
Sbjct  409  AFRGGFILSKVANPWSTGELKLINTNVEDNPAVTFNYFSHPYDLKRCVEGIRLAIKVVQT  468

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            +  +N+T C++E  +++LN+S +AN+NLIP+H NDT+S+EQFC+D+VITIWHYHGGCHVG
Sbjct  469  EHVTNYTLCERENAEKMLNLSVKANINLIPKHPNDTKSVEQFCRDSVITIWHYHGGCHVG  528

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV  +++VLG  RLRVVDGST +ESPGTNPQAT++MMGRYMG+KILR RLG  AG+
Sbjct  529  KVVNSEHKVLGVDRLRVVDGSTFSESPGTNPQATVMMMGRYMGLKILRDRLGKLAGI  585



>ref|XP_004510377.1| PREDICTED: protein HOTHEAD-like [Cicer arietinum]
Length=591

 Score =   272 bits (695),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 149/177 (84%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGF+L K+AS  S G++ L NTNV++NP +TFNYFSHP DL++CV GIR+  K+V+S
Sbjct  415  AFKGGFVLSKVASAWSVGELKLNNTNVDENPNVTFNYFSHPYDLQRCVEGIRLAIKVVQS  474

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K F+N+T C+K+T ++LLN++ +ANVN IP+H NDT SLEQFC+DTVITIWHYHGGCHVG
Sbjct  475  KHFTNYTLCNKQTTEKLLNLTVKANVNFIPKHANDTASLEQFCRDTVITIWHYHGGCHVG  534

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV PD +VL   RLRVVDGST  ESPGTNPQAT++MMGRYMGVKILR RLG  AG+
Sbjct  535  KVVSPDLKVLDVDRLRVVDGSTFDESPGTNPQATVMMMGRYMGVKILRDRLGRLAGI  591



>gb|KEH18350.1| glucose-methanol-choline (GMC) oxidoreductase family protein 
[Medicago truncatula]
Length=586

 Score =   271 bits (694),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 146/177 (82%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGF+L K+ S  S G++ L NTNV +NPA+TFNYFSHP DLK+CV GI +  K+V+S
Sbjct  410  AFKGGFVLSKVGSAWSVGELKLVNTNVNENPAVTFNYFSHPYDLKRCVEGISMAIKVVQS  469

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + F+N+T C +ET +RLLN+S +  VN IP+H NDT SLEQFCKDTVITIWHYHGGCHVG
Sbjct  470  EHFTNYTLCKRETAERLLNLSVKTTVNFIPKHANDTSSLEQFCKDTVITIWHYHGGCHVG  529

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV PDY+VL   RLRVVDGST TESPGTNPQAT++MMGRYMGVKILR RLG  AG+
Sbjct  530  KVVSPDYKVLDVDRLRVVDGSTFTESPGTNPQATVMMMGRYMGVKILRGRLGRLAGI  586



>ref|XP_006302040.1| hypothetical protein CARUB_v10020023mg [Capsella rubella]
 gb|EOA34938.1| hypothetical protein CARUB_v10020023mg [Capsella rubella]
Length=592

 Score =   271 bits (694),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 148/177 (84%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF G FILEK+A P SRG + L NTNV+DNP++TFNYF HP DL++CV  IR+V K+V S
Sbjct  416  AFNGSFILEKLAYPLSRGHLSLVNTNVDDNPSVTFNYFKHPADLQRCVEAIRLVSKVVTS  475

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            KRF N+TQC+K+ + ++L++S +AN+NL P+  NDT+S+ QFCKDTV+TIWHYHGGC VG
Sbjct  476  KRFLNYTQCEKQDVHKMLSLSVKANINLRPKQLNDTESMAQFCKDTVVTIWHYHGGCLVG  535

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV P+ RVLG  RLRV+DGST  ESPGTNPQATL+MMGRYMGVKILR RLG+KAGV
Sbjct  536  KVVSPNRRVLGVDRLRVIDGSTFHESPGTNPQATLMMMGRYMGVKILRKRLGDKAGV  592



>ref|XP_006302041.1| hypothetical protein CARUB_v10020023mg [Capsella rubella]
 gb|EOA34939.1| hypothetical protein CARUB_v10020023mg [Capsella rubella]
Length=594

 Score =   271 bits (693),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 148/177 (84%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF G FILEK+A P SRG + L NTNV+DNP++TFNYF HP DL++CV  IR+V K+V S
Sbjct  418  AFNGSFILEKLAYPLSRGHLSLVNTNVDDNPSVTFNYFKHPADLQRCVEAIRLVSKVVTS  477

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            KRF N+TQC+K+ + ++L++S +AN+NL P+  NDT+S+ QFCKDTV+TIWHYHGGC VG
Sbjct  478  KRFLNYTQCEKQDVHKMLSLSVKANINLRPKQLNDTESMAQFCKDTVVTIWHYHGGCLVG  537

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV P+ RVLG  RLRV+DGST  ESPGTNPQATL+MMGRYMGVKILR RLG+KAGV
Sbjct  538  KVVSPNRRVLGVDRLRVIDGSTFHESPGTNPQATLMMMGRYMGVKILRKRLGDKAGV  594



>ref|NP_565050.1| embryo sac development arrest 17 [Arabidopsis thaliana]
 sp|Q9S746.1|HTH_ARATH RecName: Full=Protein HOTHEAD; AltName: Full=Protein ADHESION 
OF CALYX EDGES; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD55644.1|AC008017_17 ACE [Arabidopsis thaliana]
 dbj|BAA77837.1| ACE [Arabidopsis thaliana]
 gb|AAL06854.1| At1g72970/F3N23_17 [Arabidopsis thaliana]
 gb|AAO11564.1| At1g72970/F3N23_17 [Arabidopsis thaliana]
 gb|AEE35397.1| embryo sac development arrest 17 [Arabidopsis thaliana]
Length=594

 Score =   271 bits (692),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 147/177 (83%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF G FILEK+A P SRG + L NTNV+DNP++TFNYF HP DL++CV  IR+V K+V S
Sbjct  418  AFNGSFILEKLAYPISRGHLSLVNTNVDDNPSVTFNYFKHPVDLQRCVEAIRLVSKVVTS  477

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
             RF N+TQCDK+ + ++L++S +AN+NL P+  NDT+S+ QFCKDTV+TIWHYHGGC VG
Sbjct  478  NRFLNYTQCDKQNVHKMLSLSVKANINLRPKQLNDTKSMAQFCKDTVVTIWHYHGGCLVG  537

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV P+ +VLG  RLRV+DGST  ESPGTNPQAT++MMGRYMGVKILR RLGNKAGV
Sbjct  538  KVVSPNRKVLGVDRLRVIDGSTFDESPGTNPQATMMMMGRYMGVKILRERLGNKAGV  594



>ref|XP_002887465.1| hypothetical protein ARALYDRAFT_895153 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63724.1| hypothetical protein ARALYDRAFT_895153 [Arabidopsis lyrata subsp. 
lyrata]
Length=594

 Score =   270 bits (691),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 147/177 (83%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF G FILEK+A P SRG + L NTNV+DNP++TFNYF HP DL++CV  IR+V K+V S
Sbjct  418  AFNGSFILEKLAYPISRGHLSLVNTNVDDNPSVTFNYFKHPVDLQRCVEAIRLVSKVVTS  477

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            KRF N+TQCDK+ + ++L++S +AN+NL P+  NDT+S+ QFCKDTV+TIWHYHGGC VG
Sbjct  478  KRFLNYTQCDKQNVHKMLSLSVKANINLRPKQLNDTKSMAQFCKDTVVTIWHYHGGCLVG  537

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV P+ +VLG  RLRV+DGST  ESPGTNPQAT++MMGRYMGVKILR RLGN AGV
Sbjct  538  KVVSPNRKVLGVDRLRVIDGSTFDESPGTNPQATMMMMGRYMGVKILRKRLGNNAGV  594



>emb|CDX82122.1| BnaC02g21680D [Brassica napus]
Length=594

 Score =   270 bits (689),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 148/177 (84%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF G FILEK+A P SRG + L NTNV+DNP++TFNYF HP DL++CV  IR+V K+V S
Sbjct  418  AFNGSFILEKLAYPISRGHLSLLNTNVDDNPSVTFNYFKHPLDLQRCVEAIRLVSKVVTS  477

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            KRF N+TQCDK+ + ++L++S +AN+NL P+  NDT+S+ QFCKDTV+TIWHYHGGC VG
Sbjct  478  KRFLNYTQCDKQNVHKMLSLSVKANINLRPKQVNDTKSMAQFCKDTVVTIWHYHGGCLVG  537

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV P+ +VLG +RLRV+DGST  ESPGTNPQAT++MMGRYMGVKIL  RLGNKAGV
Sbjct  538  KVVNPNRKVLGVNRLRVIDGSTFDESPGTNPQATVMMMGRYMGVKILWERLGNKAGV  594



>ref|XP_010471340.1| PREDICTED: protein HOTHEAD-like [Camelina sativa]
Length=591

 Score =   269 bits (688),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 147/177 (83%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            +F G FILEK+A P SRG + L NTNV+DNP++TFNYF HP DL++CV  IR+V K+V S
Sbjct  415  SFNGSFILEKLAYPLSRGHLSLVNTNVDDNPSVTFNYFKHPVDLQRCVEAIRLVSKVVTS  474

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            KR+ N+TQC+KE + ++L++S +AN+NL P+  NDT+S+ QFCKDTV+TIWHYHGGC VG
Sbjct  475  KRYLNYTQCEKENVHKMLSLSVKANINLRPKQLNDTESMAQFCKDTVVTIWHYHGGCLVG  534

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV P+ +VLG  RLRVVDGST  ESPGTNPQATL+MMGRYMGVKILR RLGN AGV
Sbjct  535  KVVSPNRKVLGVDRLRVVDGSTFDESPGTNPQATLMMMGRYMGVKILRKRLGNNAGV  591



>ref|XP_003529733.1| PREDICTED: protein HOTHEAD-like isoform X1 [Glycine max]
Length=591

 Score =   268 bits (686),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 145/176 (82%), Gaps = 0/176 (0%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            F+GGFIL K+A+P S G++ L NTNV DNP +TFNYFSHP DL +CV GIR+  K+ +SK
Sbjct  416  FKGGFILSKVANPWSVGELRLNNTNVNDNPVVTFNYFSHPYDLHRCVKGIRLAIKVAQSK  475

Query  184  RFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVGK  363
             F+N+T CDK+T + LLN++ +ANVN I +H NDT S+ QFCKDTVITIWHYHGGCH+GK
Sbjct  476  HFTNYTLCDKKTSEELLNLTVKANVNFITKHPNDTASIAQFCKDTVITIWHYHGGCHLGK  535

Query  364  VVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            VV PDY+VLG  RLRVVDGST  ESPGTNPQAT++MMGRYMG+KILR RLG  AG+
Sbjct  536  VVSPDYKVLGVDRLRVVDGSTFDESPGTNPQATVMMMGRYMGLKILRDRLGKLAGI  591



>gb|KHN39304.1| Protein HOTHEAD [Glycine soja]
Length=591

 Score =   268 bits (685),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 145/176 (82%), Gaps = 0/176 (0%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            F+GGFIL K+A+P S G++ L NTNV DNP +TFNYFSHP DL +CV GIR+  K+ +SK
Sbjct  416  FKGGFILSKVANPWSVGELRLNNTNVNDNPVVTFNYFSHPYDLHRCVKGIRLAIKVAQSK  475

Query  184  RFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVGK  363
             F+N+T CDK+T + LLN++ +ANVN I +H NDT S+ QFCKDTVITIWHYHGGCH+GK
Sbjct  476  HFTNYTLCDKKTSEELLNLTVKANVNFITKHPNDTASIAQFCKDTVITIWHYHGGCHLGK  535

Query  364  VVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            VV PDY+VLG  RLRVVDGST  ESPGTNPQAT++MMGRYMG+KILR RLG  AG+
Sbjct  536  VVSPDYKVLGVDRLRVVDGSTFDESPGTNPQATVMMMGRYMGLKILRDRLGKLAGI  591



>gb|EPS62021.1| hypothetical protein M569_12771, partial [Genlisea aurea]
Length=563

 Score =   266 bits (680),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 146/174 (84%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF GGFILEK+A+P SRG I LK  +++DNP ITFNYFSHP D+ +CV+GIRIVEK++KS
Sbjct  390  AFMGGFILEKLAAPLSRGGISLKTGDIDDNPTITFNYFSHPSDVARCVDGIRIVEKVLKS  449

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K F  FT  D  T++RL+N+S +ANVNLIP+HTNDTQSL+QFC+DTVITIWHYHGGCHVG
Sbjct  450  KSFRRFTNLDGGTVERLVNMSVEANVNLIPKHTNDTQSLQQFCRDTVITIWHYHGGCHVG  509

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNK  522
            +VV  +Y+V+G  RLRVVDGS   ESPGTNPQAT++MMGRYMG+KIL  R G +
Sbjct  510  QVVDGNYKVIGVDRLRVVDGSVFFESPGTNPQATVMMMGRYMGLKILMERQGQE  563



>ref|XP_010924991.1| PREDICTED: protein HOTHEAD-like [Elaeis guineensis]
Length=580

 Score =   266 bits (681),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 149/177 (84%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFILEKI  P S G++ L +TNV++NP++TFNYFSHPDDL++CV GIR++EKIV++
Sbjct  404  AFQGGFILEKIDGPLSTGELSLIDTNVDNNPSVTFNYFSHPDDLRRCVYGIRMIEKIVQT  463

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            ++F+N +     +++RLLNIS +ANVNLIP+HTNDT S+EQFC+DTVITIWHYHGGCHVG
Sbjct  464  RQFANLSDDCANSMERLLNISVKANVNLIPKHTNDTTSIEQFCRDTVITIWHYHGGCHVG  523

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV  DYRVLG   LRVVD ST   SPGTNPQAT++M+GRYMGVKILR RLG   GV
Sbjct  524  KVVDHDYRVLGITSLRVVDSSTFVNSPGTNPQATVMMLGRYMGVKILRERLGRAGGV  580



>ref|XP_009394110.1| PREDICTED: protein HOTHEAD-like [Musa acuminata subsp. malaccensis]
Length=581

 Score =   266 bits (679),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 146/177 (82%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFILEKI  P SRG++ L +T+V++NP++TFNYFSHP DLK+CV GIR +E+IV++
Sbjct  405  AFQGGFILEKIDGPLSRGRLRLNDTDVDNNPSVTFNYFSHPYDLKRCVYGIRSIEEIVRT  464

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            KRF+  T  D  T+  LLN+S QANVNLIP+HTNDT S+EQFC+D+V TIWHYHGGCHVG
Sbjct  465  KRFARLTVDDAYTMRMLLNMSVQANVNLIPKHTNDTASVEQFCRDSVTTIWHYHGGCHVG  524

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV  +YRVLG  RLRVVDGST   SPGTNPQAT++MMGRYMG KILR RLG  AG 
Sbjct  525  KVVDGEYRVLGVSRLRVVDGSTFDRSPGTNPQATVMMMGRYMGAKILRKRLGRAAGA  581



>ref|XP_010428198.1| PREDICTED: LOW QUALITY PROTEIN: protein HOTHEAD-like [Camelina 
sativa]
Length=591

 Score =   266 bits (680),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 146/177 (82%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            +F G FILEK+A P SRG + L NTNV+DNP++TFNYF HP DL++CV  IR+V K+V S
Sbjct  415  SFNGSFILEKLAYPLSRGHLSLVNTNVDDNPSVTFNYFKHPVDLQRCVEAIRLVSKVVTS  474

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            KR+ N+ QC+KE + ++L++S +AN+NL P+  NDT+S+ QFCKDTV+TIWHYHGGC VG
Sbjct  475  KRYLNYXQCEKEDVHKMLSLSVKANINLRPKQLNDTESMAQFCKDTVVTIWHYHGGCLVG  534

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV P+ +VLG  RLRV+DGST  ESPGTNPQATL+MMGRYMGVKILR RLGN AGV
Sbjct  535  KVVSPNRKVLGVDRLRVIDGSTFDESPGTNPQATLMMMGRYMGVKILRKRLGNNAGV  591



>ref|XP_010685404.1| PREDICTED: protein HOTHEAD-like [Beta vulgaris subsp. vulgaris]
Length=605

 Score =   266 bits (679),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 145/174 (83%), Gaps = 2/174 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFILEKIA P S+G++ L NTN+  NP +TFNYFSHP DL++CV GIRI+E +VKS
Sbjct  431  AFKGGFILEKIALPMSKGELKLINTNINGNPNVTFNYFSHPQDLRRCVEGIRIMESLVKS  490

Query  181  KRFSNFT--QCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCH  354
              F+N    + D+ET ++LLN+S +AN+NLIP+HTNDT+SLEQFCKDTVITIWHYHGGC 
Sbjct  491  VNFTNTIGIKLDEETTEKLLNMSVKANINLIPKHTNDTKSLEQFCKDTVITIWHYHGGCQ  550

Query  355  VGKVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLG  516
            VGKVV  DYRV G  RLRVVDGST   SPGTNPQAT++MMGRYMGVKILR RLG
Sbjct  551  VGKVVAHDYRVFGVDRLRVVDGSTFRTSPGTNPQATVMMMGRYMGVKILRERLG  604



>ref|XP_010242221.1| PREDICTED: protein HOTHEAD-like isoform X2 [Nelumbo nucifera]
Length=567

 Score =   264 bits (675),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 147/177 (83%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF GGF+LEKI  P S G++ L +TNV++NP++TFNYFSHP DL++CV GIR +EK+V++
Sbjct  391  AFMGGFVLEKIVGPLSTGELRLNSTNVDENPSVTFNYFSHPYDLQRCVYGIRTIEKVVRT  450

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K F++       T++ LLN+S +ANVNLIP+ TNDT+SLEQFC+DTVITIWHYHGGCHVG
Sbjct  451  KHFAHIINTHIPTVEMLLNMSVKANVNLIPKKTNDTKSLEQFCRDTVITIWHYHGGCHVG  510

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV   Y+VLG H LRVVDGST T+SPGTNPQAT++MMGRYMGVKILR RLG  AGV
Sbjct  511  KVVDSHYKVLGVHGLRVVDGSTFTDSPGTNPQATVMMMGRYMGVKILRERLGRAAGV  567



>ref|XP_010242219.1| PREDICTED: protein HOTHEAD-like isoform X1 [Nelumbo nucifera]
Length=588

 Score =   264 bits (675),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 147/177 (83%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF GGF+LEKI  P S G++ L +TNV++NP++TFNYFSHP DL++CV GIR +EK+V++
Sbjct  412  AFMGGFVLEKIVGPLSTGELRLNSTNVDENPSVTFNYFSHPYDLQRCVYGIRTIEKVVRT  471

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K F++       T++ LLN+S +ANVNLIP+ TNDT+SLEQFC+DTVITIWHYHGGCHVG
Sbjct  472  KHFAHIINTHIPTVEMLLNMSVKANVNLIPKKTNDTKSLEQFCRDTVITIWHYHGGCHVG  531

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV   Y+VLG H LRVVDGST T+SPGTNPQAT++MMGRYMGVKILR RLG  AGV
Sbjct  532  KVVDSHYKVLGVHGLRVVDGSTFTDSPGTNPQATVMMMGRYMGVKILRERLGRAAGV  588



>gb|KJB70231.1| hypothetical protein B456_011G064300 [Gossypium raimondii]
Length=575

 Score =   263 bits (672),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFILEKIA P S G + L NTN+++NP++TFNYF HP DL++CVNGIR+  K+++S
Sbjct  416  AFKGGFILEKIAMPLSTGHLNLINTNIDNNPSVTFNYFGHPRDLRRCVNGIRMAAKVIQS  475

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
             RF+NFT+CDK T++RLLN+S +AN+N IP+HTNDT+SLEQFCKDTVITIWHYHGGCHVG
Sbjct  476  DRFTNFTKCDKPTVERLLNMSVKANINFIPKHTNDTKSLEQFCKDTVITIWHYHGGCHVG  535

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGR  480
            KVV P+++VLGT RLR+VDGST +ESPGTNPQ T+LMMGR
Sbjct  536  KVVDPNHKVLGTRRLRIVDGSTFSESPGTNPQGTVLMMGR  575



>ref|XP_010685403.1| PREDICTED: protein HOTHEAD [Beta vulgaris subsp. vulgaris]
Length=601

 Score =   260 bits (665),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF GGFIL K+A P S G + L  TN++DNP +T+NYFSHP DL+KCV  I+++EKIVKS
Sbjct  427  AFMGGFILGKVAKPKSTGHLKLNTTNIDDNPEVTYNYFSHPQDLRKCVKSIQLIEKIVKS  486

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            KR   F   D  T+++LLN+S QANVNLIP+HTND QSLEQFCKDTVIT+WH+HGGCH+ 
Sbjct  487  KRLRYFINSDNLTIEKLLNMSVQANVNLIPKHTNDIQSLEQFCKDTVITMWHFHGGCHMD  546

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKA  525
            KVVG DY+V G   LRV+DGST  ESPGTNPQAT++MMGRYMGVKIL  R G ++
Sbjct  547  KVVGRDYQVFGVDSLRVIDGSTFDESPGTNPQATVMMMGRYMGVKILMERHGERS  601



>ref|XP_008795416.1| PREDICTED: protein HOTHEAD-like isoform X2 [Phoenix dactylifera]
Length=581

 Score =   258 bits (660),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 149/177 (84%), Gaps = 1/177 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFILEKI  P S G++ L +TN ++NP++TFNYFSHP DL++CV GIR++ KIV++
Sbjct  404  AFQGGFILEKIDGPLSTGELNLADTNADNNPSVTFNYFSHPYDLQRCVYGIRMIGKIVQT  463

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            ++F+N +     +++RLLNIS +ANVNLIP+HTNDT SLEQFC+DTVITIWHYHGGCHVG
Sbjct  464  RQFANLSDDHFYSMERLLNISVKANVNLIPKHTNDTASLEQFCRDTVITIWHYHGGCHVG  523

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV  DYRVLG   LRV+DGST   SPGTNPQAT++M+GRYMGVK+LR RLG +AGV
Sbjct  524  KVVDRDYRVLGIAGLRVIDGSTFVNSPGTNPQATVMMLGRYMGVKMLRERLG-RAGV  579



>ref|XP_008795415.1| PREDICTED: protein HOTHEAD-like isoform X1 [Phoenix dactylifera]
Length=582

 Score =   258 bits (660),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 149/177 (84%), Gaps = 1/177 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFILEKI  P S G++ L +TN ++NP++TFNYFSHP DL++CV GIR++ KIV++
Sbjct  405  AFQGGFILEKIDGPLSTGELNLADTNADNNPSVTFNYFSHPYDLQRCVYGIRMIGKIVQT  464

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            ++F+N +     +++RLLNIS +ANVNLIP+HTNDT SLEQFC+DTVITIWHYHGGCHVG
Sbjct  465  RQFANLSDDHFYSMERLLNISVKANVNLIPKHTNDTASLEQFCRDTVITIWHYHGGCHVG  524

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV  DYRVLG   LRV+DGST   SPGTNPQAT++M+GRYMGVK+LR RLG +AGV
Sbjct  525  KVVDRDYRVLGIAGLRVIDGSTFVNSPGTNPQATVMMLGRYMGVKMLRERLG-RAGV  580



>ref|XP_010537564.1| PREDICTED: protein HOTHEAD [Tarenaya hassleriana]
Length=595

 Score =   259 bits (661),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 147/176 (84%), Gaps = 0/176 (0%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            F GGF LEK+A P S G + L NTNV+DNP++TFNYFS+P D+++CV G+R++ K+V SK
Sbjct  420  FNGGFFLEKLAHPISTGHLSLVNTNVDDNPSVTFNYFSNPLDVQRCVEGVRLITKVVTSK  479

Query  184  RFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVGK  363
            RF N+T+ +K ++++LL++S +AN+NL+P+H ND+ S+ QFCKDTVITIWHYHGGCHVGK
Sbjct  480  RFLNYTRTEKLSVEKLLSLSTKANINLMPKHLNDSTSIAQFCKDTVITIWHYHGGCHVGK  539

Query  364  VVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            VV  D  V+G  RLRV+DGST +ESPGTNPQAT++MMGRYMGVKILR RLG  AGV
Sbjct  540  VVSNDRTVIGVDRLRVIDGSTFSESPGTNPQATVMMMGRYMGVKILRERLGKNAGV  595



>ref|XP_010106238.1| hypothetical protein L484_005099 [Morus notabilis]
 gb|EXC09147.1| hypothetical protein L484_005099 [Morus notabilis]
Length=593

 Score =   258 bits (660),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKIA P S G I L NTNV+DNP+ITFNYFSHP DLK+CV+GI++  K+ +S
Sbjct  422  AFRGGFILEKIAYPISTGHISLLNTNVDDNPSITFNYFSHPYDLKRCVDGIQVAIKVAQS  481

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + F NFTQ DK T++++LN+S +ANVNL+PRH NDT+SLEQFCKDTVITIWHYHGGCHVG
Sbjct  482  RHFLNFTQVDKPTVEKVLNMSVKANVNLVPRHPNDTKSLEQFCKDTVITIWHYHGGCHVG  541

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYM  486
            KVV   Y+VLG  RLRVVDGS  TESPGTNPQ T+LMMGRY+
Sbjct  542  KVVDTKYKVLGVDRLRVVDGSIFTESPGTNPQGTVLMMGRYV  583



>gb|ACG29139.1| protein HOTHEAD precursor [Zea mays]
Length=590

 Score =   258 bits (659),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 144/177 (81%), Gaps = 1/177 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            F GGFILEKI  P S G ++L +T+V +NPA+TFNYFSHP DL +C+ GI+ +E+I+K+ 
Sbjct  414  FHGGFILEKIDGPMSTGHLVLTDTDVRNNPAVTFNYFSHPQDLNRCIYGIKTIERILKTN  473

Query  184  RFSNFTQCDKE-TLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            RFS  +      +++R+LN+S QANVNLIP+HTNDT+SLEQFCKDTVITIWHYHGGCHVG
Sbjct  474  RFSELSADGAGLSMERVLNMSVQANVNLIPKHTNDTESLEQFCKDTVITIWHYHGGCHVG  533

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV   YRVLG   LRVVDGS  ++SPGTNPQAT++MMGRYMGVKILR RLG  AGV
Sbjct  534  KVVDQHYRVLGVSGLRVVDGSIFSKSPGTNPQATVMMMGRYMGVKILRERLGRAAGV  590



>gb|ACF81814.1| unknown [Zea mays]
Length=591

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 144/177 (81%), Gaps = 1/177 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            F GGFILEKI  P S G ++L +T+V +NPA+TFNYFSHP DL +C+ GI+ +E+I+K+ 
Sbjct  415  FHGGFILEKIDGPMSTGHLVLTDTDVRNNPAVTFNYFSHPQDLNRCIYGIKTIERILKTN  474

Query  184  RFSNFTQCDKE-TLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            RFS  +      +++R+LN+S QANVNLIP+HTNDT+SLEQFCKDTVITIWHYHGGCHVG
Sbjct  475  RFSELSADGAGLSMERVLNMSVQANVNLIPKHTNDTESLEQFCKDTVITIWHYHGGCHVG  534

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV   YRVLG   LRVVDGS  ++SPGTNPQAT++MMGRYMGVKILR RLG  AGV
Sbjct  535  KVVDQHYRVLGVSGLRVVDGSIFSKSPGTNPQATVMMMGRYMGVKILRERLGRAAGV  591



>ref|NP_001130910.1| protein HOTHEAD precursor [Zea mays]
 gb|ACF79296.1| unknown [Zea mays]
 gb|ACN26254.1| unknown [Zea mays]
 tpg|DAA61180.1| TPA: protein HOTHEAD [Zea mays]
Length=591

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 144/177 (81%), Gaps = 1/177 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            F GGFILEKI  P S G ++L +T+V +NPA+TFNYFSHP DL +C+ GI+ +E+I+K+ 
Sbjct  415  FHGGFILEKIDGPMSTGHLVLTDTDVRNNPAVTFNYFSHPQDLNRCIYGIKTIERILKTN  474

Query  184  RFSNFTQCDKE-TLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            RFS  +      +++R+LN+S QANVNLIP+HTNDT+SLEQFCKDTVITIWHYHGGCHVG
Sbjct  475  RFSELSADGAGLSMERVLNMSVQANVNLIPKHTNDTESLEQFCKDTVITIWHYHGGCHVG  534

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV   YRVLG   LRVVDGS  ++SPGTNPQAT++MMGRYMGVKILR RLG  AGV
Sbjct  535  KVVDQHYRVLGVSGLRVVDGSIFSKSPGTNPQATVMMMGRYMGVKILRERLGRAAGV  591



>ref|XP_010906842.1| PREDICTED: protein HOTHEAD-like [Elaeis guineensis]
Length=579

 Score =   257 bits (656),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 145/171 (85%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI  P S G++ + +T+V++NP +TFNYFSHP DL++CV GIR++EKIV++
Sbjct  404  AFRGGFILEKIDGPLSTGELSIADTDVDNNPNVTFNYFSHPYDLQRCVYGIRMIEKIVQT  463

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            ++F+N +     +L+RLLN+S +ANVNLIP+HTNDT SLEQFC+DTV+TIWHYHGGCHVG
Sbjct  464  RQFANLSYDHVYSLERLLNMSVKANVNLIPKHTNDTASLEQFCRDTVMTIWHYHGGCHVG  523

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRL  513
            KVV  DYRVLG   LRV+DGST   SPGTNPQAT++M+GRYMGVKILR RL
Sbjct  524  KVVDHDYRVLGIASLRVIDGSTFVNSPGTNPQATVMMLGRYMGVKILRERL  574



>ref|XP_010262118.1| PREDICTED: protein HOTHEAD-like [Nelumbo nucifera]
Length=588

 Score =   257 bits (657),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 142/177 (80%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF GGF+LEKI  P S G++ L +T+V+DNP++TFNYFSHP DLK+CV GIR++EK+V++
Sbjct  412  AFMGGFVLEKIVGPLSTGELSLISTDVDDNPSVTFNYFSHPYDLKRCVYGIRMIEKVVQT  471

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K F++    D   ++ LLN+S +ANVNLIP+ TNDT+SLEQFCKDTV TIWHYHGGCHVG
Sbjct  472  KHFADLINSDMPAVEMLLNMSIKANVNLIPKQTNDTKSLEQFCKDTVTTIWHYHGGCHVG  531

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV   Y+VLG   LRVVDGS    SPGTNPQAT++MMGRYMGVKILR  LG  AGV
Sbjct  532  KVVDAKYKVLGVDGLRVVDGSIFNTSPGTNPQATVMMMGRYMGVKILREPLGRAAGV  588



>ref|XP_002462276.1| hypothetical protein SORBIDRAFT_02g023010 [Sorghum bicolor]
 gb|EER98797.1| hypothetical protein SORBIDRAFT_02g023010 [Sorghum bicolor]
Length=591

 Score =   257 bits (656),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 142/177 (80%), Gaps = 1/177 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            F GGFILEKI  P S G ++L +T+V +NPA+TFNYFSHP DL  CV GI+ +E+I+K+ 
Sbjct  415  FHGGFILEKIDGPLSTGHLVLTDTDVRNNPAVTFNYFSHPQDLNHCVYGIKTIERILKTN  474

Query  184  RFSNFTQCDKE-TLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            RFS  +      +++R+LN+S QANVNLIP+HTNDT+SLEQFCKDTVITIWHYHGGCHVG
Sbjct  475  RFSELSADGAGLSMERVLNMSVQANVNLIPKHTNDTESLEQFCKDTVITIWHYHGGCHVG  534

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV   YRVLG   LRVVDGS  + SPGTNPQAT++MMGRYMGVKILR RLG  AGV
Sbjct  535  KVVDQHYRVLGVSGLRVVDGSIFSRSPGTNPQATVMMMGRYMGVKILRERLGRAAGV  591



>ref|XP_006853836.1| hypothetical protein AMTR_s00036p00060130 [Amborella trichopoda]
 gb|ERN15303.1| hypothetical protein AMTR_s00036p00060130 [Amborella trichopoda]
Length=574

 Score =   255 bits (652),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 142/176 (81%), Gaps = 0/176 (0%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            F+GGFILEK+  P S+G + L +T++  NP +TFNYFSHP+DL++CV+GI+++ KI +SK
Sbjct  399  FKGGFILEKVVGPLSKGHLTLNSTDIRANPVVTFNYFSHPEDLRRCVSGIQMISKIARSK  458

Query  184  RFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVGK  363
                 TQ D  T+ +LLN+S  ANVNLIP+H NDT+SL QFC+DTV+TIWHYHGGC VGK
Sbjct  459  SVVLLTQNDDYTMQKLLNLSVVANVNLIPKHPNDTKSLAQFCRDTVLTIWHYHGGCQVGK  518

Query  364  VVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            VV  DYRVLG  RLR++DGST   SPGTNPQAT++M+GRYMGVK+LR RLG +AGV
Sbjct  519  VVDSDYRVLGVERLRIIDGSTFLASPGTNPQATVMMLGRYMGVKLLRERLGARAGV  574



>ref|XP_004956668.1| PREDICTED: protein HOTHEAD-like [Setaria italica]
Length=582

 Score =   255 bits (652),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 143/177 (81%), Gaps = 1/177 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            F GGFILEKI  P S G ++L +T+V +NPA+TFNYFSHP DL +CV GI+ +E+I+K+ 
Sbjct  406  FHGGFILEKIDGPLSTGHLVLTDTDVRNNPAVTFNYFSHPQDLDRCVYGIKTIERILKTN  465

Query  184  RFSNFTQCDKE-TLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            RFS         +++R+LN+S QANVNLIP+HTNDT+SL QFCKDTVITIWHYHGGCHVG
Sbjct  466  RFSELAADGTGFSMERVLNMSVQANVNLIPKHTNDTESLGQFCKDTVITIWHYHGGCHVG  525

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV   YRVLG   +RVVDGST ++SPGTNPQAT++MMGRYMGVKILR RLG  AGV
Sbjct  526  KVVDQHYRVLGVSGIRVVDGSTFSKSPGTNPQATVMMMGRYMGVKILRERLGRAAGV  582



>ref|XP_009389850.1| PREDICTED: protein HOTHEAD-like [Musa acuminata subsp. malaccensis]
Length=581

 Score =   253 bits (647),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 144/177 (81%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI  P S G++ L +T+V+ +P++TFNYFSHP DLK+CV GIR +EKIV++
Sbjct  405  AFRGGFILEKIDGPLSTGELSLLDTDVDCSPSVTFNYFSHPYDLKRCVYGIRTIEKIVRT  464

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K  +  +  D+  ++ LLN+S +AN+NL+P+HTNDT S++QFC+DTVITIWHYHGGCHVG
Sbjct  465  KHIAKLSGVDEYPMEVLLNMSVKANLNLVPKHTNDTASIQQFCRDTVITIWHYHGGCHVG  524

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV  DYRV+G   LRV+DGST   SPGTNPQAT++MMGRYMGVKILR RLG  A V
Sbjct  525  KVVDHDYRVMGVAGLRVIDGSTFVNSPGTNPQATVMMMGRYMGVKILRERLGRAAEV  581



>gb|EMT05881.1| Protein HOTHEAD [Aegilops tauschii]
Length=591

 Score =   253 bits (647),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 144/177 (81%), Gaps = 1/177 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            F+GGFILEKI  P S G ++L +T+V++NPA+TFNYFSHP DL +CV GI+ +EKI+K+ 
Sbjct  415  FQGGFILEKIDGPLSTGHLVLADTDVKNNPAVTFNYFSHPQDLSRCVYGIKTIEKILKTN  474

Query  184  RFSNFTQCDK-ETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
             F++ T  D    ++R+LN+S +ANVNLIP+HTN T+SLEQFCKDTVITIWHYHGGCHVG
Sbjct  475  SFAHLTPDDAGYEMERVLNMSVRANVNLIPKHTNTTESLEQFCKDTVITIWHYHGGCHVG  534

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV   +RVLG   LRVVDGST + SPGTNPQAT++MMGRY GVKILR RLG  AGV
Sbjct  535  KVVDQQHRVLGVSGLRVVDGSTFSRSPGTNPQATVMMMGRYFGVKILRERLGRAAGV  591



>gb|EAZ08804.1| hypothetical protein OsI_31066 [Oryza sativa Indica Group]
Length=585

 Score =   253 bits (645),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 142/177 (80%), Gaps = 1/177 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            F GGFILEKI  P S G + L +T+V+ NPA+TFNYFSHP DL +CV GI+ +E+I+K+ 
Sbjct  409  FHGGFILEKIDGPLSTGHLALIDTDVKKNPAVTFNYFSHPQDLTRCVYGIKTIERILKTN  468

Query  184  RFSNFT-QCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            RFS  +   D  +++R+LN+S QANVNLIP+HTNDT+SLEQFC+DTVITIWHYHGGCHVG
Sbjct  469  RFSELSANTDGHSMERVLNMSVQANVNLIPKHTNDTESLEQFCRDTVITIWHYHGGCHVG  528

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV   +RVLG   +RVVDGST + SPGTNPQAT++MMGRY GV ILR RLG  AGV
Sbjct  529  KVVDQQHRVLGVSGVRVVDGSTFSRSPGTNPQATVMMMGRYFGVMILRGRLGRAAGV  585



>ref|NP_001062996.1| Os09g0363900 [Oryza sativa Japonica Group]
 dbj|BAD23416.1| putative adhesion of calyx edges protein ACE [Oryza sativa Japonica 
Group]
 dbj|BAD33717.1| putative adhesion of calyx edges protein ACE [Oryza sativa Japonica 
Group]
 dbj|BAF24910.1| Os09g0363900 [Oryza sativa Japonica Group]
 gb|EAZ44464.1| hypothetical protein OsJ_29078 [Oryza sativa Japonica Group]
 dbj|BAG93195.1| unnamed protein product [Oryza sativa Japonica Group]
Length=585

 Score =   253 bits (645),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 142/177 (80%), Gaps = 1/177 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            F GGFILEKI  P S G + L +T+V+ NPA+TFNYFSHP DL +CV GI+ +E+I+K+ 
Sbjct  409  FHGGFILEKIDGPLSTGHLALIDTDVKKNPAVTFNYFSHPQDLTRCVYGIKTIERILKTN  468

Query  184  RFSNFT-QCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            RFS  +   D  +++R+LN+S QANVNLIP+HTNDT+SLEQFC+DTVITIWHYHGGCHVG
Sbjct  469  RFSELSANTDGHSMERVLNMSVQANVNLIPKHTNDTESLEQFCRDTVITIWHYHGGCHVG  528

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV   +RVLG   +RVVDGST + SPGTNPQAT++MMGRY GV ILR RLG  AGV
Sbjct  529  KVVDQQHRVLGVSGVRVVDGSTFSRSPGTNPQATVMMMGRYFGVMILRGRLGRAAGV  585



>dbj|BAJ90011.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=591

 Score =   252 bits (643),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 143/177 (81%), Gaps = 1/177 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            F+GGFILEKI  P S G ++L +T+V++NPA+TFNYFSHP DL +CV GI+ +EKI+K+ 
Sbjct  415  FQGGFILEKIDGPLSTGHLVLADTDVKNNPAVTFNYFSHPQDLSRCVYGIKTIEKILKTN  474

Query  184  RFSNFT-QCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
             F++ T       ++R+LN+S QANVNLIP+HTN T+SLEQFCKDTVITIWHYHGGCHVG
Sbjct  475  SFAHLTPDGAGYEMERVLNMSVQANVNLIPKHTNTTESLEQFCKDTVITIWHYHGGCHVG  534

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV   +RVLG   LRVVDGST + SPGTNPQAT++MMGRY GVKILR RLG  AGV
Sbjct  535  KVVDQQHRVLGVSGLRVVDGSTFSRSPGTNPQATVMMMGRYFGVKILRERLGPAAGV  591



>ref|XP_006660570.1| PREDICTED: protein HOTHEAD-like [Oryza brachyantha]
Length=585

 Score =   251 bits (642),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 142/177 (80%), Gaps = 1/177 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            F GGFILEKI  P S G + L +T+V +NPA+TFNYFSHP DL +CV GI+ +E+I+K+ 
Sbjct  409  FHGGFILEKIDGPLSTGHLALIDTDVRNNPAVTFNYFSHPQDLTRCVYGIKTIERILKTN  468

Query  184  RFSNFT-QCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            RFS  +   D  +++R+LN+S QANVNLIP+HTNDT+SLEQFC+DTVITIWHYHGGCHVG
Sbjct  469  RFSELSANNDGYSMERVLNMSVQANVNLIPKHTNDTESLEQFCRDTVITIWHYHGGCHVG  528

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV   +RVLG   +RVVDGST + SPGTNPQAT++MMGRY GV ILR RLG  AGV
Sbjct  529  KVVDQQHRVLGVSGVRVVDGSTFSRSPGTNPQATVMMMGRYFGVMILRGRLGRAAGV  585



>gb|EMS45416.1| Protein HOTHEAD [Triticum urartu]
Length=645

 Score =   253 bits (645),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 144/178 (81%), Gaps = 2/178 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            F+GGFILEKI  P S G ++L +T+V++NPA+TFNYFSHP DL +CV GI+ +EKI+K+ 
Sbjct  468  FQGGFILEKIDGPLSTGHLVLADTDVKNNPAVTFNYFSHPQDLSRCVYGIKTIEKILKTN  527

Query  184  RFSNFTQCDKE--TLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHV  357
             F++ T  D     ++R+LN+S +ANVNLIP+HTN T+SLEQFCKDTVITIWHYHGGCHV
Sbjct  528  SFAHLTPDDDAGYEIERVLNMSVRANVNLIPKHTNTTESLEQFCKDTVITIWHYHGGCHV  587

Query  358  GKVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            GKVV   +RVLG   LRVVDGST + SPGTNPQAT++MMGRY GVKILR RLG  AGV
Sbjct  588  GKVVDQQHRVLGVSGLRVVDGSTFSRSPGTNPQATVMMMGRYFGVKILRQRLGRAAGV  645



>ref|XP_010238105.1| PREDICTED: protein HOTHEAD-like [Brachypodium distachyon]
Length=591

 Score =   249 bits (636),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 142/177 (80%), Gaps = 1/177 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            F+GGFILEKI  P S G ++L +T+V +NPA+TFNYFSHP DL +CV GI+ +EKI+K+ 
Sbjct  415  FQGGFILEKIDGPLSTGHLVLIDTDVRNNPAVTFNYFSHPQDLSRCVYGIKTIEKILKTN  474

Query  184  RFSNFT-QCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            RF+  T       ++R+LN+S +ANVNLIP+HTN T+SLEQFCKDTVITIWHYHGGC+VG
Sbjct  475  RFAKLTPDAAGYEMERMLNMSVRANVNLIPKHTNTTESLEQFCKDTVITIWHYHGGCNVG  534

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV   +RVLG   LRV+DGST + SPGTNPQAT++MMGRY GVKILR RLG  AGV
Sbjct  535  KVVDQQHRVLGVSGLRVIDGSTFSRSPGTNPQATVMMMGRYFGVKILRGRLGQAAGV  591



>ref|XP_008809962.1| PREDICTED: protein HOTHEAD-like [Phoenix dactylifera]
Length=566

 Score =   248 bits (633),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 144/178 (81%), Gaps = 1/178 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFILEKI  P S G++ L +TNV+ NP+ITFNYFSHP DL++CV GIR++EKIV++
Sbjct  388  AFQGGFILEKIDGPLSTGELSLVDTNVDSNPSITFNYFSHPHDLRRCVYGIRMIEKIVQT  447

Query  181  KRFSNFTQCD-KETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHV  357
            ++F++ +  D   ++ RLLN+S +ANVNLIP+HTNDT S+EQFC+DTV TIWHYHGGCH+
Sbjct  448  RQFASLSDDDCGHSMQRLLNMSVKANVNLIPKHTNDTASIEQFCRDTVTTIWHYHGGCHL  507

Query  358  GKVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            GKVV  DYRVLG   LRV+D S    SPGTNPQAT++M+GRYMGVK+LR RL    GV
Sbjct  508  GKVVDRDYRVLGIAGLRVIDSSIFFNSPGTNPQATVMMLGRYMGVKVLRERLRRAGGV  565



>emb|CDM82692.1| unnamed protein product [Triticum aestivum]
 emb|CDM82995.1| unnamed protein product [Triticum aestivum]
Length=584

 Score =   248 bits (633),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 141/177 (80%), Gaps = 1/177 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            F GGFIL KI  P S G ++L +T+   NP +TFNYF HP DL++CV GI+ +EKI+ + 
Sbjct  408  FHGGFILSKIDGPLSTGNLVLVDTDPNSNPIVTFNYFKHPQDLRRCVYGIKTIEKIISTN  467

Query  184  RFSNFTQCDK-ETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
             FSNFT  +   ++++LLN+S  AN+NLIP+HTND+ SLEQFC+DTV+TIWHYHGGCHVG
Sbjct  468  TFSNFTPKEGGYSMEKLLNMSVAANINLIPKHTNDSTSLEQFCRDTVVTIWHYHGGCHVG  527

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV   Y+V+GT  LRV+DGSTL+ SPGTNPQAT++MMGRYMGVKILR RLG  AGV
Sbjct  528  KVVDQQYKVIGTSGLRVIDGSTLSRSPGTNPQATVMMMGRYMGVKILRERLGRAAGV  584



>dbj|BAJ87395.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=584

 Score =   248 bits (633),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 141/177 (80%), Gaps = 1/177 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            F GGFIL KI  P S G ++L +T+   NP +TFNYF+HP DL++CV GI+ +E+IV + 
Sbjct  408  FHGGFILSKIDGPLSTGNLVLVDTDPNSNPKVTFNYFNHPQDLRRCVYGIKTIERIVSTN  467

Query  184  RFSNFTQCDK-ETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
             FSNFT  D   ++++LLN+S  AN+NLIP+HTND+ SLEQFC+DTV+TIWHYHGGCHVG
Sbjct  468  TFSNFTPKDGGYSMEKLLNMSVAANINLIPKHTNDSTSLEQFCRDTVVTIWHYHGGCHVG  527

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV   Y+V+G   LRV+DGSTL+ SPGTNPQAT++MMGRYMGVKILR RLG  AGV
Sbjct  528  KVVDQQYKVIGASGLRVIDGSTLSRSPGTNPQATVMMMGRYMGVKILRERLGRAAGV  584



>gb|EMS57763.1| Protein HOTHEAD [Triticum urartu]
Length=699

 Score =   249 bits (635),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 141/177 (80%), Gaps = 1/177 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            F GGFIL KI  P S G ++L +T+   NP +TFNYF HP DL++CV GI+ +EKI+ + 
Sbjct  523  FHGGFILSKIDGPLSTGNLVLVDTDPNSNPNVTFNYFKHPQDLRRCVYGIKTIEKIISTN  582

Query  184  RFSNFTQCDK-ETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
             FSNFT  D   ++++LLN+S  AN+NLIP+HTND+ SLEQFC+DTV+TIWHYHGGCHVG
Sbjct  583  TFSNFTPKDGGYSMEKLLNMSVAANINLIPKHTNDSTSLEQFCRDTVVTIWHYHGGCHVG  642

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV   Y+V+GT  LRV+DGSTL+ SPGTNPQAT++MMGRYMGVKILR RLG  AGV
Sbjct  643  KVVDQQYKVIGTSGLRVIDGSTLSRSPGTNPQATVMMMGRYMGVKILRERLGRAAGV  699



>ref|XP_004973380.1| PREDICTED: protein HOTHEAD-like isoform X2 [Setaria italica]
Length=584

 Score =   246 bits (627),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 138/177 (78%), Gaps = 1/177 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            F GGFILEKI  P S G ++L +T+V+ NP++TFNYF HP DL +CV GI+ +EKI+K+ 
Sbjct  408  FDGGFILEKIDGPLSTGNLVLVDTDVDSNPSVTFNYFQHPKDLSRCVYGIKTIEKILKTN  467

Query  184  RFSNFTQCDK-ETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
             F+N T       ++ LLN+S  AN+NLIP+HT+DT SLEQFC+DTV TIWHYHGGCHVG
Sbjct  468  HFTNLTANGAGYPMETLLNMSVSANINLIPKHTDDTTSLEQFCRDTVTTIWHYHGGCHVG  527

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV   YRV+G   LRVVDGSTL  SPGTNPQAT+LMMGRYMGVKILR RLG  AGV
Sbjct  528  KVVDQQYRVIGISGLRVVDGSTLFRSPGTNPQATVLMMGRYMGVKILRERLGRAAGV  584



>ref|XP_002445466.1| hypothetical protein SORBIDRAFT_07g019920 [Sorghum bicolor]
 gb|EES14961.1| hypothetical protein SORBIDRAFT_07g019920 [Sorghum bicolor]
Length=584

 Score =   246 bits (627),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 138/177 (78%), Gaps = 1/177 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            F GGFILEKI  P S G ++L +T+++ NP +TFNYF HP DL++CV GI+ +EKI+K+ 
Sbjct  408  FDGGFILEKIDGPLSTGSLVLVDTDIDSNPNVTFNYFQHPQDLRRCVYGIKTIEKILKTN  467

Query  184  RFSNFTQCDK-ETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
             F+N T       ++ LLN+S  AN+NLIP+HTNDT SLEQFC+DTV TIWHYHGGCHVG
Sbjct  468  HFTNLTANGAGYPMETLLNMSISANINLIPKHTNDTTSLEQFCRDTVTTIWHYHGGCHVG  527

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV   YRV+G   LRV+DGSTL  SPGTNPQAT+LMMGRYMGVKILR RLG  AGV
Sbjct  528  KVVDQHYRVIGISGLRVIDGSTLFSSPGTNPQATVLMMGRYMGVKILRERLGRAAGV  584



>ref|XP_003574447.1| PREDICTED: protein HOTHEAD-like [Brachypodium distachyon]
Length=583

 Score =   245 bits (626),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 140/177 (79%), Gaps = 1/177 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            F GGFIL KI  P S G ++L +T+   NP +TFNYF HP DL++CV GI+ +E+I+ + 
Sbjct  407  FHGGFILSKIDGPLSTGNLVLVDTDANSNPNVTFNYFKHPQDLRRCVYGIKTIERIMHTN  466

Query  184  RFSNFT-QCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
             FSNFT +  +  +++LLN+S  AN+NLIP+HT+D+ S EQFCKDTV+TIWHYHGGCHVG
Sbjct  467  TFSNFTPKGAQYPMEKLLNMSVTANINLIPKHTDDSTSFEQFCKDTVVTIWHYHGGCHVG  526

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV  +YRV+GT  LRV+DGST + SPGTNPQAT++MMGRYMGVKILR RLG  AGV
Sbjct  527  KVVDQNYRVIGTSGLRVIDGSTFSRSPGTNPQATVMMMGRYMGVKILRERLGRAAGV  583



>ref|NP_001147913.1| protein HOTHEAD precursor [Zea mays]
 gb|ACG29097.1| protein HOTHEAD precursor [Zea mays]
Length=580

 Score =   244 bits (622),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 139/177 (79%), Gaps = 1/177 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            F GGFILEKI  P S G ++L +T+++ NP+++FNYF HP DL++CV GI+ +E+I+K+ 
Sbjct  404  FDGGFILEKIDGPLSTGSLVLADTDIDSNPSVSFNYFQHPQDLRRCVYGIQTIERILKTN  463

Query  184  RFSNFTQCDK-ETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
             F+N T       ++ LLN+S  AN+NLIP+HT+DT SLEQFC+DTV TIWHYHGGCHVG
Sbjct  464  HFANLTANGAGYPMETLLNLSVSANINLIPKHTDDTTSLEQFCRDTVTTIWHYHGGCHVG  523

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV   YRV+G   LRV+DGSTL  SPGTNPQAT+LMMGRYMGVKILR RLG  AGV
Sbjct  524  KVVDRHYRVIGISGLRVIDGSTLFSSPGTNPQATVLMMGRYMGVKILRERLGRAAGV  580



>ref|NP_001061757.1| Os08g0401500 [Oryza sativa Japonica Group]
 dbj|BAC98678.1| putative mandelonitrile lyase [Oryza sativa Japonica Group]
 dbj|BAF23671.1| Os08g0401500 [Oryza sativa Japonica Group]
 gb|EEC83542.1| hypothetical protein OsI_29157 [Oryza sativa Indica Group]
 gb|EEE68648.1| hypothetical protein OsJ_27223 [Oryza sativa Japonica Group]
Length=584

 Score =   241 bits (615),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 137/177 (77%), Gaps = 1/177 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            F GGFIL KI  P S G ++L +T++  NP +TFNYF HP DL +CV GI+ +E+I+K+ 
Sbjct  408  FSGGFILSKIDGPLSTGNLVLVDTDINSNPTVTFNYFQHPKDLSRCVYGIKTIERILKTN  467

Query  184  RFSNFT-QCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
             F+NFT       ++ +LN+S  AN+NLIP+HTND+ S+EQFC+DTV+TIWHYHGGCHVG
Sbjct  468  HFTNFTLNGGGYPMEVVLNMSVTANINLIPKHTNDSTSMEQFCRDTVVTIWHYHGGCHVG  527

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV   YRV+G   LRV+DGSTL  SPGTNPQAT++MMGRYMGVKILR RLG  AGV
Sbjct  528  KVVDQQYRVIGVSGLRVIDGSTLFRSPGTNPQATVMMMGRYMGVKILRRRLGRAAGV  584



>gb|KDO63592.1| hypothetical protein CISIN_1g0081631mg, partial [Citrus sinensis]
 gb|KDO63593.1| hypothetical protein CISIN_1g0081631mg, partial [Citrus sinensis]
 gb|KDO63594.1| hypothetical protein CISIN_1g0081631mg, partial [Citrus sinensis]
 gb|KDO63595.1| hypothetical protein CISIN_1g0081631mg, partial [Citrus sinensis]
 gb|KDO63596.1| hypothetical protein CISIN_1g0081631mg, partial [Citrus sinensis]
 gb|KDO63597.1| hypothetical protein CISIN_1g0081631mg, partial [Citrus sinensis]
Length=280

 Score =   231 bits (590),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 134/173 (77%), Gaps = 1/173 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEK+  P S G + L+  N  DNP++TFNYF  P+DL++CV GI  +EKI++S
Sbjct  105  AFRGGFILEKVMGPVSTGHLELRTRNPNDNPSVTFNYFKEPEDLQRCVQGISTIEKIIES  164

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K FS F + +  ++  L+N++A A VNL+PRH+N + SLEQFC+DTV+TIWHYHGGC VG
Sbjct  165  KSFSKF-KYESMSVPILVNMTASAPVNLLPRHSNASTSLEQFCRDTVMTIWHYHGGCQVG  223

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGN  519
            KVV  DY+VLG   LRV+DGST   SPGTNPQAT++M+GRYMGV+IL  RL +
Sbjct  224  KVVDHDYKVLGVDALRVIDGSTFYYSPGTNPQATVMMLGRYMGVRILSERLAS  276



>gb|EMT10900.1| Protein HOTHEAD [Aegilops tauschii]
Length=660

 Score =   240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 138/172 (80%), Gaps = 1/172 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            FRGGFILEK+  P+S G + L+N N +DNPA+TFNYFSHP+DL++CV G+ ++E++++SK
Sbjct  411  FRGGFILEKVLGPASTGHLELRNLNPDDNPAVTFNYFSHPEDLRRCVEGLTLIERVIQSK  470

Query  184  RFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVGK  363
             F NFT     +L+ LLNI+A+  VNL+PRH ND++SLEQFCKDTV+TIWHYHGGC VG+
Sbjct  471  SFQNFTY-PYFSLEELLNITAEFPVNLLPRHDNDSKSLEQFCKDTVMTIWHYHGGCQVGR  529

Query  364  VVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGN  519
            VV  +YRVLG   LRV+DGST   SPGTNPQAT++M+GRYMGVK+   R  N
Sbjct  530  VVDAEYRVLGVDALRVIDGSTFNASPGTNPQATVMMLGRYMGVKMRDERYVN  581



>dbj|BAK04452.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=589

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 138/170 (81%), Gaps = 1/170 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            FRGGFILEK+  P+S G + L+N N +DNPA+TFNYFSHP+DL++CV G+ ++E++++SK
Sbjct  411  FRGGFILEKVLGPASTGHLELRNLNPDDNPAVTFNYFSHPEDLRRCVEGLTLIERVIQSK  470

Query  184  RFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVGK  363
             F NFT     +++ LLN++A+  VNL+PRH ND++SLEQFCKDTV+TIWHYHGGC VG+
Sbjct  471  SFENFTY-PYFSMEALLNMTAEFPVNLLPRHDNDSRSLEQFCKDTVMTIWHYHGGCQVGR  529

Query  364  VVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRL  513
            VV  +YRVLG   LRV+DGST   SPGTNPQAT++M+GRYMGVKI   R+
Sbjct  530  VVDAEYRVLGIDALRVIDGSTFNASPGTNPQATVMMLGRYMGVKIRDERV  579



>gb|EYU36945.1| hypothetical protein MIMGU_mgv1a007376mg [Erythranthe guttata]
Length=409

 Score =   233 bits (595),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 133/171 (78%), Gaps = 1/171 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI  P S G + L+N N  DNP+ITFNYF+ P+DL +CV+G+R++E +++S
Sbjct  234  AFRGGFILEKIMGPISTGHLHLRNRNPNDNPSITFNYFNEPEDLARCVDGLRVIESVIQS  293

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
              FS F   D ++L  LLN++A A VNL+PRH N + SLEQFC+DTV+TIWHYHGGC VG
Sbjct  294  AAFSPFRYGD-QSLPALLNMTAHAPVNLLPRHDNSSTSLEQFCRDTVMTIWHYHGGCQVG  352

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRL  513
            +VV  DYRV G   LRVVDGST   SPGTNPQAT++M+GRYMGV+IL  R+
Sbjct  353  RVVDSDYRVRGVDALRVVDGSTFVYSPGTNPQATVMMLGRYMGVRILEERI  403



>ref|XP_004976549.1| PREDICTED: protein HOTHEAD-like [Setaria italica]
Length=597

 Score =   237 bits (604),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 133/170 (78%), Gaps = 1/170 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
             RGGFILEK+  P S G + L+N N +DNPA+TFNYFSHP+DL++CV G+ ++E++++SK
Sbjct  419  LRGGFILEKVLGPLSTGHLELRNRNPDDNPAVTFNYFSHPEDLRRCVAGLSVIERVIQSK  478

Query  184  RFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVGK  363
             F NFT     +++ LLNIS    VNL+PRH ND+ SLEQFCKDTV+TIWHYHGGC VG+
Sbjct  479  AFENFTYT-SFSMETLLNISTGFPVNLLPRHDNDSTSLEQFCKDTVMTIWHYHGGCQVGR  537

Query  364  VVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRL  513
            VV  +YRVLG   LRV+DGST   SPGTNPQAT++M+GRYMGVKI   RL
Sbjct  538  VVDAEYRVLGVDALRVIDGSTFNASPGTNPQATVMMLGRYMGVKIQSERL  587



>ref|NP_001053612.1| Os04g0573100 [Oryza sativa Japonica Group]
 emb|CAD41660.3| OSJNBa0019K04.7 [Oryza sativa Japonica Group]
 dbj|BAF15526.1| Os04g0573100 [Oryza sativa Japonica Group]
 emb|CAH66958.1| OSIGBa0147H17.6 [Oryza sativa Indica Group]
 gb|EAY95230.1| hypothetical protein OsI_17047 [Oryza sativa Indica Group]
 gb|EAZ31699.1| hypothetical protein OsJ_15848 [Oryza sativa Japonica Group]
Length=591

 Score =   236 bits (603),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 138/175 (79%), Gaps = 1/175 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI  P S G + L+N N +DNP++TFNYF+HP+DL++CV G+ ++E++++S
Sbjct  412  AFRGGFILEKILGPLSTGHLELRNRNPDDNPSVTFNYFAHPEDLRRCVAGVSVIERVIRS  471

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + F+NFT     +++ LLN++A   VNL PRH ND+ SLEQFCKDTV+TIWHYHGGC V 
Sbjct  472  EAFANFTY-PYFSVETLLNMTAGFPVNLRPRHDNDSTSLEQFCKDTVMTIWHYHGGCQVN  530

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKA  525
            +VV  +YRV+G   LRV+DGST   SPGTNPQAT++M+GRYMGVKI   RLGN+ 
Sbjct  531  RVVDAEYRVIGVDALRVIDGSTFNASPGTNPQATVMMLGRYMGVKIQNERLGNEG  585



>ref|XP_006857945.1| hypothetical protein AMTR_s00069p00163110 [Amborella trichopoda]
 gb|ERN19412.1| hypothetical protein AMTR_s00069p00163110 [Amborella trichopoda]
Length=581

 Score =   234 bits (598),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 134/171 (78%), Gaps = 1/171 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI  P S+G++ L+N N  DNP +TFNYF  P+DL++CVNGIRI+EK++ S
Sbjct  398  AFRGGFILEKILGPVSKGELRLRNRNPSDNPQVTFNYFKEPEDLRRCVNGIRIIEKVISS  457

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + FS F +    + + L+N++A   VNL+P H+ND+ SLEQFCKDTV+TIWHYHGGCHV 
Sbjct  458  RAFSKF-KYPYLSPNTLINMTASFPVNLVPHHSNDSTSLEQFCKDTVMTIWHYHGGCHVN  516

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRL  513
            +VV  DY VLG   LRV+DGST   SPGTNPQAT++M+GRYMG+KI R RL
Sbjct  517  RVVDQDYHVLGVDALRVIDGSTFNYSPGTNPQATVMMLGRYMGLKIQRERL  567



>ref|XP_009616548.1| PREDICTED: protein HOTHEAD-like [Nicotiana tomentosiformis]
Length=574

 Score =   234 bits (598),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 137/174 (79%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFI+EKI  P S G + L+  N  DNP++TFNYF  P+DL++CVNG++++E I++S
Sbjct  399  AFRGGFIIEKIMGPISTGHLELRTRNPNDNPSVTFNYFKQPEDLQRCVNGLKVIENIIES  458

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K FS F + D  ++  LLN++A A VNL+PRH N + SLEQFCKDTV+TIWHYHGGC VG
Sbjct  459  KSFSKF-RYDTLSIPALLNLTASAPVNLLPRHDNVSVSLEQFCKDTVMTIWHYHGGCQVG  517

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNK  522
            +VV  DY+V+G  +LRV+DGST + SPGTNPQAT++M+GRYMGV+IL  RL  +
Sbjct  518  RVVDQDYKVIGIGKLRVIDGSTFSYSPGTNPQATVMMLGRYMGVRILNERLAKE  571



>ref|XP_009800461.1| PREDICTED: protein HOTHEAD [Nicotiana sylvestris]
Length=576

 Score =   234 bits (597),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 137/174 (79%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFI+EKI  P S G + L+  N  DNP++TFNYF  P+DL++CVNG++++E I++S
Sbjct  399  AFRGGFIIEKIMGPISTGHLELRTRNPNDNPSVTFNYFKQPEDLQRCVNGLKVIENIIES  458

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K FS F + D  ++  LLN++A A VNL+PRH N + SLEQFCKDTV+TIWHYHGGC VG
Sbjct  459  KSFSKF-RYDTISIPALLNLTASAPVNLLPRHDNVSVSLEQFCKDTVMTIWHYHGGCQVG  517

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNK  522
            +VV  DY+V+G  +LRV+DGST + SPGTNPQAT++M+GRYMGV+IL  RL  +
Sbjct  518  RVVDQDYKVIGIGKLRVIDGSTFSYSPGTNPQATVMMLGRYMGVRILNERLAKE  571



>ref|XP_006659383.1| PREDICTED: protein HOTHEAD-like [Oryza brachyantha]
Length=583

 Score =   234 bits (597),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 133/177 (75%), Gaps = 1/177 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            F GGFIL K+  P S G ++L +T++  NP +TFNYF +P DL +CV GIR VE+I+K+ 
Sbjct  407  FNGGFILSKVDGPLSTGNLVLMDTDINSNPMVTFNYFQNPKDLSRCVYGIRTVERILKTN  466

Query  184  RFSNFT-QCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
             F+ FT       ++  LN+S  AN+NLIP+H ND+ SLEQFCKDTV+TIWHYHGGCHVG
Sbjct  467  HFNKFTPNGSGYPMEVYLNMSVTANINLIPKHINDSTSLEQFCKDTVVTIWHYHGGCHVG  526

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV   YRV+G   +RV+DGST   SPGTNPQAT+LMMGRYMGVKILR RLG  AGV
Sbjct  527  KVVDQQYRVIGVSGVRVIDGSTFFRSPGTNPQATVLMMGRYMGVKILRGRLGRAAGV  583



>ref|XP_008246185.1| PREDICTED: protein HOTHEAD-like [Prunus mume]
Length=182

 Score =   222 bits (566),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 131/173 (76%), Gaps = 1/173 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEK+  P S G + L+  N  DNP++TFNYF  P DL++C+ GI  +EKI++S
Sbjct  8    AFRGGFILEKVMGPISTGHLELRTRNPNDNPSVTFNYFKDPQDLERCIQGIETIEKIIES  67

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K FS F + D  +L  LLNI+A + +NL+P+H N ++SL+QFCKDTV+TIWHYHGGC VG
Sbjct  68   KPFSKF-RYDYLSLAALLNITANSPINLLPKHANASRSLDQFCKDTVMTIWHYHGGCQVG  126

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGN  519
            +VV   Y+VLG   LRV+DGST   SPGTNPQAT++M+GRYMG +IL  RL +
Sbjct  127  RVVDYQYKVLGVDALRVIDGSTFIYSPGTNPQATVMMLGRYMGKRILDERLAS  179



>ref|XP_011072078.1| PREDICTED: protein HOTHEAD-like [Sesamum indicum]
Length=411

 Score =   229 bits (585),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 133/170 (78%), Gaps = 1/170 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            FRGGFILEKI  P S G + L+N N  DNP++TFNYF+HP DL++CV G++++E +V+S+
Sbjct  237  FRGGFILEKITGPISTGHLALRNKNPNDNPSVTFNYFTHPQDLRRCVRGLQLIENVVESR  296

Query  184  RFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVGK  363
             FS F + D  +L  LLN++A A VNL+PRH N + SLEQFC+DTV+TIWHYHGGC +G+
Sbjct  297  AFSPF-RYDYLSLPALLNMTAAAPVNLLPRHANVSTSLEQFCRDTVMTIWHYHGGCRMGR  355

Query  364  VVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRL  513
            VV  +YRV G   LRVVDGST   SPGTNPQAT++M+GRYMGV+IL  RL
Sbjct  356  VVDAEYRVRGVDALRVVDGSTFHYSPGTNPQATVMMLGRYMGVRILSERL  405



>gb|EPS58737.1| hypothetical protein M569_16076, partial [Genlisea aurea]
Length=320

 Score =   226 bits (577),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 134/169 (79%), Gaps = 1/169 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
             +GGFILEKI  P S+G + L+  N +DNP++TFNYF  P DL++CV+G++++E +++SK
Sbjct  153  LQGGFILEKIEGPLSKGHMQLRTKNPDDNPSVTFNYFKDPRDLRRCVDGLKVIESVIESK  212

Query  184  RFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVGK  363
             F+ F + D  +L  LLN++A A VNL+P+H N + SLEQFCKDTV+TIWHYHGGC VG+
Sbjct  213  AFAPF-RYDPLSLPFLLNLTAGAPVNLLPKHANVSSSLEQFCKDTVMTIWHYHGGCVVGR  271

Query  364  VVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHR  510
            VV  +YRV+G  RLRVVDGST ++SPGTNPQAT++M+GRYMGVKI   R
Sbjct  272  VVDSEYRVMGVDRLRVVDGSTFSDSPGTNPQATVMMLGRYMGVKIAEER  320



>ref|XP_008803247.1| PREDICTED: protein HOTHEAD-like [Phoenix dactylifera]
Length=580

 Score =   234 bits (596),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 135/172 (78%), Gaps = 1/172 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            + RGGFILEK+A P S GQ+ L+N N +DNP++TFNYF HP DL++C+ GI ++EK+V+S
Sbjct  402  SLRGGFILEKVAGPLSTGQLELRNRNPDDNPSVTFNYFKHPLDLQRCIQGIEVIEKVVQS  461

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
              FS F +    +++ LLN++A   VNLIPRH ND+ SLEQ+CKDTV+TIWHYHGGC VG
Sbjct  462  MAFSKF-KYPFISIEELLNLTADFPVNLIPRHDNDSTSLEQYCKDTVMTIWHYHGGCQVG  520

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLG  516
            +VV  DY+VLG   LRVVDGST   SPGTNPQAT++M+GRYMG++I   RLG
Sbjct  521  RVVDSDYKVLGVDALRVVDGSTFNFSPGTNPQATVMMLGRYMGIRIQNERLG  572



>ref|XP_006652668.1| PREDICTED: protein HOTHEAD-like [Oryza brachyantha]
Length=593

 Score =   233 bits (594),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 136/175 (78%), Gaps = 1/175 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI  P S G + L+N N +DNP++TFNYF+HP+DL++CV G+ ++E++++S
Sbjct  414  AFRGGFILEKILGPLSTGHLELRNRNPDDNPSVTFNYFAHPEDLRRCVAGVAVIERVIQS  473

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K F NFT     +++ LLN++A   VNL PRH ND+ SLEQFCKDTV+TIWHYHGGC V 
Sbjct  474  KAFVNFTY-PYFSVEALLNMTAGFPVNLRPRHDNDSTSLEQFCKDTVMTIWHYHGGCQVN  532

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKA  525
            +VV  +YRV+G   LRV+DGST   SPGTNPQAT++M+GRYMGVKI   RLG + 
Sbjct  533  RVVDTEYRVIGVDALRVIDGSTFNASPGTNPQATVMMLGRYMGVKIQNERLGAEG  587



>ref|XP_006358855.1| PREDICTED: protein HOTHEAD-like [Solanum tuberosum]
Length=576

 Score =   231 bits (590),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 134/174 (77%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI  P S G + L+  N  DNP+ITFNYF  P+DL++CVNG++++E I++S
Sbjct  400  AFRGGFILEKIMGPISTGHLELRTRNPNDNPSITFNYFKEPEDLQRCVNGLKVIENIIES  459

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K FS F + D  +L  LLN++A A VNL+P+H N + SLEQFCKDTV+TIWHYHGGC VG
Sbjct  460  KSFSQF-RYDSISLPALLNLTASAPVNLLPKHDNISVSLEQFCKDTVMTIWHYHGGCQVG  518

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNK  522
             VV  DY+V+G   LRV+DGST   SPGTNPQAT++M+GRYMGV+I+  RL  +
Sbjct  519  NVVDQDYKVIGVDNLRVIDGSTFNYSPGTNPQATVMMLGRYMGVRIVNERLAKE  572



>ref|XP_006440518.1| hypothetical protein CICLE_v10019427mg [Citrus clementina]
 gb|ESR53758.1| hypothetical protein CICLE_v10019427mg [Citrus clementina]
Length=580

 Score =   231 bits (590),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 134/173 (77%), Gaps = 1/173 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEK+  P S G + L+  N  DNP++TFNYF  P+DL++CV GI  +EKI++S
Sbjct  405  AFRGGFILEKVMGPVSTGHLELRTRNPNDNPSVTFNYFKEPEDLQRCVQGISTIEKIIES  464

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K FS F + +  ++  L+N++A A VNL+PRH+N + SLEQFC+DTV+TIWHYHGGC VG
Sbjct  465  KSFSKF-KYESMSVPTLVNMTASAPVNLLPRHSNSSTSLEQFCRDTVMTIWHYHGGCQVG  523

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGN  519
            KVV  DY+VLG   LRV+DGST   SPGTNPQAT++M+GRYMGV+IL  RL +
Sbjct  524  KVVDHDYKVLGVDALRVIDGSTFYYSPGTNPQATVMMLGRYMGVRILSERLAS  576



>gb|AFW72795.1| hypothetical protein ZEAMMB73_541586 [Zea mays]
Length=209

 Score =   221 bits (562),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 129/171 (75%), Gaps = 1/171 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            A RGGFILEK+  P S GQ+ L+N N +DNP++ FNYF+HPDDL++CV GI  +E++++S
Sbjct  36   ALRGGFILEKVLGPQSVGQLALRNLNPDDNPSVRFNYFAHPDDLRRCVAGIAAIERVIRS  95

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + FS FT          LN++A+  VN + R   D ++LE+FC+DTV+TIWHYHGGC VG
Sbjct  96   RAFSRFTY-QNFAFPAALNVTAEFPVNTLYRRGGDPRALERFCRDTVMTIWHYHGGCQVG  154

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRL  513
            +VV  DYRVLG   LRV+DGST   SPGTNPQAT++M+GRYMGVK+L+ R+
Sbjct  155  RVVDRDYRVLGVDALRVIDGSTFNASPGTNPQATVMMLGRYMGVKLLKERM  205



>tpg|DAA36392.1| TPA: hypothetical protein ZEAMMB73_775461 [Zea mays]
Length=599

 Score =   231 bits (590),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 134/175 (77%), Gaps = 1/175 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEK+  P S G + L+N + +DNP +TFNYFSHP+DL++CV G+ ++E+++ S
Sbjct  420  AFRGGFILEKVLGPLSTGHLELRNRDPDDNPLVTFNYFSHPEDLRRCVAGLSVIERVIHS  479

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + F NFT  D  +++ LLN+S    VNL+PRH ND+ SLE FCKDTV+TIWHYHGGC VG
Sbjct  480  QAFKNFTYPDF-SMETLLNMSTGFPVNLLPRHDNDSTSLEMFCKDTVMTIWHYHGGCQVG  538

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKA  525
            +VV  +YRVLG   LRV+DGST   SPGTNPQAT++M+GRYMGV+I   RL  + 
Sbjct  539  RVVDAEYRVLGIDALRVIDGSTFNASPGTNPQATVMMLGRYMGVRITNERLAAEG  593



>ref|XP_010055593.1| PREDICTED: protein HOTHEAD [Eucalyptus grandis]
 gb|KCW72080.1| hypothetical protein EUGRSUZ_E00525 [Eucalyptus grandis]
Length=579

 Score =   231 bits (589),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 134/175 (77%), Gaps = 1/175 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            A +GGFILEKI  P S G + L++ N  DNP++TFNYF  PDDL++CV G+  +E++++S
Sbjct  405  ALQGGFILEKITGPKSTGHMELRSRNPNDNPSVTFNYFQDPDDLRRCVEGLSTIERVIES  464

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K F++F + D  T   LLN++A A VNL+PRH N + SLEQ+C+D+V+TIWHYHGGC VG
Sbjct  465  KAFADF-KYDAMTFASLLNLTASAPVNLLPRHRNTSTSLEQYCRDSVMTIWHYHGGCQVG  523

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKA  525
             VV  DYRVLG   LRV+DGST   SPGTNPQAT++M+GRYMGVKIL  RL ++A
Sbjct  524  MVVDRDYRVLGVDALRVIDGSTFNHSPGTNPQATVMMLGRYMGVKILNERLASEA  578



>ref|XP_006440517.1| hypothetical protein CICLE_v10019427mg [Citrus clementina]
 gb|ESR53757.1| hypothetical protein CICLE_v10019427mg [Citrus clementina]
Length=587

 Score =   231 bits (589),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 134/173 (77%), Gaps = 1/173 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEK+  P S G + L+  N  DNP++TFNYF  P+DL++CV GI  +EKI++S
Sbjct  405  AFRGGFILEKVMGPVSTGHLELRTRNPNDNPSVTFNYFKEPEDLQRCVQGISTIEKIIES  464

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K FS F + +  ++  L+N++A A VNL+PRH+N + SLEQFC+DTV+TIWHYHGGC VG
Sbjct  465  KSFSKF-KYESMSVPTLVNMTASAPVNLLPRHSNSSTSLEQFCRDTVMTIWHYHGGCQVG  523

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGN  519
            KVV  DY+VLG   LRV+DGST   SPGTNPQAT++M+GRYMGV+IL  RL +
Sbjct  524  KVVDHDYKVLGVDALRVIDGSTFYYSPGTNPQATVMMLGRYMGVRILSERLAS  576



>ref|XP_006477371.1| PREDICTED: protein HOTHEAD-like isoform X5 [Citrus sinensis]
Length=580

 Score =   231 bits (588),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 134/173 (77%), Gaps = 1/173 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEK+  P S G + L+  N  DNP++TFNYF  P+DL++CV GI  +EKI++S
Sbjct  405  AFRGGFILEKVMGPVSTGHLELRTRNPNDNPSVTFNYFKEPEDLQRCVQGISTIEKIIES  464

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K FS F + +  ++  L+N++A A VNL+PRH+N + SLEQFC+DTV+TIWHYHGGC VG
Sbjct  465  KSFSKF-KYESMSVPILVNMTASAPVNLLPRHSNASTSLEQFCRDTVMTIWHYHGGCQVG  523

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGN  519
            KVV  DY+VLG   LRV+DGST   SPGTNPQAT++M+GRYMGV+IL  RL +
Sbjct  524  KVVDHDYKVLGVDALRVIDGSTFYYSPGTNPQATVMMLGRYMGVRILSERLAS  576



>ref|XP_006440515.1| hypothetical protein CICLE_v10019611mg [Citrus clementina]
 gb|ESR53755.1| hypothetical protein CICLE_v10019611mg [Citrus clementina]
Length=542

 Score =   230 bits (586),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 133/172 (77%), Gaps = 1/172 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            +RGGFI EKI  P S G + L+  N  DNP++TFNYF  P+DL++CV GI  +EKI++SK
Sbjct  368  YRGGFIFEKIVGPESTGHLELRTRNPNDNPSVTFNYFKEPEDLQRCVQGISTIEKIIESK  427

Query  184  RFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVGK  363
             FS F + D  +++ LLN++A   +NL+P+H+N + SLEQFC+DTV+TIWHYHGGC VGK
Sbjct  428  SFSRF-KYDNMSVETLLNMTASMPLNLLPKHSNASTSLEQFCRDTVMTIWHYHGGCQVGK  486

Query  364  VVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGN  519
            VV  DY+VLG   LRVVDGST   SPGTNPQAT++M+GRYMGV+ILR RL +
Sbjct  487  VVDHDYKVLGVDALRVVDGSTFYYSPGTNPQATVMMLGRYMGVRILRERLAS  538



>gb|AES94124.2| glucose-methanol-choline (GMC) oxidoreductase family protein 
[Medicago truncatula]
Length=545

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 132/173 (76%), Gaps = 1/173 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI  P S G + L+NT+  +NP +TFNYF  P DL++C+ G+  +EKI+ S
Sbjct  370  AFRGGFILEKILGPISTGHLELRNTDPNENPLVTFNYFQDPRDLERCIQGMNTIEKIIDS  429

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K FS F   +  ++  LLN++A + VNL+P+HTN + SLEQFC+DTV+TIWHYHGGC VG
Sbjct  430  KAFSPFKYTNM-SVSMLLNMTANSPVNLLPKHTNTSMSLEQFCRDTVMTIWHYHGGCQVG  488

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGN  519
            +VV  DY+V G H LRV+DGST   SPGTNPQAT++M+GRYMGVKILR R  +
Sbjct  489  RVVDSDYKVAGVHALRVIDGSTFNHSPGTNPQATVMMLGRYMGVKILRERFAD  541



>ref|XP_004511612.1| PREDICTED: protein HOTHEAD-like [Cicer arietinum]
Length=575

 Score =   230 bits (586),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 133/174 (76%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFILEKI  P S G + L+NT+  +NP +TFNYF  P DL++C+ GI  +EKI+ S
Sbjct  400  AFKGGFILEKIMGPISTGHLELQNTDPNENPLVTFNYFKDPRDLERCIQGISTIEKIIDS  459

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K FS F + +   +  LLN++A + VNL+P+HTN + SLEQFC+DTV+TIWHYHGGC VG
Sbjct  460  KAFSPF-KYNNMPVSMLLNMTANSPVNLLPKHTNTSLSLEQFCRDTVMTIWHYHGGCQVG  518

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNK  522
            +VV  DY+VLG   LRV+DGST   SPGTNPQATL+M+GRYMGVKILR RL  K
Sbjct  519  RVVNSDYKVLGVDALRVIDGSTFNYSPGTNPQATLMMLGRYMGVKILRERLAAK  572



>ref|XP_004245659.1| PREDICTED: protein HOTHEAD [Solanum lycopersicum]
Length=575

 Score =   230 bits (586),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 134/174 (77%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI  P S G + L+  N  DNP++TFNYF  P+DL++CV+G++I+E I++S
Sbjct  400  AFRGGFILEKIMGPISTGHLELRTRNPNDNPSVTFNYFKEPEDLQRCVDGLKIIENIIES  459

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K FS F + D  +L  LLN++A A VNL+P+H N + SLEQFCKDTV+TIWHYHGGC VG
Sbjct  460  KSFSQF-RYDSISLPALLNLTASAPVNLLPKHDNISVSLEQFCKDTVMTIWHYHGGCQVG  518

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNK  522
             VV  DY+V+G   LRV+DGST   SPGTNPQAT++M+GRYMGV+I+  RL  +
Sbjct  519  NVVDQDYKVIGIDNLRVIDGSTFNYSPGTNPQATVMMLGRYMGVRIVNERLAKE  572



>ref|XP_006477369.1| PREDICTED: protein HOTHEAD-like isoform X3 [Citrus sinensis]
 ref|XP_006477370.1| PREDICTED: protein HOTHEAD-like isoform X4 [Citrus sinensis]
Length=586

 Score =   230 bits (586),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 134/173 (77%), Gaps = 1/173 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEK+  P S G + L+  N  DNP++TFNYF  P+DL++CV GI  +EKI++S
Sbjct  404  AFRGGFILEKVMGPVSTGHLELRTRNPNDNPSVTFNYFKEPEDLQRCVQGISTIEKIIES  463

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K FS F + +  ++  L+N++A A VNL+PRH+N + SLEQFC+DTV+TIWHYHGGC VG
Sbjct  464  KSFSKF-KYESMSVPILVNMTASAPVNLLPRHSNASTSLEQFCRDTVMTIWHYHGGCQVG  522

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGN  519
            KVV  DY+VLG   LRV+DGST   SPGTNPQAT++M+GRYMGV+IL  RL +
Sbjct  523  KVVDHDYKVLGVDALRVIDGSTFYYSPGTNPQATVMMLGRYMGVRILSERLAS  575



>ref|XP_006477367.1| PREDICTED: protein HOTHEAD-like isoform X1 [Citrus sinensis]
 ref|XP_006477368.1| PREDICTED: protein HOTHEAD-like isoform X2 [Citrus sinensis]
Length=587

 Score =   230 bits (586),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 134/173 (77%), Gaps = 1/173 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEK+  P S G + L+  N  DNP++TFNYF  P+DL++CV GI  +EKI++S
Sbjct  405  AFRGGFILEKVMGPVSTGHLELRTRNPNDNPSVTFNYFKEPEDLQRCVQGISTIEKIIES  464

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K FS F + +  ++  L+N++A A VNL+PRH+N + SLEQFC+DTV+TIWHYHGGC VG
Sbjct  465  KSFSKF-KYESMSVPILVNMTASAPVNLLPRHSNASTSLEQFCRDTVMTIWHYHGGCQVG  523

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGN  519
            KVV  DY+VLG   LRV+DGST   SPGTNPQAT++M+GRYMGV+IL  RL +
Sbjct  524  KVVDHDYKVLGVDALRVIDGSTFYYSPGTNPQATVMMLGRYMGVRILSERLAS  576



>ref|XP_003611166.1| Choline dehydrogenase [Medicago truncatula]
Length=580

 Score =   230 bits (586),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 132/173 (76%), Gaps = 1/173 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI  P S G + L+NT+  +NP +TFNYF  P DL++C+ G+  +EKI+ S
Sbjct  405  AFRGGFILEKILGPISTGHLELRNTDPNENPLVTFNYFQDPRDLERCIQGMNTIEKIIDS  464

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K FS F   +  ++  LLN++A + VNL+P+HTN + SLEQFC+DTV+TIWHYHGGC VG
Sbjct  465  KAFSPFKYTNM-SVSMLLNMTANSPVNLLPKHTNTSMSLEQFCRDTVMTIWHYHGGCQVG  523

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGN  519
            +VV  DY+V G H LRV+DGST   SPGTNPQAT++M+GRYMGVKILR R  +
Sbjct  524  RVVDSDYKVAGVHALRVIDGSTFNHSPGTNPQATVMMLGRYMGVKILRERFAD  576



>gb|KJB25745.1| hypothetical protein B456_004G207200 [Gossypium raimondii]
Length=292

 Score =   222 bits (565),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 129/172 (75%), Gaps = 1/172 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            FRGGFILEK+  P S G + L+  N  DNP++TFNYF  P DL++CV GI+ +EKI++SK
Sbjct  122  FRGGFILEKVMGPISTGHLELRTRNPNDNPSVTFNYFKDPQDLQRCVQGIQTIEKIIESK  181

Query  184  RFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVGK  363
             F  F + +  +   LLN++A A +NL+P+H N +  LE FCKDTV+TIWHYHGGC VGK
Sbjct  182  AFFRF-RYEFLSWPILLNMTANAPLNLLPKHYNPSMPLEVFCKDTVMTIWHYHGGCQVGK  240

Query  364  VVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGN  519
            VV  DY+VLG   LRV+DGST  +SPGTNPQAT++M+GRYMGVKIL  RL N
Sbjct  241  VVDLDYKVLGVDALRVIDGSTFNDSPGTNPQATVMMLGRYMGVKILSERLAN  292



>ref|XP_008348797.1| PREDICTED: protein HOTHEAD-like [Malus domestica]
Length=293

 Score =   222 bits (565),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 129/173 (75%), Gaps = 1/173 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF GGFILEK+  P S G + L+  N  DNPA+TFNYF  P DL++CV GI  +EKI++S
Sbjct  118  AFXGGFILEKVMGPISTGHMELRTRNPNDNPAVTFNYFKEPQDLERCVQGIETIEKIIES  177

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K FS F + +  ++  LLN +A + VNL+P+H N ++SL+QFCKDTV+TIWHYHGGC VG
Sbjct  178  KAFSKF-RYEGMSIAALLNATASSPVNLLPKHANASRSLDQFCKDTVMTIWHYHGGCQVG  236

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGN  519
            +VV  DY+VLG   LRV+DGST   SPGTNPQAT++M+GRYMG  IL  RL +
Sbjct  237  RVVDHDYKVLGVDALRVIDGSTFNYSPGTNPQATVMMLGRYMGKTILDERLAS  289



>gb|KHN34438.1| Protein HOTHEAD [Glycine soja]
Length=548

 Score =   229 bits (583),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 132/177 (75%), Gaps = 1/177 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI  P S G + L++ +  DNP++TFNYF  P DL++CV G+  VEKI++S
Sbjct  368  AFRGGFILEKIMGPISSGHLELRSRDPNDNPSVTFNYFQDPRDLQRCVQGLSTVEKIIES  427

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K FS F +     +  LLN++A A VNL+P+HTN + SLEQ+CKDTV+TIWHYHGGC V 
Sbjct  428  KAFSPF-RYPNMPVPVLLNMTASAPVNLLPKHTNSSLSLEQYCKDTVMTIWHYHGGCQVA  486

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV  DY+VLG   LRV+DGST   SPGTNPQAT++M+GRYMGVKIL  RLG  A  
Sbjct  487  KVVDRDYKVLGVDALRVIDGSTFNYSPGTNPQATVMMLGRYMGVKILSERLGGAAAA  543



>ref|XP_002282510.2| PREDICTED: protein HOTHEAD [Vitis vinifera]
 emb|CBI34759.3| unnamed protein product [Vitis vinifera]
Length=578

 Score =   229 bits (585),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 134/173 (77%), Gaps = 1/173 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI  P S G + L++ N  DNP++TFNYF  P+DL++CVNG++I+EKI++S
Sbjct  403  AFRGGFILEKIMGPISTGHLELQSRNPNDNPSVTFNYFKEPEDLQRCVNGMQIIEKIIES  462

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K FS F + D  ++  L+N++    VNL+PRH N + SLEQFCKDTV+TIWHYHGGC VG
Sbjct  463  KAFSQF-KYDYLSVPALINMTLNFPVNLVPRHDNASTSLEQFCKDTVMTIWHYHGGCQVG  521

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGN  519
             VV  DY+VLG   LRV+DGST   SPGTNPQAT++M+GRYMG++IL  RL +
Sbjct  522  SVVDHDYKVLGVDALRVIDGSTFNASPGTNPQATVMMLGRYMGLRILSERLAS  574



>ref|NP_001146691.1| uncharacterized protein LOC100280292 precursor [Zea mays]
 gb|ACL54547.1| unknown [Zea mays]
Length=599

 Score =   230 bits (586),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 134/175 (77%), Gaps = 1/175 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEK+  P S G + L+N + +DNP +TFNYFSHP+DL++CV G+ ++E+++ S
Sbjct  420  AFRGGFILEKVLGPLSTGHLELRNRDPDDNPLVTFNYFSHPEDLRRCVAGLSVIERVIHS  479

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + F NFT  D  +++ LLN+S    VNL+PRH ND+ SLE FCKDTV+TIWHYHGGC VG
Sbjct  480  QAFKNFTYPDF-SMETLLNMSTGFPVNLLPRHDNDSTSLEMFCKDTVMTIWHYHGGCQVG  538

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKA  525
            +VV  +YRVLG   LRV+DGST   SPGTNPQAT++++GRYMGV+I   RL  + 
Sbjct  539  RVVDAEYRVLGIDALRVIDGSTFNASPGTNPQATVMILGRYMGVRITNERLAAEG  593



>ref|XP_003581546.1| PREDICTED: protein HOTHEAD [Brachypodium distachyon]
Length=593

 Score =   229 bits (584),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 134/170 (79%), Gaps = 1/170 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            FRGGFILEK+  P S G + L+N N +DNPA+TFNYFSHP+DL++CV+G+ ++E++++SK
Sbjct  415  FRGGFILEKVLGPLSTGHLELRNLNPDDNPAVTFNYFSHPEDLRRCVDGLTVIERVIQSK  474

Query  184  RFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVGK  363
               NFT     +++ +LN++A   VN+  RH ND++SLEQFCKDTV+TIWHYHGGC VG+
Sbjct  475  ALENFTY-PYLSVEDMLNMTADFPVNMRARHDNDSRSLEQFCKDTVMTIWHYHGGCQVGR  533

Query  364  VVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRL  513
            VV  +YRVLG   LRV+DGST   SPGTNPQAT++M+GRYMGVKI   RL
Sbjct  534  VVDAEYRVLGVDALRVIDGSTFNASPGTNPQATVMMLGRYMGVKIQNERL  583



>ref|XP_003525734.1| PREDICTED: protein HOTHEAD-like [Glycine max]
Length=581

 Score =   229 bits (583),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 132/177 (75%), Gaps = 1/177 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI  P S G + L++ +  DNP++TFNYF  P DL++CV G+  VEKI++S
Sbjct  401  AFRGGFILEKIMGPISSGHLELRSRDPNDNPSVTFNYFQDPRDLQRCVQGLSTVEKIIES  460

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K FS F +     +  LLN++A A VNL+P+HTN + SLEQ+CKDTV+TIWHYHGGC V 
Sbjct  461  KAFSPF-RYPNMPVPVLLNMTASAPVNLLPKHTNSSLSLEQYCKDTVMTIWHYHGGCQVA  519

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV  DY+VLG   LRV+DGST   SPGTNPQAT++M+GRYMGVKIL  RLG  A  
Sbjct  520  KVVDRDYKVLGVDALRVIDGSTFNYSPGTNPQATVMMLGRYMGVKILSERLGGAAAA  576



>ref|XP_010255566.1| PREDICTED: protein HOTHEAD-like [Nelumbo nucifera]
Length=579

 Score =   228 bits (582),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 134/175 (77%), Gaps = 1/175 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGF+LEKI  P S G + L+N N  DNP++TFNYF  P+DL++CV+GI  ++K+++S
Sbjct  404  AFRGGFLLEKIIGPISTGHLELRNRNPYDNPSVTFNYFKDPEDLRRCVDGINTIKKVIES  463

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K FS F +    +L+ L+N++    VNL+PRH ND+ S+EQFCKDTV+TIWHYHGGC VG
Sbjct  464  KAFSRF-RYPYISLEALINMTTNFPVNLLPRHDNDSTSMEQFCKDTVMTIWHYHGGCQVG  522

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKA  525
            +VV  DYRVLG   LRV+DGST   SPGTNPQAT++M+GRYMGV+IL  RL  + 
Sbjct  523  RVVDQDYRVLGVDALRVIDGSTFNYSPGTNPQATVMMLGRYMGVRILNERLATEG  577



>emb|CDP09821.1| unnamed protein product [Coffea canephora]
Length=578

 Score =   228 bits (582),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 134/174 (77%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF GGFILEK   P S G ++L+  N   NP++TFNYF  P+DLK+CV+GI+++E +++S
Sbjct  403  AFSGGFILEKTMGPLSNGYLMLRKKNPNANPSVTFNYFQEPEDLKRCVDGIKVIESVIES  462

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K FS F + D  TL  LLN++A + VNL+PRH+N + SLEQFCKDTV+TIWHYHGGC V 
Sbjct  463  KSFSKF-RYDDLTLQVLLNMTANSPVNLLPRHSNASTSLEQFCKDTVMTIWHYHGGCQVN  521

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNK  522
            +VV  DY+VLG   LRV+DGST  +SPGTNPQAT++M+GRYMGV +L  RL ++
Sbjct  522  RVVDEDYKVLGVDNLRVIDGSTFYDSPGTNPQATVMMLGRYMGVTMLNERLASE  575



>gb|KJB25741.1| hypothetical protein B456_004G207200 [Gossypium raimondii]
Length=315

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 129/172 (75%), Gaps = 1/172 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            FRGGFILEK+  P S G + L+  N  DNP++TFNYF  P DL++CV GI+ +EKI++SK
Sbjct  145  FRGGFILEKVMGPISTGHLELRTRNPNDNPSVTFNYFKDPQDLQRCVQGIQTIEKIIESK  204

Query  184  RFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVGK  363
             F  F + +  +   LLN++A A +NL+P+H N +  LE FCKDTV+TIWHYHGGC VGK
Sbjct  205  AFFRF-RYEFLSWPILLNMTANAPLNLLPKHYNPSMPLEVFCKDTVMTIWHYHGGCQVGK  263

Query  364  VVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGN  519
            VV  DY+VLG   LRV+DGST  +SPGTNPQAT++M+GRYMGVKIL  RL N
Sbjct  264  VVDLDYKVLGVDALRVIDGSTFNDSPGTNPQATVMMLGRYMGVKILSERLAN  315



>ref|XP_010272578.1| PREDICTED: protein HOTHEAD-like [Nelumbo nucifera]
Length=580

 Score =   228 bits (581),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 133/171 (78%), Gaps = 1/171 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGF+LEKI  P S G + L++ N E NP++TFNYF HP DLK+CV+GI  + K+++S
Sbjct  405  AFRGGFLLEKIMGPISTGHLELRSRNPEHNPSVTFNYFKHPTDLKRCVDGINTIRKVIES  464

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + FS F +    ++  L+N++A   VNL+PRH ND+ S+EQFCKDTV+TIWHYHGGC VG
Sbjct  465  RAFSRF-RYPYISVGALINMTANFPVNLLPRHDNDSTSMEQFCKDTVMTIWHYHGGCQVG  523

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRL  513
            +VV  DYRVLG   LRV+DGST   SPGTNPQAT++M+GRYMGV++LR RL
Sbjct  524  RVVDHDYRVLGVDALRVIDGSTFNYSPGTNPQATVMMLGRYMGVRMLRERL  574



>gb|EYU39000.1| hypothetical protein MIMGU_mgv1a003421mg [Erythranthe guttata]
Length=586

 Score =   228 bits (581),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 133/170 (78%), Gaps = 1/170 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            FRGGF+LEKI  P S G + LK+ N  DNP++TFNYF+ P DL++CV G++++E +++S+
Sbjct  410  FRGGFLLEKILGPISTGHLSLKSKNPNDNPSVTFNYFNEPQDLERCVEGLKVIETVIESR  469

Query  184  RFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVGK  363
             FS+F +    +L  LLN++A A VNL+P+H N + SLEQFCKDTV+TIWHYHGGC VGK
Sbjct  470  AFSSF-RYSYLSLPMLLNMTASAPVNLLPKHANVSTSLEQFCKDTVMTIWHYHGGCQVGK  528

Query  364  VVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRL  513
            VV  DYRV G   LRV+DGST   SPGTNPQAT++M+GRYMGVK+L+ RL
Sbjct  529  VVDSDYRVSGVDSLRVIDGSTFIYSPGTNPQATVMMLGRYMGVKMLKERL  578



>gb|KJB25748.1| hypothetical protein B456_004G207200 [Gossypium raimondii]
Length=338

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 129/172 (75%), Gaps = 1/172 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            FRGGFILEK+  P S G + L+  N  DNP++TFNYF  P DL++CV GI+ +EKI++SK
Sbjct  168  FRGGFILEKVMGPISTGHLELRTRNPNDNPSVTFNYFKDPQDLQRCVQGIQTIEKIIESK  227

Query  184  RFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVGK  363
             F  F + +  +   LLN++A A +NL+P+H N +  LE FCKDTV+TIWHYHGGC VGK
Sbjct  228  AFFRF-RYEFLSWPILLNMTANAPLNLLPKHYNPSMPLEVFCKDTVMTIWHYHGGCQVGK  286

Query  364  VVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGN  519
            VV  DY+VLG   LRV+DGST  +SPGTNPQAT++M+GRYMGVKIL  RL N
Sbjct  287  VVDLDYKVLGVDALRVIDGSTFNDSPGTNPQATVMMLGRYMGVKILSERLAN  338



>ref|XP_002446965.1| hypothetical protein SORBIDRAFT_06g025960 [Sorghum bicolor]
 gb|EES11293.1| hypothetical protein SORBIDRAFT_06g025960 [Sorghum bicolor]
Length=595

 Score =   228 bits (580),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 132/171 (77%), Gaps = 1/171 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEK+  P S G + L++ + +DNP++TFNYFSHP+DL++CV G+ ++E ++ S
Sbjct  416  AFRGGFILEKVLGPLSTGHLELRSRDPDDNPSVTFNYFSHPEDLRRCVAGLSVIESVIHS  475

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K F NFT     +++ LLN+S    VNL+PRH +D+ SLE FCKDTV+TIWHYHGGC VG
Sbjct  476  KAFENFTYS-YFSMETLLNMSTGFPVNLLPRHDSDSTSLEMFCKDTVMTIWHYHGGCQVG  534

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRL  513
            +VV  +YRVLG   LRV+DGST   SPGTNPQAT++M+GRYMGV+I   RL
Sbjct  535  RVVDAEYRVLGVDALRVIDGSTFNASPGTNPQATVMMLGRYMGVRIQNERL  585



>ref|XP_004515792.1| PREDICTED: protein HOTHEAD-like [Cicer arietinum]
Length=589

 Score =   227 bits (579),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 130/171 (76%), Gaps = 1/171 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEK+  P S G + LK  +  +NP +TFNYF  P DL++CV G+ IVEK+++S
Sbjct  401  AFRGGFILEKVIGPISTGHLELKTRDPNENPLVTFNYFQDPQDLERCVKGLSIVEKVIES  460

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K FS F +     +  L N++A A VNL+P+HTN + SLEQFCKDTV+TIWHYHGGCHVG
Sbjct  461  KAFSQF-KYPNMPISVLRNLTASAPVNLLPKHTNSSLSLEQFCKDTVMTIWHYHGGCHVG  519

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRL  513
            KVV  DY+V+G   LRV+DGST   SPGTNPQAT++M+GRYMGVKIL  RL
Sbjct  520  KVVDRDYKVIGVDALRVIDGSTFNYSPGTNPQATVMMLGRYMGVKILNERL  570



>gb|KJB25747.1| hypothetical protein B456_004G207200 [Gossypium raimondii]
Length=334

 Score =   220 bits (561),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 129/172 (75%), Gaps = 1/172 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            FRGGFILEK+  P S G + L+  N  DNP++TFNYF  P DL++CV GI+ +EKI++SK
Sbjct  164  FRGGFILEKVMGPISTGHLELRTRNPNDNPSVTFNYFKDPQDLQRCVQGIQTIEKIIESK  223

Query  184  RFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVGK  363
             F  F + +  +   LLN++A A +NL+P+H N +  LE FCKDTV+TIWHYHGGC VGK
Sbjct  224  AFFRF-RYEFLSWPILLNMTANAPLNLLPKHYNPSMPLEVFCKDTVMTIWHYHGGCQVGK  282

Query  364  VVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGN  519
            VV  DY+VLG   LRV+DGST  +SPGTNPQAT++M+GRYMGVKIL  RL N
Sbjct  283  VVDLDYKVLGVDALRVIDGSTFNDSPGTNPQATVMMLGRYMGVKILSERLAN  334



>ref|XP_008358316.1| PREDICTED: protein HOTHEAD-like, partial [Malus domestica]
Length=337

 Score =   220 bits (561),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 128/173 (74%), Gaps = 1/173 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF GGFILEK+  P S G + L+  N  DNPA+TFNYF  P DL++CV GI  +EKI++S
Sbjct  162  AFXGGFILEKVMGPISTGHMELRTRNPNDNPAVTFNYFKEPQDLERCVQGIETIEKIIES  221

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K FS F + +  ++  LLN +A + VNL+P+H N ++SL+QFCKD V+TIWHYHGGC VG
Sbjct  222  KAFSKF-RYEGMSIAALLNATASSPVNLLPKHANASRSLDQFCKDXVMTIWHYHGGCQVG  280

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGN  519
            +VV  DY+VLG   LRV+DGST   SPGTNPQAT++M+GRYMG  IL  RL +
Sbjct  281  RVVDHDYKVLGVDALRVIDGSTFNYSPGTNPQATVMMLGRYMGKTILDERLAS  333



>ref|XP_011029158.1| PREDICTED: protein HOTHEAD [Populus euphratica]
Length=578

 Score =   226 bits (577),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 132/174 (76%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFILEKI  P S G + L+  + EDNP++TFNYF  P DL++CV GI  +EK++ S
Sbjct  401  AFQGGFILEKIMGPISTGHLELRTRHPEDNPSVTFNYFKEPQDLQRCVEGISTIEKVIDS  460

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K FS F + D  ++ +LLN++A A VNL+PRH N +QSLE FCKDTV+TIWHYHGGC VG
Sbjct  461  KPFSKF-RFDYLSVPQLLNMTASAPVNLLPRHYNSSQSLEDFCKDTVMTIWHYHGGCQVG  519

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNK  522
             VV  DY+V+G   LRV+DGST   +PGTNPQAT++M+GRYMGV IL+ RL  +
Sbjct  520  SVVDHDYKVMGVDALRVIDGSTFNFTPGTNPQATVMMLGRYMGVNILKERLARE  573



>gb|KHN34994.1| Protein HOTHEAD [Glycine soja]
Length=551

 Score =   226 bits (575),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 132/171 (77%), Gaps = 1/171 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI  P S G++ L+ ++  DNP+++FNYF  P DLK+CV GIR +EK+++S
Sbjct  376  AFRGGFILEKIMGPISTGELQLETSDPNDNPSVSFNYFKDPRDLKRCVQGIRTIEKVIES  435

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K FS F +    +   LLN++A + VNL+P+H+N   SLEQFC+DTV+TIWHYHGGC VG
Sbjct  436  KAFSRF-RYHNMSASVLLNMTANSPVNLLPKHSNTATSLEQFCRDTVMTIWHYHGGCQVG  494

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRL  513
            +VV   Y+V+G   LRV+DGST   SPGTNPQAT++M+GRYMGVKILR RL
Sbjct  495  RVVDARYKVIGVDALRVIDGSTFNCSPGTNPQATVMMLGRYMGVKILRERL  545



>gb|KDO63602.1| hypothetical protein CISIN_1g0092411mg, partial [Citrus sinensis]
Length=509

 Score =   225 bits (573),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 131/172 (76%), Gaps = 1/172 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            +RGGFI EKI  P S G + L+  N  D P++TFNYF  P+DL++CV GI  +EKI++SK
Sbjct  338  YRGGFIFEKIIGPVSTGHLELRTRNPNDTPSVTFNYFKEPEDLQRCVQGISTIEKIIESK  397

Query  184  RFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVGK  363
             FS F + D  +++ LLN++A   +NL+P+H+N + SLEQFC+DTV+TIWHYHGGC VGK
Sbjct  398  SFSKF-KYDNMSVETLLNMTASMPLNLLPKHSNTSTSLEQFCRDTVMTIWHYHGGCQVGK  456

Query  364  VVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGN  519
            VV  DY+VLG   LRVVDGST   SPGTNPQAT++M+GRYMGV+IL  RL +
Sbjct  457  VVDHDYKVLGVDALRVVDGSTFYYSPGTNPQATVMMLGRYMGVRILSERLAS  508



>gb|KDO63601.1| hypothetical protein CISIN_1g0092411mg, partial [Citrus sinensis]
Length=510

 Score =   224 bits (572),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 131/172 (76%), Gaps = 1/172 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            +RGGFI EKI  P S G + L+  N  D P++TFNYF  P+DL++CV GI  +EKI++SK
Sbjct  339  YRGGFIFEKIIGPVSTGHLELRTRNPNDTPSVTFNYFKEPEDLQRCVQGISTIEKIIESK  398

Query  184  RFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVGK  363
             FS F + D  +++ LLN++A   +NL+P+H+N + SLEQFC+DTV+TIWHYHGGC VGK
Sbjct  399  SFSKF-KYDNMSVETLLNMTASMPLNLLPKHSNTSTSLEQFCRDTVMTIWHYHGGCQVGK  457

Query  364  VVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGN  519
            VV  DY+VLG   LRVVDGST   SPGTNPQAT++M+GRYMGV+IL  RL +
Sbjct  458  VVDHDYKVLGVDALRVVDGSTFYYSPGTNPQATVMMLGRYMGVRILSERLAS  509



>gb|KJB25742.1| hypothetical protein B456_004G207200 [Gossypium raimondii]
 gb|KJB25743.1| hypothetical protein B456_004G207200 [Gossypium raimondii]
Length=391

 Score =   221 bits (564),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 129/172 (75%), Gaps = 1/172 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            FRGGFILEK+  P S G + L+  N  DNP++TFNYF  P DL++CV GI+ +EKI++SK
Sbjct  221  FRGGFILEKVMGPISTGHLELRTRNPNDNPSVTFNYFKDPQDLQRCVQGIQTIEKIIESK  280

Query  184  RFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVGK  363
             F  F + +  +   LLN++A A +NL+P+H N +  LE FCKDTV+TIWHYHGGC VGK
Sbjct  281  AFFRF-RYEFLSWPILLNMTANAPLNLLPKHYNPSMPLEVFCKDTVMTIWHYHGGCQVGK  339

Query  364  VVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGN  519
            VV  DY+VLG   LRV+DGST  +SPGTNPQAT++M+GRYMGVKIL  RL N
Sbjct  340  VVDLDYKVLGVDALRVIDGSTFNDSPGTNPQATVMMLGRYMGVKILSERLAN  391



>ref|XP_007040104.1| Glucose-methanol-choline oxidoreductase family protein isoform 
1 [Theobroma cacao]
 ref|XP_007040105.1| Glucose-methanol-choline oxidoreductase family protein isoform 
1 [Theobroma cacao]
 ref|XP_007040106.1| Glucose-methanol-choline oxidoreductase family protein isoform 
1 [Theobroma cacao]
 ref|XP_007040107.1| Glucose-methanol-choline oxidoreductase family protein isoform 
1 [Theobroma cacao]
 gb|EOY24605.1| Glucose-methanol-choline oxidoreductase family protein isoform 
1 [Theobroma cacao]
 gb|EOY24606.1| Glucose-methanol-choline oxidoreductase family protein isoform 
1 [Theobroma cacao]
 gb|EOY24607.1| Glucose-methanol-choline oxidoreductase family protein isoform 
1 [Theobroma cacao]
 gb|EOY24608.1| Glucose-methanol-choline oxidoreductase family protein isoform 
1 [Theobroma cacao]
Length=574

 Score =   226 bits (576),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 131/173 (76%), Gaps = 1/173 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI  P S G + L+  N+ DNP++TFNYF  P DL++CV GI+ ++KIV+S
Sbjct  403  AFRGGFILEKIMGPISTGHLELRTRNLNDNPSVTFNYFKDPQDLQRCVQGIQTIQKIVES  462

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K FS F + D  +   LLN++A A +NL+P+H N +  LE +CKDTV+TIWHYHGGC VG
Sbjct  463  KPFSKF-RFDYMSWPILLNMTASAPLNLLPKHYNPSMPLEVYCKDTVMTIWHYHGGCQVG  521

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGN  519
            +VV  DY+VLG   LRV+DGST   SPGTNPQAT++M+GRYMGVKIL  RL N
Sbjct  522  RVVDLDYKVLGVDALRVIDGSTFNYSPGTNPQATVMMLGRYMGVKILSERLAN  574



>ref|XP_002298074.1| glucose-methanol-choline oxidoreductase family protein [Populus 
trichocarpa]
 gb|EEE82879.1| glucose-methanol-choline oxidoreductase family protein [Populus 
trichocarpa]
Length=577

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 131/174 (75%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFILEKI  P S G + L+  + EDNP++TFNYF  P DL++CV GI  +EK++ S
Sbjct  401  AFQGGFILEKIMGPISTGHLELRTRHPEDNPSVTFNYFKEPQDLQRCVEGISTIEKVIDS  460

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + FS F + D  ++ +LLN++A A VNL+PRH N +QSLE FCKDTV+TIWHYHGGC  G
Sbjct  461  RPFSKF-RFDYLSVPQLLNMTASAPVNLLPRHYNSSQSLEDFCKDTVMTIWHYHGGCQAG  519

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNK  522
             VV  DY+V+G   LRV+DGST   SPGTNPQAT++M+GRYMGV IL+ RL  +
Sbjct  520  SVVDHDYKVMGVDALRVIDGSTFNVSPGTNPQATVMMLGRYMGVNILKERLAKE  573



>gb|KHN14126.1| Protein HOTHEAD [Glycine soja]
Length=582

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 131/172 (76%), Gaps = 1/172 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI  P S G + L+  +  DNP++TFNYF  P DL++CV G+  VEKI++S
Sbjct  401  AFRGGFILEKIMGPISSGHLELRTRDPNDNPSVTFNYFQDPRDLQRCVQGLSTVEKIIES  460

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K FS F +     +  LLN++A A VNL+P+HTN + SLEQ+C+DTV+TIWHYHGGC VG
Sbjct  461  KAFSPF-RYPNMPVPVLLNLTASAPVNLLPKHTNSSLSLEQYCRDTVMTIWHYHGGCQVG  519

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLG  516
            KV+  DY++LG   LRV+DGST   SPGTNPQAT++M+GRYMGVKIL  RLG
Sbjct  520  KVLDRDYKLLGVDALRVIDGSTFNYSPGTNPQATVMMLGRYMGVKILSERLG  571



>gb|AFK39106.1| unknown [Medicago truncatula]
Length=412

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 128/172 (74%), Gaps = 1/172 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            A RGGFILEK+  P S G + L+NT+  DNP +TFNYF  P DL++C+ G+  +EKI+ S
Sbjct  237  ALRGGFILEKVIGPISTGHLELRNTDPNDNPLVTFNYFQDPRDLERCIQGMGTIEKIIDS  296

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
              F+ F + +  +   LLN+ A A VNL+P+HTN + SLEQFC+DTV+TIWHYHGGC VG
Sbjct  297  NAFAPF-RYNNISFSMLLNMIANAQVNLLPKHTNTSMSLEQFCRDTVMTIWHYHGGCQVG  355

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLG  516
            +VV  DY+VLG   LRV+DGST    PGTNPQATL+M+GRYMGV+ILR RL 
Sbjct  356  RVVDNDYKVLGVDALRVIDGSTFNYFPGTNPQATLMMLGRYMGVRILRERLA  407



>gb|KDO63598.1| hypothetical protein CISIN_1g0081631mg, partial [Citrus sinensis]
Length=283

 Score =   217 bits (553),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 129/169 (76%), Gaps = 1/169 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEK+  P S G + L+  N  DNP++TFNYF  P+DL++CV GI  +EKI++S
Sbjct  105  AFRGGFILEKVMGPVSTGHLELRTRNPNDNPSVTFNYFKEPEDLQRCVQGISTIEKIIES  164

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K FS F + +  ++  L+N++A A VNL+PRH+N + SLEQFC+DTV+TIWHYHGGC VG
Sbjct  165  KSFSKF-KYESMSVPILVNMTASAPVNLLPRHSNASTSLEQFCRDTVMTIWHYHGGCQVG  223

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRH  507
            KVV  DY+VLG   LRV+DGST   SPGTNPQAT++M+GRY+ +   ++
Sbjct  224  KVVDHDYKVLGVDALRVIDGSTFYYSPGTNPQATVMMLGRYVNLTTSKY  272



>ref|XP_006477365.1| PREDICTED: protein HOTHEAD-like isoform X1 [Citrus sinensis]
Length=539

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 131/172 (76%), Gaps = 1/172 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            +RGGFI EKI  P S G + L+  N  D P++TFNYF  P+DL++CV GI  +EKI++SK
Sbjct  368  YRGGFIFEKIIGPVSTGHLELRTRNPNDTPSVTFNYFKEPEDLQRCVQGISTIEKIIESK  427

Query  184  RFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVGK  363
             FS F + D  +++ LLN++A   +NL+P+H+N + SLEQFC+DTV+TIWHYHGGC VGK
Sbjct  428  SFSKF-KYDNMSVETLLNMTASMPLNLLPKHSNTSTSLEQFCRDTVMTIWHYHGGCQVGK  486

Query  364  VVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGN  519
            VV  DY+VLG   LRVVDGST   SPGTNPQAT++M+GRYMGV+IL  RL +
Sbjct  487  VVDHDYKVLGVDALRVVDGSTFYYSPGTNPQATVMMLGRYMGVRILSERLAS  538



>ref|XP_006477366.1| PREDICTED: protein HOTHEAD-like isoform X2 [Citrus sinensis]
Length=538

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 131/172 (76%), Gaps = 1/172 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            +RGGFI EKI  P S G + L+  N  D P++TFNYF  P+DL++CV GI  +EKI++SK
Sbjct  367  YRGGFIFEKIIGPVSTGHLELRTRNPNDTPSVTFNYFKEPEDLQRCVQGISTIEKIIESK  426

Query  184  RFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVGK  363
             FS F + D  +++ LLN++A   +NL+P+H+N + SLEQFC+DTV+TIWHYHGGC VGK
Sbjct  427  SFSKF-KYDNMSVETLLNMTASMPLNLLPKHSNTSTSLEQFCRDTVMTIWHYHGGCQVGK  485

Query  364  VVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGN  519
            VV  DY+VLG   LRVVDGST   SPGTNPQAT++M+GRYMGV+IL  RL +
Sbjct  486  VVDHDYKVLGVDALRVVDGSTFYYSPGTNPQATVMMLGRYMGVRILSERLAS  537



>gb|KHG29300.1| Protein HOTHEAD -like protein [Gossypium arboreum]
Length=533

 Score =   224 bits (571),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 131/173 (76%), Gaps = 1/173 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            A +GGFILEKI  P S G + L+  N +DNP++TFNYF HP DL++CV GI+ + KIV+S
Sbjct  362  ALQGGFILEKIMGPISTGHLELQTRNPDDNPSVTFNYFQHPLDLQRCVQGIQTIGKIVES  421

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + FS F + D  +   L+N++  + +NL+PRH N +  LE FC+DTV+TIWHYHGGC V 
Sbjct  422  ESFSKF-RYDYMSWPGLVNMTEHSPINLLPRHYNSSIPLETFCRDTVMTIWHYHGGCQVS  480

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGN  519
            +VV PDY+VLG   LRV+DGST   SPGTNPQAT++M+GRYMGVKILR RLGN
Sbjct  481  RVVDPDYKVLGVEALRVIDGSTFNYSPGTNPQATVMMLGRYMGVKILRERLGN  533



>ref|XP_010919202.1| PREDICTED: protein HOTHEAD-like [Elaeis guineensis]
Length=582

 Score =   225 bits (573),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 132/171 (77%), Gaps = 1/171 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            FRGGFILEK+A P SRG + L+N N +DNP++TFNYF  P DL++C+ GI  +EK+V+SK
Sbjct  405  FRGGFILEKVAGPLSRGHLELRNRNPDDNPSVTFNYFKDPLDLQRCIKGIETIEKVVQSK  464

Query  184  RFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVGK  363
             FS F +    +++ LLN++A    N+IPRH ND++SL Q+CKDTV+TIWHYHGGC V +
Sbjct  465  AFSRF-RYPYISIEALLNMTANFPTNMIPRHDNDSKSLAQYCKDTVMTIWHYHGGCQVER  523

Query  364  VVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLG  516
            VV  DY+VLG   LRV+DGST   SPGTNPQAT++M+GRYMG++I   RLG
Sbjct  524  VVDYDYKVLGVDALRVIDGSTFNSSPGTNPQATVMMLGRYMGIRIQNERLG  574



>gb|ACR38765.1| unknown [Zea mays]
Length=293

 Score =   217 bits (553),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 126/170 (74%), Gaps = 1/170 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI  P S G + L++ +   NPA+TFNYF   +DL++CV GI+ +E++++S
Sbjct  122  AFRGGFILEKILGPVSSGHVELRSADPRANPAVTFNYFQESEDLQRCVRGIQTIERVIQS  181

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + F+NFT  +  T + +   SA   VNL+PRH ND+++ EQ+C+DTV+TIWHYHGGC VG
Sbjct  182  RAFANFTYANAST-ESIFTDSANFPVNLLPRHVNDSRTPEQYCRDTVMTIWHYHGGCQVG  240

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHR  510
             VV  DYRV G  RLRV+D ST   SPGTNPQAT++M+GRYMGVKI   R
Sbjct  241  AVVDDDYRVFGVQRLRVIDSSTFKYSPGTNPQATVMMLGRYMGVKIQAER  290



>gb|KJB52037.1| hypothetical protein B456_008G243300 [Gossypium raimondii]
Length=577

 Score =   224 bits (572),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 131/173 (76%), Gaps = 1/173 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            A +GGFILEKI  P S G + L+  N +DNP++TFNYF HP DL++CV GI+ + KIV+S
Sbjct  406  ALQGGFILEKIMGPISTGHLELQTRNPDDNPSVTFNYFQHPLDLQRCVQGIQTIGKIVES  465

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + FS F + D  +   L+N++  + +NL+PRH N +  LE FC+DTV+TIWHYHGGC V 
Sbjct  466  ESFSKF-RYDYMSWPGLVNMTEHSPINLLPRHYNSSIPLETFCRDTVMTIWHYHGGCQVS  524

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGN  519
            +VV PDY+VLG   LRV+DGST   SPGTNPQAT++M+GRYMGVKILR RLGN
Sbjct  525  RVVDPDYKVLGVEALRVIDGSTFNYSPGTNPQATVMMLGRYMGVKILRERLGN  577



>ref|XP_006590534.1| PREDICTED: protein HOTHEAD-like isoform X1 [Glycine max]
Length=581

 Score =   225 bits (573),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 132/171 (77%), Gaps = 1/171 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI  P S G++ L+ ++  DNP+++FNYF  P DL++CV GIR +EK+++S
Sbjct  406  AFRGGFILEKIMGPISTGELQLETSDPNDNPSVSFNYFKDPRDLRRCVQGIRTIEKVIES  465

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K FS F +    +   LLN++A + VNL+P+H+N   SLEQFC+DTV+TIWHYHGGC VG
Sbjct  466  KAFSRF-RYHNMSASVLLNMTANSPVNLLPKHSNTATSLEQFCRDTVMTIWHYHGGCQVG  524

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRL  513
            +VV   Y+V+G   LRV+DGST   SPGTNPQAT++M+GRYMGVKILR RL
Sbjct  525  RVVDARYKVIGVDALRVIDGSTFNCSPGTNPQATVMMLGRYMGVKILRERL  575



>ref|XP_006590535.1| PREDICTED: protein HOTHEAD-like isoform X2 [Glycine max]
Length=579

 Score =   224 bits (572),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 132/171 (77%), Gaps = 1/171 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI  P S G++ L+ ++  DNP+++FNYF  P DL++CV GIR +EK+++S
Sbjct  404  AFRGGFILEKIMGPISTGELQLETSDPNDNPSVSFNYFKDPRDLRRCVQGIRTIEKVIES  463

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K FS F +    +   LLN++A + VNL+P+H+N   SLEQFC+DTV+TIWHYHGGC VG
Sbjct  464  KAFSRF-RYHNMSASVLLNMTANSPVNLLPKHSNTATSLEQFCRDTVMTIWHYHGGCQVG  522

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRL  513
            +VV   Y+V+G   LRV+DGST   SPGTNPQAT++M+GRYMGVKILR RL
Sbjct  523  RVVDARYKVIGVDALRVIDGSTFNCSPGTNPQATVMMLGRYMGVKILRERL  573



>ref|XP_010108049.1| Protein HOTHEAD [Morus notabilis]
 gb|EXC17781.1| Protein HOTHEAD [Morus notabilis]
Length=580

 Score =   224 bits (571),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 131/171 (77%), Gaps = 1/171 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGF+LEKI  P S G + L+  N  DNPA+TFNYF    DL++CV GI  +E+I++S
Sbjct  405  AFRGGFLLEKIMGPISTGHLELRTRNPNDNPAVTFNYFKETLDLQRCVQGISTIERIIES  464

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K FS F + D  ++  LLN++A + +NL+P+H N + SLEQFCKDTV+TIWHYHGGC VG
Sbjct  465  KSFSRF-RYDYMSVPTLLNMTASSPINLLPKHANSSTSLEQFCKDTVMTIWHYHGGCQVG  523

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRL  513
            +VV  DY+VLG   LRV+DGST + SPGTNPQAT++M+GRYMGV+IL  RL
Sbjct  524  RVVDTDYKVLGVDALRVIDGSTFSYSPGTNPQATVMMLGRYMGVRILGERL  574



>ref|NP_001154469.1| embryo sac development arrest 17 [Arabidopsis thaliana]
 gb|AEE35398.1| embryo sac development arrest 17 [Arabidopsis thaliana]
Length=567

 Score =   224 bits (570),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 127/177 (72%), Gaps = 27/177 (15%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF G FILEK+A P SRG + L NTNV+DNP++TFNYF HP                   
Sbjct  418  AFNGSFILEKLAYPISRGHLSLVNTNVDDNPSVTFNYFKHP-------------------  458

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
                    CDK+ + ++L++S +AN+NL P+  NDT+S+ QFCKDTV+TIWHYHGGC VG
Sbjct  459  --------CDKQNVHKMLSLSVKANINLRPKQLNDTKSMAQFCKDTVVTIWHYHGGCLVG  510

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            KVV P+ +VLG  RLRV+DGST  ESPGTNPQAT++MMGRYMGVKILR RLGNKAGV
Sbjct  511  KVVSPNRKVLGVDRLRVIDGSTFDESPGTNPQATMMMMGRYMGVKILRERLGNKAGV  567



>ref|XP_007155569.1| hypothetical protein PHAVU_003G213000g [Phaseolus vulgaris]
 gb|ESW27563.1| hypothetical protein PHAVU_003G213000g [Phaseolus vulgaris]
Length=583

 Score =   224 bits (570),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 133/176 (76%), Gaps = 1/176 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI  P S G + L++ +   NP++TFNYF  P DL++CV G+ +VEKI++S
Sbjct  401  AFRGGFILEKIMGPISTGHLELRSRDPNQNPSVTFNYFQEPQDLERCVQGLSVVEKIIES  460

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K F+ F +     +  LLN++A + VNL+P+HTN + SL+QFC+DTV+TIWHYHGGC VG
Sbjct  461  KAFAPF-RYPNMPVSVLLNMTANSPVNLLPKHTNSSLSLQQFCRDTVMTIWHYHGGCQVG  519

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAG  528
            +VV  DY+VLG   LRV+DGST   SPGTNPQAT++M+GRYMG++IL  RLG  A 
Sbjct  520  RVVDRDYKVLGVDALRVIDGSTFNYSPGTNPQATVMMLGRYMGLQILSQRLGAPAA  575



>ref|XP_003611165.1| Choline dehydrogenase [Medicago truncatula]
 gb|AES94123.1| glucose-methanol-choline (GMC) oxidoreductase family protein 
[Medicago truncatula]
Length=580

 Score =   223 bits (569),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 129/171 (75%), Gaps = 1/171 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            A RGGFILEK+  P S G + L+NT+  DNP +TFNYF  P DL++C+ G+  +EKI+ S
Sbjct  405  ALRGGFILEKVIGPISTGHLELRNTDPNDNPLVTFNYFQDPRDLERCIQGMGTIEKIIDS  464

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
              F+ F + +  +   LLN+ A A VNL+P+HTN + SLEQFC+DTV+TIWHYHGGC VG
Sbjct  465  NAFAPF-RYNNISFSMLLNMIANAQVNLLPKHTNTSMSLEQFCRDTVMTIWHYHGGCQVG  523

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRL  513
            +VV  DY+VLG   LRV+DGST   SPGTNPQATL+M+GRYMGV+ILR RL
Sbjct  524  RVVDNDYKVLGVDALRVIDGSTFNYSPGTNPQATLMMLGRYMGVRILRERL  574



>ref|XP_003549865.1| PREDICTED: protein HOTHEAD-like [Glycine max]
Length=581

 Score =   223 bits (569),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 130/171 (76%), Gaps = 1/171 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI  P S G + L+  +  DNP++TFNYF  P DL++CV G+  VEKI++S
Sbjct  401  AFRGGFILEKIMGPISSGHLELRTRDPNDNPSVTFNYFQDPRDLQRCVQGLSTVEKIIES  460

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K FS F +     +  LLN++A A VNL+P+HTN + SLEQ+C+DTV+TIWHYHGGC VG
Sbjct  461  KAFSPF-RYPNMPVPVLLNLTASAPVNLLPKHTNSSLSLEQYCRDTVMTIWHYHGGCQVG  519

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRL  513
            KV+  DY++LG   LRV+DGST   SPGTNPQAT++M+GRYMGVKIL  RL
Sbjct  520  KVLDRDYKLLGVDALRVIDGSTFNYSPGTNPQATVMMLGRYMGVKILSERL  570



>ref|XP_008245837.1| PREDICTED: protein HOTHEAD-like [Prunus mume]
Length=576

 Score =   223 bits (568),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 131/173 (76%), Gaps = 1/173 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEK+  P S G + L+  N  DNP++TFNYF  P DL++C+ GI  +EKI++S
Sbjct  402  AFRGGFILEKVMGPISTGHLELRTRNPNDNPSVTFNYFKDPQDLERCIQGIETIEKIIES  461

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K FS F + D  +L  LLNI+A + +NL+P+H N ++SL+QFCKDTV+TIWHYHGGC VG
Sbjct  462  KPFSKF-RYDYLSLAALLNITANSPINLLPKHANASRSLDQFCKDTVMTIWHYHGGCQVG  520

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGN  519
            +VV   Y+VLG   LRV+DGST   SPGTNPQAT++M+GRYMG +IL  RL +
Sbjct  521  RVVDYQYKVLGVDALRVIDGSTFIYSPGTNPQATVMMLGRYMGKRILDERLAS  573



>ref|XP_004973379.1| PREDICTED: protein HOTHEAD-like isoform X1 [Setaria italica]
Length=619

 Score =   224 bits (570),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 126/162 (78%), Gaps = 1/162 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            F GGFILEKI  P S G ++L +T+V+ NP++TFNYF HP DL +CV GI+ +EKI+K+ 
Sbjct  408  FDGGFILEKIDGPLSTGNLVLVDTDVDSNPSVTFNYFQHPKDLSRCVYGIKTIEKILKTN  467

Query  184  RFSNFTQCDK-ETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
             F+N T       ++ LLN+S  AN+NLIP+HT+DT SLEQFC+DTV TIWHYHGGCHVG
Sbjct  468  HFTNLTANGAGYPMETLLNMSVSANINLIPKHTDDTTSLEQFCRDTVTTIWHYHGGCHVG  527

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYM  486
            KVV   YRV+G   LRVVDGSTL  SPGTNPQAT+LMMGRYM
Sbjct  528  KVVDQQYRVIGISGLRVVDGSTLFRSPGTNPQATVLMMGRYM  569



>gb|KJB25740.1| hypothetical protein B456_004G207200 [Gossypium raimondii]
 gb|KJB25746.1| hypothetical protein B456_004G207200 [Gossypium raimondii]
Length=548

 Score =   221 bits (564),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 129/172 (75%), Gaps = 1/172 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            FRGGFILEK+  P S G + L+  N  DNP++TFNYF  P DL++CV GI+ +EKI++SK
Sbjct  378  FRGGFILEKVMGPISTGHLELRTRNPNDNPSVTFNYFKDPQDLQRCVQGIQTIEKIIESK  437

Query  184  RFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVGK  363
             F  F + +  +   LLN++A A +NL+P+H N +  LE FCKDTV+TIWHYHGGC VGK
Sbjct  438  AFFRF-RYEFLSWPILLNMTANAPLNLLPKHYNPSMPLEVFCKDTVMTIWHYHGGCQVGK  496

Query  364  VVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGN  519
            VV  DY+VLG   LRV+DGST  +SPGTNPQAT++M+GRYMGVKIL  RL N
Sbjct  497  VVDLDYKVLGVDALRVIDGSTFNDSPGTNPQATVMMLGRYMGVKILSERLAN  548



>ref|XP_004300752.1| PREDICTED: protein HOTHEAD [Fragaria vesca subsp. vesca]
Length=573

 Score =   222 bits (565),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 130/172 (76%), Gaps = 1/172 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFILEKI  P S G + L+  N  DNP++TFNYF  P DL++CV G+R +EK+V+S
Sbjct  398  AFKGGFILEKILGPVSTGHLELQTLNPNDNPSVTFNYFQDPVDLERCVQGLRTIEKLVES  457

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K FSNF + D  ++  LLN + +A +NL+P+H N ++SLEQFCKDTV+TIWHYHGGC VG
Sbjct  458  KAFSNF-RFDNMSIPTLLNNTVRAPINLLPKHENSSRSLEQFCKDTVMTIWHYHGGCQVG  516

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLG  516
            +VV   Y+VLG   LRV+DGST   SPGTNPQAT++M+GRYMG  IL  RL 
Sbjct  517  RVVDQQYKVLGVDALRVIDGSTFNYSPGTNPQATVMMLGRYMGQIILNERLA  568



>ref|XP_009377909.1| PREDICTED: protein HOTHEAD [Pyrus x bretschneideri]
Length=577

 Score =   222 bits (565),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 129/173 (75%), Gaps = 1/173 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFILEK+  P S G + L+  N  DNPA+TFNYF  P DL++CV GI  +EKI+ S
Sbjct  402  AFKGGFILEKVMGPISTGHMELRTRNPNDNPAVTFNYFKEPQDLERCVQGIETIEKIIDS  461

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K FS F + +  ++  LLN +A + VNL+P+H N ++SL+QFCKDTV+TIWHYHGGC VG
Sbjct  462  KAFSKF-RYEGMSIAALLNATANSPVNLLPKHANASRSLDQFCKDTVMTIWHYHGGCQVG  520

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGN  519
            +VV  DY+VLG   LRV+DGST   SPGTNPQAT++M+GRYMG  IL  RL +
Sbjct  521  RVVDHDYKVLGVDALRVIDGSTFNYSPGTNPQATVMMLGRYMGKTILDERLAS  573



>ref|XP_007209039.1| hypothetical protein PRUPE_ppa003422mg [Prunus persica]
 gb|EMJ10238.1| hypothetical protein PRUPE_ppa003422mg [Prunus persica]
Length=576

 Score =   221 bits (564),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 131/173 (76%), Gaps = 1/173 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEK+  P S G + L+  N  DNP++TFNYF  P DL++C+ G+  +EKI++S
Sbjct  402  AFRGGFILEKVMGPISTGHLELRTRNPNDNPSVTFNYFKDPQDLERCIQGLETIEKIIES  461

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K FS F + D  +L  LLNI+A + +NL+P+H N ++SL+QFCKDTV+TIWHYHGGC VG
Sbjct  462  KPFSKF-RYDYLSLAALLNITANSPINLLPKHANVSRSLDQFCKDTVMTIWHYHGGCQVG  520

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGN  519
            +VV   Y+VLG   LRV+DGST   SPGTNPQAT++M+GRYMG +IL  RL +
Sbjct  521  RVVDYQYKVLGVDALRVIDGSTFIYSPGTNPQATVMMLGRYMGKRILDERLAS  573



>gb|KHG26487.1| Protein HOTHEAD [Gossypium arboreum]
Length=552

 Score =   221 bits (563),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 129/172 (75%), Gaps = 1/172 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            FRGGFILEK+  P S G + L+  N  DNP++TFNYF  P DL++CV GI+ +EKI++SK
Sbjct  382  FRGGFILEKVMGPISTGHLELRTRNPNDNPSVTFNYFKDPQDLQRCVQGIQTIEKIIESK  441

Query  184  RFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVGK  363
             F  F + +  +   LLN++A A +NL+P+H N +  LE FCKDTV+TIWHYHGGC VGK
Sbjct  442  AFFRF-RYEFLSWPILLNMTANAPLNLLPKHYNPSMPLEVFCKDTVMTIWHYHGGCQVGK  500

Query  364  VVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGN  519
            VV  DY+VLG   LRV+DGST  +SPGTNPQAT++M+GRYMGVKIL  R+ N
Sbjct  501  VVDLDYKVLGVDALRVIDGSTFNDSPGTNPQATVMMLGRYMGVKILSERIAN  552



>gb|ACN31684.1| unknown [Zea mays]
 gb|AFW72794.1| protein HOTHEAD [Zea mays]
Length=576

 Score =   221 bits (564),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 129/171 (75%), Gaps = 1/171 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            A RGGFILEK+  P S GQ+ L+N N +DNP++ FNYF+HPDDL++CV GI  +E++++S
Sbjct  403  ALRGGFILEKVLGPQSVGQLALRNLNPDDNPSVRFNYFAHPDDLRRCVAGIAAIERVIRS  462

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + FS FT          LN++A+  VN + R   D ++LE+FC+DTV+TIWHYHGGC VG
Sbjct  463  RAFSRFTY-QNFAFPAALNVTAEFPVNTLYRRGGDPRALERFCRDTVMTIWHYHGGCQVG  521

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRL  513
            +VV  DYRVLG   LRV+DGST   SPGTNPQAT++M+GRYMGVK+L+ R+
Sbjct  522  RVVDRDYRVLGVDALRVIDGSTFNASPGTNPQATVMMLGRYMGVKLLKERM  572



>gb|KHG26488.1| Protein HOTHEAD [Gossypium arboreum]
Length=548

 Score =   221 bits (562),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 129/172 (75%), Gaps = 1/172 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            FRGGFILEK+  P S G + L+  N  DNP++TFNYF  P DL++CV GI+ +EKI++SK
Sbjct  378  FRGGFILEKVMGPISTGHLELRTRNPNDNPSVTFNYFKDPQDLQRCVQGIQTIEKIIESK  437

Query  184  RFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVGK  363
             F  F + +  +   LLN++A A +NL+P+H N +  LE FCKDTV+TIWHYHGGC VGK
Sbjct  438  AFFRF-RYEFLSWPILLNMTANAPLNLLPKHYNPSMPLEVFCKDTVMTIWHYHGGCQVGK  496

Query  364  VVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGN  519
            VV  DY+VLG   LRV+DGST  +SPGTNPQAT++M+GRYMGVKIL  R+ N
Sbjct  497  VVDLDYKVLGVDALRVIDGSTFNDSPGTNPQATVMMLGRYMGVKILSERIAN  548



>ref|NP_001149739.1| protein HOTHEAD precursor [Zea mays]
 gb|ACG36616.1| protein HOTHEAD precursor [Zea mays]
Length=576

 Score =   221 bits (562),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 129/171 (75%), Gaps = 1/171 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            A RGGFILEK+  P S GQ+ L+N N +DNP++ FNYF+HPDDL++CV GI  +E++++S
Sbjct  403  ALRGGFILEKVLGPQSVGQLALRNLNPDDNPSVRFNYFAHPDDLRRCVAGIAAIERVIRS  462

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + FS FT          LN++A+  VN + R   D ++LE+FC+DTV+TIWHYHGGC VG
Sbjct  463  RAFSRFTY-QNFAFPAALNVTAEFPVNTLYRRGGDPRALERFCRDTVMTIWHYHGGCQVG  521

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRL  513
            +VV  DYRVLG   LRV+DGST   SPGTNPQAT++M+GRYMGVK+L+ R+
Sbjct  522  RVVDRDYRVLGVDALRVIDGSTFNASPGTNPQATVMMLGRYMGVKLLKERM  572



>gb|EPS60348.1| hypothetical protein M569_14454 [Genlisea aurea]
Length=564

 Score =   220 bits (561),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 128/165 (78%), Gaps = 1/165 (1%)
 Frame = +1

Query  16   FILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSKRFSN  195
            F+LEKI  P S+G + LKN N  DNP++TFNYFSHP D+++CV G++++  +++SK FS 
Sbjct  399  FVLEKIMGPLSKGYLELKNKNPNDNPSVTFNYFSHPVDVQRCVEGLKVMTSVLESKAFSP  458

Query  196  FTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVGKVVGP  375
            F   D   +  LL+I A A +NL  +H N T SLEQFCKDTV+TIWHYHGGC VGKVV  
Sbjct  459  FKYRDM-NVSLLLDIVASAPINLRAKHPNTTTSLEQFCKDTVMTIWHYHGGCEVGKVVDS  517

Query  376  DYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHR  510
            DY+V+G  RLRV+DGST +ESPGTNPQAT++M+GRYMGVKILR R
Sbjct  518  DYKVMGVDRLRVIDGSTFSESPGTNPQATVMMLGRYMGVKILRGR  562



>ref|XP_008437197.1| PREDICTED: protein HOTHEAD [Cucumis melo]
Length=578

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 129/171 (75%), Gaps = 1/171 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI  P S G + L+  +  DNP++TFNYF  P DL +CV GI ++ +I+ S
Sbjct  403  AFRGGFILEKIMGPISSGHLELRTRDPNDNPSVTFNYFKEPTDLHRCVAGINLIRRIIDS  462

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K FS F + +  ++  LLN++A A +NL+P+H N T+S EQ+C+DTV+TIWHYHGGC  G
Sbjct  463  KSFSRF-RYNNVSVATLLNMTASAPINLLPKHENLTRSPEQYCRDTVMTIWHYHGGCQTG  521

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRL  513
             VV  DYRVLG   LRVVDGST  +SPGTNPQAT++M+GRYMGV+ILR RL
Sbjct  522  AVVDRDYRVLGVDSLRVVDGSTFHDSPGTNPQATVMMLGRYMGVRILRERL  572



>ref|NP_001168618.1| uncharacterized protein LOC100382402 [Zea mays]
 gb|ACN28873.1| unknown [Zea mays]
Length=496

 Score =   217 bits (553),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 126/170 (74%), Gaps = 1/170 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI  P S G + L++ +   NPA+TFNYF   +DL++CV GI+ +E++++S
Sbjct  325  AFRGGFILEKILGPVSSGHVELRSADPRANPAVTFNYFQESEDLQRCVRGIQTIERVIQS  384

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + F+NFT  +  T + +   SA   VNL+PRH ND+++ EQ+C+DTV+TIWHYHGGC VG
Sbjct  385  RAFANFTYANAST-ESIFTDSANFPVNLLPRHVNDSRTPEQYCRDTVMTIWHYHGGCQVG  443

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHR  510
             VV  DYRV G  RLRV+D ST   SPGTNPQAT++M+GRYMGVKI   R
Sbjct  444  AVVDDDYRVFGVQRLRVIDSSTFKYSPGTNPQATVMMLGRYMGVKIQAER  493



>gb|AAF65820.1|AF251031_1 putative mandelonitrile lyase [Oryza sativa]
Length=589

 Score =   219 bits (558),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 127/170 (75%), Gaps = 1/170 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI  P S G + L+ T+   NP++TFNYF   +DL++CV+GI  +E++++S
Sbjct  418  AFRGGFILEKILGPVSSGHVELRTTDPRANPSVTFNYFREAEDLERCVHGIETIERVIQS  477

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + FSNFT  +  +++ +   SA   VNL+PRH ND++S EQ+C DTV+TIWHYHGGCHVG
Sbjct  478  RAFSNFTYANA-SVESIFTDSANFPVNLLPRHVNDSRSPEQYCMDTVMTIWHYHGGCHVG  536

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHR  510
             VV  DYRV G H LRV+D ST   SPGTNPQAT++M+GRYMGVKI   R
Sbjct  537  AVVDDDYRVFGVHGLRVIDSSTFKYSPGTNPQATVMMLGRYMGVKIQSER  586



>gb|KDP25523.1| hypothetical protein JCGZ_20679 [Jatropha curcas]
Length=574

 Score =   218 bits (555),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 126/171 (74%), Gaps = 3/171 (2%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI  P S G + L   N  DNP++TFNYF  P DL++C+ GI  +EK++ S
Sbjct  400  AFRGGFILEKIMGPISTGHLELITRNPNDNPSVTFNYFKEPQDLQRCMEGISTIEKVIDS  459

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + F+ F      ++ +LLN++A   VNL+P+H N + SLEQFCKDTV+TIWHYHGGC VG
Sbjct  460  QPFAKFRNM---SVPQLLNLTANFPVNLLPKHYNTSMSLEQFCKDTVMTIWHYHGGCQVG  516

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRL  513
             VV  +Y+V+G   LRV+DGST   SPGTNPQAT++M+GRYMGVKIL  RL
Sbjct  517  SVVDTNYKVIGVDALRVIDGSTFNASPGTNPQATVMMLGRYMGVKILSERL  567



>ref|XP_006440516.1| hypothetical protein CICLE_v10019427mg [Citrus clementina]
 gb|ESR53756.1| hypothetical protein CICLE_v10019427mg [Citrus clementina]
Length=583

 Score =   218 bits (554),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 129/169 (76%), Gaps = 1/169 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEK+  P S G + L+  N  DNP++TFNYF  P+DL++CV GI  +EKI++S
Sbjct  405  AFRGGFILEKVMGPVSTGHLELRTRNPNDNPSVTFNYFKEPEDLQRCVQGISTIEKIIES  464

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K FS F + +  ++  L+N++A A VNL+PRH+N + SLEQFC+DTV+TIWHYHGGC VG
Sbjct  465  KSFSKF-KYESMSVPTLVNMTASAPVNLLPRHSNSSTSLEQFCRDTVMTIWHYHGGCQVG  523

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRH  507
            KVV  DY+VLG   LRV+DGST   SPGTNPQAT++M+GRY+ +   ++
Sbjct  524  KVVDHDYKVLGVDALRVIDGSTFYYSPGTNPQATVMMLGRYVNLTTSKY  572



>ref|XP_004983866.1| PREDICTED: protein HOTHEAD-like [Setaria italica]
Length=581

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 127/170 (75%), Gaps = 1/170 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI  P S G I L++T+   NPA+TFNYF   +DL +CV+GI  +E++++S
Sbjct  410  AFRGGFILEKILGPVSSGHIELRSTDPRANPAVTFNYFQEKEDLDRCVHGIETIERVIQS  469

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + F+NFT  +  +++ +   SA   VNL+PRH ND+++ EQ+C+DTV+TIWHYHGGC VG
Sbjct  470  RAFANFTYANA-SVESIFTDSANFPVNLLPRHANDSRTPEQYCRDTVMTIWHYHGGCQVG  528

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHR  510
             VV  DYRV G  RLRV+D ST   SPGTNPQAT++M+GRYMGVKI   R
Sbjct  529  AVVDDDYRVFGVQRLRVIDSSTFKYSPGTNPQATVMMLGRYMGVKIQAER  578



>ref|XP_004159980.1| PREDICTED: protein HOTHEAD-like [Cucumis sativus]
Length=580

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 128/171 (75%), Gaps = 1/171 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI  P S G + L+  +  DNP++TFNYF  P DL +CV GI ++ +I+ S
Sbjct  403  AFRGGFILEKIMGPISSGHLELRTRDPNDNPSVTFNYFKEPTDLHRCVAGINLIRRIIDS  462

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K FS F + D  ++  LLN++A A +NL+P+H N ++S EQ+C+DTV+TIWHYHGGC  G
Sbjct  463  KSFSRF-RYDNVSVATLLNMTASAPINLLPKHENLSRSPEQYCRDTVMTIWHYHGGCQTG  521

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRL  513
             VV  DYRV G   LRVVDGST  +SPGTNPQAT++M+GRY+GV+ILR RL
Sbjct  522  AVVDRDYRVFGVDSLRVVDGSTFHDSPGTNPQATVMMLGRYVGVRILRERL  572



>ref|XP_004143995.1| PREDICTED: protein HOTHEAD-like [Cucumis sativus]
 gb|KGN50152.1| hypothetical protein Csa_5G156120 [Cucumis sativus]
Length=578

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 128/171 (75%), Gaps = 1/171 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI  P S G + L+  +  DNP++TFNYF  P DL +CV GI ++ +I+ S
Sbjct  403  AFRGGFILEKIMGPISSGHLELRTRDPNDNPSVTFNYFKEPTDLHRCVAGINLIRRIIDS  462

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K FS F + D  ++  LLN++A A +NL+P+H N ++S EQ+C+DTV+TIWHYHGGC  G
Sbjct  463  KSFSRF-RYDNVSVATLLNMTASAPINLLPKHENLSRSPEQYCRDTVMTIWHYHGGCQTG  521

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRL  513
             VV  DYRV G   LRVVDGST  +SPGTNPQAT++M+GRY+GV+ILR RL
Sbjct  522  AVVDRDYRVFGVDSLRVVDGSTFHDSPGTNPQATVMMLGRYVGVRILRERL  572



>ref|XP_010533726.1| PREDICTED: protein HOTHEAD [Tarenaya hassleriana]
Length=579

 Score =   217 bits (553),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 132/174 (76%), Gaps = 2/174 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFILEK+  P S G + L+  N  DNP +TFNYF  P DLK+CV GI+ + K+++S
Sbjct  404  AFQGGFILEKVMGPLSTGHLELRTRNPNDNPTVTFNYFRDPLDLKRCVLGIQAIAKVIQS  463

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K F+ F   D  + + LLN +A A VN++PRH +D+ +LE+FC+DTV+TIWHYHGGCHVG
Sbjct  464  KAFTEFKFTDM-SFEYLLNHTASAPVNVLPRH-HDSATLERFCRDTVMTIWHYHGGCHVG  521

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNK  522
            +VV  DYRV G  RLRV+D ST++  PGTNPQAT++M+GRYMGVKILR RL  +
Sbjct  522  RVVDRDYRVFGVDRLRVIDMSTVSYCPGTNPQATVMMLGRYMGVKILRGRLAKE  575



>ref|XP_002467623.1| hypothetical protein SORBIDRAFT_01g031110 [Sorghum bicolor]
 gb|EER94621.1| hypothetical protein SORBIDRAFT_01g031110 [Sorghum bicolor]
Length=582

 Score =   217 bits (553),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 128/170 (75%), Gaps = 1/170 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI  P S G I L++ +   NPA+TFNYF   +DL++CV+GI+ +E++++S
Sbjct  411  AFRGGFILEKILGPVSSGHIELRSADPRANPAVTFNYFQESEDLERCVHGIQTIERVIQS  470

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + F+NFT  +  +++ +   SA   VNL+PRH ND+++ EQ+C+DTV+TIWHYHGGC VG
Sbjct  471  RAFANFTYANA-SVESIFTDSANFPVNLLPRHVNDSRTPEQYCRDTVMTIWHYHGGCQVG  529

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHR  510
             VV  DYRV G  RLRV+D ST   SPGTNPQAT++M+GRYMGVKI   R
Sbjct  530  AVVDDDYRVFGVQRLRVIDSSTFKYSPGTNPQATVMMLGRYMGVKIQAQR  579



>tpg|DAA46009.1| TPA: hypothetical protein ZEAMMB73_516201 [Zea mays]
Length=582

 Score =   217 bits (553),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 126/170 (74%), Gaps = 1/170 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI  P S G + L++ +   NPA+TFNYF   +DL++CV GI+ +E++++S
Sbjct  411  AFRGGFILEKILGPVSSGHVELRSADPRANPAVTFNYFQESEDLQRCVRGIQTIERVIQS  470

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + F+NFT  +  T + +   SA   VNL+PRH ND+++ EQ+C+DTV+TIWHYHGGC VG
Sbjct  471  RAFANFTYANAST-ESIFTDSANFPVNLLPRHVNDSRTPEQYCRDTVMTIWHYHGGCQVG  529

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHR  510
             VV  DYRV G  RLRV+D ST   SPGTNPQAT++M+GRYMGVKI   R
Sbjct  530  AVVDDDYRVFGVQRLRVIDSSTFKYSPGTNPQATVMMLGRYMGVKIQAER  579



>gb|EMT00670.1| Protein HOTHEAD [Aegilops tauschii]
Length=562

 Score =   216 bits (550),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 128/170 (75%), Gaps = 1/170 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI  P S G I L++T+   NPA+TFNYF   +DL++CV GI+ +E++++S
Sbjct  391  AFRGGFILEKILGPVSTGHIELRSTDPRANPAVTFNYFQEAEDLERCVRGIQTIERVIQS  450

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + FSNFT  +  T++ +   SA   VNL+PRH ND++S EQ+C++TV+TIWHYHGGCHVG
Sbjct  451  RAFSNFTYANT-TVESIFTDSANFPVNLLPRHVNDSRSPEQYCRETVMTIWHYHGGCHVG  509

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHR  510
             VV  +YRV G   LRV+D ST   SPGTNPQAT++M+GRYMG+KI   R
Sbjct  510  AVVDDNYRVFGVRGLRVIDSSTFRYSPGTNPQATVMMLGRYMGIKIQAER  559



>gb|EAY79265.1| hypothetical protein OsI_34381 [Oryza sativa Indica Group]
Length=588

 Score =   216 bits (551),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 126/170 (74%), Gaps = 1/170 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI  P S G + L+ T+   NP++TFNYF   +DL++CV+GI  +E++++S
Sbjct  417  AFRGGFILEKILGPVSSGHVELRTTDPRANPSVTFNYFREAEDLERCVHGIETIERVIQS  476

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + FSNFT  +  +++ +   SA   VNL+PRH ND++S EQ+C DTV+TIWHYHGGCHVG
Sbjct  477  RAFSNFTYANA-SVESIFTDSANFPVNLLPRHVNDSRSPEQYCMDTVMTIWHYHGGCHVG  535

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHR  510
             VV  DYRV G   LRV+D ST   SPGTNPQAT++M+GRYMGVKI   R
Sbjct  536  AVVDDDYRVFGVQGLRVIDSSTFKYSPGTNPQATVMMLGRYMGVKIQSER  585



>ref|XP_006661974.1| PREDICTED: protein HOTHEAD-like [Oryza brachyantha]
Length=585

 Score =   216 bits (551),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 125/170 (74%), Gaps = 1/170 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI  P S G I L+  +   NPA+TFNYF   +DL++CV+G+  +E++++S
Sbjct  414  AFRGGFILEKILGPVSSGHIELRTADPRANPAVTFNYFREAEDLERCVHGVETIERVIQS  473

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + FSNFT  +  +++ +   SA   VNL+PRH ND++S EQ+CKDTV+TIWHYHGGCHVG
Sbjct  474  RAFSNFTYANA-SVESIFTDSANFPVNLLPRHANDSRSPEQYCKDTVMTIWHYHGGCHVG  532

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHR  510
             VV  DYRV G   LRV+D ST   SPGTNPQA ++M+GRYMGVKI   R
Sbjct  533  AVVDDDYRVFGVQGLRVIDSSTFKYSPGTNPQAPVMMLGRYMGVKIQAER  582



>ref|NP_001065107.1| Os10g0524500 [Oryza sativa Japonica Group]
 gb|AAO00719.1| putative mandelonitrile lyase [Oryza sativa Japonica Group]
 gb|AAP54703.1| HOTHEAD protein precursor, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF27021.1| Os10g0524500 [Oryza sativa Japonica Group]
 gb|EAZ16737.1| hypothetical protein OsJ_32214 [Oryza sativa Japonica Group]
 dbj|BAG95029.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99694.1| unnamed protein product [Oryza sativa Japonica Group]
Length=586

 Score =   216 bits (551),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 126/170 (74%), Gaps = 1/170 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI  P S G + L+ T+   NP++TFNYF   +DL++CV+GI  +E++++S
Sbjct  415  AFRGGFILEKILGPVSSGHVELRTTDPRANPSVTFNYFREAEDLERCVHGIETIERVIQS  474

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + FSNFT  +  +++ +   SA   VNL+PRH ND++S EQ+C DTV+TIWHYHGGCHVG
Sbjct  475  RAFSNFTYANA-SVESIFTDSANFPVNLLPRHVNDSRSPEQYCMDTVMTIWHYHGGCHVG  533

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHR  510
             VV  DYRV G   LRV+D ST   SPGTNPQAT++M+GRYMGVKI   R
Sbjct  534  AVVDDDYRVFGVQGLRVIDSSTFKYSPGTNPQATVMMLGRYMGVKIQSER  583



>tpg|DAA46010.1| TPA: hypothetical protein ZEAMMB73_516201 [Zea mays]
Length=608

 Score =   217 bits (552),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 126/170 (74%), Gaps = 1/170 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI  P S G + L++ +   NPA+TFNYF   +DL++CV GI+ +E++++S
Sbjct  437  AFRGGFILEKILGPVSSGHVELRSADPRANPAVTFNYFQESEDLQRCVRGIQTIERVIQS  496

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + F+NFT  +  T + +   SA   VNL+PRH ND+++ EQ+C+DTV+TIWHYHGGC VG
Sbjct  497  RAFANFTYANAST-ESIFTDSANFPVNLLPRHVNDSRTPEQYCRDTVMTIWHYHGGCQVG  555

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHR  510
             VV  DYRV G  RLRV+D ST   SPGTNPQAT++M+GRYMGVKI   R
Sbjct  556  AVVDDDYRVFGVQRLRVIDSSTFKYSPGTNPQATVMMLGRYMGVKIQAER  605



>ref|XP_002454481.1| hypothetical protein SORBIDRAFT_04g031910 [Sorghum bicolor]
 gb|EES07457.1| hypothetical protein SORBIDRAFT_04g031910 [Sorghum bicolor]
Length=584

 Score =   216 bits (550),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 130/172 (76%), Gaps = 2/172 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            A RGGFILEK+  P S G ++L+N N +DNP++ FNYF+HPDDL++CV GI  +E++++S
Sbjct  410  ALRGGFILEKVLGPQSTGHLVLRNLNPDDNPSVRFNYFAHPDDLRRCVAGISAIERVIRS  469

Query  181  KRFSNFTQCDKETLDRLLNISAQANVN-LIPRHTNDTQSLEQFCKDTVITIWHYHGGCHV  357
            + FS FT  +       LN++A+  VN L  R   D ++LEQFC+DTV+TIWHYHGGC V
Sbjct  470  RAFSRFTYPNF-AFPAALNVTAEFPVNTLYRRGGGDPRALEQFCRDTVMTIWHYHGGCQV  528

Query  358  GKVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRL  513
            G+VV  +Y+VLG   LRV+DGST   SPGTNPQAT++M+GRYMGVK+L+ R+
Sbjct  529  GRVVDRNYKVLGVEALRVIDGSTFNASPGTNPQATVMMLGRYMGVKLLKERM  580



>ref|XP_006647683.1| PREDICTED: protein HOTHEAD-like [Oryza brachyantha]
Length=582

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 130/172 (76%), Gaps = 2/172 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            A RGGFILEK+  P S G++ L+N + +DNPA++FNYFSHPDDL++CV GI  +E++++S
Sbjct  403  ALRGGFILEKVLGPQSTGRLALRNLDPDDNPAVSFNYFSHPDDLRRCVAGIGAIERVIRS  462

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLI-PRHTNDTQSLEQFCKDTVITIWHYHGGCHV  357
            + FS F   +       +N++A+   NL+  R  +D ++LEQFC+DTV+TIWHYHGGC V
Sbjct  463  RAFSRFAYPNF-AFPATINVTAEFPANLLRVRGGSDPRALEQFCRDTVMTIWHYHGGCQV  521

Query  358  GKVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRL  513
            G+VV  DYRVLG   LRV+DGST   SPGTNPQAT++M+GRYMGVKI + R+
Sbjct  522  GRVVDRDYRVLGIEALRVIDGSTFNASPGTNPQATVMMLGRYMGVKIQKERM  573



>ref|XP_009413011.1| PREDICTED: protein HOTHEAD [Musa acuminata subsp. malaccensis]
Length=572

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 128/170 (75%), Gaps = 1/170 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            + RGGFILEKI  P S G + LKN N +DNP++TFNYF  P+DL++CV GI  +EK+++S
Sbjct  393  SMRGGFILEKIMGPLSTGHLDLKNKNPDDNPSVTFNYFKEPEDLQRCVKGIETIEKVIQS  452

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            K FS F +    + + LL ++    +NL+P+H N ++SLEQFCKDTV+TIWHYHGGC VG
Sbjct  453  KAFSRF-RFQYISTEELLRMALNFPMNLLPKHDNASKSLEQFCKDTVMTIWHYHGGCQVG  511

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHR  510
            +VV  DY+V+G   LRVVDGST   SPGTNPQAT++M+GRYMG+KI   R
Sbjct  512  QVVDKDYKVVGVDALRVVDGSTFNFSPGTNPQATVMMLGRYMGIKIQTER  561



>dbj|BAK07510.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=588

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 127/170 (75%), Gaps = 1/170 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI  P S G I L+ T+   NPA+TFNYF   +DL++CV GI+ +E++++S
Sbjct  417  AFRGGFILEKILGPVSTGHIELRTTDPRANPAVTFNYFQEAEDLERCVRGIQTIERVIQS  476

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + FSNFT  +  T++ +   SA   VNL+PRH ND++S EQ+C++TV+TIWHYHGGCHVG
Sbjct  477  RAFSNFTYANT-TVESIFTDSANFPVNLLPRHVNDSRSPEQYCRETVMTIWHYHGGCHVG  535

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHR  510
             VV  +YRV G   LRV+D ST   SPGTNPQAT++M+GRYMG+KI   R
Sbjct  536  AVVDDNYRVFGVGGLRVIDSSTFRYSPGTNPQATVMMLGRYMGIKIQAER  585



>emb|CDY57073.1| BnaCnng31540D [Brassica napus]
Length=264

 Score =   206 bits (525),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 126/177 (71%), Gaps = 5/177 (3%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            F+GGFILEK+  P S G + L+  N  DNP +TFNYF HPDDLK+CV GI+ +E++V+SK
Sbjct  89   FQGGFILEKVMGPLSTGHMELRTKNPNDNPVVTFNYFQHPDDLKRCVRGIQTIERVVQSK  148

Query  184  RFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSL----EQFCKDTVITIWHYHGGC  351
             F+ +   D  + + LLN++A   VNL P  +    SL    E+FC+ TV TIWHYHGGC
Sbjct  149  AFARYKYADM-SFEYLLNLTASTPVNLRPPRSGPGASLPPSAEEFCQHTVTTIWHYHGGC  207

Query  352  HVGKVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNK  522
             VG+VV  DY+V+G + LRV+D ST+   PGTNPQAT++M+GRYMGVKI R RL NK
Sbjct  208  VVGRVVDGDYKVIGIYWLRVIDMSTVGYCPGTNPQATVMMLGRYMGVKITRERLANK  264



>ref|XP_010234930.1| PREDICTED: protein HOTHEAD-like isoform X2 [Brachypodium distachyon]
Length=563

 Score =   214 bits (544),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 126/170 (74%), Gaps = 1/170 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI  P S G + L+ T+   NPA+ FNYF   +DL++CV GI+ +E+++ S
Sbjct  392  AFRGGFILEKILGPVSTGHVELRTTDPRANPAVLFNYFQEAEDLERCVRGIQTIERVIAS  451

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + FSNFT  +  +++ + + SA   VNL+PRH ND++S EQ+C++TV+TIWHYHGGCHVG
Sbjct  452  RAFSNFTYSNA-SVESIFSDSANFPVNLLPRHANDSRSPEQYCRETVMTIWHYHGGCHVG  510

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHR  510
             VV  DYRV G   LRV+D ST   SPGTNPQAT++M+GRYMGVKI   R
Sbjct  511  AVVDDDYRVFGVRGLRVIDSSTFRYSPGTNPQATVMMLGRYMGVKIQAER  560



>ref|XP_003574225.1| PREDICTED: protein HOTHEAD-like isoform X1 [Brachypodium distachyon]
Length=583

 Score =   214 bits (544),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 126/170 (74%), Gaps = 1/170 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI  P S G + L+ T+   NPA+ FNYF   +DL++CV GI+ +E+++ S
Sbjct  412  AFRGGFILEKILGPVSTGHVELRTTDPRANPAVLFNYFQEAEDLERCVRGIQTIERVIAS  471

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
            + FSNFT  +  +++ + + SA   VNL+PRH ND++S EQ+C++TV+TIWHYHGGCHVG
Sbjct  472  RAFSNFTYSNA-SVESIFSDSANFPVNLLPRHANDSRSPEQYCRETVMTIWHYHGGCHVG  530

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHR  510
             VV  DYRV G   LRV+D ST   SPGTNPQAT++M+GRYMGVKI   R
Sbjct  531  AVVDDDYRVFGVRGLRVIDSSTFRYSPGTNPQATVMMLGRYMGVKIQAER  580



>ref|XP_010533369.1| PREDICTED: protein HOTHEAD-like [Tarenaya hassleriana]
Length=296

 Score =   205 bits (522),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 120/168 (71%), Gaps = 1/168 (1%)
 Frame = +1

Query  7    RGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSKR  186
            R G IL+K++ P SRG + L+NTN  DNP++ FNYF  P+DL+KCV G+  + K++ +K 
Sbjct  117  RAGVILQKVSGPMSRGHLELRNTNPYDNPSVRFNYFQEPEDLRKCVQGLSTIIKVINTKA  176

Query  187  FSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVGKV  366
            FS F   D  ++ RLLN+      NL PRH   T +LEQFC DTV+TIWHYHGGC VG+V
Sbjct  177  FSKFRYLDM-SVPRLLNLMLSVPTNLRPRHMTATFNLEQFCTDTVMTIWHYHGGCQVGRV  235

Query  367  VGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHR  510
            V  +YRV G   LRV+DGST  +SPGTNPQAT++M+GRYMG  ILR +
Sbjct  236  VDKNYRVFGVDALRVIDGSTFLKSPGTNPQATVMMLGRYMGQMILREK  283



>ref|XP_002468629.1| hypothetical protein SORBIDRAFT_01g049320 [Sorghum bicolor]
 gb|EER95627.1| hypothetical protein SORBIDRAFT_01g049320 [Sorghum bicolor]
Length=602

 Score =   213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 129/183 (70%), Gaps = 3/183 (2%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEK+  P S G I L++ +   NPA+TFNYF  P D+++C  GI  +E++V+S
Sbjct  420  AFRGGFILEKVLGPLSTGHIELRSADAHANPAVTFNYFRDPRDVERCARGIEAIERVVRS  479

Query  181  KRFSNFTQCDKETLD---RLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGC  351
            + FS FT  +   +D   R    +A   VNL+PRH  DT++L+Q+C+DTV+TIWHYHGGC
Sbjct  480  RAFSRFTYANHTAMDAAFRRAAGTAYFPVNLLPRHPRDTRTLQQYCRDTVMTIWHYHGGC  539

Query  352  HVGKVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            HVG VV  DYRV+G   LRVVD ST   SPGTNPQAT++M+GRYMG++IL+ R   K   
Sbjct  540  HVGGVVDRDYRVVGVQGLRVVDSSTFRYSPGTNPQATVMMLGRYMGLRILKDRWIRKGAE  599

Query  532  *RH  540
             +H
Sbjct  600  DKH  602



>gb|EAY87068.1| hypothetical protein OsI_08464 [Oryza sativa Indica Group]
Length=583

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 128/172 (74%), Gaps = 2/172 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            A RGGFILEK+  P S G++ L+N + +DNP ++FNYFSHPDDL++C  GI  +E++++S
Sbjct  404  ALRGGFILEKVLGPQSTGRLALRNLDPDDNPTVSFNYFSHPDDLRRCAAGIATIERVIRS  463

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIP-RHTNDTQSLEQFCKDTVITIWHYHGGCHV  357
            + FS F   +       +N++A+   NL+  R  +D ++LEQFC+DTV+TIWHYHGGC V
Sbjct  464  RAFSRFAYPNF-AFPATINVTAEFPANLMRMRGGSDPRALEQFCRDTVMTIWHYHGGCQV  522

Query  358  GKVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRL  513
            G+VV  DYRVLG   LRV+DGST   SPGTNPQAT++M+GRYMGVKI + R+
Sbjct  523  GRVVDRDYRVLGIEALRVIDGSTFNASPGTNPQATVMMLGRYMGVKIQKERM  574



>gb|EEE57571.1| hypothetical protein OsJ_07923 [Oryza sativa Japonica Group]
Length=570

 Score =   211 bits (538),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 128/172 (74%), Gaps = 2/172 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            A RGGFILEK+  P S G++ L+N + +DNP ++FNYFSHPDDL++C  GI  +E++++S
Sbjct  391  ALRGGFILEKVLGPQSTGRLALRNLDPDDNPTVSFNYFSHPDDLRRCAAGIATIERVIRS  450

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIP-RHTNDTQSLEQFCKDTVITIWHYHGGCHV  357
            + FS F   +       +N++A+   NL+  R  +D ++LEQFC+DTV+TIWHYHGGC V
Sbjct  451  RAFSRFAYPNF-AFPATINVTAEFPANLMRMRGGSDPRALEQFCRDTVMTIWHYHGGCQV  509

Query  358  GKVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRL  513
            G+VV  DYRVLG   LRV+DGST   SPGTNPQAT++M+GRYMGVKI + R+
Sbjct  510  GRVVDRDYRVLGIEALRVIDGSTFNASPGTNPQATVMMLGRYMGVKIQKERM  561



>dbj|BAK04607.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=571

 Score =   211 bits (538),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 128/172 (74%), Gaps = 2/172 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            A RGGFILEK+  P S G + L+N + +DNP + FNYF+HPDDL++CV GI  +E++++S
Sbjct  392  ALRGGFILEKVLGPQSTGSLALRNLDPDDNPIVQFNYFAHPDDLRRCVAGIEAIERVIRS  451

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLI-PRHTNDTQSLEQFCKDTVITIWHYHGGCHV  357
            + FS F   +      +LN++A+  VNL+  R  +D  +LE+FC+DTV+TIWHYHGGC V
Sbjct  452  RSFSRFAYPNF-AFPAMLNVTAEFPVNLMRVRGGSDPAALERFCRDTVMTIWHYHGGCQV  510

Query  358  GKVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRL  513
            G+VV  DYRV+G   LRV+DGST   SPGTNPQAT++M+GRYMGVKI + R+
Sbjct  511  GRVVDRDYRVIGIDALRVIDGSTFNASPGTNPQATVMMLGRYMGVKIEKERM  562



>ref|XP_010676567.1| PREDICTED: protein HOTHEAD-like isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=581

 Score =   211 bits (537),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 126/171 (74%), Gaps = 1/171 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFI+EK+  P S G + L+N +   NP++TFNYF   +DL++CV G++ +EK++ S
Sbjct  406  AFQGGFIIEKVMGPVSSGHLELRNIDPNANPSVTFNYFQEAEDLQRCVQGLQTIEKVINS  465

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
              FS F +    ++  LLN++A   VNL+P H N + SLE+FCKDTV+TIWHYHGGC VG
Sbjct  466  NSFSKF-KYQGISVQTLLNMTASTPVNLLPHHANVSASLEEFCKDTVMTIWHYHGGCQVG  524

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRL  513
            +VV  DY+V+G   LRV+DGST   SPGTNPQAT++M+GRYMGV+IL  R 
Sbjct  525  RVVDADYKVIGIDSLRVIDGSTFYYSPGTNPQATVMMLGRYMGVRILTERF  575



>ref|XP_010676566.1| PREDICTED: protein HOTHEAD-like isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=599

 Score =   211 bits (537),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 126/171 (74%), Gaps = 1/171 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AF+GGFI+EK+  P S G + L+N +   NP++TFNYF   +DL++CV G++ +EK++ S
Sbjct  424  AFQGGFIIEKVMGPVSSGHLELRNIDPNANPSVTFNYFQEAEDLQRCVQGLQTIEKVINS  483

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVG  360
              FS F +    ++  LLN++A   VNL+P H N + SLE+FCKDTV+TIWHYHGGC VG
Sbjct  484  NSFSKF-KYQGISVQTLLNMTASTPVNLLPHHANVSASLEEFCKDTVMTIWHYHGGCQVG  542

Query  361  KVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRL  513
            +VV  DY+V+G   LRV+DGST   SPGTNPQAT++M+GRYMGV+IL  R 
Sbjct  543  RVVDADYKVIGIDSLRVIDGSTFYYSPGTNPQATVMMLGRYMGVRILTERF  593



>ref|XP_004987208.1| PREDICTED: protein HOTHEAD-like [Setaria italica]
Length=599

 Score =   211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 129/183 (70%), Gaps = 3/183 (2%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI  P S G I L++T+   NPA+TFNYF  P D+++CV GI  ++++V+S
Sbjct  417  AFRGGFILEKILGPLSTGHIELRSTDAHANPAVTFNYFRDPRDVERCVRGIEAIQRVVRS  476

Query  181  KRFSNFTQCDKETLDRLLNISAQAN---VNLIPRHTNDTQSLEQFCKDTVITIWHYHGGC  351
            + FS FT  +   ++ +   +A      VNL+PRH  DT+ L Q+C++TV+TIWHYHGGC
Sbjct  477  RAFSRFTYANHTAMEAVFRRAAGTAYFPVNLLPRHPRDTRPLHQYCRETVMTIWHYHGGC  536

Query  352  HVGKVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNKAGV  531
            HVG VV  DYRV+G   LRV+D ST   SPGTNPQAT++M+GRYMG++IL+ R   K   
Sbjct  537  HVGGVVDRDYRVIGVRGLRVIDSSTFKYSPGTNPQATVMMLGRYMGLRILKERWIRKGAE  596

Query  532  *RH  540
             +H
Sbjct  597  DKH  599



>ref|XP_003562180.2| PREDICTED: protein HOTHEAD-like [Brachypodium distachyon]
Length=637

 Score =   211 bits (537),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 96/175 (55%), Positives = 126/175 (72%), Gaps = 1/175 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI  P S G + L++T+   NPA+TFNYF  P D+++CV GI  +E++V S
Sbjct  463  AFRGGFILEKILGPLSTGHVELRSTDPNANPAVTFNYFRDPKDVERCVRGIETIERVVHS  522

Query  181  KRFSNFTQCDKETLDRLLNISAQAN-VNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHV  357
            + FS FT  +   ++   + +A A  +NL+PRH  D + L+Q+C+DTV+TIWHYHGGCHV
Sbjct  523  RAFSRFTYANASAMEAAFDRAALAKFLNLMPRHPRDDRPLQQYCRDTVMTIWHYHGGCHV  582

Query  358  GKVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNK  522
            G VV  DYRV+G   LRVVD ST   SPGTNPQAT++M+GRYMG+KI +  L  K
Sbjct  583  GDVVDQDYRVIGVQGLRVVDSSTFKYSPGTNPQATVMMLGRYMGLKIQKEGLIGK  637



>emb|CDY58608.1| BnaCnng33370D [Brassica napus]
Length=570

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 127/177 (72%), Gaps = 5/177 (3%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            F+GGFILEK+  P S G + L+  N  DNP +TFNYF HPDDLK+CV GI+ +E++V+SK
Sbjct  395  FQGGFILEKVMGPLSTGHLELQTRNPNDNPVVTFNYFQHPDDLKRCVRGIQTIERVVQSK  454

Query  184  RFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSL----EQFCKDTVITIWHYHGGC  351
             F+ F   D  + + LLN++A   VNL P  +    SL    E+FC+ TV TIWHYHGGC
Sbjct  455  AFARFKYADM-SFEYLLNLTASTPVNLRPPRSGPEASLPPSAEEFCQHTVTTIWHYHGGC  513

Query  352  HVGKVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNK  522
             VG+VV  DY+V+G  RLRV+D ST+   PGTNPQAT++M+GRYMGVKI+R RL NK
Sbjct  514  VVGRVVDGDYKVIGIDRLRVIDMSTVGYCPGTNPQATVMMLGRYMGVKIMRDRLTNK  570



>ref|XP_007029314.1| Glucose-methanol-choline oxidoreductase family protein [Theobroma 
cacao]
 gb|EOY09816.1| Glucose-methanol-choline oxidoreductase family protein [Theobroma 
cacao]
Length=560

 Score =   209 bits (531),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 120/166 (72%), Gaps = 1/166 (1%)
 Frame = +1

Query  13   GFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSKRFS  192
            GFI+EK   P S G + L++TNV DNP + FNYF  P+DL+KCV G++ +  +V SK +S
Sbjct  394  GFIVEKFNGPISEGYLELQSTNVSDNPKVRFNYFQAPEDLRKCVQGVKTIINVVNSKSYS  453

Query  193  NFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVGKVVG  372
             F   +  T D LLN+ A  +VNL PRH N T SLEQ+C DTV+T WHYHGGC VGKVV 
Sbjct  454  RFRYSNTTTQD-LLNMMASMSVNLRPRHPNSTVSLEQYCIDTVMTFWHYHGGCQVGKVVD  512

Query  373  PDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHR  510
             DY+V G  RLRV+DGST   SPGTNPQATL+M+GRYMG +IL+ R
Sbjct  513  RDYKVFGVDRLRVIDGSTFNFSPGTNPQATLMMLGRYMGRRILQSR  558



>ref|XP_009397840.1| PREDICTED: protein HOTHEAD-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=561

 Score =   209 bits (531),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 126/170 (74%), Gaps = 1/170 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            F+GG I+EK+A P SRG + LKN N EDNPA+TFNYF  P+D++ CV G+  +++++++K
Sbjct  386  FQGGLIVEKLARPLSRGHLHLKNLNPEDNPAVTFNYFVEPEDVRTCVEGMETIKRVLETK  445

Query  184  RFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVGK  363
              S F   ++   D L+ +SA   VN   RH +D+ SLEQ+CKD  +TIWHYHGGC VG+
Sbjct  446  EMSEFRNSNQSVED-LITLSASLIVNNRTRHDDDSTSLEQYCKDLTMTIWHYHGGCQVGQ  504

Query  364  VVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRL  513
            VV  DYRVLG   LRV+DGST T SPGTNPQAT++M+GRYMGV+I + RL
Sbjct  505  VVDHDYRVLGVDALRVIDGSTFTFSPGTNPQATVMMLGRYMGVQIQKQRL  554



>ref|XP_009397839.1| PREDICTED: protein HOTHEAD-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=561

 Score =   209 bits (531),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 126/170 (74%), Gaps = 1/170 (1%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            F+GG I+EK+A P SRG + LKN N EDNPA+TFNYF  P+D++ CV G+  +++++++K
Sbjct  386  FQGGLIVEKLARPLSRGHLHLKNLNPEDNPAVTFNYFVEPEDVRTCVEGMETIKRVLETK  445

Query  184  RFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVGK  363
              S F   ++   D L+ +SA   VN   RH +D+ SLEQ+CKD  +TIWHYHGGC VG+
Sbjct  446  EMSEFRNSNQSVED-LITLSASLIVNNRTRHDDDSTSLEQYCKDLTMTIWHYHGGCQVGQ  504

Query  364  VVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRL  513
            VV  DYRVLG   LRV+DGST T SPGTNPQAT++M+GRYMGV+I + RL
Sbjct  505  VVDHDYRVLGVDALRVIDGSTFTFSPGTNPQATVMMLGRYMGVQIQKQRL  554



>ref|XP_009110637.1| PREDICTED: protein HOTHEAD [Brassica rapa]
 emb|CDY21057.1| BnaA08g24680D [Brassica napus]
Length=570

 Score =   209 bits (531),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 126/177 (71%), Gaps = 5/177 (3%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            F+GGFILEK+  P S G + L+  N  DNP +TFNYF HPDDLK+CV GI+ +E++V+SK
Sbjct  395  FQGGFILEKVMGPLSTGHLELRTRNPNDNPVVTFNYFQHPDDLKRCVRGIQTIERVVQSK  454

Query  184  RFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSL----EQFCKDTVITIWHYHGGC  351
             F+ F   D    + LLN++A   VNL P  +    SL    E+FC+ TV TIWHYHGGC
Sbjct  455  AFARFKYADMP-FEYLLNLTASTPVNLRPPRSGPGASLPPSAEEFCQHTVTTIWHYHGGC  513

Query  352  HVGKVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNK  522
             VG+VV  DY+V+G  RLRV+D ST+   PGTNPQAT++M+GRYMGVKI+R RL NK
Sbjct  514  VVGRVVDGDYKVIGIDRLRVIDMSTVGYCPGTNPQATVMMLGRYMGVKIMRERLTNK  570



>ref|XP_004955148.1| PREDICTED: protein HOTHEAD-like [Setaria italica]
Length=596

 Score =   209 bits (532),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 128/179 (72%), Gaps = 9/179 (5%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            A RGGFILEK+  P S G + L+N + +DNP++ FNYF+HPDDL++CV GI  +E++++S
Sbjct  409  ALRGGFILEKVLGPQSTGHLALRNLDPDDNPSVRFNYFAHPDDLRRCVAGISGIERVIRS  468

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLI--------PRHTNDTQSLEQFCKDTVITIWH  336
            + FS FT  +       LN++A   VN +            +D ++LEQFC+DTV+TIWH
Sbjct  469  RAFSRFTYPNF-AFPATLNVTADFPVNTLYGRRGGAGGGGGSDPRALEQFCRDTVMTIWH  527

Query  337  YHGGCHVGKVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRL  513
            YHGGC VG+VV  DY+VLG   LRV+DGST   SPGTNPQAT++M+GRYMGVK+LR R+
Sbjct  528  YHGGCQVGRVVDRDYKVLGVEALRVIDGSTFNASPGTNPQATVMMLGRYMGVKLLRERM  586



>ref|XP_010235819.1| PREDICTED: protein HOTHEAD-like [Brachypodium distachyon]
Length=548

 Score =   208 bits (530),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 128/173 (74%), Gaps = 3/173 (2%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            A RGGFILEK+  P S G + L+N + +DNP + FNYF+HPDDL++CV GI+ +E++++S
Sbjct  371  ALRGGFILEKVMGPQSTGSLALRNLDPDDNPIVRFNYFAHPDDLRRCVAGIQAIERVIRS  430

Query  181  KRFSNFTQCDKETLDRLLNISAQANVNLI--PRHTNDTQSLEQFCKDTVITIWHYHGGCH  354
            + FS F   +      +LN++A+  VNL+   R  ++  +LEQFC+DTV+TIWHYHGG  
Sbjct  431  RAFSRFAYPNF-AFPAMLNVTAEFPVNLVMRVRGGSEPAALEQFCRDTVMTIWHYHGGSQ  489

Query  355  VGKVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRL  513
            VG+VV  +YRVLG   LRV+DGST   SPGTNPQAT++M+GRYMGVKI + R+
Sbjct  490  VGRVVDREYRVLGIDALRVIDGSTFNASPGTNPQATVMMLGRYMGVKIEKERM  542



>gb|AAF88098.1|AC025417_26 T12C24.11 [Arabidopsis thaliana]
Length=549

 Score =   208 bits (529),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 127/177 (72%), Gaps = 5/177 (3%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            F+GGF+LEK+  P S G + LK  N +DNP +TFNYF HPDDLK+CV GI+ +E++V+SK
Sbjct  374  FQGGFLLEKVMGPLSTGHLELKTRNPKDNPIVTFNYFQHPDDLKRCVRGIQTIERVVQSK  433

Query  184  RFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSL----EQFCKDTVITIWHYHGGC  351
             FS +   D  + + LLN++A   VNL P  +    SL    E+FC+ TV TIWHYHGGC
Sbjct  434  AFSRYKYADV-SFEYLLNLTASTPVNLRPPRSGPGASLPPSAEEFCQHTVTTIWHYHGGC  492

Query  352  HVGKVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNK  522
             VG+VV  DY+V+G  RLRV+D ST+   PGTNPQAT++M+GRYMGVKILR RL  K
Sbjct  493  VVGRVVDGDYKVIGIDRLRVIDMSTVGYCPGTNPQATVMMLGRYMGVKILRERLTKK  549



>gb|AAF79648.1|AC025416_22 F5O11.31 [Arabidopsis thaliana]
Length=539

 Score =   208 bits (529),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 127/177 (72%), Gaps = 5/177 (3%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            F+GGF+LEK+  P S G + LK  N +DNP +TFNYF HPDDLK+CV GI+ +E++V+SK
Sbjct  364  FQGGFLLEKVMGPLSTGHLELKTRNPKDNPIVTFNYFQHPDDLKRCVRGIQTIERVVQSK  423

Query  184  RFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSL----EQFCKDTVITIWHYHGGC  351
             FS +   D  + + LLN++A   VNL P  +    SL    E+FC+ TV TIWHYHGGC
Sbjct  424  AFSRYKYADV-SFEYLLNLTASTPVNLRPPRSGPGASLPPSAEEFCQHTVTTIWHYHGGC  482

Query  352  HVGKVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNK  522
             VG+VV  DY+V+G  RLRV+D ST+   PGTNPQAT++M+GRYMGVKILR RL  K
Sbjct  483  VVGRVVDGDYKVIGIDRLRVIDMSTVGYCPGTNPQATVMMLGRYMGVKILRERLTKK  539



>gb|EMT29817.1| hypothetical protein F775_42853 [Aegilops tauschii]
Length=433

 Score =   204 bits (520),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 121/162 (75%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI  P S G + L++T+   NPA+TFNYF  P D+++CV GI+ +E++V+S
Sbjct  235  AFRGGFILEKILGPLSTGHVELRSTDPHANPAVTFNYFRDPRDVERCVRGIQTIERVVRS  294

Query  181  KRFSNFTQCDKETLDRLLNISAQAN-VNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHV  357
            + FS FT  +   +D   + +A A  +NL+PRH  DT+ L+Q+C+DTV+TIWHYHGGCHV
Sbjct  295  RAFSRFTYANATAMDVAFDRAALAKFLNLLPRHPRDTRPLQQYCRDTVMTIWHYHGGCHV  354

Query  358  GKVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRY  483
            G VV PDYRV+G   LRVVD ST   SPGTNPQAT++M+G +
Sbjct  355  GPVVDPDYRVIGVAGLRVVDSSTFKYSPGTNPQATVMMLGSH  396



>ref|NP_172718.2| glucose-methanol-choline (GMC) oxidoreductase-like protein [Arabidopsis 
thaliana]
 gb|AAU05540.1| At1g12570 [Arabidopsis thaliana]
 gb|AEE28898.1| glucose-methanol-choline (GMC) oxidoreductase-like protein [Arabidopsis 
thaliana]
Length=572

 Score =   207 bits (528),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 127/177 (72%), Gaps = 5/177 (3%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            F+GGF+LEK+  P S G + LK  N +DNP +TFNYF HPDDLK+CV GI+ +E++V+SK
Sbjct  397  FQGGFLLEKVMGPLSTGHLELKTRNPKDNPIVTFNYFQHPDDLKRCVRGIQTIERVVQSK  456

Query  184  RFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSL----EQFCKDTVITIWHYHGGC  351
             FS +   D  + + LLN++A   VNL P  +    SL    E+FC+ TV TIWHYHGGC
Sbjct  457  AFSRYKYADV-SFEYLLNLTASTPVNLRPPRSGPGASLPPSAEEFCQHTVTTIWHYHGGC  515

Query  352  HVGKVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNK  522
             VG+VV  DY+V+G  RLRV+D ST+   PGTNPQAT++M+GRYMGVKILR RL  K
Sbjct  516  VVGRVVDGDYKVIGIDRLRVIDMSTVGYCPGTNPQATVMMLGRYMGVKILRERLTKK  572



>ref|XP_007029322.1| Glucose-methanol-choline oxidoreductase family protein, putative 
[Theobroma cacao]
 gb|EOY09824.1| Glucose-methanol-choline oxidoreductase family protein, putative 
[Theobroma cacao]
Length=557

 Score =   207 bits (526),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 119/166 (72%), Gaps = 1/166 (1%)
 Frame = +1

Query  13   GFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSKRFS  192
            GFI+EK   P S G + L++TNV DNP + FNYF  P+DL+KCV G++ +  +V SK +S
Sbjct  391  GFIVEKFNGPISEGYLELQSTNVSDNPKVRFNYFQAPEDLRKCVQGVKTIINVVNSKSYS  450

Query  193  NFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVGKVVG  372
             F   +  T D LLN+ A   VNL PRH N T SLEQ+C DTV+T WHYHGGC VGKVV 
Sbjct  451  RFRYSNTTTQD-LLNMMASMPVNLRPRHPNSTVSLEQYCIDTVMTFWHYHGGCQVGKVVD  509

Query  373  PDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHR  510
             DY+V G  RLRV+DGST   SPGTNPQATL+M+GRYMG +IL+ R
Sbjct  510  RDYKVFGVDRLRVLDGSTFNFSPGTNPQATLMMLGRYMGRRILQSR  555



>gb|EAY88296.1| hypothetical protein OsI_09753 [Oryza sativa Indica Group]
Length=590

 Score =   207 bits (526),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 124/172 (72%), Gaps = 2/172 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI  P S G + L++ + + NPA+TFNYF  P D+++CV GI  +E++V+S
Sbjct  411  AFRGGFILEKILGPMSTGHVALRSADPDANPAVTFNYFRDPRDVERCVRGIETIERVVRS  470

Query  181  KRFSNFTQCDKETLDR--LLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCH  354
            + F+ FT  +   ++   L   +    VNL+PR   DT+ L+Q+C++TV+TIWHYHGGCH
Sbjct  471  RAFARFTYANVTAMEAAVLGRRAGHLPVNLLPRRATDTRPLQQYCRETVMTIWHYHGGCH  530

Query  355  VGKVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHR  510
            VG VV  DYRVLG   LRVVD ST   SPGTNPQAT++M+GRYMG+KI + R
Sbjct  531  VGAVVDQDYRVLGVRGLRVVDSSTFKYSPGTNPQATVMMLGRYMGLKIQKER  582



>emb|CBI31862.3| unnamed protein product [Vitis vinifera]
Length=537

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 121/168 (72%), Gaps = 1/168 (1%)
 Frame = +1

Query  7    RGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSKR  186
            RGG ILEKI  P S G + L+ TN EDNP +TFNYF  P+DL++CV G+R + K++ SK 
Sbjct  371  RGGIILEKIKGPISTGHLKLRTTNPEDNPYVTFNYFEEPEDLQRCVEGMRTIIKVINSKA  430

Query  187  FSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVGKV  366
            FS F +     +  L+++   + VNL PRH   +  LEQFC DTV+TIWHYHGGCHVG+V
Sbjct  431  FSKF-RFPHIPVQLLIDMMVYSPVNLRPRHVGASIFLEQFCIDTVMTIWHYHGGCHVGRV  489

Query  367  VGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHR  510
            V PDY+V+G   LR++DGST   SPGTNPQAT++M+GRYMG KIL  R
Sbjct  490  VEPDYKVIGVDGLRIIDGSTFNHSPGTNPQATVMMLGRYMGEKILGER  537



>ref|NP_001173240.1| Os03g0118700 [Oryza sativa Japonica Group]
 gb|AAO15286.1| Putative mandelonitrile lyase [Oryza sativa Japonica Group]
 gb|ABF93672.1| GMC oxidoreductase family protein [Oryza sativa Japonica Group]
 gb|EAZ25373.1| hypothetical protein OsJ_09190 [Oryza sativa Japonica Group]
 dbj|BAH91968.1| Os03g0118700 [Oryza sativa Japonica Group]
Length=590

 Score =   207 bits (526),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 124/172 (72%), Gaps = 2/172 (1%)
 Frame = +1

Query  1    AFRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKS  180
            AFRGGFILEKI  P S G + L++ + + NPA+TFNYF  P D+++CV GI  +E++V+S
Sbjct  411  AFRGGFILEKILGPMSTGHVALRSADPDANPAVTFNYFRDPRDVERCVRGIETIERVVRS  470

Query  181  KRFSNFTQCDKETLDR--LLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCH  354
            + F+ FT  +   ++   L   +    VNL+PR   DT+ L+Q+C++TV+TIWHYHGGCH
Sbjct  471  RAFARFTYANVTAMEAAVLGRRAGHLPVNLLPRRATDTRPLQQYCRETVMTIWHYHGGCH  530

Query  355  VGKVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHR  510
            VG VV  DYRVLG   LRVVD ST   SPGTNPQAT++M+GRYMG+KI + R
Sbjct  531  VGAVVDQDYRVLGVRGLRVVDSSTFKYSPGTNPQATVMMLGRYMGLKIQKER  582



>ref|XP_010482540.1| PREDICTED: protein HOTHEAD-like isoform X1 [Camelina sativa]
Length=586

 Score =   207 bits (526),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 122/168 (73%), Gaps = 1/168 (1%)
 Frame = +1

Query  7    RGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSKR  186
            R G IL+KIA P SRG + L+NTN +DNP++ FNY+  P+DLKKCV GI I+ K++ SK 
Sbjct  410  RAGLILQKIAGPVSRGHLELRNTNPDDNPSVRFNYYQDPEDLKKCVEGINIIIKVINSKA  469

Query  187  FSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVGKV  366
            FS F   D  T+  LL++      NL PRH     +L+QFC DTV+TIWHYHGGC VG+V
Sbjct  470  FSKFKYPDA-TIKGLLDLILSVPTNLRPRHLTSAFNLKQFCIDTVMTIWHYHGGCQVGRV  528

Query  367  VGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHR  510
            V  +YRVLG   LRV+DGST  +SPGTNPQAT++M+GRYMG +IL+ R
Sbjct  529  VDKNYRVLGLDSLRVIDGSTFLKSPGTNPQATVMMLGRYMGQRILQER  576



>ref|XP_006417220.1| hypothetical protein EUTSA_v10007216mg [Eutrema salsugineum]
 gb|ESQ35573.1| hypothetical protein EUTSA_v10007216mg [Eutrema salsugineum]
Length=570

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 127/177 (72%), Gaps = 5/177 (3%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            F+GGFILEK+  P S G + L+  N  DNP +TFNYF +PDDLK+CV GI+ +E++V+SK
Sbjct  395  FQGGFILEKVMGPISTGHLELRTRNPNDNPVVTFNYFQNPDDLKRCVRGIQTIERVVQSK  454

Query  184  RFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSL----EQFCKDTVITIWHYHGGC  351
             F+ F   D  + + +LN++A   VNL PR +    SL    E+FC+ TV TIWHYHGGC
Sbjct  455  AFARFKYADM-SFEYMLNLTASTPVNLRPRRSGPGASLPPSAEEFCQHTVTTIWHYHGGC  513

Query  352  HVGKVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNK  522
             VG+VV  DY+V+G  +LRV+D ST+   PGTNPQAT++M+GRYMGVKILR RL  K
Sbjct  514  VVGRVVDEDYQVIGIDQLRVIDMSTVGYCPGTNPQATVMMLGRYMGVKILRERLSKK  570



>ref|XP_010482541.1| PREDICTED: protein HOTHEAD-like isoform X2 [Camelina sativa]
Length=584

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 122/168 (73%), Gaps = 1/168 (1%)
 Frame = +1

Query  7    RGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSKR  186
            R G IL+KIA P SRG + L+NTN +DNP++ FNY+  P+DLKKCV GI I+ K++ SK 
Sbjct  408  RAGLILQKIAGPVSRGHLELRNTNPDDNPSVRFNYYQDPEDLKKCVEGINIIIKVINSKA  467

Query  187  FSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVGKV  366
            FS F   D  T+  LL++      NL PRH     +L+QFC DTV+TIWHYHGGC VG+V
Sbjct  468  FSKFKYPDA-TIKGLLDLILSVPTNLRPRHLTSAFNLKQFCIDTVMTIWHYHGGCQVGRV  526

Query  367  VGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHR  510
            V  +YRVLG   LRV+DGST  +SPGTNPQAT++M+GRYMG +IL+ R
Sbjct  527  VDKNYRVLGLDSLRVIDGSTFLKSPGTNPQATVMMLGRYMGQRILQER  574



>ref|XP_010480446.1| PREDICTED: protein HOTHEAD-like [Camelina sativa]
Length=462

 Score =   204 bits (519),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 125/177 (71%), Gaps = 5/177 (3%)
 Frame = +1

Query  4    FRGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSK  183
            F+GGF+LEK+  P S G + +K  N +DNP +TFNYF HPDDLK+CV GI+ ++++V+SK
Sbjct  287  FQGGFLLEKVMGPLSTGHLEIKTRNPKDNPVVTFNYFQHPDDLKRCVRGIQTIQRVVQSK  346

Query  184  RFSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSL----EQFCKDTVITIWHYHGGC  351
             FS +   D    + LLN++A   VNL P  +    SL    E+FC+ TV TIWHYHGGC
Sbjct  347  AFSRYKYADMP-FEYLLNLTASTPVNLRPPRSGPGASLPPSAEEFCQHTVTTIWHYHGGC  405

Query  352  HVGKVVGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHRLGNK  522
             VGKVV  DY+V+G  RLRV+D ST+   PGTNPQAT++M+GRYMGVKIL+ R   K
Sbjct  406  VVGKVVDGDYKVIGIDRLRVIDMSTVGYCPGTNPQATVMMLGRYMGVKILKERFTKK  462



>ref|XP_010482542.1| PREDICTED: protein HOTHEAD-like isoform X3 [Camelina sativa]
Length=576

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 122/168 (73%), Gaps = 1/168 (1%)
 Frame = +1

Query  7    RGGFILEKIASPSSRGQILLKNTNVEDNPAITFNYFSHPDDLKKCVNGIRIVEKIVKSKR  186
            R G IL+KIA P SRG + L+NTN +DNP++ FNY+  P+DLKKCV GI I+ K++ SK 
Sbjct  400  RAGLILQKIAGPVSRGHLELRNTNPDDNPSVRFNYYQDPEDLKKCVEGINIIIKVINSKA  459

Query  187  FSNFTQCDKETLDRLLNISAQANVNLIPRHTNDTQSLEQFCKDTVITIWHYHGGCHVGKV  366
            FS F   D  T+  LL++      NL PRH     +L+QFC DTV+TIWHYHGGC VG+V
Sbjct  460  FSKFKYPDA-TIKGLLDLILSVPTNLRPRHLTSAFNLKQFCIDTVMTIWHYHGGCQVGRV  518

Query  367  VGPDYRVLGTHRLRVVDGSTLTESPGTNPQATLLMMGRYMGVKILRHR  510
            V  +YRVLG   LRV+DGST  +SPGTNPQAT++M+GRYMG +IL+ R
Sbjct  519  VDKNYRVLGLDSLRVIDGSTFLKSPGTNPQATVMMLGRYMGQRILQER  566



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 883751467950