BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS066B02

Length=628
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAK19067.1|  GIGANTEA                                               437   8e-142   Ipomoea nil [qian niu]
emb|CDP11443.1|  unnamed protein product                                391   2e-124   Coffea canephora [robusta coffee]
ref|XP_009610493.1|  PREDICTED: protein GIGANTEA-like                   390   4e-124   Nicotiana tomentosiformis
ref|XP_009802612.1|  PREDICTED: protein GIGANTEA-like                   384   8e-122   Nicotiana sylvestris
emb|CBI22760.3|  unnamed protein product                                367   3e-121   Vitis vinifera
ref|XP_009772049.1|  PREDICTED: protein GIGANTEA-like                   380   1e-120   Nicotiana sylvestris
ref|XP_004237832.1|  PREDICTED: protein GIGANTEA                        378   1e-119   Solanum lycopersicum
ref|XP_006359040.1|  PREDICTED: protein GIGANTEA-like isoform X2        376   7e-119   Solanum tuberosum [potatoes]
ref|XP_006359039.1|  PREDICTED: protein GIGANTEA-like isoform X1        376   7e-119   Solanum tuberosum [potatoes]
ref|XP_009631434.1|  PREDICTED: protein GIGANTEA-like isoform X5        372   2e-117   Nicotiana tomentosiformis
ref|XP_007019603.1|  Gigantea protein isoform 3                         370   1e-116   
ref|XP_007019601.1|  Gigantea protein isoform 1                         370   1e-116   
ref|XP_007019604.1|  Gigantea protein isoform 4                         369   1e-116   
ref|XP_002264755.1|  PREDICTED: protein GIGANTEA                        370   2e-116   
gb|KHG25928.1|  Protein GIGANTEA                                        360   2e-116   Gossypium arboreum [tree cotton]
gb|KDP36552.1|  hypothetical protein JCGZ_08319                         368   6e-116   Jatropha curcas
ref|XP_008237480.1|  PREDICTED: protein GIGANTEA                        368   7e-116   
ref|XP_011074106.1|  PREDICTED: protein GIGANTEA-like isoform X2        367   1e-115   
gb|AJC01622.1|  gigantea                                                367   1e-115   Prunus dulcis [sweet almond]
gb|EYU30283.1|  hypothetical protein MIMGU_mgv1a000455mg                366   2e-115   Erythranthe guttata [common monkey flower]
gb|EYU36555.1|  hypothetical protein MIMGU_mgv1a000427mg                367   2e-115   Erythranthe guttata [common monkey flower]
gb|KJB59491.1|  hypothetical protein B456_009G258800                    363   2e-115   Gossypium raimondii
ref|XP_011074103.1|  PREDICTED: protein GIGANTEA-like isoform X1        367   2e-115   Sesamum indicum [beniseed]
ref|XP_009631433.1|  PREDICTED: protein GIGANTEA-like isoform X4        366   3e-115   Nicotiana tomentosiformis
ref|XP_004290483.1|  PREDICTED: protein GIGANTEA                        367   3e-115   Fragaria vesca subsp. vesca
gb|KJB59493.1|  hypothetical protein B456_009G258800                    363   3e-115   Gossypium raimondii
gb|KJB28963.1|  hypothetical protein B456_005G077100                    361   1e-114   Gossypium raimondii
gb|KJB28960.1|  hypothetical protein B456_005G077100                    362   1e-114   Gossypium raimondii
gb|KJB59492.1|  hypothetical protein B456_009G258800                    362   1e-114   Gossypium raimondii
ref|XP_009336496.1|  PREDICTED: protein GIGANTEA-like                   363   3e-114   Pyrus x bretschneideri [bai li]
gb|KJB59494.1|  hypothetical protein B456_009G258800                    363   5e-114   Gossypium raimondii
gb|KJB28964.1|  hypothetical protein B456_005G077100                    361   6e-114   Gossypium raimondii
ref|XP_008381855.1|  PREDICTED: protein GIGANTEA-like                   362   1e-113   
ref|XP_009631431.1|  PREDICTED: protein GIGANTEA-like isoform X2        362   1e-113   Nicotiana tomentosiformis
ref|XP_011100590.1|  PREDICTED: protein GIGANTEA-like                   362   1e-113   Sesamum indicum [beniseed]
gb|KJB28962.1|  hypothetical protein B456_005G077100                    360   3e-113   Gossypium raimondii
gb|KJB28961.1|  hypothetical protein B456_005G077100                    360   3e-113   Gossypium raimondii
ref|XP_011042897.1|  PREDICTED: protein GIGANTEA-like                   359   1e-112   Populus euphratica
ref|XP_009631429.1|  PREDICTED: protein GIGANTEA-like isoform X1        357   1e-111   Nicotiana tomentosiformis
gb|AII99806.1|  gigantea                                                356   2e-111   Dimocarpus longan [longan]
ref|XP_009335139.1|  PREDICTED: protein GIGANTEA-like                   356   3e-111   Pyrus x bretschneideri [bai li]
ref|XP_010097648.1|  hypothetical protein L484_023788                   355   6e-111   
ref|XP_004496436.1|  PREDICTED: protein GIGANTEA-like isoform X2        354   6e-111   
gb|AES62297.2|  gigantea protein 1B                                     351   9e-111   Medicago truncatula
ref|XP_006361616.1|  PREDICTED: protein GIGANTEA-like isoform X1        354   1e-110   Solanum tuberosum [potatoes]
gb|ACA24490.1|  gigantea-like protein 2                                 350   2e-110   Glycine max [soybeans]
ref|XP_004496435.1|  PREDICTED: protein GIGANTEA-like isoform X1        353   2e-110   Cicer arietinum [garbanzo]
gb|ABP81863.1|  LATE BLOOMER 1                                          353   2e-110   Pisum sativum [garden pea]
gb|KHN46389.1|  Protein GIGANTEA                                        353   2e-110   Glycine soja [wild soybean]
ref|XP_006386299.1|  hypothetical protein POPTR_0002s06490g             353   4e-110   
ref|XP_002300901.2|  GIGANTEA family protein                            353   4e-110   
ref|XP_008386373.1|  PREDICTED: protein GIGANTEA-like                   352   4e-110   
dbj|BAJ22595.1|  GIGANTEA                                               352   5e-110   Glycine max [soybeans]
ref|XP_011044276.1|  PREDICTED: protein GIGANTEA-like                   352   7e-110   Populus euphratica
gb|KHN17039.1|  Protein GIGANTEA                                        350   2e-109   Glycine soja [wild soybean]
ref|XP_003592046.1|  Protein GIGANTEA                                   350   2e-109   
ref|XP_003556164.1|  PREDICTED: protein GIGANTEA isoformX1              350   2e-109   
gb|AES62299.2|  gigantea protein 1B                                     350   2e-109   Medicago truncatula
gb|ACJ65312.1|  GI1 protein                                             350   2e-109   Glycine max [soybeans]
ref|XP_003592048.1|  Protein GIGANTEA                                   351   2e-109   
ref|XP_004252566.1|  PREDICTED: protein GIGANTEA-like isoform X1        350   3e-109   Solanum lycopersicum
ref|NP_001239995.1|  uncharacterized protein LOC100800578               350   3e-109   
ref|XP_002307516.1|  GIGANTEA family protein                            350   3e-109   
ref|XP_007143577.1|  hypothetical protein PHAVU_007G083500g             350   3e-109   Phaseolus vulgaris [French bean]
gb|EPS65289.1|  hypothetical protein M569_09488                         327   4e-109   Genlisea aurea
dbj|BAN82581.1|  gigantea                                               350   4e-109   Glycine max [soybeans]
ref|XP_006588466.1|  PREDICTED: uncharacterized protein LOC100800...    350   4e-109   Glycine max [soybeans]
ref|XP_006361617.1|  PREDICTED: protein GIGANTEA-like isoform X2        349   6e-109   Solanum tuberosum [potatoes]
dbj|BAN82586.1|  gigantea                                               349   6e-109   Glycine max [soybeans]
dbj|BAM67030.1|  gigantea-like                                          348   8e-109   Chrysanthemum seticuspe f. boreale
gb|AGL61504.1|  gigantea-like protein                                   348   8e-109   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AFK65758.1|  GIGANTEA                                                347   5e-108   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_010314472.1|  PREDICTED: protein GIGANTEA-like isoform X2        345   2e-107   
dbj|BAN82589.1|  gigantea                                               345   3e-107   Glycine max [soybeans]
gb|AGW52153.1|  GI                                                      345   5e-107   Populus tomentosa [Chinese white poplar]
ref|XP_010268583.1|  PREDICTED: protein GIGANTEA-like isoform X1        341   3e-106   Nelumbo nucifera [Indian lotus]
ref|XP_010268589.1|  PREDICTED: protein GIGANTEA-like isoform X2        341   3e-106   Nelumbo nucifera [Indian lotus]
ref|XP_004139688.1|  PREDICTED: protein GIGANTEA-like                   342   3e-106   
gb|ACY30446.1|  gigantea-like protein                                   342   7e-106   Liriodendron tulipifera
gb|KHN41309.1|  Protein GIGANTEA                                        340   1e-105   Glycine soja [wild soybean]
gb|AIR93790.1|  gigantea                                                339   2e-105   Kalanchoe fedtschenkoi [lavender-scallops]
gb|AGU91438.1|  GIGANTEA-like protein                                   336   2e-105   Chrysanthemum boreale
ref|XP_009381150.1|  PREDICTED: protein GIGANTEA-like                   335   9e-104   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008456743.1|  PREDICTED: protein GIGANTEA-like                   335   2e-103   Cucumis melo [Oriental melon]
ref|XP_006473104.1|  PREDICTED: protein GIGANTEA-like isoform X1        334   2e-103   Citrus sinensis [apfelsine]
ref|XP_002890532.1|  hypothetical protein ARALYDRAFT_889789             334   2e-103   Arabidopsis lyrata subsp. lyrata
ref|XP_004160322.1|  PREDICTED: protein GIGANTEA-like                   331   3e-103   
ref|XP_007151935.1|  hypothetical protein PHAVU_004G088300g             333   5e-103   Phaseolus vulgaris [French bean]
ref|XP_006416158.1|  hypothetical protein EUTSA_v10006603mg             330   7e-103   
gb|ABP96481.1|  GIGANTEA                                                333   8e-103   Arabidopsis lyrata subsp. petraea
ref|XP_009631432.1|  PREDICTED: protein GIGANTEA-like isoform X3        333   9e-103   Nicotiana tomentosiformis
ref|XP_006842209.1|  hypothetical protein AMTR_s00078p00173230          332   9e-103   
gb|KFK44368.1|  gigantea                                                332   1e-102   Arabis alpina [alpine rockcress]
ref|XP_004140955.1|  PREDICTED: protein GIGANTEA-like                   332   2e-102   Cucumis sativus [cucumbers]
ref|XP_008786518.1|  PREDICTED: protein GIGANTEA-like                   331   3e-102   
ref|XP_006416159.1|  hypothetical protein EUTSA_v10006603mg             330   6e-102   
ref|XP_010925341.1|  PREDICTED: protein GIGANTEA-like                   330   7e-102   Elaeis guineensis
gb|AAF00023.1|  GIGANTEA                                                329   1e-101   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96485.1|  GIGANTEA                                                329   1e-101   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96497.1|  GIGANTEA                                                329   1e-101   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96484.1|  GIGANTEA                                                329   1e-101   Arabidopsis thaliana [mouse-ear cress]
gb|AAT97404.1|  gigantea                                                329   1e-101   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564180.1|  protein GIGANTEA                                      329   1e-101   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96498.1|  GIGANTEA                                                329   1e-101   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96482.1|  GIGANTEA                                                329   1e-101   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96496.1|  GIGANTEA                                                329   2e-101   Arabidopsis thaliana [mouse-ear cress]
gb|AAT80910.1|  GIGANTEA                                                329   2e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010062087.1|  PREDICTED: protein GIGANTEA isoform X1             328   3e-101   Eucalyptus grandis [rose gum]
gb|KCW69153.1|  hypothetical protein EUGRSUZ_F02686                     328   3e-101   Eucalyptus grandis [rose gum]
gb|ABP96488.1|  GIGANTEA                                                328   6e-101   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96483.1|  GIGANTEA                                                328   6e-101   Arabidopsis thaliana [mouse-ear cress]
gb|KDO83806.1|  hypothetical protein CISIN_1g001216mg                   326   2e-100   Citrus sinensis [apfelsine]
ref|XP_008793464.1|  PREDICTED: protein GIGANTEA-like                   325   3e-100   Phoenix dactylifera
ref|XP_007199688.1|  hypothetical protein PRUPE_ppa000556mg             324   5e-100   
ref|XP_006306336.1|  hypothetical protein CARUB_v10012213mg             324   9e-100   Capsella rubella
ref|XP_010915066.1|  PREDICTED: protein GIGANTEA-like                   324   2e-99    Elaeis guineensis
ref|XP_009115601.1|  PREDICTED: protein GIGANTEA                        324   2e-99    Brassica rapa
emb|CDY21388.1|  BnaA09g30390D                                          323   3e-99    Brassica napus [oilseed rape]
ref|XP_010462850.1|  PREDICTED: protein GIGANTEA-like                   323   3e-99    Camelina sativa [gold-of-pleasure]
ref|XP_010535090.1|  PREDICTED: protein GIGANTEA                        323   3e-99    Tarenaya hassleriana [spider flower]
ref|XP_010261026.1|  PREDICTED: protein GIGANTEA-like isoform X3        322   4e-99    Nelumbo nucifera [Indian lotus]
ref|XP_010498761.1|  PREDICTED: protein GIGANTEA                        322   4e-99    Camelina sativa [gold-of-pleasure]
ref|XP_010477545.1|  PREDICTED: protein GIGANTEA-like isoform X3        322   7e-99    Camelina sativa [gold-of-pleasure]
ref|XP_010477546.1|  PREDICTED: protein GIGANTEA-like isoform X4        322   8e-99    Camelina sativa [gold-of-pleasure]
ref|XP_010261024.1|  PREDICTED: protein GIGANTEA-like isoform X1        322   8e-99    Nelumbo nucifera [Indian lotus]
emb|CDY04787.1|  BnaC05g18020D                                          321   2e-98    
pir||T00767  hypothetical protein T22J18.6 - Arabidopsis thaliana       319   3e-98    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001288824.1|  protein GIGANTEA                                   320   6e-98    Brassica rapa
ref|XP_010681263.1|  PREDICTED: protein GIGANTEA                        319   6e-98    
ref|XP_008672375.1|  PREDICTED: uncharacterized protein LOC100272...    319   9e-98    Zea mays [maize]
gb|AFW80279.1|  gigantea1A isoform 1                                    316   1e-97    
ref|XP_010477544.1|  PREDICTED: protein GIGANTEA-like isoform X2        319   1e-97    Camelina sativa [gold-of-pleasure]
ref|XP_010477543.1|  PREDICTED: protein GIGANTEA-like isoform X1        319   1e-97    Camelina sativa [gold-of-pleasure]
ref|XP_009408935.1|  PREDICTED: protein GIGANTEA-like isoform X2        318   1e-97    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009408933.1|  PREDICTED: protein GIGANTEA-like isoform X1        318   2e-97    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001140728.1|  uncharacterized protein LOC100272803               317   4e-97    
gb|ADP92454.1|  GIGANTEA 1                                              317   4e-97    x Doritaenopsis hybrid cultivar
dbj|BAD97864.1|  GI homologue 1                                         316   7e-97    Lemna aequinoctialis
gb|AFW80281.1|  gigantea1A                                              315   7e-97    
gb|AFW80282.1|  gigantea1A                                              315   7e-97    
ref|XP_008461912.1|  PREDICTED: protein GIGANTEA-like isoform X1        316   1e-96    Cucumis melo [Oriental melon]
ref|NP_001288586.1|  gigantea like1a                                    316   1e-96    Zea mays [maize]
gb|ACJ65314.1|  GI3 protein                                             315   3e-96    Glycine max [soybeans]
emb|CAA72908.1|  hypothetical protein                                   315   4e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004968438.1|  PREDICTED: protein GIGANTEA-like                   312   3e-95    Setaria italica
gb|ABZ81992.1|  gigantea                                                312   3e-95    Zea mays [maize]
ref|NP_001042220.1|  Os01g0182600                                       312   3e-95    
gb|EEE54000.1|  hypothetical protein OsJ_00641                          311   5e-95    Oryza sativa Japonica Group [Japonica rice]
gb|EEC70061.1|  hypothetical protein OsI_00663                          311   5e-95    Oryza sativa Indica Group [Indian rice]
ref|XP_002524341.1|  Protein GIGANTEA, putative                         309   3e-94    
ref|XP_006643836.1|  PREDICTED: protein GIGANTEA-like isoform X1        309   4e-94    Oryza brachyantha
gb|ACT22765.1|  GIGANTEA                                                308   5e-94    Allium cepa
gb|ACT22764.1|  GIGANTEA                                                308   5e-94    Allium cepa
gb|ABR18021.1|  unknown                                                 308   8e-94    Picea sitchensis
ref|XP_009380419.1|  PREDICTED: protein GIGANTEA-like isoform X1        306   3e-93    
gb|AGH20049.1|  GI                                                      305   2e-92    Picea abies
dbj|BAD97869.1|  GI homologue                                           302   6e-92    Lemna gibba
ref|XP_003564357.1|  PREDICTED: protein GIGANTEA                        300   4e-91    
gb|AAW66945.1|  gigantea-like protein                                   299   1e-90    Hordeum vulgare [barley]
emb|CDM81775.1|  unnamed protein product                                298   3e-90    Triticum aestivum [Canadian hard winter wheat]
gb|AAT79486.1|  gigantea 2                                              297   5e-90    Triticum aestivum [Canadian hard winter wheat]
gb|AAT79487.1|  gigantea 3                                              297   7e-90    Triticum aestivum [Canadian hard winter wheat]
emb|CAY26028.1|  GIGANTEA                                               295   4e-89    Lolium perenne [perennial ryegrass]
gb|AIC83986.1|  gigantea-like protein                                   295   4e-89    Festuca pratensis [meadow ryegrass]
ref|XP_006434519.1|  hypothetical protein CICLE_v10004044mg             294   6e-89    
gb|AGM20686.1|  GI1-2                                                   294   7e-89    Populus tomentosa [Chinese white poplar]
gb|AEK05801.1|  gigantea 2                                              289   3e-87    Populus balsamifera [balsam poplar]
gb|AEK05799.1|  gigantea 2                                              289   4e-87    Populus balsamifera [balsam poplar]
gb|AEK05803.1|  gigantea 2                                              289   4e-87    Populus balsamifera [balsam poplar]
gb|AEK05793.1|  gigantea 2                                              289   4e-87    Populus balsamifera [balsam poplar]
gb|AEK05802.1|  gigantea 2                                              289   4e-87    Populus balsamifera [balsam poplar]
gb|AEK05790.1|  gigantea 2                                              289   4e-87    Populus balsamifera [balsam poplar]
gb|AEK05807.1|  gigantea 2                                              289   4e-87    Populus balsamifera [balsam poplar]
gb|AEK05791.1|  gigantea 2                                              289   4e-87    Populus balsamifera [balsam poplar]
gb|AEK05795.1|  gigantea 2                                              288   6e-87    Populus balsamifera [balsam poplar]
ref|XP_010261025.1|  PREDICTED: protein GIGANTEA-like isoform X2        288   1e-86    Nelumbo nucifera [Indian lotus]
gb|ADR51711.1|  GI                                                      287   2e-86    Secale cereale
gb|AAQ11738.1|  gigantea                                                286   7e-86    Triticum aestivum [Canadian hard winter wheat]
ref|XP_002961231.1|  hypothetical protein SELMODRAFT_140066             278   3e-83    
ref|XP_002969462.1|  hypothetical protein SELMODRAFT_170553             278   4e-83    
dbj|BAP76055.1|  putative GI                                            266   1e-78    Cryptomeria japonica
emb|CAN81809.1|  hypothetical protein VITISV_032939                     257   1e-75    Vitis vinifera
dbj|BAO66507.1|  GIGANTEA                                               253   4e-74    Marchantia polymorpha
dbj|BAO74110.1|  GIGANTEA                                               242   1e-70    Lotus japonicus
dbj|BAO74118.1|  GIGANTEA                                               241   2e-70    Lotus japonicus
gb|ACJ09481.1|  putative gigantea                                       213   8e-66    Oryza sativa Indica Group [Indian rice]
gb|ACJ09482.1|  putative gigantea                                       213   9e-66    Oryza sativa Japonica Group [Japonica rice]
gb|ACJ09478.1|  putative gigantea                                       213   9e-66    Oryza sativa Japonica Group [Japonica rice]
gb|ACJ09480.1|  putative gigantea                                       213   1e-65    Oryza sativa Indica Group [Indian rice]
gb|ACJ09479.1|  putative gigantea                                       212   2e-65    Oryza sativa Japonica Group [Japonica rice]
gb|ACJ09488.1|  putative gigantea                                       211   4e-65    Oryza sativa Japonica Group [Japonica rice]
gb|ACJ09483.1|  putative gigantea                                       209   2e-64    Oryza sativa Japonica Group [Japonica rice]
gb|AEK05888.1|  gigantea-5                                              205   2e-63    Populus balsamifera [balsam poplar]
gb|AEK05878.1|  gigantea-5                                              205   2e-63    Populus balsamifera [balsam poplar]
gb|AEK05858.1|  gigantea-5                                              203   7e-63    Populus balsamifera [balsam poplar]
gb|AEK26574.1|  gigantea 5                                              201   4e-62    Populus tremula [European aspen]
gb|AEK05813.1|  gigantea-5                                              195   1e-59    Populus balsamifera [balsam poplar]
gb|AEK05848.1|  gigantea-5                                              195   1e-59    Populus balsamifera [balsam poplar]
gb|EMT06342.1|  hypothetical protein F775_28583                         196   9e-54    
gb|EMS55238.1|  hypothetical protein TRIUR3_30834                       195   2e-53    Triticum urartu
dbj|BAI40156.1|  gigantea-like protein                                  173   2e-51    Diospyros kaki [Japanese persimmon]
gb|KJB59490.1|  hypothetical protein B456_009G258800                    182   3e-49    Gossypium raimondii
gb|KGN44454.1|  LATE BLOOMER 1                                          136   4e-37    
emb|CAB56058.1|  gigantea homologue                                     145   5e-36    Oryza sativa [red rice]
ref|XP_004173872.1|  PREDICTED: protein GIGANTEA-like                   117   1e-29    
gb|ADX35837.1|  gigantea                                                113   3e-28    Brachypodium rupestre
gb|ADX35845.1|  gigantea                                                113   3e-28    Brachypodium mexicanum
gb|ADX35839.1|  gigantea                                                113   4e-28    Brachypodium retusum
gb|ADX35848.1|  gigantea                                                112   5e-28    Brachypodium distachyon [annual false brome]
gb|ADX35844.1|  gigantea                                                112   1e-27    Brachypodium mexicanum
gb|ADX35846.1|  gigantea                                                111   2e-27    Brachypodium distachyon [annual false brome]
gb|AFB78142.1|  gigantea                                                110   3e-27    Brachypodium boissieri
gb|KGN44455.1|  hypothetical protein Csa_7G293730                     97.1    1e-20    
ref|XP_004163795.1|  PREDICTED: protein GIGANTEA-like                 95.1    1e-18    
ref|XP_010062090.1|  PREDICTED: protein GIGANTEA isoform X2           90.1    6e-17    Eucalyptus grandis [rose gum]
ref|XP_008461913.1|  PREDICTED: protein GIGANTEA-like isoform X2      61.2    2e-16    
dbj|BAD68053.1|  putative gigantea                                    79.3    2e-14    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009631436.1|  PREDICTED: protein GIGANTEA-like isoform X7      82.4    2e-14    Nicotiana tomentosiformis
ref|XP_009631435.1|  PREDICTED: protein GIGANTEA-like isoform X6      76.6    2e-12    Nicotiana tomentosiformis
gb|ABV55998.1|  gigantea1A                                            63.2    1e-08    Zea mays [maize]
ref|XP_008461914.1|  PREDICTED: protein GIGANTEA-like isoform X3      61.2    1e-07    



>dbj|BAK19067.1| GIGANTEA [Ipomoea nil]
Length=1166

 Score =   437 bits (1123),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF
Sbjct  48   PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK
Sbjct  108  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  167

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
            SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS
Sbjct  168  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  227

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
            TASSRGSGKHPQLIPSTPRWAVANGAGV
Sbjct  228  TASSRGSGKHPQLIPSTPRWAVANGAGV  255



>emb|CDP11443.1| unnamed protein product [Coffea canephora]
Length=1167

 Score =   391 bits (1004),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 193/208 (93%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAELIRNRYPS+ENRLFDDVLATF+LHHPEHGHAVI PIISCIIDG LEYDKN PPF
Sbjct  48   PEDIAELIRNRYPSEENRLFDDVLATFVLHHPEHGHAVILPIISCIIDGLLEYDKNCPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+NE SEQWALACGEILRILTHYNRPVYKVE  DS+ADR+NSG H STSK
Sbjct  108  ASFISLVCPSSENEYSEQWALACGEILRILTHYNRPVYKVENNDSDADRNNSGKHVSTSK  167

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
             ADG PSL S QH+RKPLR LSPWITDILLAAPLGIRSDYFRWC GVMGKYAAGELKPPS
Sbjct  168  YADGEPSLSSSQHDRKPLRPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGELKPPS  227

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
            T SSRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  228  TVSSRGSGKHPQLMPSTPRWAVANGAGV  255



>ref|XP_009610493.1| PREDICTED: protein GIGANTEA-like [Nicotiana tomentosiformis]
 ref|XP_009610494.1| PREDICTED: protein GIGANTEA-like [Nicotiana tomentosiformis]
Length=1158

 Score =   390 bits (1001),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 183/208 (88%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAELIRNRYPSKENRLFDDVLATF+LHHPEHGHAVIHPIISCIIDGTLEYDK+SPPF
Sbjct  51   PEDIAELIRNRYPSKENRLFDDVLATFVLHHPEHGHAVIHPIISCIIDGTLEYDKSSPPF  110

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+N  SEQWALACGEILRILTHYNRP++KV++Q++ ADRS SGSHASTSK
Sbjct  111  ASFISLVCPSSENGYSEQWALACGEILRILTHYNRPIFKVDRQENRADRSTSGSHASTSK  170

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
            SAD  P + S QHERKPLR LSPWITDILLAAPLGIRSDYFRWC GVMGKYAAGELKPPS
Sbjct  171  SADSEPGVPSIQHERKPLRPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGELKPPS  230

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
            +A+SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  231  SAASRGSGKHPQLLPSTPRWAVANGAGV  258



>ref|XP_009802612.1| PREDICTED: protein GIGANTEA-like [Nicotiana sylvestris]
 ref|XP_009802613.1| PREDICTED: protein GIGANTEA-like [Nicotiana sylvestris]
Length=1156

 Score =   384 bits (985),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 180/208 (87%), Positives = 195/208 (94%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAELIRNRYPSK+NRLFDDVLATF+LHHPEHGHAVIHPIISCIIDGTLEYDK+SPPF
Sbjct  51   PEDIAELIRNRYPSKQNRLFDDVLATFVLHHPEHGHAVIHPIISCIIDGTLEYDKSSPPF  110

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+N  SEQWALACGEILRILTHYNRP++KV++ ++ ADRS SGSHASTSK
Sbjct  111  ASFISLVCPSSENGYSEQWALACGEILRILTHYNRPIFKVDRHENRADRSTSGSHASTSK  170

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
            SAD  P + S QHERK LR LSPWITDILLAAPLGIRSDYFRWC GVMGKYAAGELKPPS
Sbjct  171  SADSEPGVPSIQHERKTLRPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGELKPPS  230

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
            +A+SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  231  SAASRGSGKHPQLLPSTPRWAVANGAGV  258



>emb|CBI22760.3| unnamed protein product [Vitis vinifera]
Length=549

 Score =   367 bits (941),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 191/212 (90%), Gaps = 7/212 (3%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAELIR+RYPSKE RLFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YD+ +PPF
Sbjct  48   PEDIAELIRSRYPSKEQRLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDRCTPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+NE SEQWALACGEILRILTHYNRP+YKVE Q SEADRS+SG HA+TS 
Sbjct  108  ASFISLVCPSSENEYSEQWALACGEILRILTHYNRPIYKVEHQSSEADRSSSGRHATTSD  167

Query  363  SADG----GPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGEL  530
            S DG    GP L   Q+ERKP R LSPWITDILLAAPLGIRSDYFRWC GVMGKYAAGEL
Sbjct  168  SVDGKSSQGPLL---QNERKPSRPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGEL  224

Query  531  KPPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            KPPSTAS+RGSGKHPQLIPSTPRWAVANGAGV
Sbjct  225  KPPSTASTRGSGKHPQLIPSTPRWAVANGAGV  256



>ref|XP_009772049.1| PREDICTED: protein GIGANTEA-like [Nicotiana sylvestris]
Length=1155

 Score =   380 bits (976),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 181/208 (87%), Positives = 193/208 (93%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAELIR+RYPSKENRLFDDVLATF+LHHP+HGHAVI PIISCIIDGTL+YDK+ PPF
Sbjct  48   PEDIAELIRHRYPSKENRLFDDVLATFVLHHPDHGHAVILPIISCIIDGTLDYDKSCPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCPNS+ E SEQWALACGEILRILTHYNRP+YKV +Q+  ADRS+ G+HASTSK
Sbjct  108  ASFISLVCPNSEKEYSEQWALACGEILRILTHYNRPIYKVVQQEGGADRSSGGNHASTSK  167

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
            SAD  PSL S  HERKPLR LSPWITDIL+AAPLGIRSDYFRWC GVMGKYAAGELKPPS
Sbjct  168  SADSEPSLPSMHHERKPLRPLSPWITDILVAAPLGIRSDYFRWCGGVMGKYAAGELKPPS  227

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
            TASSRGSGKHPQLIPSTPRWAVANGAGV
Sbjct  228  TASSRGSGKHPQLIPSTPRWAVANGAGV  255



>ref|XP_004237832.1| PREDICTED: protein GIGANTEA [Solanum lycopersicum]
Length=1167

 Score =   378 bits (970),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 180/208 (87%), Positives = 189/208 (91%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAELIRNRYPSKENRLFDDVLATF+LHHPEHGH VI PIISCIIDGTL+YDK+ PPF
Sbjct  48   PEDIAELIRNRYPSKENRLFDDVLATFVLHHPEHGHTVILPIISCIIDGTLDYDKSCPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+ E SEQWALACGEILRILTHYNRP+YKV +Q  EADRS+ G  ASTSK
Sbjct  108  ASFISLVCPSSEKEYSEQWALACGEILRILTHYNRPIYKVVQQGGEADRSSQGIDASTSK  167

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
            SAD GPS+ S  HERK LR LSPWITDILL APLGIRSDYFRWC GVMGKYAAGELKPPS
Sbjct  168  SADSGPSMPSVHHERKTLRPLSPWITDILLTAPLGIRSDYFRWCGGVMGKYAAGELKPPS  227

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
            TASSRGSGKHPQLIPSTPRWAVANGAGV
Sbjct  228  TASSRGSGKHPQLIPSTPRWAVANGAGV  255



>ref|XP_006359040.1| PREDICTED: protein GIGANTEA-like isoform X2 [Solanum tuberosum]
Length=1166

 Score =   376 bits (965),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 179/208 (86%), Positives = 189/208 (91%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAELIRNRYPSKENRLFDDVLATF+LHHPEHGH VI PIISCIIDGTL+YDK+ PPF
Sbjct  48   PEDIAELIRNRYPSKENRLFDDVLATFVLHHPEHGHTVILPIISCIIDGTLDYDKSCPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
             SFISLVCP+S+ E SEQWALACGEILRILTHYNRP+YKV +Q  EADRS+ G HASTSK
Sbjct  108  TSFISLVCPSSEKEYSEQWALACGEILRILTHYNRPIYKVVQQGGEADRSSRGIHASTSK  167

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
            SAD  PS+ S  HERK LR LSPWITDILLAAPLGIRSDYFRWC GVMGKYA+GELKPPS
Sbjct  168  SADSEPSMPSVHHERKTLRPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYASGELKPPS  227

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
            TASSRGSGKHPQLIPSTPRWAVANGAGV
Sbjct  228  TASSRGSGKHPQLIPSTPRWAVANGAGV  255



>ref|XP_006359039.1| PREDICTED: protein GIGANTEA-like isoform X1 [Solanum tuberosum]
Length=1189

 Score =   376 bits (966),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 179/208 (86%), Positives = 189/208 (91%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAELIRNRYPSKENRLFDDVLATF+LHHPEHGH VI PIISCIIDGTL+YDK+ PPF
Sbjct  71   PEDIAELIRNRYPSKENRLFDDVLATFVLHHPEHGHTVILPIISCIIDGTLDYDKSCPPF  130

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
             SFISLVCP+S+ E SEQWALACGEILRILTHYNRP+YKV +Q  EADRS+ G HASTSK
Sbjct  131  TSFISLVCPSSEKEYSEQWALACGEILRILTHYNRPIYKVVQQGGEADRSSRGIHASTSK  190

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
            SAD  PS+ S  HERK LR LSPWITDILLAAPLGIRSDYFRWC GVMGKYA+GELKPPS
Sbjct  191  SADSEPSMPSVHHERKTLRPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYASGELKPPS  250

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
            TASSRGSGKHPQLIPSTPRWAVANGAGV
Sbjct  251  TASSRGSGKHPQLIPSTPRWAVANGAGV  278



>ref|XP_009631434.1| PREDICTED: protein GIGANTEA-like isoform X5 [Nicotiana tomentosiformis]
Length=1155

 Score =   372 bits (955),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 179/208 (86%), Positives = 189/208 (91%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAELIR+RYPSKENRLFDDVLATF+LHHPEHGHAVI PIISCIIDGTL+YDK+ PPF
Sbjct  48   PEDIAELIRHRYPSKENRLFDDVLATFVLHHPEHGHAVILPIISCIIDGTLDYDKSCPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+ E SEQWALACGEILRILTHYNRP+YKV +Q+  ADRS+ GSHASTSK
Sbjct  108  ASFISLVCPSSEKEYSEQWALACGEILRILTHYNRPIYKVVQQEGGADRSSRGSHASTSK  167

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
             AD  P L S  HERKPLR LSPWITDILLAAPLGIRSDYFRWC GVMGKYAAGELKPPS
Sbjct  168  FADSEPRLPSMHHERKPLRPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGELKPPS  227

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
            TASS GSGKH QLIPSTPRWAVANGAGV
Sbjct  228  TASSHGSGKHHQLIPSTPRWAVANGAGV  255



>ref|XP_007019603.1| Gigantea protein isoform 3 [Theobroma cacao]
 gb|EOY16828.1| Gigantea protein isoform 3 [Theobroma cacao]
Length=1171

 Score =   370 bits (950),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 175/210 (83%), Positives = 190/210 (90%), Gaps = 2/210 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAEL+RNRYP KE RLFDDVLA F+LHHPEHGHAV+ PIISCIIDGTL YDK++PPF
Sbjct  48   PEDIAELVRNRYPHKEQRLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLVYDKSTPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+NE SEQWALACGEILRILTHYNRP+YK+E+Q+SE DRSNS   A+TS+
Sbjct  108  ASFISLVCPSSENEYSEQWALACGEILRILTHYNRPIYKMEQQNSETDRSNSSGQATTSE  167

Query  363  SADGGPSLLSP--QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKP  536
              DG PS   P  Q ERKPLR LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAG+LKP
Sbjct  168  PVDGEPSFHIPLMQQERKPLRPLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGDLKP  227

Query  537  PSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            PSTASSRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  228  PSTASSRGSGKHPQLMPSTPRWAVANGAGV  257



>ref|XP_007019601.1| Gigantea protein isoform 1 [Theobroma cacao]
 ref|XP_007019602.1| Gigantea protein isoform 1 [Theobroma cacao]
 gb|EOY16826.1| Gigantea protein isoform 1 [Theobroma cacao]
 gb|EOY16827.1| Gigantea protein isoform 1 [Theobroma cacao]
Length=1170

 Score =   370 bits (949),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 175/210 (83%), Positives = 190/210 (90%), Gaps = 2/210 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAEL+RNRYP KE RLFDDVLA F+LHHPEHGHAV+ PIISCIIDGTL YDK++PPF
Sbjct  48   PEDIAELVRNRYPHKEQRLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLVYDKSTPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+NE SEQWALACGEILRILTHYNRP+YK+E+Q+SE DRSNS   A+TS+
Sbjct  108  ASFISLVCPSSENEYSEQWALACGEILRILTHYNRPIYKMEQQNSETDRSNSSGQATTSE  167

Query  363  SADGGPSLLSP--QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKP  536
              DG PS   P  Q ERKPLR LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAG+LKP
Sbjct  168  PVDGEPSFHIPLMQQERKPLRPLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGDLKP  227

Query  537  PSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            PSTASSRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  228  PSTASSRGSGKHPQLMPSTPRWAVANGAGV  257



>ref|XP_007019604.1| Gigantea protein isoform 4 [Theobroma cacao]
 gb|EOY16829.1| Gigantea protein isoform 4 [Theobroma cacao]
Length=1147

 Score =   369 bits (948),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 175/210 (83%), Positives = 190/210 (90%), Gaps = 2/210 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAEL+RNRYP KE RLFDDVLA F+LHHPEHGHAV+ PIISCIIDGTL YDK++PPF
Sbjct  48   PEDIAELVRNRYPHKEQRLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLVYDKSTPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+NE SEQWALACGEILRILTHYNRP+YK+E+Q+SE DRSNS   A+TS+
Sbjct  108  ASFISLVCPSSENEYSEQWALACGEILRILTHYNRPIYKMEQQNSETDRSNSSGQATTSE  167

Query  363  SADGGPSLLSP--QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKP  536
              DG PS   P  Q ERKPLR LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAG+LKP
Sbjct  168  PVDGEPSFHIPLMQQERKPLRPLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGDLKP  227

Query  537  PSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            PSTASSRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  228  PSTASSRGSGKHPQLMPSTPRWAVANGAGV  257



>ref|XP_002264755.1| PREDICTED: protein GIGANTEA [Vitis vinifera]
 ref|XP_010665061.1| PREDICTED: protein GIGANTEA [Vitis vinifera]
 ref|XP_010665062.1| PREDICTED: protein GIGANTEA [Vitis vinifera]
Length=1170

 Score =   370 bits (949),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 191/212 (90%), Gaps = 7/212 (3%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAELIR+RYPSKE RLFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YD+ +PPF
Sbjct  48   PEDIAELIRSRYPSKEQRLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDRCTPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+NE SEQWALACGEILRILTHYNRP+YKVE Q SEADRS+SG HA+TS 
Sbjct  108  ASFISLVCPSSENEYSEQWALACGEILRILTHYNRPIYKVEHQSSEADRSSSGRHATTSD  167

Query  363  SADG----GPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGEL  530
            S DG    GP L   Q+ERKP R LSPWITDILLAAPLGIRSDYFRWC GVMGKYAAGEL
Sbjct  168  SVDGKSSQGPLL---QNERKPSRPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGEL  224

Query  531  KPPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            KPPSTAS+RGSGKHPQLIPSTPRWAVANGAGV
Sbjct  225  KPPSTASTRGSGKHPQLIPSTPRWAVANGAGV  256



>gb|KHG25928.1| Protein GIGANTEA [Gossypium arboreum]
 gb|KHG25929.1| Protein GIGANTEA [Gossypium arboreum]
Length=755

 Score =   360 bits (924),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 173/210 (82%), Positives = 188/210 (90%), Gaps = 2/210 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAEL+RNRYPS E RLFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YDKN+PPF
Sbjct  48   PEDIAELVRNRYPSDEQRLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKNAPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            +SFISLVCP+S+NE SEQWALACGEILRILTHYNRP+ K E  +SEADRSNS S A+TS+
Sbjct  108  SSFISLVCPSSENEYSEQWALACGEILRILTHYNRPICKTELPNSEADRSNSSSQATTSE  167

Query  363  SADGGPSLLSP--QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKP  536
            SADG  S   P  + ERKPLR LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAG+L+P
Sbjct  168  SADGESSFHIPSVRQERKPLRPLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGDLRP  227

Query  537  PSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            P TAS RGSGKHPQL+PSTPRWAVANGAGV
Sbjct  228  PMTASIRGSGKHPQLMPSTPRWAVANGAGV  257



>gb|KDP36552.1| hypothetical protein JCGZ_08319 [Jatropha curcas]
Length=1168

 Score =   368 bits (945),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 193/212 (91%), Gaps = 7/212 (3%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAELIRNRYPSKE RLFDDVLATF+LHHPEHGHAV+ PIISC+IDGTL YD++SPPF
Sbjct  48   PDDIAELIRNRYPSKEKRLFDDVLATFVLHHPEHGHAVVLPIISCLIDGTLVYDRSSPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+NE SEQWALACGEILRILTHYNRPVYKVE+Q+SE +R N G++A++S 
Sbjct  108  ASFISLVCPSSENEYSEQWALACGEILRILTHYNRPVYKVEQQNSEMERKNDGNYATSSG  167

Query  363  SADG----GPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGEL  530
            S DG     PS+   Q ERKPLR LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGEL
Sbjct  168  SVDGEACHAPSV---QQERKPLRPLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGEL  224

Query  531  KPPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            KPP+TASSRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  225  KPPTTASSRGSGKHPQLMPSTPRWAVANGAGV  256



>ref|XP_008237480.1| PREDICTED: protein GIGANTEA [Prunus mume]
 ref|XP_008237481.1| PREDICTED: protein GIGANTEA [Prunus mume]
 ref|XP_008237482.1| PREDICTED: protein GIGANTEA [Prunus mume]
 ref|XP_008237483.1| PREDICTED: protein GIGANTEA [Prunus mume]
Length=1170

 Score =   368 bits (944),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 176/209 (84%), Positives = 191/209 (91%), Gaps = 1/209 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAELIRNRYPS+  RLFDDVLA F+LHHPEHGHAVI PIISCIIDGTL Y++ SPPF
Sbjct  48   PEDIAELIRNRYPSEVKRLFDDVLAMFVLHHPEHGHAVILPIISCIIDGTLAYERISPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+NE SEQWALACGEILRILTHYNRP+YKVE+Q+SE +RS+SGSHA+TS 
Sbjct  108  ASFISLVCPSSENEYSEQWALACGEILRILTHYNRPIYKVEQQNSETERSSSGSHATTSD  167

Query  363  SADGGPSLLS-PQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  539
            S DG  S +   Q ERKP+R LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP
Sbjct  168  SVDGESSHIPLVQQERKPIRPLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  227

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            STASSRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  228  STASSRGSGKHPQLMPSTPRWAVANGAGV  256



>ref|XP_011074106.1| PREDICTED: protein GIGANTEA-like isoform X2 [Sesamum indicum]
Length=1138

 Score =   367 bits (941),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 174/211 (82%), Positives = 191/211 (91%), Gaps = 3/211 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAELIRNRYPS ENRLFDDVLATF+LHHPEHGHAVI PIISCIIDG+LEYD++ PPF
Sbjct  48   PDDIAELIRNRYPSNENRLFDDVLATFVLHHPEHGHAVILPIISCIIDGSLEYDRSGPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYK---VEKQDSEADRSNSGSHAS  353
            ASFISLVCPNS+ E +EQWALACGEILRILTHYNRP+Y+   +E  + EADRS+SG+HAS
Sbjct  108  ASFISLVCPNSEMEYTEQWALACGEILRILTHYNRPIYRRELLEPSEKEADRSSSGTHAS  167

Query  354  TSKSADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELK  533
            TS+S DG PSL   Q ERKPLR LSPWITDILLAAPL IRSDYFRWC GVMGKYAAG+LK
Sbjct  168  TSRSKDGEPSLPPTQLERKPLRPLSPWITDILLAAPLAIRSDYFRWCGGVMGKYAAGQLK  227

Query  534  PPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            PPSTA+SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  228  PPSTATSRGSGKHPQLMPSTPRWAVANGAGV  258



>gb|AJC01622.1| gigantea [Prunus dulcis]
Length=1170

 Score =   367 bits (942),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 175/209 (84%), Positives = 190/209 (91%), Gaps = 1/209 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAELIRNRYPS+  RLFDDVLA F+LHHPEHGHAVI PIISCIIDGTL Y++ SPPF
Sbjct  48   PEDIAELIRNRYPSEVKRLFDDVLAMFVLHHPEHGHAVILPIISCIIDGTLAYERTSPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+NE SEQWALACGEILRILTHYNRP+YKVE+Q+SE +RS+SGSHA+TS 
Sbjct  108  ASFISLVCPSSENEYSEQWALACGEILRILTHYNRPIYKVEQQNSETERSSSGSHATTSD  167

Query  363  SADGGPSLLS-PQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  539
            S DG    +   Q ERKP+R LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP
Sbjct  168  SVDGESRHIPLVQQERKPIRPLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  227

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            STASSRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  228  STASSRGSGKHPQLMPSTPRWAVANGAGV  256



>gb|EYU30283.1| hypothetical protein MIMGU_mgv1a000455mg [Erythranthe guttata]
Length=1141

 Score =   366 bits (940),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 174/209 (83%), Positives = 191/209 (91%), Gaps = 1/209 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P++IAELIR+RYPSKENRLFDDVLATF+LHHPEHGH+VIHPIISCIID TLEYDK+ PPF
Sbjct  48   PDEIAELIRSRYPSKENRLFDDVLATFVLHHPEHGHSVIHPIISCIIDSTLEYDKSGPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLV P S+NE SEQWALACGEILRILTHYNRP+YK+E+Q++E DRS+SG+HASTS 
Sbjct  108  ASFISLVSPKSENEYSEQWALACGEILRILTHYNRPIYKLERQENEGDRSSSGNHASTSM  167

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
            S DG PSL S Q ERK  R LSPWITDILLAAPLG+RSDYFRWC GVMGKYAAGELKPP 
Sbjct  168  STDGEPSLPSTQSERKTTRPLSPWITDILLAAPLGVRSDYFRWCGGVMGKYAAGELKPPL  227

Query  543  T-ASSRGSGKHPQLIPSTPRWAVANGAGV  626
            T +SSRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  228  TVSSSRGSGKHPQLMPSTPRWAVANGAGV  256



>gb|EYU36555.1| hypothetical protein MIMGU_mgv1a000427mg [Erythranthe guttata]
Length=1160

 Score =   367 bits (941),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 189/208 (91%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAEL+R+RYPS +NRLFDDVLA F+LHHPEHGHAVI PIISCIIDG +EY ++ PPF
Sbjct  48   PDDIAELVRSRYPSDQNRLFDDVLAKFVLHHPEHGHAVILPIISCIIDGLVEYKRSGPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCPNS+NE SEQWALACGEILRILTHYNRP+YK E+Q++E DRS+SG+ ASTSK
Sbjct  108  ASFISLVCPNSENEYSEQWALACGEILRILTHYNRPIYKRERQENETDRSSSGTLASTSK  167

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
            S DG PSL S Q ERK LR LSPWITDILLAAPLGIRSDYFRWC GVMGKYAAGELKPPS
Sbjct  168  STDGEPSLPSTQLERKMLRPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGELKPPS  227

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
            TA SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  228  TAFSRGSGKHPQLVPSTPRWAVANGAGV  255



>gb|KJB59491.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
Length=975

 Score =   363 bits (931),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 174/210 (83%), Positives = 190/210 (90%), Gaps = 2/210 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAELIR RYPSKE RLFDDVLATF+LHHPEHGHAV+ PIIS IIDG+L YDK+S PF
Sbjct  48   PEDIAELIRTRYPSKEQRLFDDVLATFVLHHPEHGHAVVLPIISGIIDGSLVYDKSSLPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+NE SEQWALACGEILRILTHYNRP+YK+E Q++E DRS+S S A+TS+
Sbjct  108  ASFISLVCPSSENEYSEQWALACGEILRILTHYNRPIYKMEPQNNETDRSHSSSQATTSE  167

Query  363  SADGGPSLLSP--QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKP  536
            S DG PS   P  Q ERKPLR LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAG+LKP
Sbjct  168  SVDGEPSFQIPLMQQERKPLRPLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGDLKP  227

Query  537  PSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            P+TASSRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  228  PTTASSRGSGKHPQLMPSTPRWAVANGAGV  257



>ref|XP_011074103.1| PREDICTED: protein GIGANTEA-like isoform X1 [Sesamum indicum]
 ref|XP_011074104.1| PREDICTED: protein GIGANTEA-like isoform X1 [Sesamum indicum]
 ref|XP_011074105.1| PREDICTED: protein GIGANTEA-like isoform X1 [Sesamum indicum]
Length=1169

 Score =   367 bits (941),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 174/211 (82%), Positives = 191/211 (91%), Gaps = 3/211 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAELIRNRYPS ENRLFDDVLATF+LHHPEHGHAVI PIISCIIDG+LEYD++ PPF
Sbjct  48   PDDIAELIRNRYPSNENRLFDDVLATFVLHHPEHGHAVILPIISCIIDGSLEYDRSGPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYK---VEKQDSEADRSNSGSHAS  353
            ASFISLVCPNS+ E +EQWALACGEILRILTHYNRP+Y+   +E  + EADRS+SG+HAS
Sbjct  108  ASFISLVCPNSEMEYTEQWALACGEILRILTHYNRPIYRRELLEPSEKEADRSSSGTHAS  167

Query  354  TSKSADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELK  533
            TS+S DG PSL   Q ERKPLR LSPWITDILLAAPL IRSDYFRWC GVMGKYAAG+LK
Sbjct  168  TSRSKDGEPSLPPTQLERKPLRPLSPWITDILLAAPLAIRSDYFRWCGGVMGKYAAGQLK  227

Query  534  PPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            PPSTA+SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  228  PPSTATSRGSGKHPQLMPSTPRWAVANGAGV  258



>ref|XP_009631433.1| PREDICTED: protein GIGANTEA-like isoform X4 [Nicotiana tomentosiformis]
Length=1159

 Score =   366 bits (940),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 189/212 (89%), Gaps = 4/212 (2%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAELIR+RYPSKENRLFDDVLATF+LHHPEHGHAVI PIISCIIDGTL+YDK+ PPF
Sbjct  48   PEDIAELIRHRYPSKENRLFDDVLATFVLHHPEHGHAVILPIISCIIDGTLDYDKSCPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+ E SEQWALACGEILRILTHYNRP+YKV +Q+  ADRS+ GSHASTSK
Sbjct  108  ASFISLVCPSSEKEYSEQWALACGEILRILTHYNRPIYKVVQQEGGADRSSRGSHASTSK  167

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
             AD  P L S  HERKPLR LSPWITDILLAAPLGIRSDYFRWC GVMGKYAAGELKPPS
Sbjct  168  FADSEPRLPSMHHERKPLRPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGELKPPS  227

Query  543  T----ASSRGSGKHPQLIPSTPRWAVANGAGV  626
            T    ASS GSGKH QLIPSTPRWAVANGAGV
Sbjct  228  TDFIVASSHGSGKHHQLIPSTPRWAVANGAGV  259



>ref|XP_004290483.1| PREDICTED: protein GIGANTEA [Fragaria vesca subsp. vesca]
 ref|XP_011458472.1| PREDICTED: protein GIGANTEA [Fragaria vesca subsp. vesca]
 ref|XP_011458473.1| PREDICTED: protein GIGANTEA [Fragaria vesca subsp. vesca]
Length=1178

 Score =   367 bits (941),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 174/209 (83%), Positives = 191/209 (91%), Gaps = 1/209 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDI+ELIRNRYPS+  RLFDDVLA F+LHHPEHGHAV+ PIISCIIDGTL Y++ SPPF
Sbjct  48   PEDISELIRNRYPSEVKRLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLPYERTSPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+ E SEQWALACGEILRILTHYNRP+YKVE+Q+SE +RS+SGSHA+TS 
Sbjct  108  ASFISLVCPSSEKEYSEQWALACGEILRILTHYNRPIYKVEQQNSETERSSSGSHATTSD  167

Query  363  SADGGPSLL-SPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  539
            S DG  S + S Q ERKP+R LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP
Sbjct  168  SVDGESSHVPSVQQERKPIRPLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  227

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            STASSRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  228  STASSRGSGKHPQLMPSTPRWAVANGAGV  256



>gb|KJB59493.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
Length=973

 Score =   363 bits (931),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 174/210 (83%), Positives = 190/210 (90%), Gaps = 2/210 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAELIR RYPSKE RLFDDVLATF+LHHPEHGHAV+ PIIS IIDG+L YDK+S PF
Sbjct  48   PEDIAELIRTRYPSKEQRLFDDVLATFVLHHPEHGHAVVLPIISGIIDGSLVYDKSSLPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+NE SEQWALACGEILRILTHYNRP+YK+E Q++E DRS+S S A+TS+
Sbjct  108  ASFISLVCPSSENEYSEQWALACGEILRILTHYNRPIYKMEPQNNETDRSHSSSQATTSE  167

Query  363  SADGGPSLLSP--QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKP  536
            S DG PS   P  Q ERKPLR LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAG+LKP
Sbjct  168  SVDGEPSFQIPLMQQERKPLRPLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGDLKP  227

Query  537  PSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            P+TASSRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  228  PTTASSRGSGKHPQLMPSTPRWAVANGAGV  257



>gb|KJB28963.1| hypothetical protein B456_005G077100 [Gossypium raimondii]
Length=970

 Score =   361 bits (926),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 172/210 (82%), Positives = 188/210 (90%), Gaps = 2/210 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAEL+RNRYPS E RLFDDVLATF+LHHPEHGHAV+ PII+CIIDGTL YDKN+PPF
Sbjct  48   PEDIAELVRNRYPSDEQRLFDDVLATFVLHHPEHGHAVVLPIIACIIDGTLMYDKNAPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            +SFISLVCP+S+NE SEQWALACGEILRILTHYNRP+ K E  +SEADRSNS S A+TS+
Sbjct  108  SSFISLVCPSSENEYSEQWALACGEILRILTHYNRPICKTELPNSEADRSNSSSQATTSE  167

Query  363  SADGGPSLLSP--QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKP  536
            SADG  S   P  + ERKPLR LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAG+L+P
Sbjct  168  SADGESSFHMPSMRQERKPLRPLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGDLRP  227

Query  537  PSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            P TAS RGSGKHPQL+PSTPRWAVANGAGV
Sbjct  228  PMTASIRGSGKHPQLMPSTPRWAVANGAGV  257



>gb|KJB28960.1| hypothetical protein B456_005G077100 [Gossypium raimondii]
Length=1001

 Score =   362 bits (928),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 172/210 (82%), Positives = 188/210 (90%), Gaps = 2/210 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAEL+RNRYPS E RLFDDVLATF+LHHPEHGHAV+ PII+CIIDGTL YDKN+PPF
Sbjct  48   PEDIAELVRNRYPSDEQRLFDDVLATFVLHHPEHGHAVVLPIIACIIDGTLMYDKNAPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            +SFISLVCP+S+NE SEQWALACGEILRILTHYNRP+ K E  +SEADRSNS S A+TS+
Sbjct  108  SSFISLVCPSSENEYSEQWALACGEILRILTHYNRPICKTELPNSEADRSNSSSQATTSE  167

Query  363  SADGGPSLLSP--QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKP  536
            SADG  S   P  + ERKPLR LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAG+L+P
Sbjct  168  SADGESSFHMPSMRQERKPLRPLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGDLRP  227

Query  537  PSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            P TAS RGSGKHPQL+PSTPRWAVANGAGV
Sbjct  228  PMTASIRGSGKHPQLMPSTPRWAVANGAGV  257



>gb|KJB59492.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
Length=1055

 Score =   362 bits (930),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 174/210 (83%), Positives = 190/210 (90%), Gaps = 2/210 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAELIR RYPSKE RLFDDVLATF+LHHPEHGHAV+ PIIS IIDG+L YDK+S PF
Sbjct  48   PEDIAELIRTRYPSKEQRLFDDVLATFVLHHPEHGHAVVLPIISGIIDGSLVYDKSSLPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+NE SEQWALACGEILRILTHYNRP+YK+E Q++E DRS+S S A+TS+
Sbjct  108  ASFISLVCPSSENEYSEQWALACGEILRILTHYNRPIYKMEPQNNETDRSHSSSQATTSE  167

Query  363  SADGGPSLLSP--QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKP  536
            S DG PS   P  Q ERKPLR LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAG+LKP
Sbjct  168  SVDGEPSFQIPLMQQERKPLRPLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGDLKP  227

Query  537  PSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            P+TASSRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  228  PTTASSRGSGKHPQLMPSTPRWAVANGAGV  257



>ref|XP_009336496.1| PREDICTED: protein GIGANTEA-like [Pyrus x bretschneideri]
Length=1170

 Score =   363 bits (933),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 174/209 (83%), Positives = 189/209 (90%), Gaps = 1/209 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAELIRNRYPS+  RLFDDVLA F+LHHPEHGHAVI PIISCIIDGTL Y  +SPPF
Sbjct  48   PEDIAELIRNRYPSEVKRLFDDVLAMFVLHHPEHGHAVILPIISCIIDGTLAYKSSSPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+ E SEQWALACGEILRILTHYNRP+YKVE+Q+SE +RS+SGSHA+TS 
Sbjct  108  ASFISLVCPSSEKEYSEQWALACGEILRILTHYNRPIYKVEQQNSETERSSSGSHATTSD  167

Query  363  SADGGPSLLS-PQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  539
            S DG  S +   Q E+KP+R LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP
Sbjct  168  SVDGESSRIPLVQQEKKPIRPLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  227

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            STASSRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  228  STASSRGSGKHPQLMPSTPRWAVANGAGV  256



>gb|KJB59494.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
 gb|KJB59495.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
 gb|KJB59496.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
 gb|KJB59497.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
 gb|KJB59498.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
Length=1168

 Score =   363 bits (931),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 174/210 (83%), Positives = 190/210 (90%), Gaps = 2/210 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAELIR RYPSKE RLFDDVLATF+LHHPEHGHAV+ PIIS IIDG+L YDK+S PF
Sbjct  48   PEDIAELIRTRYPSKEQRLFDDVLATFVLHHPEHGHAVVLPIISGIIDGSLVYDKSSLPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+NE SEQWALACGEILRILTHYNRP+YK+E Q++E DRS+S S A+TS+
Sbjct  108  ASFISLVCPSSENEYSEQWALACGEILRILTHYNRPIYKMEPQNNETDRSHSSSQATTSE  167

Query  363  SADGGPSLLSP--QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKP  536
            S DG PS   P  Q ERKPLR LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAG+LKP
Sbjct  168  SVDGEPSFQIPLMQQERKPLRPLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGDLKP  227

Query  537  PSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            P+TASSRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  228  PTTASSRGSGKHPQLMPSTPRWAVANGAGV  257



>gb|KJB28964.1| hypothetical protein B456_005G077100 [Gossypium raimondii]
Length=1080

 Score =   361 bits (927),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 172/210 (82%), Positives = 188/210 (90%), Gaps = 2/210 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAEL+RNRYPS E RLFDDVLATF+LHHPEHGHAV+ PII+CIIDGTL YDKN+PPF
Sbjct  48   PEDIAELVRNRYPSDEQRLFDDVLATFVLHHPEHGHAVVLPIIACIIDGTLMYDKNAPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            +SFISLVCP+S+NE SEQWALACGEILRILTHYNRP+ K E  +SEADRSNS S A+TS+
Sbjct  108  SSFISLVCPSSENEYSEQWALACGEILRILTHYNRPICKTELPNSEADRSNSSSQATTSE  167

Query  363  SADGGPSLLSP--QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKP  536
            SADG  S   P  + ERKPLR LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAG+L+P
Sbjct  168  SADGESSFHMPSMRQERKPLRPLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGDLRP  227

Query  537  PSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            P TAS RGSGKHPQL+PSTPRWAVANGAGV
Sbjct  228  PMTASIRGSGKHPQLMPSTPRWAVANGAGV  257



>ref|XP_008381855.1| PREDICTED: protein GIGANTEA-like [Malus domestica]
Length=1170

 Score =   362 bits (929),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 173/209 (83%), Positives = 188/209 (90%), Gaps = 1/209 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAELIRNRYPS+  RLFDDVLA F+LHHPEHGHAVI PIISCIIDGTL Y  +SPPF
Sbjct  48   PEDIAELIRNRYPSEVKRLFDDVLAMFVLHHPEHGHAVILPIISCIIDGTLXYKSSSPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+ E SEQWALACGEILRILTHYNRP+YKVE+Q+ E +RS+SGSHA+TS 
Sbjct  108  ASFISLVCPSSEKEYSEQWALACGEILRILTHYNRPIYKVEQQNCETERSSSGSHATTSD  167

Query  363  SADGGPSLLS-PQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  539
            S DG  S +   Q E+KP+R LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP
Sbjct  168  SVDGESSRIPLVQQEKKPIRPLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  227

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            STASSRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  228  STASSRGSGKHPQLMPSTPRWAVANGAGV  256



>ref|XP_009631431.1| PREDICTED: protein GIGANTEA-like isoform X2 [Nicotiana tomentosiformis]
Length=1169

 Score =   362 bits (929),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 179/222 (81%), Positives = 189/222 (85%), Gaps = 14/222 (6%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAELIR+RYPSKENRLFDDVLATF+LHHPEHGHAVI PIISCIIDGTL+YDK+ PPF
Sbjct  48   PEDIAELIRHRYPSKENRLFDDVLATFVLHHPEHGHAVILPIISCIIDGTLDYDKSCPPF  107

Query  183  ASFISLVCPNSQ--------------NELSEQWALACGEILRILTHYNRPVYKVEKQDSE  320
            ASFISLVCP+S+               E SEQWALACGEILRILTHYNRP+YKV +Q+  
Sbjct  108  ASFISLVCPSSEVLRILNYQFEGLSHKEYSEQWALACGEILRILTHYNRPIYKVVQQEGG  167

Query  321  ADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSG  500
            ADRS+ GSHASTSK AD  P L S  HERKPLR LSPWITDILLAAPLGIRSDYFRWC G
Sbjct  168  ADRSSRGSHASTSKFADSEPRLPSMHHERKPLRPLSPWITDILLAAPLGIRSDYFRWCGG  227

Query  501  VMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            VMGKYAAGELKPPSTASS GSGKH QLIPSTPRWAVANGAGV
Sbjct  228  VMGKYAAGELKPPSTASSHGSGKHHQLIPSTPRWAVANGAGV  269



>ref|XP_011100590.1| PREDICTED: protein GIGANTEA-like [Sesamum indicum]
Length=1166

 Score =   362 bits (929),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 172/208 (83%), Positives = 187/208 (90%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAELIR+RYPSKE RLFDDVLATF+LHHPEHGHAVI PIISCIID +LEYD++SPPF
Sbjct  48   PDDIAELIRSRYPSKEIRLFDDVLATFVLHHPEHGHAVILPIISCIIDCSLEYDRSSPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLV PNS+NE  EQWALACGEILRILTHYNRP+YK+E+QDS+ D+ +SG HASTS 
Sbjct  108  ASFISLVYPNSENEYLEQWALACGEILRILTHYNRPIYKLEQQDSDTDKRSSGDHASTSN  167

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
            S DG       Q ERKPLR LSPWITDILLAAPLGIRSDYFRWC GVMGKYAAGELKPP+
Sbjct  168  STDGEADFPPTQPERKPLRPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGELKPPT  227

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
            TASSRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  228  TASSRGSGKHPQLMPSTPRWAVANGAGV  255



>gb|KJB28962.1| hypothetical protein B456_005G077100 [Gossypium raimondii]
Length=1147

 Score =   360 bits (925),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/210 (82%), Positives = 188/210 (90%), Gaps = 2/210 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAEL+RNRYPS E RLFDDVLATF+LHHPEHGHAV+ PII+CIIDGTL YDKN+PPF
Sbjct  48   PEDIAELVRNRYPSDEQRLFDDVLATFVLHHPEHGHAVVLPIIACIIDGTLMYDKNAPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            +SFISLVCP+S+NE SEQWALACGEILRILTHYNRP+ K E  +SEADRSNS S A+TS+
Sbjct  108  SSFISLVCPSSENEYSEQWALACGEILRILTHYNRPICKTELPNSEADRSNSSSQATTSE  167

Query  363  SADGGPSLLSP--QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKP  536
            SADG  S   P  + ERKPLR LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAG+L+P
Sbjct  168  SADGESSFHMPSMRQERKPLRPLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGDLRP  227

Query  537  PSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            P TAS RGSGKHPQL+PSTPRWAVANGAGV
Sbjct  228  PMTASIRGSGKHPQLMPSTPRWAVANGAGV  257



>gb|KJB28961.1| hypothetical protein B456_005G077100 [Gossypium raimondii]
Length=1155

 Score =   360 bits (925),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/210 (82%), Positives = 188/210 (90%), Gaps = 2/210 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAEL+RNRYPS E RLFDDVLATF+LHHPEHGHAV+ PII+CIIDGTL YDKN+PPF
Sbjct  48   PEDIAELVRNRYPSDEQRLFDDVLATFVLHHPEHGHAVVLPIIACIIDGTLMYDKNAPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            +SFISLVCP+S+NE SEQWALACGEILRILTHYNRP+ K E  +SEADRSNS S A+TS+
Sbjct  108  SSFISLVCPSSENEYSEQWALACGEILRILTHYNRPICKTELPNSEADRSNSSSQATTSE  167

Query  363  SADGGPSLLSP--QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKP  536
            SADG  S   P  + ERKPLR LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAG+L+P
Sbjct  168  SADGESSFHMPSMRQERKPLRPLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGDLRP  227

Query  537  PSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            P TAS RGSGKHPQL+PSTPRWAVANGAGV
Sbjct  228  PMTASIRGSGKHPQLMPSTPRWAVANGAGV  257



>ref|XP_011042897.1| PREDICTED: protein GIGANTEA-like [Populus euphratica]
 ref|XP_011042898.1| PREDICTED: protein GIGANTEA-like [Populus euphratica]
 ref|XP_011042899.1| PREDICTED: protein GIGANTEA-like [Populus euphratica]
Length=1169

 Score =   359 bits (921),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 168/208 (81%), Positives = 187/208 (90%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAELIRNRYPSK+  LFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YD +SPPF
Sbjct  49   PDDIAELIRNRYPSKDKHLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDGSSPPF  108

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+NE SEQWALACGEILRILTHYNRP+YK+EKQ+SE DRS+S  H+++ +
Sbjct  109  ASFISLVCPSSENEYSEQWALACGEILRILTHYNRPIYKLEKQNSETDRSSSDGHSTSIE  168

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
            S     ++   QHERKP R LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+
Sbjct  169  SEGKSSTIPLVQHERKPFRPLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPT  228

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
            T SSRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  229  TTSSRGSGKHPQLMPSTPRWAVANGAGV  256



>ref|XP_009631429.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009631430.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nicotiana tomentosiformis]
Length=1173

 Score =   357 bits (915),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 179/226 (79%), Positives = 189/226 (84%), Gaps = 18/226 (8%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAELIR+RYPSKENRLFDDVLATF+LHHPEHGHAVI PIISCIIDGTL+YDK+ PPF
Sbjct  48   PEDIAELIRHRYPSKENRLFDDVLATFVLHHPEHGHAVILPIISCIIDGTLDYDKSCPPF  107

Query  183  ASFISLVCPNSQ--------------NELSEQWALACGEILRILTHYNRPVYKVEKQDSE  320
            ASFISLVCP+S+               E SEQWALACGEILRILTHYNRP+YKV +Q+  
Sbjct  108  ASFISLVCPSSEVLRILNYQFEGLSHKEYSEQWALACGEILRILTHYNRPIYKVVQQEGG  167

Query  321  ADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSG  500
            ADRS+ GSHASTSK AD  P L S  HERKPLR LSPWITDILLAAPLGIRSDYFRWC G
Sbjct  168  ADRSSRGSHASTSKFADSEPRLPSMHHERKPLRPLSPWITDILLAAPLGIRSDYFRWCGG  227

Query  501  VMGKYAAGELKPPST----ASSRGSGKHPQLIPSTPRWAVANGAGV  626
            VMGKYAAGELKPPST    ASS GSGKH QLIPSTPRWAVANGAGV
Sbjct  228  VMGKYAAGELKPPSTDFIVASSHGSGKHHQLIPSTPRWAVANGAGV  273



>gb|AII99806.1| gigantea [Dimocarpus longan]
Length=1171

 Score =   356 bits (914),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 173/210 (82%), Positives = 188/210 (90%), Gaps = 3/210 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAELIRNRYPSKE RLFDDVLA F+LHHPEHGHAV+ PIIS II+GTL YDK+SPPF
Sbjct  48   PEDIAELIRNRYPSKEMRLFDDVLAMFVLHHPEHGHAVVLPIISSIIEGTLVYDKSSPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+NE SEQWALACGEILRILTHYNRP+YK+E+ +SE +RS+SG HA+TS 
Sbjct  108  ASFISLVCPSSENEYSEQWALACGEILRILTHYNRPIYKMEQHNSETERSSSGRHATTSN  167

Query  363  SADGGPSLLSP--QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKP  536
            S  GG +   P  Q ERKPLR LSPWITDILLAAPL IRSDYFRWCSGVMGKYAAGELKP
Sbjct  168  SG-GGETCHVPLVQQERKPLRPLSPWITDILLAAPLAIRSDYFRWCSGVMGKYAAGELKP  226

Query  537  PSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            P TASSRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  227  PPTASSRGSGKHPQLMPSTPRWAVANGAGV  256



>ref|XP_009335139.1| PREDICTED: protein GIGANTEA-like [Pyrus x bretschneideri]
 ref|XP_009335140.1| PREDICTED: protein GIGANTEA-like [Pyrus x bretschneideri]
Length=1169

 Score =   356 bits (913),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 173/209 (83%), Positives = 188/209 (90%), Gaps = 2/209 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAELIRNRYPS+  RLFDDVLA F+LHHPEHGHAVI PIISCIIDGTL Y  +SPPF
Sbjct  48   PEDIAELIRNRYPSEVKRLFDDVLAMFVLHHPEHGHAVILPIISCIIDGTLAYKSSSPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+ E SEQWALACGEILRILTHYNRP+YK E+Q++E +RS+SGSHA+TS 
Sbjct  108  ASFISLVCPSSE-EYSEQWALACGEILRILTHYNRPIYKAEQQNNETERSSSGSHATTSD  166

Query  363  SADGGPSLLS-PQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  539
            S DG  S L   Q E+KP+R LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP
Sbjct  167  SGDGESSHLPLVQQEKKPIRPLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  226

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            STASSRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  227  STASSRGSGKHPQLMPSTPRWAVANGAGV  255



>ref|XP_010097648.1| hypothetical protein L484_023788 [Morus notabilis]
 gb|EXB70603.1| hypothetical protein L484_023788 [Morus notabilis]
Length=1195

 Score =   355 bits (911),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 186/208 (89%), Gaps = 1/208 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAELIRNRYPSKE+RLFDDVLATF+LHHPEHGHAV+ PIIS IIDGTL YD+ +PPF
Sbjct  48   PDDIAELIRNRYPSKEHRLFDDVLATFVLHHPEHGHAVVLPIISGIIDGTLVYDRTTPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+NE SEQWALACGEILRILTHYNRP+YKVE+  SE +RS+SGS A+TS 
Sbjct  108  ASFISLVCPSSENEYSEQWALACGEILRILTHYNRPIYKVEQHCSETERSSSGSQATTSD  167

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
              +     L  Q ERKP+R LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+
Sbjct  168  GGESSSRTLPVQQERKPIRPLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPT  227

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
            TA SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  228  TA-SRGSGKHPQLMPSTPRWAVANGAGV  254



>ref|XP_004496436.1| PREDICTED: protein GIGANTEA-like isoform X2 [Cicer arietinum]
Length=1152

 Score =   354 bits (909),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 168/208 (81%), Positives = 186/208 (89%), Gaps = 1/208 (0%)
 Frame = +3

Query  6    EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFA  185
            +DIAE+IRNRYPSKE  LFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFA
Sbjct  26   DDIAEMIRNRYPSKEILLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKTSPPFA  85

Query  186  SFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKS  365
            S ISLVCP ++NE SEQWALACGEILRILTHYNRP+YK+E+Q SE +RS+SGSHA+TS+ 
Sbjct  86   SLISLVCPKNENEYSEQWALACGEILRILTHYNRPIYKMERQSSETERSSSGSHATTSEP  145

Query  366  ADG-GPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
             DG   +    Q E+KP+R LSPWITDILLAAP+GIRSDYFRWCSGVMGKYAAGELKPPS
Sbjct  146  LDGKAVNNALAQQEKKPIRPLSPWITDILLAAPVGIRSDYFRWCSGVMGKYAAGELKPPS  205

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
            TASSRGSGKHPQ +PSTPRWAVANGAGV
Sbjct  206  TASSRGSGKHPQHVPSTPRWAVANGAGV  233



>gb|AES62297.2| gigantea protein 1B [Medicago truncatula]
Length=975

 Score =   351 bits (900),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 166/208 (80%), Positives = 183/208 (88%), Gaps = 1/208 (0%)
 Frame = +3

Query  6    EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFA  185
            +DIAELIRNRYPSKE  LFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFA
Sbjct  54   DDIAELIRNRYPSKEIILFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKTSPPFA  113

Query  186  SFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKS  365
            S ISLVCP  +NE SEQWALACGEILRILTHYNRP+YK E+Q SE +RS+SGSHA+TS+ 
Sbjct  114  SLISLVCPKDENEYSEQWALACGEILRILTHYNRPIYKTERQSSETERSSSGSHATTSEP  173

Query  366  ADG-GPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
             +G   +    Q E+KP+R LSPWITDILL AP+GIRSDYFRWCSGVMGKYAAGELKPPS
Sbjct  174  LNGKAVNNALAQQEKKPIRPLSPWITDILLVAPVGIRSDYFRWCSGVMGKYAAGELKPPS  233

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
             A+SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  234  IATSRGSGKHPQLVPSTPRWAVANGAGV  261



>ref|XP_006361616.1| PREDICTED: protein GIGANTEA-like isoform X1 [Solanum tuberosum]
Length=1171

 Score =   354 bits (909),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 175/208 (84%), Positives = 192/208 (92%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAELIRNRYPSKENRLFDDVLATF+LHHPEHGHAV+HPIISCIIDGTLEYDK+SPPF
Sbjct  48   PEDIAELIRNRYPSKENRLFDDVLATFVLHHPEHGHAVVHPIISCIIDGTLEYDKSSPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVC  S+ E SEQWALACGEILRILTHYNRP++KV++QD+  DRS SGSH STSK
Sbjct  108  ASFISLVCSRSEKEYSEQWALACGEILRILTHYNRPIFKVDRQDNGTDRSTSGSHTSTSK  167

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
            S+   P + S QHERKP+R LSPWITDILLAAPLGIRSDYFRWC GVMGKYAAG+LKPPS
Sbjct  168  SSCSEPGVPSIQHERKPIRPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGDLKPPS  227

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
            +A+SRGSGKHPQL+P+TPRWAVANGAGV
Sbjct  228  SAASRGSGKHPQLLPATPRWAVANGAGV  255



>gb|ACA24490.1| gigantea-like protein 2 [Glycine max]
Length=990

 Score =   350 bits (899),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 184/207 (89%), Gaps = 1/207 (0%)
 Frame = +3

Query  6    EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFA  185
            +DIAELIRNRYPSK+  LFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFA
Sbjct  56   DDIAELIRNRYPSKDILLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKASPPFA  115

Query  186  SFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKS  365
            SFIS VCP  +NE SEQWALACGEILRILTHYNRP+YK E+Q  E +RS SGSHA+TS+ 
Sbjct  116  SFISSVCPKIENEYSEQWALACGEILRILTHYNRPIYKTERQSGETERSTSGSHATTSEP  175

Query  366  ADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPST  545
               G + L+ Q E+KP+R LSPWITDILL++P+GIRSDYFRWCSGVMGKYAAGELKPPST
Sbjct  176  GKSGHNSLT-QQEKKPIRPLSPWITDILLSSPVGIRSDYFRWCSGVMGKYAAGELKPPST  234

Query  546  ASSRGSGKHPQLIPSTPRWAVANGAGV  626
            ASSRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  235  ASSRGSGKHPQLVPSTPRWAVANGAGV  261



>ref|XP_004496435.1| PREDICTED: protein GIGANTEA-like isoform X1 [Cicer arietinum]
Length=1180

 Score =   353 bits (907),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 168/208 (81%), Positives = 186/208 (89%), Gaps = 1/208 (0%)
 Frame = +3

Query  6    EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFA  185
            +DIAE+IRNRYPSKE  LFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFA
Sbjct  54   DDIAEMIRNRYPSKEILLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKTSPPFA  113

Query  186  SFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKS  365
            S ISLVCP ++NE SEQWALACGEILRILTHYNRP+YK+E+Q SE +RS+SGSHA+TS+ 
Sbjct  114  SLISLVCPKNENEYSEQWALACGEILRILTHYNRPIYKMERQSSETERSSSGSHATTSEP  173

Query  366  ADG-GPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
             DG   +    Q E+KP+R LSPWITDILLAAP+GIRSDYFRWCSGVMGKYAAGELKPPS
Sbjct  174  LDGKAVNNALAQQEKKPIRPLSPWITDILLAAPVGIRSDYFRWCSGVMGKYAAGELKPPS  233

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
            TASSRGSGKHPQ +PSTPRWAVANGAGV
Sbjct  234  TASSRGSGKHPQHVPSTPRWAVANGAGV  261



>gb|ABP81863.1| LATE BLOOMER 1 [Pisum sativum]
Length=1175

 Score =   353 bits (906),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 167/207 (81%), Positives = 185/207 (89%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFA  185
            +DIAELIRNRYPSKE  LFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFA
Sbjct  53   DDIAELIRNRYPSKEILLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKTSPPFA  112

Query  186  SFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKS  365
            S ISLVCP ++NE SEQWALACGEILRILTHYNRP+YK+E+Q SE +RS+SGS A+TS+ 
Sbjct  113  SLISLVCPKNENEYSEQWALACGEILRILTHYNRPIYKMERQSSETERSSSGSLATTSEP  172

Query  366  ADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPST  545
             +G     +   E+KP+R LSPWITDILLAAP+GIRSDYFRWCSGVMGKYAAGELKPPST
Sbjct  173  LNGKAVNSALAQEKKPIRPLSPWITDILLAAPVGIRSDYFRWCSGVMGKYAAGELKPPST  232

Query  546  ASSRGSGKHPQLIPSTPRWAVANGAGV  626
            ASSRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  233  ASSRGSGKHPQLVPSTPRWAVANGAGV  259



>gb|KHN46389.1| Protein GIGANTEA, partial [Glycine soja]
Length=1157

 Score =   353 bits (905),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 167/207 (81%), Positives = 184/207 (89%), Gaps = 1/207 (0%)
 Frame = +3

Query  6    EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFA  185
            +DIAELIRNRYPSK+  LFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFA
Sbjct  20   DDIAELIRNRYPSKDILLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKASPPFA  79

Query  186  SFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKS  365
            SFIS VCP  +NE SEQWALACGEILRILTHYNRP+YK E+Q  E +RS SGSHA+TS+ 
Sbjct  80   SFISSVCPKIENEYSEQWALACGEILRILTHYNRPIYKTERQSGETERSTSGSHATTSEP  139

Query  366  ADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPST  545
               G + L+ Q E+KP+R LSPWITDILLA+P+GIRSDYFRWCSGVMGKYAAGELKPPST
Sbjct  140  GKSGHNSLT-QQEKKPIRPLSPWITDILLASPVGIRSDYFRWCSGVMGKYAAGELKPPST  198

Query  546  ASSRGSGKHPQLIPSTPRWAVANGAGV  626
            ASSRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  199  ASSRGSGKHPQLVPSTPRWAVANGAGV  225



>ref|XP_006386299.1| hypothetical protein POPTR_0002s06490g [Populus trichocarpa]
 gb|ERP64096.1| hypothetical protein POPTR_0002s06490g [Populus trichocarpa]
Length=1171

 Score =   353 bits (905),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 165/208 (79%), Positives = 185/208 (89%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAELIRNRYPSK+  LFDDVLA F+LHHPEHGHAV+ PIISCIIDGTL YD +SPPF
Sbjct  49   PDDIAELIRNRYPSKDKHLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLVYDGSSPPF  108

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+NE SEQWALACGEILRILTHYNRP+YK+EKQ+SE DRS+S  ++++ +
Sbjct  109  ASFISLVCPSSENEYSEQWALACGEILRILTHYNRPIYKLEKQNSETDRSSSDGNSTSIE  168

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
            S     ++   Q ERKP R LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+
Sbjct  169  SEGKSSTIPLVQQERKPFRPLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPT  228

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
            T SSRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  229  TTSSRGSGKHPQLVPSTPRWAVANGAGV  256



>ref|XP_002300901.2| GIGANTEA family protein [Populus trichocarpa]
 gb|EEE80174.2| GIGANTEA family protein [Populus trichocarpa]
Length=1194

 Score =   353 bits (905),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 165/208 (79%), Positives = 185/208 (89%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAELIRNRYPSK+  LFDDVLA F+LHHPEHGHAV+ PIISCIIDGTL YD +SPPF
Sbjct  49   PDDIAELIRNRYPSKDKHLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLVYDGSSPPF  108

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+NE SEQWALACGEILRILTHYNRP+YK+EKQ+SE DRS+S  ++++ +
Sbjct  109  ASFISLVCPSSENEYSEQWALACGEILRILTHYNRPIYKLEKQNSETDRSSSDGNSTSIE  168

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
            S     ++   Q ERKP R LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+
Sbjct  169  SEGKSSTIPLVQQERKPFRPLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPT  228

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
            T SSRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  229  TTSSRGSGKHPQLVPSTPRWAVANGAGV  256



>ref|XP_008386373.1| PREDICTED: protein GIGANTEA-like [Malus domestica]
Length=1169

 Score =   352 bits (904),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 170/209 (81%), Positives = 187/209 (89%), Gaps = 2/209 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PED+AELIRNRYPS+  RLFDDVLA F+LHHPEHGHAVI PIISCIIDGTL Y  + PPF
Sbjct  48   PEDVAELIRNRYPSEVKRLFDDVLAMFVLHHPEHGHAVILPIISCIIDGTLAYKSSGPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+ E SEQWALACGEILRILTHYNRP+YK E+Q++E +RS+SGSHA+TS 
Sbjct  108  ASFISLVCPSSE-EYSEQWALACGEILRILTHYNRPIYKAEQQNNETERSSSGSHATTSD  166

Query  363  SADGGPSLLS-PQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  539
            + DG  S L   Q E+KP+R LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP
Sbjct  167  NVDGESSHLPLVQQEKKPIRPLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  226

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            STASSRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  227  STASSRGSGKHPQLMPSTPRWAVANGAGV  255



>dbj|BAJ22595.1| GIGANTEA [Glycine max]
Length=1168

 Score =   352 bits (903),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 167/207 (81%), Positives = 184/207 (89%), Gaps = 1/207 (0%)
 Frame = +3

Query  6    EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFA  185
            +DIAELIRNRYPSK+  LFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFA
Sbjct  49   DDIAELIRNRYPSKDILLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKASPPFA  108

Query  186  SFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKS  365
            SFIS VCP  +NE SEQWALACGEILRILTHYNRP+YK E+Q  E +RS SGSHA+TS+ 
Sbjct  109  SFISSVCPKIENEYSEQWALACGEILRILTHYNRPIYKTERQSGETERSTSGSHATTSEP  168

Query  366  ADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPST  545
               G + L+ Q E+KP+R LSPWITDILLA+P+GIRSDYFRWCSGVMGKYAAGELKPPST
Sbjct  169  GKSGHNSLT-QQEKKPIRPLSPWITDILLASPVGIRSDYFRWCSGVMGKYAAGELKPPST  227

Query  546  ASSRGSGKHPQLIPSTPRWAVANGAGV  626
            ASSRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  228  ASSRGSGKHPQLVPSTPRWAVANGAGV  254



>ref|XP_011044276.1| PREDICTED: protein GIGANTEA-like [Populus euphratica]
Length=1171

 Score =   352 bits (903),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 173/209 (83%), Positives = 191/209 (91%), Gaps = 1/209 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DI+ELIRNRYPSK+ RLFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YD++SPPF
Sbjct  49   PDDISELIRNRYPSKDKRLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDRSSPPF  108

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP S+NE SEQWALACGEILRILTHYNRP+YK E+QD+E DRS+S SHA++S+
Sbjct  109  ASFISLVCPGSENEYSEQWALACGEILRILTHYNRPIYKREQQDNETDRSSSDSHATSSE  168

Query  363  SADGGPSLLS-PQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  539
            SA+G  S +   Q ERKP R LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP
Sbjct  169  SAEGKSSSMPLVQQERKPFRPLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  228

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            +T SSRGSGKHPQLIPSTPRWAVANGAGV
Sbjct  229  TTTSSRGSGKHPQLIPSTPRWAVANGAGV  257



>gb|KHN17039.1| Protein GIGANTEA [Glycine soja]
Length=1149

 Score =   350 bits (899),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 184/207 (89%), Gaps = 1/207 (0%)
 Frame = +3

Query  6    EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFA  185
            +DIAELIRN YPSK+  LFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFA
Sbjct  56   DDIAELIRNHYPSKDILLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKASPPFA  115

Query  186  SFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKS  365
            SFIS VCP  +NE SE+WALACGEILRILTHYNRP+YK E+Q  E +RS SGSHA+TS+ 
Sbjct  116  SFISSVCPKIENEYSEEWALACGEILRILTHYNRPIYKTERQSGETERSTSGSHATTSEP  175

Query  366  ADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPST  545
               G + L+ QHE+KP+R LSPWITDILLA+P+GIRSDYFRWCSGVMGKYAAGELKPPST
Sbjct  176  GKSGHNSLT-QHEKKPIRPLSPWITDILLASPVGIRSDYFRWCSGVMGKYAAGELKPPST  234

Query  546  ASSRGSGKHPQLIPSTPRWAVANGAGV  626
            ASSRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  235  ASSRGSGKHPQLVPSTPRWAVANGAGV  261



>ref|XP_003592046.1| Protein GIGANTEA [Medicago truncatula]
Length=1172

 Score =   350 bits (899),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 166/208 (80%), Positives = 183/208 (88%), Gaps = 1/208 (0%)
 Frame = +3

Query  6    EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFA  185
            +DIAELIRNRYPSKE  LFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFA
Sbjct  49   DDIAELIRNRYPSKEIILFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKTSPPFA  108

Query  186  SFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKS  365
            S ISLVCP  +NE SEQWALACGEILRILTHYNRP+YK E+Q SE +RS+SGSHA+TS+ 
Sbjct  109  SLISLVCPKDENEYSEQWALACGEILRILTHYNRPIYKTERQSSETERSSSGSHATTSEP  168

Query  366  ADG-GPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
             +G   +    Q E+KP+R LSPWITDILL AP+GIRSDYFRWCSGVMGKYAAGELKPPS
Sbjct  169  LNGKAVNNALAQQEKKPIRPLSPWITDILLVAPVGIRSDYFRWCSGVMGKYAAGELKPPS  228

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
             A+SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  229  IATSRGSGKHPQLVPSTPRWAVANGAGV  256



>ref|XP_003556164.1| PREDICTED: protein GIGANTEA isoformX1 [Glycine max]
 ref|XP_006606175.1| PREDICTED: protein GIGANTEA isoform X2 [Glycine max]
 ref|XP_006606176.1| PREDICTED: protein GIGANTEA isoform X3 [Glycine max]
 ref|XP_006606177.1| PREDICTED: protein GIGANTEA isoform X4 [Glycine max]
 gb|ACA24489.1| gigantea-like protein 1 [Glycine max]
Length=1175

 Score =   350 bits (899),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 184/207 (89%), Gaps = 1/207 (0%)
 Frame = +3

Query  6    EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFA  185
            +DIAELIRNRYPSK+  LFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFA
Sbjct  56   DDIAELIRNRYPSKDILLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKASPPFA  115

Query  186  SFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKS  365
            SFIS VCP  +NE SEQWALACGEILRILTHYNRP+YK E+Q  E +RS SGSHA+TS+ 
Sbjct  116  SFISSVCPKIENEYSEQWALACGEILRILTHYNRPIYKTERQSGETERSTSGSHATTSEP  175

Query  366  ADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPST  545
               G + L+ Q E+KP+R LSPWITDILL++P+GIRSDYFRWCSGVMGKYAAGELKPPST
Sbjct  176  GKSGHNSLT-QQEKKPIRPLSPWITDILLSSPVGIRSDYFRWCSGVMGKYAAGELKPPST  234

Query  546  ASSRGSGKHPQLIPSTPRWAVANGAGV  626
            ASSRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  235  ASSRGSGKHPQLVPSTPRWAVANGAGV  261



>gb|AES62299.2| gigantea protein 1B [Medicago truncatula]
Length=1177

 Score =   350 bits (899),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 166/208 (80%), Positives = 183/208 (88%), Gaps = 1/208 (0%)
 Frame = +3

Query  6    EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFA  185
            +DIAELIRNRYPSKE  LFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFA
Sbjct  54   DDIAELIRNRYPSKEIILFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKTSPPFA  113

Query  186  SFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKS  365
            S ISLVCP  +NE SEQWALACGEILRILTHYNRP+YK E+Q SE +RS+SGSHA+TS+ 
Sbjct  114  SLISLVCPKDENEYSEQWALACGEILRILTHYNRPIYKTERQSSETERSSSGSHATTSEP  173

Query  366  ADG-GPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
             +G   +    Q E+KP+R LSPWITDILL AP+GIRSDYFRWCSGVMGKYAAGELKPPS
Sbjct  174  LNGKAVNNALAQQEKKPIRPLSPWITDILLVAPVGIRSDYFRWCSGVMGKYAAGELKPPS  233

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
             A+SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  234  IATSRGSGKHPQLVPSTPRWAVANGAGV  261



>gb|ACJ65312.1| GI1 protein [Glycine max]
Length=1176

 Score =   350 bits (899),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 184/207 (89%), Gaps = 1/207 (0%)
 Frame = +3

Query  6    EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFA  185
            +DIAELIRNRYPSK+  LFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFA
Sbjct  56   DDIAELIRNRYPSKDILLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKASPPFA  115

Query  186  SFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKS  365
            SFIS VCP  +NE SEQWALACGEILRILTHYNRP+YK E+Q  E +RS SGSHA+TS+ 
Sbjct  116  SFISSVCPKIENEYSEQWALACGEILRILTHYNRPIYKTERQSGETERSTSGSHATTSEP  175

Query  366  ADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPST  545
               G + L+ Q E+KP+R LSPWITDILL++P+GIRSDYFRWCSGVMGKYAAGELKPPST
Sbjct  176  GKSGHNSLT-QQEKKPIRPLSPWITDILLSSPVGIRSDYFRWCSGVMGKYAAGELKPPST  234

Query  546  ASSRGSGKHPQLIPSTPRWAVANGAGV  626
            ASSRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  235  ASSRGSGKHPQLVPSTPRWAVANGAGV  261



>ref|XP_003592048.1| Protein GIGANTEA [Medicago truncatula]
Length=1200

 Score =   351 bits (900),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 166/208 (80%), Positives = 183/208 (88%), Gaps = 1/208 (0%)
 Frame = +3

Query  6    EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFA  185
            +DIAELIRNRYPSKE  LFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFA
Sbjct  49   DDIAELIRNRYPSKEIILFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKTSPPFA  108

Query  186  SFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKS  365
            S ISLVCP  +NE SEQWALACGEILRILTHYNRP+YK E+Q SE +RS+SGSHA+TS+ 
Sbjct  109  SLISLVCPKDENEYSEQWALACGEILRILTHYNRPIYKTERQSSETERSSSGSHATTSEP  168

Query  366  ADG-GPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
             +G   +    Q E+KP+R LSPWITDILL AP+GIRSDYFRWCSGVMGKYAAGELKPPS
Sbjct  169  LNGKAVNNALAQQEKKPIRPLSPWITDILLVAPVGIRSDYFRWCSGVMGKYAAGELKPPS  228

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
             A+SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  229  IATSRGSGKHPQLVPSTPRWAVANGAGV  256



>ref|XP_004252566.1| PREDICTED: protein GIGANTEA-like isoform X1 [Solanum lycopersicum]
Length=1167

 Score =   350 bits (898),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 190/208 (91%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAELIRNRYPSKENRLFDDVLATF+LHHPEHGHAV+HPIISCIIDGTLEYDK+SPPF
Sbjct  48   PEDIAELIRNRYPSKENRLFDDVLATFVLHHPEHGHAVVHPIISCIIDGTLEYDKSSPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVC +S+ E SEQWALACGEILRILTHYNRP++KV++QD   DRS SGSH STS+
Sbjct  108  ASFISLVCSSSEKEYSEQWALACGEILRILTHYNRPIFKVDRQDKGTDRSTSGSHTSTSE  167

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
            S+   P + S QHERK LR LSPWITDILLAAPLGIRSDYFRWC GVMGKYAAG+LKPPS
Sbjct  168  SSSSEPGVPSIQHERKLLRPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGDLKPPS  227

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
            +A+S GSGKHPQL+P+TPRWAVANGAGV
Sbjct  228  SAASHGSGKHPQLLPATPRWAVANGAGV  255



>ref|NP_001239995.1| uncharacterized protein LOC100800578 [Glycine max]
 gb|ACJ65313.1| GI2 protein [Glycine max]
 dbj|BAJ22594.1| GIGANTEA [Glycine max]
Length=1170

 Score =   350 bits (898),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 165/207 (80%), Positives = 184/207 (89%), Gaps = 1/207 (0%)
 Frame = +3

Query  6    EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFA  185
            +DIAELIRN YPSK+  LFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFA
Sbjct  49   DDIAELIRNHYPSKDILLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKASPPFA  108

Query  186  SFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKS  365
            SFIS VCP  +NE SE+WALACGEILRILTHYNRP+YK E+Q  E +RS SGSHA+TS+ 
Sbjct  109  SFISSVCPKIENEYSEEWALACGEILRILTHYNRPIYKTERQSGETERSTSGSHATTSEP  168

Query  366  ADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPST  545
               G + L+ QHE+KP+R LSPWITDILLA+P+GIRSDYFRWCSG+MGKYAAGELKPPST
Sbjct  169  GKSGHNSLT-QHEKKPIRPLSPWITDILLASPVGIRSDYFRWCSGIMGKYAAGELKPPST  227

Query  546  ASSRGSGKHPQLIPSTPRWAVANGAGV  626
            ASSRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  228  ASSRGSGKHPQLVPSTPRWAVANGAGV  254



>ref|XP_002307516.1| GIGANTEA family protein [Populus trichocarpa]
 gb|EEE94512.1| GIGANTEA family protein [Populus trichocarpa]
Length=1171

 Score =   350 bits (898),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 172/209 (82%), Positives = 191/209 (91%), Gaps = 1/209 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DI+ELIRNRYPSK+ RLFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YD++SPPF
Sbjct  49   PDDISELIRNRYPSKDKRLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDRSSPPF  108

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP S+NE SEQWALACGEILRILTHYNRP+YK E+Q++E DRS+S SHA++S+
Sbjct  109  ASFISLVCPGSENEYSEQWALACGEILRILTHYNRPIYKREQQNNETDRSSSDSHATSSE  168

Query  363  SADG-GPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  539
            SA+G   S+   Q ERKP R LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP
Sbjct  169  SAEGKSTSMPLVQQERKPFRPLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  228

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            +T SSRGSGKHPQLIPSTPRWAVANGAGV
Sbjct  229  TTTSSRGSGKHPQLIPSTPRWAVANGAGV  257



>ref|XP_007143577.1| hypothetical protein PHAVU_007G083500g [Phaseolus vulgaris]
 ref|XP_007143578.1| hypothetical protein PHAVU_007G083500g [Phaseolus vulgaris]
 gb|ESW15571.1| hypothetical protein PHAVU_007G083500g [Phaseolus vulgaris]
 gb|ESW15572.1| hypothetical protein PHAVU_007G083500g [Phaseolus vulgaris]
Length=1199

 Score =   350 bits (899),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 168/208 (81%), Positives = 184/208 (88%), Gaps = 1/208 (0%)
 Frame = +3

Query  6    EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFA  185
            +DIAELIRNRYPSKE  LFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFA
Sbjct  56   DDIAELIRNRYPSKEILLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKASPPFA  115

Query  186  SFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKS  365
            SFIS VCP  +NE SEQWALACGEILRILTHYNRP+YK+E+Q  E +RS+SGSHA+TS+ 
Sbjct  116  SFISSVCPKVENEYSEQWALACGEILRILTHYNRPIYKIERQYGETERSSSGSHATTSEP  175

Query  366  ADGGPSLLS-PQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
             DG     S    E+KP+R LSPWITDILLA+P+GIRSDYFRWCSGVMGKYAAGELKPPS
Sbjct  176  IDGKSVHNSLTNQEKKPIRPLSPWITDILLASPVGIRSDYFRWCSGVMGKYAAGELKPPS  235

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
            TASSRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  236  TASSRGSGKHPQLVPSTPRWAVANGAGV  263



>gb|EPS65289.1| hypothetical protein M569_09488 [Genlisea aurea]
Length=305

 Score =   327 bits (839),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 159/209 (76%), Positives = 183/209 (88%), Gaps = 6/209 (3%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P++IAELIR+RYPS+ +RLFDDVLATF+LHHPEHGH VI PIISC+ID ++EYDK+  PF
Sbjct  48   PDEIAELIRSRYPSQRSRLFDDVLATFVLHHPEHGHDVILPIISCVIDSSVEYDKDGAPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            +SFISL   N++N+ SEQWALACGEILRILTHYNRP+YK E  D+EADRS SG+HAS+SK
Sbjct  108  SSFISLFSLNTENDYSEQWALACGEILRILTHYNRPIYKTESLDNEADRSGSGNHASSSK  167

Query  363  SADGGPSLLSPQ-HERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  539
            SA G P  L+P   ERKP+R LSPWITDILL+APLGIRSDYFRWC GVMGKYAAGELKPP
Sbjct  168  SASGRP--LAPTLTERKPMRPLSPWITDILLSAPLGIRSDYFRWCGGVMGKYAAGELKPP  225

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            STAS   +GKHPQL+P+TPRWAVANGAGV
Sbjct  226  STAS---AGKHPQLMPATPRWAVANGAGV  251



>dbj|BAN82581.1| gigantea [Glycine max]
 dbj|BAN82582.1| gigantea [Glycine max]
 dbj|BAN82583.1| gigantea [Glycine max]
 dbj|BAN82584.1| gigantea [Glycine max]
 dbj|BAN82585.1| gigantea [Glycine max]
 dbj|BAN82587.1| gigantea [Glycine max]
 dbj|BAN82588.1| gigantea [Glycine max]
Length=1170

 Score =   350 bits (897),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 184/207 (89%), Gaps = 1/207 (0%)
 Frame = +3

Query  6    EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFA  185
            +DIAELIRN YPSK+  LFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFA
Sbjct  49   DDIAELIRNHYPSKDILLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKASPPFA  108

Query  186  SFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKS  365
            SFIS VCP  +NE SE+WALACGEILRILTHYNRP+YK E+Q  E +RS SGSHA+TS+ 
Sbjct  109  SFISSVCPKIENEYSEEWALACGEILRILTHYNRPIYKTERQSGETERSTSGSHATTSEP  168

Query  366  ADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPST  545
               G + L+ QHE+KP+R LSPWITDILLA+P+GIRSDYFRWCSGVMGKYAAGELKPPST
Sbjct  169  GKSGHNSLT-QHEKKPIRPLSPWITDILLASPVGIRSDYFRWCSGVMGKYAAGELKPPST  227

Query  546  ASSRGSGKHPQLIPSTPRWAVANGAGV  626
            ASSRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  228  ASSRGSGKHPQLVPSTPRWAVANGAGV  254



>ref|XP_006588466.1| PREDICTED: uncharacterized protein LOC100800578 isoform X1 [Glycine 
max]
 ref|XP_006588467.1| PREDICTED: uncharacterized protein LOC100800578 isoform X2 [Glycine 
max]
 ref|XP_006588468.1| PREDICTED: uncharacterized protein LOC100800578 isoform X3 [Glycine 
max]
Length=1177

 Score =   350 bits (897),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 165/207 (80%), Positives = 184/207 (89%), Gaps = 1/207 (0%)
 Frame = +3

Query  6    EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFA  185
            +DIAELIRN YPSK+  LFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFA
Sbjct  56   DDIAELIRNHYPSKDILLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKASPPFA  115

Query  186  SFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKS  365
            SFIS VCP  +NE SE+WALACGEILRILTHYNRP+YK E+Q  E +RS SGSHA+TS+ 
Sbjct  116  SFISSVCPKIENEYSEEWALACGEILRILTHYNRPIYKTERQSGETERSTSGSHATTSEP  175

Query  366  ADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPST  545
               G + L+ QHE+KP+R LSPWITDILLA+P+GIRSDYFRWCSG+MGKYAAGELKPPST
Sbjct  176  GKSGHNSLT-QHEKKPIRPLSPWITDILLASPVGIRSDYFRWCSGIMGKYAAGELKPPST  234

Query  546  ASSRGSGKHPQLIPSTPRWAVANGAGV  626
            ASSRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  235  ASSRGSGKHPQLVPSTPRWAVANGAGV  261



>ref|XP_006361617.1| PREDICTED: protein GIGANTEA-like isoform X2 [Solanum tuberosum]
Length=1170

 Score =   349 bits (896),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 175/208 (84%), Positives = 192/208 (92%), Gaps = 1/208 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAELIRNRYPSKENRLFDDVLATF+LHHPEHGHAV+HPIISCIIDGTLEYDK+SPPF
Sbjct  48   PEDIAELIRNRYPSKENRLFDDVLATFVLHHPEHGHAVVHPIISCIIDGTLEYDKSSPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVC  S+ E SEQWALACGEILRILTHYNRP++KV++QD+  DRS SGSH STSK
Sbjct  108  ASFISLVCSRSE-EYSEQWALACGEILRILTHYNRPIFKVDRQDNGTDRSTSGSHTSTSK  166

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
            S+   P + S QHERKP+R LSPWITDILLAAPLGIRSDYFRWC GVMGKYAAG+LKPPS
Sbjct  167  SSCSEPGVPSIQHERKPIRPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGDLKPPS  226

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
            +A+SRGSGKHPQL+P+TPRWAVANGAGV
Sbjct  227  SAASRGSGKHPQLLPATPRWAVANGAGV  254



>dbj|BAN82586.1| gigantea [Glycine max]
 dbj|BAN82590.1| gigantea [Glycine max]
 dbj|BAN82591.1| gigantea [Glycine max]
 dbj|BAN82592.1| gigantea [Glycine max]
Length=1170

 Score =   349 bits (896),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 165/207 (80%), Positives = 184/207 (89%), Gaps = 1/207 (0%)
 Frame = +3

Query  6    EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFA  185
            +DIAELIRN YPSK+  LFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFA
Sbjct  49   DDIAELIRNHYPSKDILLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKASPPFA  108

Query  186  SFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKS  365
            SFIS VCP  +NE SE+WALACGEILRILTHYNRP+YK E+Q  E +RS SGSHA+TS+ 
Sbjct  109  SFISSVCPKIENEYSEEWALACGEILRILTHYNRPIYKTERQSGETERSTSGSHATTSEP  168

Query  366  ADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPST  545
               G + L+ QHE+KP+R LSPWITDILLA+P+GIRSDYFRWCSG+MGKYAAGELKPPST
Sbjct  169  GKSGHNSLT-QHEKKPIRPLSPWITDILLASPVGIRSDYFRWCSGIMGKYAAGELKPPST  227

Query  546  ASSRGSGKHPQLIPSTPRWAVANGAGV  626
            ASSRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  228  ASSRGSGKHPQLVPSTPRWAVANGAGV  254



>dbj|BAM67030.1| gigantea-like [Chrysanthemum seticuspe f. boreale]
Length=1145

 Score =   348 bits (894),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 165/209 (79%), Positives = 182/209 (87%), Gaps = 1/209 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAEL+R+RYPS+E RLFDDVLATF+LHHPEHGH+VI PIISCIIDGT+EYD+++PPF
Sbjct  48   PEDIAELVRHRYPSQEKRLFDDVLATFVLHHPEHGHSVILPIISCIIDGTMEYDRSTPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP++  E SEQWALACGEILR+LTHYNRP+ K + Q    DRS SGS ASTS 
Sbjct  108  ASFISLVCPSTDKEYSEQWALACGEILRVLTHYNRPILKADHQHKVTDRSVSGSQASTSN  167

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
            S D   S  S Q+E KPLRLLSPWITDILLAAPLGIRSDYFRWC GVMGKYAAGELKPPS
Sbjct  168  SPDSETSSPSAQNENKPLRLLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGELKPPS  227

Query  543  TA-SSRGSGKHPQLIPSTPRWAVANGAGV  626
               +SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  228  VVMASRGSGKHPQLVPSTPRWAVANGAGV  256



>gb|AGL61504.1| gigantea-like protein [Chrysanthemum x morifolium]
Length=1145

 Score =   348 bits (894),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 165/209 (79%), Positives = 182/209 (87%), Gaps = 1/209 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAEL+R+RYPS+E RLFDDVLATF+LHHPEHGH+VI PIISCIIDGT+EYD+++PPF
Sbjct  48   PEDIAELVRHRYPSQEKRLFDDVLATFVLHHPEHGHSVILPIISCIIDGTMEYDRSTPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP++  E SEQWALACGEILR+LTHYNRP+ K + Q    DRS SGS ASTS 
Sbjct  108  ASFISLVCPSTDKEYSEQWALACGEILRVLTHYNRPILKADHQHKVTDRSVSGSQASTSN  167

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
            S D   S  S Q+E KPLRLLSPWITDILLAAPLGIRSDYFRWC GVMGKYAAGELKPPS
Sbjct  168  SPDSETSSPSAQNENKPLRLLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGELKPPS  227

Query  543  TA-SSRGSGKHPQLIPSTPRWAVANGAGV  626
               +SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  228  VVMASRGSGKHPQLVPSTPRWAVANGAGV  256



>gb|AFK65758.1| GIGANTEA, partial [Chrysanthemum x morifolium]
Length=1151

 Score =   347 bits (889),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 182/210 (87%), Gaps = 2/210 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAEL+R+ YPS+E RLFDDVLATF+LHHPEHGH+VI PIISCIIDGT+EYD+++PPF
Sbjct  49   PEDIAELVRHHYPSQEKRLFDDVLATFVLHHPEHGHSVILPIISCIIDGTMEYDRSTPPF  108

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP++  E SEQWALACGEILR+LTHYNRP+ K + Q    DRS SGS ASTS 
Sbjct  109  ASFISLVCPSTDKEYSEQWALACGEILRVLTHYNRPILKADHQHKVTDRSVSGSQASTSN  168

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
            S D   S  S Q+E KPLRLLSPWITDILLAAPLGIRSDYFRWC GVMGKYAAGELKPPS
Sbjct  169  SPDSETSSPSAQNENKPLRLLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGELKPPS  228

Query  543  T--ASSRGSGKHPQLIPSTPRWAVANGAGV  626
               ASSRGSGKHPQL+P+TPRWAVANGAGV
Sbjct  229  VVMASSRGSGKHPQLMPATPRWAVANGAGV  258



>ref|XP_010314472.1| PREDICTED: protein GIGANTEA-like isoform X2 [Solanum lycopersicum]
Length=1166

 Score =   345 bits (885),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 190/208 (91%), Gaps = 1/208 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAELIRNRYPSKENRLFDDVLATF+LHHPEHGHAV+HPIISCIIDGTLEYDK+SPPF
Sbjct  48   PEDIAELIRNRYPSKENRLFDDVLATFVLHHPEHGHAVVHPIISCIIDGTLEYDKSSPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVC +S+ E SEQWALACGEILRILTHYNRP++KV++QD   DRS SGSH STS+
Sbjct  108  ASFISLVCSSSE-EYSEQWALACGEILRILTHYNRPIFKVDRQDKGTDRSTSGSHTSTSE  166

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
            S+   P + S QHERK LR LSPWITDILLAAPLGIRSDYFRWC GVMGKYAAG+LKPPS
Sbjct  167  SSSSEPGVPSIQHERKLLRPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGDLKPPS  226

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
            +A+S GSGKHPQL+P+TPRWAVANGAGV
Sbjct  227  SAASHGSGKHPQLLPATPRWAVANGAGV  254



>dbj|BAN82589.1| gigantea [Glycine max]
Length=1171

 Score =   345 bits (884),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 165/208 (79%), Positives = 184/208 (88%), Gaps = 2/208 (1%)
 Frame = +3

Query  6    EDIAE-LIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            +DIAE LIRN YPSK+  LFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPF
Sbjct  49   DDIAEVLIRNHYPSKDILLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKASPPF  108

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFIS VCP  +NE SE+WALACGEILRILTHYNRP+YK E+Q  E +RS SGSHA+TS+
Sbjct  109  ASFISSVCPKIENEYSEEWALACGEILRILTHYNRPIYKTERQSGETERSTSGSHATTSE  168

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
                G + L+ QHE+KP+R LSPWITDILLA+P+GIRSDYFRWCSG+MGKYAAGELKPPS
Sbjct  169  PGKSGHNSLT-QHEKKPIRPLSPWITDILLASPVGIRSDYFRWCSGIMGKYAAGELKPPS  227

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
            TASSRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  228  TASSRGSGKHPQLVPSTPRWAVANGAGV  255



>gb|AGW52153.1| GI [Populus tomentosa]
Length=1241

 Score =   345 bits (885),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 170/209 (81%), Positives = 189/209 (90%), Gaps = 1/209 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DI+ELIRNRYPSK+ RLFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YD++SPPF
Sbjct  108  PDDISELIRNRYPSKDKRLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDRSSPPF  167

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP S+NE SEQWALACGEILRILTHYNRP+YK E+Q++E DRS+S SHA++S+
Sbjct  168  ASFISLVCPGSENEYSEQWALACGEILRILTHYNRPIYKREQQNNETDRSSSDSHATSSE  227

Query  363  SADG-GPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  539
            SA+G   S+   Q ERKP R LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP
Sbjct  228  SAEGKSTSMPLVQQERKPFRPLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  287

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
             T SSR SGKHPQL+PSTPRWAVANGAGV
Sbjct  288  RTTSSRVSGKHPQLMPSTPRWAVANGAGV  316



>ref|XP_010268583.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
 ref|XP_010268584.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
 ref|XP_010268585.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
 ref|XP_010268586.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
 ref|XP_010268587.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
 ref|XP_010268588.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
Length=1083

 Score =   341 bits (874),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 165/211 (78%), Positives = 186/211 (88%), Gaps = 4/211 (2%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DI ELIR+RYPSK+ RLFD+VLA F+LHHPEHGHAV+ PIISC+IDGTL YDK+SPPF
Sbjct  48   PDDIGELIRSRYPSKDKRLFDEVLAMFVLHHPEHGHAVLLPIISCVIDGTLVYDKSSPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            +SFI LVCP+S+NE SEQWALACGEILR+LTHYNRP+YK E Q++EADRS+SGSHA+TS 
Sbjct  108  SSFICLVCPSSENEYSEQWALACGEILRVLTHYNRPIYKAEHQNNEADRSSSGSHATTSN  167

Query  363  SADGGP--SLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELK  533
            S +G    S LS Q E+KP R LSPWI DILLAAPLGIRSDYFRWC GVMGKY+A GELK
Sbjct  168  STEGESCHSALSKQ-EKKPSRPLSPWIADILLAAPLGIRSDYFRWCGGVMGKYSAGGELK  226

Query  534  PPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            PP+TA SRGSGKHPQLIPSTPRWAVANGA V
Sbjct  227  PPTTACSRGSGKHPQLIPSTPRWAVANGAAV  257



>ref|XP_010268589.1| PREDICTED: protein GIGANTEA-like isoform X2 [Nelumbo nucifera]
Length=1081

 Score =   341 bits (874),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 165/211 (78%), Positives = 186/211 (88%), Gaps = 4/211 (2%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DI ELIR+RYPSK+ RLFD+VLA F+LHHPEHGHAV+ PIISC+IDGTL YDK+SPPF
Sbjct  46   PDDIGELIRSRYPSKDKRLFDEVLAMFVLHHPEHGHAVLLPIISCVIDGTLVYDKSSPPF  105

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            +SFI LVCP+S+NE SEQWALACGEILR+LTHYNRP+YK E Q++EADRS+SGSHA+TS 
Sbjct  106  SSFICLVCPSSENEYSEQWALACGEILRVLTHYNRPIYKAEHQNNEADRSSSGSHATTSN  165

Query  363  SADGGP--SLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELK  533
            S +G    S LS Q E+KP R LSPWI DILLAAPLGIRSDYFRWC GVMGKY+A GELK
Sbjct  166  STEGESCHSALSKQ-EKKPSRPLSPWIADILLAAPLGIRSDYFRWCGGVMGKYSAGGELK  224

Query  534  PPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            PP+TA SRGSGKHPQLIPSTPRWAVANGA V
Sbjct  225  PPTTACSRGSGKHPQLIPSTPRWAVANGAAV  255



>ref|XP_004139688.1| PREDICTED: protein GIGANTEA-like [Cucumis sativus]
Length=1168

 Score =   342 bits (877),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 159/207 (77%), Positives = 181/207 (87%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFA  185
            EDIAELIR R+ SKE RLFDDVLA F+LHHPE+GHA+I PIISCI DG LEY++N PPFA
Sbjct  49   EDIAELIRIRFQSKEKRLFDDVLALFVLHHPENGHAIILPIISCIFDGALEYNRNDPPFA  108

Query  186  SFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKS  365
            SFISL CP  +N+ SEQWALACGEILRILTHYNRP+YK+E+++ E +RS+SGS A+TS +
Sbjct  109  SFISLFCPGIENDYSEQWALACGEILRILTHYNRPIYKMERKNGETERSSSGSRATTSDT  168

Query  366  ADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPST  545
             D     +  Q ERKP+R LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGEL+PP++
Sbjct  169  DDRELVGVPQQQERKPVRPLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELRPPTS  228

Query  546  ASSRGSGKHPQLIPSTPRWAVANGAGV  626
            ASSRGSGKHPQLIPSTPRWAVANGAGV
Sbjct  229  ASSRGSGKHPQLIPSTPRWAVANGAGV  255



>gb|ACY30446.1| gigantea-like protein [Liriodendron tulipifera]
Length=1209

 Score =   342 bits (876),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 163/210 (78%), Positives = 179/210 (85%), Gaps = 2/210 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PED+AELIR  YPSKE RL D+VLA F+LHHPEHGHAV+HPI+SCIIDGTL YDKN PPF
Sbjct  68   PEDVAELIRTCYPSKEKRLLDEVLAIFVLHHPEHGHAVVHPILSCIIDGTLVYDKNDPPF  127

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            +SFISLVCP+S+ E SEQWALACGEILRILTHYNRP+Y +E Q SE +RSNSG+HA+TS 
Sbjct  128  SSFISLVCPSSEKEYSEQWALACGEILRILTHYNRPIYNIENQSSEMERSNSGNHATTSD  187

Query  363  SADGGPSLLS-PQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  539
            S DG    LS  +HERKPLR LSPWITDILLAAPLGIRSDYFRWC GVMGKYAAGELKPP
Sbjct  188  SRDGEACQLSLVEHERKPLRPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGELKPP  247

Query  540  STASSRGS-GKHPQLIPSTPRWAVANGAGV  626
            +T        KHPQL+PSTPRWAVANGAGV
Sbjct  248  TTGYLWSQVRKHPQLMPSTPRWAVANGAGV  277



>gb|KHN41309.1| Protein GIGANTEA [Glycine soja]
Length=1166

 Score =   340 bits (873),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 162/210 (77%), Positives = 181/210 (86%), Gaps = 5/210 (2%)
 Frame = +3

Query  6    EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFA  185
            EDIAELIRN YPSKE  LFDDVLA  +LHHPEHGHAV+ PIISCIIDGTL+YDK SPPFA
Sbjct  50   EDIAELIRNHYPSKEMLLFDDVLAVLVLHHPEHGHAVVLPIISCIIDGTLDYDKTSPPFA  109

Query  186  SFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKS  365
            SFISLVCP ++NE SEQWA+ACGEILRILTHYNRP+YK+E+Q  E + S+  SHA+T+ S
Sbjct  110  SFISLVCPKNENEYSEQWAMACGEILRILTHYNRPIYKMERQYCEPEVSSGKSHATTNDS  169

Query  366  ADGGP---SLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKP  536
             DG     SL+  Q E+KP+R LSPWITDIL AAPLGIRSDYFRWCSGVMGKYAAGELKP
Sbjct  170  VDGESGHNSLM--QQEKKPIRPLSPWITDILRAAPLGIRSDYFRWCSGVMGKYAAGELKP  227

Query  537  PSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            P+  S+RGSGKHPQL+PSTPRWAVANGAGV
Sbjct  228  PTIVSARGSGKHPQLVPSTPRWAVANGAGV  257



>gb|AIR93790.1| gigantea [Kalanchoe fedtschenkoi]
Length=1149

 Score =   339 bits (870),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 163/209 (78%), Positives = 181/209 (87%), Gaps = 2/209 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+D+AELI+N YPS + RLFDDVLA F+LHHPEHGHAV+ PIIS +IDGTL YD+  PPF
Sbjct  36   PDDVAELIQNNYPSHDKRLFDDVLAMFVLHHPEHGHAVMLPIISLVIDGTLFYDRCCPPF  95

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+N  SEQWALACGEILRILTHYNRP++KVE + SEADRS SG HA+TS 
Sbjct  96   ASFISLVCPSSENYYSEQWALACGEILRILTHYNRPIFKVEHR-SEADRSTSGKHATTSD  154

Query  363  SADGGPSLLSP-QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  539
            S D      +P Q ERKP+R LSPWITDILLAAPLG+RSDYFRWC GVMGKYAAGELKPP
Sbjct  155  SNDKECGAAAPGQQERKPIRPLSPWITDILLAAPLGVRSDYFRWCGGVMGKYAAGELKPP  214

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
             TASS+GSGKHPQLIPSTPRWAVANGAGV
Sbjct  215  ITASSQGSGKHPQLIPSTPRWAVANGAGV  243



>gb|AGU91438.1| GIGANTEA-like protein, partial [Chrysanthemum boreale]
Length=949

 Score =   336 bits (861),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 164/210 (78%), Positives = 186/210 (89%), Gaps = 2/210 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAEL+RNRYPS E RL DDVLA F+LHHPEHG AV+ PIISCIIDGT+EY++++PPF
Sbjct  48   PEDIAELVRNRYPSSEKRLIDDVLAMFVLHHPEHGDAVMLPIISCIIDGTIEYERSTPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISL+CP++ NE SEQWALAC EILR+LTHYNRP++KVE+ + EADRS+SGS ASTSK
Sbjct  108  ASFISLICPSTDNEYSEQWALACVEILRMLTHYNRPIFKVERLNGEADRSSSGSQASTSK  167

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
            + DG  S  S QHERKPLR LSPWITD+LLAAPLG+RSDYFRWC GVMGKYA GELKPPS
Sbjct  168  ATDGESSSPSVQHERKPLRPLSPWITDLLLAAPLGVRSDYFRWCGGVMGKYAGGELKPPS  227

Query  543  T--ASSRGSGKHPQLIPSTPRWAVANGAGV  626
               ASSRGSGKHPQL+P+TPRWAVANGAGV
Sbjct  228  VVMASSRGSGKHPQLMPATPRWAVANGAGV  257



>ref|XP_009381150.1| PREDICTED: protein GIGANTEA-like [Musa acuminata subsp. malaccensis]
Length=1171

 Score =   335 bits (860),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 160/211 (76%), Positives = 182/211 (86%), Gaps = 4/211 (2%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDI +LI+  YPS+E RL D+VLA F+LHHPEHGHA++HPI+S IIDGTL YD+N PPF
Sbjct  48   PEDITQLIQTHYPSQEKRLLDEVLAIFILHHPEHGHAIVHPILSLIIDGTLVYDRNDPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            +SFISLV  NS+ E SEQWALACGEILRILTHYNRP+YKVE  +SE +RSNSG+HA+TSK
Sbjct  108  SSFISLVGQNSEKEYSEQWALACGEILRILTHYNRPIYKVEHHNSETERSNSGNHATTSK  167

Query  363  --SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELK  533
                DG   +L  +H+RKPLR LSPWITDILLA+PLGIRSDYFRWC GVMGKYAA GELK
Sbjct  168  PVKQDGHDQILQ-EHDRKPLRPLSPWITDILLASPLGIRSDYFRWCGGVMGKYAAGGELK  226

Query  534  PPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            PP+TA SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  227  PPTTACSRGSGKHPQLMPSTPRWAVANGAGV  257



>ref|XP_008456743.1| PREDICTED: protein GIGANTEA-like [Cucumis melo]
 ref|XP_008456744.1| PREDICTED: protein GIGANTEA-like [Cucumis melo]
 ref|XP_008456745.1| PREDICTED: protein GIGANTEA-like [Cucumis melo]
Length=1170

 Score =   335 bits (858),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 155/208 (75%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAELIR+ YP +E RL DDVLATF+LHHPEHGHAVI PIISCIIDGT+ Y K+  PF
Sbjct  49   PEDIAELIRSHYPWREKRLIDDVLATFVLHHPEHGHAVILPIISCIIDGTMAYCKDGSPF  108

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            +SFISL CP+++++ SEQWALACGEILRILTHYNRP+YK E+Q  E +RS   +H +TS 
Sbjct  109  SSFISLFCPDTEHDYSEQWALACGEILRILTHYNRPIYKTEQQSVEGERSGCDNHTTTSD  168

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
            S +  P  +    +RKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYA  ELKPP+
Sbjct  169  SNNVPPGQMPLNQDRKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAVRELKPPT  228

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
            TA+SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  229  TATSRGSGKHPQLVPSTPRWAVANGAGV  256



>ref|XP_006473104.1| PREDICTED: protein GIGANTEA-like isoform X1 [Citrus sinensis]
 ref|XP_006473105.1| PREDICTED: protein GIGANTEA-like isoform X2 [Citrus sinensis]
 ref|XP_006473106.1| PREDICTED: protein GIGANTEA-like isoform X3 [Citrus sinensis]
 ref|XP_006473107.1| PREDICTED: protein GIGANTEA-like isoform X4 [Citrus sinensis]
Length=1165

 Score =   334 bits (857),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 170/209 (81%), Positives = 185/209 (89%), Gaps = 1/209 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PE+IAELIR+ YP KE RLFDDVLA F+LHHPEHGHAV  PIISCIIDGTL YDK+SPPF
Sbjct  48   PEEIAELIRSHYPHKERRLFDDVLAMFVLHHPEHGHAVALPIISCIIDGTLVYDKSSPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASF+SLVCPNS+NE SEQWALAC EILRILTHYNRP+YK E+Q+SE +RS+S SHA+TS 
Sbjct  108  ASFVSLVCPNSENEYSEQWALACTEILRILTHYNRPIYKTEQQNSEFERSSSSSHATTSD  167

Query  363  SADGGPSLLS-PQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  539
            S DG  S +   Q ERKPLR LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP
Sbjct  168  SRDGELSNMPLVQQERKPLRPLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  227

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            + ASSRGSGKHPQL+ STPRWAVANGAGV
Sbjct  228  TIASSRGSGKHPQLMLSTPRWAVANGAGV  256



>ref|XP_002890532.1| hypothetical protein ARALYDRAFT_889789 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66791.1| hypothetical protein ARALYDRAFT_889789 [Arabidopsis lyrata subsp. 
lyrata]
Length=1174

 Score =   334 bits (857),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 162/209 (78%), Positives = 181/209 (87%), Gaps = 3/209 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAEL+R++YPS E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PF
Sbjct  51   PDDIAELVRHQYPSTEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPF  110

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+N+ SEQWALACGEILRILTHYNRP+YK E+Q+ E +R N  S A+TS 
Sbjct  111  ASFISLVCPSSENDYSEQWALACGEILRILTHYNRPIYKTEQQNGETER-NCFSKATTSG  169

Query  363  SADGGPSLLSP-QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  539
            S    P  LSP QHERKPLR LSPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP
Sbjct  170  SPTSEPKALSPTQHERKPLRPLSPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  229

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            + A SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  230  TIA-SRGSGKHPQLMPSTPRWAVANGAGV  257



>ref|XP_004160322.1| PREDICTED: protein GIGANTEA-like, partial [Cucumis sativus]
Length=994

 Score =   331 bits (849),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 155/208 (75%), Positives = 176/208 (85%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAELIR+ YP KE RL DDVLATF+LHHPEHGHAVI PIISCIIDGT+ Y K+  PF
Sbjct  49   PEDIAELIRSHYPWKEKRLIDDVLATFVLHHPEHGHAVILPIISCIIDGTMVYCKDGSPF  108

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            +SFISL CP+++++ SEQWALACGEILRILTHYNRP+YK E+Q  E +RS   +H +TS 
Sbjct  109  SSFISLFCPDTEHDYSEQWALACGEILRILTHYNRPIYKTEQQSVEGERSGCDNHTTTSD  168

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
            S +  P  +    +RKPLR LSPWITDILLAAPLGIRSDYFRWCSGVMGKYA  ELKPP+
Sbjct  169  SNNVPPGQMPLNQDRKPLRPLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAVRELKPPT  228

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
            TA+SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  229  TATSRGSGKHPQLVPSTPRWAVANGAGV  256



>ref|XP_007151935.1| hypothetical protein PHAVU_004G088300g [Phaseolus vulgaris]
 gb|ESW23929.1| hypothetical protein PHAVU_004G088300g [Phaseolus vulgaris]
Length=1169

 Score =   333 bits (854),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 160/211 (76%), Positives = 179/211 (85%), Gaps = 5/211 (2%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAELIRNRYPSKE  LFD+VLA  +LHHPEHGHAV+ PIISCIIDGTL YDK SPPF
Sbjct  52   PDDIAELIRNRYPSKEMLLFDEVLAVLVLHHPEHGHAVVLPIISCIIDGTLVYDKTSPPF  111

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP ++NE SEQWALACGEILRILT YNRP+YK+E+Q  EA+ S+ GSHA  + 
Sbjct  112  ASFISLVCPKNENEYSEQWALACGEILRILTLYNRPIYKMERQYCEAEGSSGGSHAMVND  171

Query  363  SA---DGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELK  533
            SA    G  S++  Q E+KP R LSPWITDILLAAPLGIRSDYFRWCSGV+GKY AGEL+
Sbjct  172  SAYGESGHNSMM--QQEKKPTRPLSPWITDILLAAPLGIRSDYFRWCSGVLGKYGAGELQ  229

Query  534  PPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            PP   S+RGSGKHPQL+PSTPRWAVANGAGV
Sbjct  230  PPMIVSARGSGKHPQLMPSTPRWAVANGAGV  260



>ref|XP_006416158.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
 gb|ESQ34511.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
Length=984

 Score =   330 bits (846),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 160/209 (77%), Positives = 181/209 (87%), Gaps = 3/209 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAEL+R++YPS E RL DDVLA F+LHHPEHGHAVI P+ISC+IDG+L Y K + PF
Sbjct  48   PDDIAELVRHQYPSTEKRLLDDVLAMFVLHHPEHGHAVILPMISCLIDGSLVYSKEAHPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+N+ SEQWALACGEILRILTHYNRP+YK E+Q+ E +  N  S A+TS 
Sbjct  108  ASFISLVCPSSENDYSEQWALACGEILRILTHYNRPIYKTEQQNGETE-INCLSKATTSG  166

Query  363  SADGGPSLLSP-QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  539
            SA   P  +SP QHERKPLR LSPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP
Sbjct  167  SALSEPKAVSPVQHERKPLRPLSPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  226

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            + A SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  227  TIA-SRGSGKHPQLMPSTPRWAVANGAGV  254



>gb|ABP96481.1| GIGANTEA [Arabidopsis lyrata subsp. petraea]
Length=1173

 Score =   333 bits (853),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 161/209 (77%), Positives = 181/209 (87%), Gaps = 3/209 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAEL+R++YPS E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PF
Sbjct  51   PDDIAELVRHQYPSTEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPF  110

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+N+ SEQWALACGEILRILTHYNRP+YK E+Q+ E +R N  S A+TS 
Sbjct  111  ASFISLVCPSSENDYSEQWALACGEILRILTHYNRPIYKTEQQNGETER-NCFSKATTSG  169

Query  363  SADGGPSLLSP-QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  539
            S    P  +SP QHERKPLR LSPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP
Sbjct  170  SPTSEPKAVSPTQHERKPLRPLSPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  229

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            + A SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  230  TIA-SRGSGKHPQLMPSTPRWAVANGAGV  257



>ref|XP_009631432.1| PREDICTED: protein GIGANTEA-like isoform X3 [Nicotiana tomentosiformis]
Length=1165

 Score =   333 bits (853),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 172/226 (76%), Positives = 181/226 (80%), Gaps = 26/226 (12%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAELIR+RYPSKENRLFDDVL        EHGHAVI PIISCIIDGTL+YDK+ PPF
Sbjct  48   PEDIAELIRHRYPSKENRLFDDVL--------EHGHAVILPIISCIIDGTLDYDKSCPPF  99

Query  183  ASFISLVCPNSQ--------------NELSEQWALACGEILRILTHYNRPVYKVEKQDSE  320
            ASFISLVCP+S+               E SEQWALACGEILRILTHYNRP+YKV +Q+  
Sbjct  100  ASFISLVCPSSEVLRILNYQFEGLSHKEYSEQWALACGEILRILTHYNRPIYKVVQQEGG  159

Query  321  ADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSG  500
            ADRS+ GSHASTSK AD  P L S  HERKPLR LSPWITDILLAAPLGIRSDYFRWC G
Sbjct  160  ADRSSRGSHASTSKFADSEPRLPSMHHERKPLRPLSPWITDILLAAPLGIRSDYFRWCGG  219

Query  501  VMGKYAAGELKPPST----ASSRGSGKHPQLIPSTPRWAVANGAGV  626
            VMGKYAAGELKPPST    ASS GSGKH QLIPSTPRWAVANGAGV
Sbjct  220  VMGKYAAGELKPPSTDFIVASSHGSGKHHQLIPSTPRWAVANGAGV  265



>ref|XP_006842209.1| hypothetical protein AMTR_s00078p00173230 [Amborella trichopoda]
 gb|ERN03884.1| hypothetical protein AMTR_s00078p00173230 [Amborella trichopoda]
Length=1143

 Score =   332 bits (852),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 160/212 (75%), Positives = 185/212 (87%), Gaps = 6/212 (3%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DI+ELI++RYPSKE  L DDVLA F+LHHPEHGHAVIHPI+SCIIDGTL YDK +PPF
Sbjct  21   PDDISELIQSRYPSKEVCLLDDVLAIFVLHHPEHGHAVIHPILSCIIDGTLIYDKGNPPF  80

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            +SFISL  P+S+ + SEQWALACGEILR+LTHYNRP++KVEKQ+ E +RS+SG++A+TS 
Sbjct  81   SSFISLFSPSSEKDYSEQWALACGEILRVLTHYNRPIFKVEKQNCELERSSSGNYATTSS  140

Query  363  SADGG---PSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GEL  530
              +G    P L+ P  E+KPLR LSPWITDILLAAPLGIRSDYFRWC GVMGKYAA GEL
Sbjct  141  GREGKACHPLLMEP--EKKPLRPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGEL  198

Query  531  KPPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            KPP+TAS RGSGKHPQL+PSTPRWAVANGAGV
Sbjct  199  KPPTTASGRGSGKHPQLMPSTPRWAVANGAGV  230



>gb|KFK44368.1| gigantea [Arabis alpina]
Length=1173

 Score =   332 bits (852),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 160/209 (77%), Positives = 180/209 (86%), Gaps = 3/209 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAEL+R +YPS E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PF
Sbjct  48   PDDIAELVRQQYPSNEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+N+ SEQWALACGEILRILTHYNRP+YK E+Q+ E +R N  S A+TS 
Sbjct  108  ASFISLVCPSSENDYSEQWALACGEILRILTHYNRPIYKTEQQNGETER-NCLSKATTSG  166

Query  363  SADGGPSLLSP-QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  539
            S    P  +SP QHERKP+R LSPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP
Sbjct  167  STLSEPKAVSPVQHERKPIRPLSPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  226

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            + A SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  227  TIA-SRGSGKHPQLMPSTPRWAVANGAGV  254



>ref|XP_004140955.1| PREDICTED: protein GIGANTEA-like [Cucumis sativus]
 gb|KGN46115.1| hypothetical protein Csa_6G055360 [Cucumis sativus]
Length=1170

 Score =   332 bits (850),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 155/208 (75%), Positives = 176/208 (85%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAELIR+ YP KE RL DDVLATF+LHHPEHGHAVI PIISCIIDGT+ Y K+  PF
Sbjct  49   PEDIAELIRSHYPWKEKRLIDDVLATFVLHHPEHGHAVILPIISCIIDGTMVYCKDGSPF  108

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            +SFISL CP+++++ SEQWALACGEILRILTHYNRP+YK E+Q  E +RS   +H +TS 
Sbjct  109  SSFISLFCPDTEHDYSEQWALACGEILRILTHYNRPIYKTEQQSVEGERSGCDNHTTTSD  168

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
            S +  P  +    +RKPLR LSPWITDILLAAPLGIRSDYFRWCSGVMGKYA  ELKPP+
Sbjct  169  SNNVPPGQMPLNQDRKPLRPLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAVRELKPPT  228

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
            TA+SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  229  TATSRGSGKHPQLVPSTPRWAVANGAGV  256



>ref|XP_008786518.1| PREDICTED: protein GIGANTEA-like [Phoenix dactylifera]
 ref|XP_008786528.1| PREDICTED: protein GIGANTEA-like [Phoenix dactylifera]
 ref|XP_008786537.1| PREDICTED: protein GIGANTEA-like [Phoenix dactylifera]
Length=1170

 Score =   331 bits (849),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 157/210 (75%), Positives = 180/210 (86%), Gaps = 2/210 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PED+A+LI+N YPSKE RL D+VLA F+LHHPEHGHA++HPI+S IIDGTL YDKN PPF
Sbjct  48   PEDVAQLIQNYYPSKEKRLLDEVLAIFVLHHPEHGHAIVHPILSRIIDGTLVYDKNDPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            +SFI LV  N++ E +EQWALACGEILR+LTHYNRP+YK E   SE DRS+SG+HA+TS 
Sbjct  108  SSFIYLVSQNNEKEYNEQWALACGEILRVLTHYNRPIYKFEHHSSEVDRSSSGNHATTSD  167

Query  363  SADG-GPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKP  536
            S +G   S L  +H+RKPLR LSPWITD+LLAAPLGIRSDYFRWC GVMGKYAA GELKP
Sbjct  168  SNEGEAASPLLQEHDRKPLRPLSPWITDMLLAAPLGIRSDYFRWCGGVMGKYAAGGELKP  227

Query  537  PSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            P+TA S GSGKHPQL+PSTPRWAVANGAGV
Sbjct  228  PTTACSHGSGKHPQLMPSTPRWAVANGAGV  257



>ref|XP_006416159.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
 ref|XP_006416160.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
 gb|ESQ34512.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
 gb|ESQ34513.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
Length=1171

 Score =   330 bits (847),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 160/209 (77%), Positives = 181/209 (87%), Gaps = 3/209 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAEL+R++YPS E RL DDVLA F+LHHPEHGHAVI P+ISC+IDG+L Y K + PF
Sbjct  48   PDDIAELVRHQYPSTEKRLLDDVLAMFVLHHPEHGHAVILPMISCLIDGSLVYSKEAHPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+N+ SEQWALACGEILRILTHYNRP+YK E+Q+ E +  N  S A+TS 
Sbjct  108  ASFISLVCPSSENDYSEQWALACGEILRILTHYNRPIYKTEQQNGETE-INCLSKATTSG  166

Query  363  SADGGPSLLSP-QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  539
            SA   P  +SP QHERKPLR LSPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP
Sbjct  167  SALSEPKAVSPVQHERKPLRPLSPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  226

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            + A SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  227  TIA-SRGSGKHPQLMPSTPRWAVANGAGV  254



>ref|XP_010925341.1| PREDICTED: protein GIGANTEA-like [Elaeis guineensis]
Length=1170

 Score =   330 bits (846),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 157/210 (75%), Positives = 179/210 (85%), Gaps = 2/210 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PED+A+LI+N YP KE RL D+VLA F+LHHPEHGHA++HPI+S IIDGTL YDKN PPF
Sbjct  48   PEDVAQLIQNYYPYKEKRLLDEVLAIFVLHHPEHGHAIVHPILSRIIDGTLVYDKNDPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
             SFI LV  N++ E +EQWALAC EILR+LTHYNRP+YK E   SEADRS+SG+HA+TS 
Sbjct  108  CSFIYLVSQNNEKEYNEQWALACAEILRVLTHYNRPIYKSEHHSSEADRSSSGNHATTSD  167

Query  363  SADG-GPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKP  536
            S +G   + L  +H+RKPLR LSPWITDILLAAPLGIRSDYFRWC GVMGKYAA GELKP
Sbjct  168  SNEGEAANSLLQEHDRKPLRPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGELKP  227

Query  537  PSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            P+TA SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  228  PTTACSRGSGKHPQLMPSTPRWAVANGAGV  257



>gb|AAF00023.1| GIGANTEA [Arabidopsis thaliana]
Length=1155

 Score =   329 bits (844),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 160/209 (77%), Positives = 180/209 (86%), Gaps = 3/209 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAEL+R++YPS E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PF
Sbjct  50   PDDIAELVRHQYPSTEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+N+ SEQWALACGEILRILTHYNRP+YK E+Q+ + +R N  S A+TS 
Sbjct  110  ASFISLVCPSSENDYSEQWALACGEILRILTHYNRPIYKTEQQNGDTER-NCLSKATTSG  168

Query  363  SADGGPSLLSP-QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  539
            S    P   SP QHERKPLR LSPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP
Sbjct  169  SPTSEPKAGSPTQHERKPLRPLSPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  228

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            + A SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  229  TIA-SRGSGKHPQLMPSTPRWAVANGAGV  256



>gb|ABP96485.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96486.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96499.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   329 bits (844),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 160/209 (77%), Positives = 180/209 (86%), Gaps = 3/209 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAEL+R++YPS E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PF
Sbjct  50   PDDIAELVRHQYPSTEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+N+ SEQWALACGEILRILTHYNRP+YK E+Q+ + +R N  S A+TS 
Sbjct  110  ASFISLVCPSSENDYSEQWALACGEILRILTHYNRPIYKTEQQNGDTER-NCLSKATTSG  168

Query  363  SADGGPSLLSP-QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  539
            S    P   SP QHERKPLR LSPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP
Sbjct  169  SPTSEPKAGSPTQHERKPLRPLSPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  228

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            + A SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  229  TIA-SRGSGKHPQLMPSTPRWAVANGAGV  256



>gb|ABP96497.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   329 bits (844),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 160/209 (77%), Positives = 180/209 (86%), Gaps = 3/209 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAEL+R++YPS E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PF
Sbjct  50   PDDIAELVRHQYPSTEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+N+ SEQWALACGEILRILTHYNRP+YK E+Q+ + +R N  S A+TS 
Sbjct  110  ASFISLVCPSSENDYSEQWALACGEILRILTHYNRPIYKTEQQNGDTER-NCLSKATTSG  168

Query  363  SADGGPSLLSP-QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  539
            S    P   SP QHERKPLR LSPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP
Sbjct  169  SPTSEPKAGSPTQHERKPLRPLSPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  228

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            + A SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  229  TIA-SRGSGKHPQLMPSTPRWAVANGAGV  256



>gb|ABP96484.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96487.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96489.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96500.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96501.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   329 bits (844),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 160/209 (77%), Positives = 180/209 (86%), Gaps = 3/209 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAEL+R++YPS E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PF
Sbjct  50   PDDIAELVRHQYPSTEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+N+ SEQWALACGEILRILTHYNRP+YK E+Q+ + +R N  S A+TS 
Sbjct  110  ASFISLVCPSSENDYSEQWALACGEILRILTHYNRPIYKTEQQNGDTER-NCLSKATTSG  168

Query  363  SADGGPSLLSP-QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  539
            S    P   SP QHERKPLR LSPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP
Sbjct  169  SPTSEPKAGSPTQHERKPLRPLSPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  228

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            + A SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  229  TIA-SRGSGKHPQLMPSTPRWAVANGAGV  256



>gb|AAT97404.1| gigantea [Arabidopsis thaliana]
Length=1173

 Score =   329 bits (844),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 160/209 (77%), Positives = 180/209 (86%), Gaps = 3/209 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAEL+R++YPS E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PF
Sbjct  50   PDDIAELVRHQYPSTEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+N+ SEQWALACGEILRILTHYNRP+YK E+Q+ + +R N  S A+TS 
Sbjct  110  ASFISLVCPSSENDYSEQWALACGEILRILTHYNRPIYKTEQQNGDTER-NCLSKATTSG  168

Query  363  SADGGPSLLSP-QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  539
            S    P   SP QHERKPLR LSPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP
Sbjct  169  SPTSEPKAGSPTQHERKPLRPLSPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  228

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            + A SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  229  TIA-SRGSGKHPQLMPSTPRWAVANGAGV  256



>ref|NP_564180.1| protein GIGANTEA [Arabidopsis thaliana]
 sp|Q9SQI2.2|GIGAN_ARATH RecName: Full=Protein GIGANTEA [Arabidopsis thaliana]
 gb|AAF00092.1|AF105064_1 GIGANTEA [Arabidopsis thaliana]
 emb|CAB56039.1| gigantea protein [Arabidopsis thaliana]
 gb|AAT97405.1| gigantea [Arabidopsis thaliana]
 gb|AEE30286.1| gigantea protein (GI) [Arabidopsis thaliana]
Length=1173

 Score =   329 bits (844),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 160/209 (77%), Positives = 180/209 (86%), Gaps = 3/209 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAEL+R++YPS E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PF
Sbjct  50   PDDIAELVRHQYPSTEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+N+ SEQWALACGEILRILTHYNRP+YK E+Q+ + +R N  S A+TS 
Sbjct  110  ASFISLVCPSSENDYSEQWALACGEILRILTHYNRPIYKTEQQNGDTER-NCLSKATTSG  168

Query  363  SADGGPSLLSP-QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  539
            S    P   SP QHERKPLR LSPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP
Sbjct  169  SPTSEPKAGSPTQHERKPLRPLSPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  228

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            + A SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  229  TIA-SRGSGKHPQLMPSTPRWAVANGAGV  256



>gb|ABP96498.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   329 bits (844),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 160/209 (77%), Positives = 180/209 (86%), Gaps = 3/209 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAEL+R++YPS E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PF
Sbjct  50   PDDIAELVRHQYPSTEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+N+ SEQWALACGEILRILTHYNRP+YK E+Q+ + +R N  S A+TS 
Sbjct  110  ASFISLVCPSSENDYSEQWALACGEILRILTHYNRPIYKTEQQNGDTER-NCLSKATTSG  168

Query  363  SADGGPSLLSP-QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  539
            S    P   SP QHERKPLR LSPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP
Sbjct  169  SPTSEPKAGSPTQHERKPLRPLSPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  228

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            + A SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  229  TIA-SRGSGKHPQLMPSTPRWAVANGAGV  256



>gb|ABP96482.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   329 bits (844),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 160/209 (77%), Positives = 180/209 (86%), Gaps = 3/209 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAEL+R++YPS E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PF
Sbjct  50   PDDIAELVRHQYPSTEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+N+ SEQWALACGEILRILTHYNRP+YK E+Q+ + +R N  S A+TS 
Sbjct  110  ASFISLVCPSSENDYSEQWALACGEILRILTHYNRPIYKTEQQNGDTER-NCLSKATTSG  168

Query  363  SADGGPSLLSP-QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  539
            S    P   SP QHERKPLR LSPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP
Sbjct  169  SPTSEPKAGSPTQHERKPLRPLSPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  228

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            + A SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  229  TIA-SRGSGKHPQLMPSTPRWAVANGAGV  256



>gb|ABP96496.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   329 bits (843),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 159/209 (76%), Positives = 180/209 (86%), Gaps = 3/209 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAEL+R++YPS E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PF
Sbjct  50   PDDIAELVRHQYPSTEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASF+SLVCP+S+N+ SEQWALACGEILRILTHYNRP+YK E+Q+ + +R N  S A+TS 
Sbjct  110  ASFVSLVCPSSENDYSEQWALACGEILRILTHYNRPIYKTEQQNGDTER-NCLSKATTSG  168

Query  363  SADGGPSLLSP-QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  539
            S    P   SP QHERKPLR LSPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP
Sbjct  169  SPTSEPKAGSPTQHERKPLRPLSPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  228

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            + A SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  229  TIA-SRGSGKHPQLMPSTPRWAVANGAGV  256



>gb|AAT80910.1| GIGANTEA [Arabidopsis thaliana]
Length=1173

 Score =   329 bits (843),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 159/209 (76%), Positives = 180/209 (86%), Gaps = 3/209 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAEL+R++YPS E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PF
Sbjct  50   PDDIAELVRHQYPSTEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASF+SLVCP+S+N+ SEQWALACGEILRILTHYNRP+YK E+Q+ + +R N  S A+TS 
Sbjct  110  ASFVSLVCPSSENDYSEQWALACGEILRILTHYNRPIYKTEQQNGDTER-NCLSKATTSG  168

Query  363  SADGGPSLLSP-QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  539
            S    P   SP QHERKPLR LSPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP
Sbjct  169  SPTSEPKAGSPTQHERKPLRPLSPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  228

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            + A SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  229  TIA-SRGSGKHPQLMPSTPRWAVANGAGV  256



>ref|XP_010062087.1| PREDICTED: protein GIGANTEA isoform X1 [Eucalyptus grandis]
 ref|XP_010062088.1| PREDICTED: protein GIGANTEA isoform X1 [Eucalyptus grandis]
 ref|XP_010062089.1| PREDICTED: protein GIGANTEA isoform X1 [Eucalyptus grandis]
 gb|KCW69154.1| hypothetical protein EUGRSUZ_F02686 [Eucalyptus grandis]
Length=1166

 Score =   328 bits (842),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 165/208 (79%), Positives = 185/208 (89%), Gaps = 1/208 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAELIR+RYPSKE  LFDDVLATF+LHHPEHGHAV+ PIISC+IDG+L YD++ PPF
Sbjct  47   PDDIAELIRSRYPSKEKCLFDDVLATFVLHHPEHGHAVVLPIISCLIDGSLVYDRDKPPF  106

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+NE SEQWALACGEILR+LT YNRP+YK E Q+ E DRSNS S ASTSK
Sbjct  107  ASFISLVCPSSENEYSEQWALACGEILRMLTLYNRPIYKTEHQNGEPDRSNSCSSASTSK  166

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
            S +G  S+   Q ER+P+R LSPWITDILLAAPLGIRSDYFRWC GVMGKYAAGELKPP 
Sbjct  167  STEGD-SVPLVQQERRPIRPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGELKPPI  225

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
            T++SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  226  TSTSRGSGKHPQLMPSTPRWAVANGAGV  253



>gb|KCW69153.1| hypothetical protein EUGRSUZ_F02686 [Eucalyptus grandis]
Length=1167

 Score =   328 bits (842),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 165/208 (79%), Positives = 185/208 (89%), Gaps = 1/208 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAELIR+RYPSKE  LFDDVLATF+LHHPEHGHAV+ PIISC+IDG+L YD++ PPF
Sbjct  47   PDDIAELIRSRYPSKEKCLFDDVLATFVLHHPEHGHAVVLPIISCLIDGSLVYDRDKPPF  106

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+NE SEQWALACGEILR+LT YNRP+YK E Q+ E DRSNS S ASTSK
Sbjct  107  ASFISLVCPSSENEYSEQWALACGEILRMLTLYNRPIYKTEHQNGEPDRSNSCSSASTSK  166

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
            S +G  S+   Q ER+P+R LSPWITDILLAAPLGIRSDYFRWC GVMGKYAAGELKPP 
Sbjct  167  STEGD-SVPLVQQERRPIRPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGELKPPI  225

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
            T++SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  226  TSTSRGSGKHPQLMPSTPRWAVANGAGV  253



>gb|ABP96488.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   328 bits (840),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 159/209 (76%), Positives = 179/209 (86%), Gaps = 3/209 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAEL+R++YPS E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PF
Sbjct  50   PDDIAELVRHQYPSTEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+N+ SEQWALACGEILRILTHYNRP+YK E+Q+ + +R N    A+TS 
Sbjct  110  ASFISLVCPSSENDYSEQWALACGEILRILTHYNRPIYKTEQQNGDTER-NCLRKATTSG  168

Query  363  SADGGPSLLSP-QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  539
            S    P   SP QHERKPLR LSPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP
Sbjct  169  SPTSEPKAGSPTQHERKPLRPLSPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  228

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            + A SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  229  TIA-SRGSGKHPQLMPSTPRWAVANGAGV  256



>gb|ABP96483.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96490.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96491.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96492.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96493.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96494.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96495.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96502.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   328 bits (840),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 159/209 (76%), Positives = 179/209 (86%), Gaps = 3/209 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAEL+R++YPS E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PF
Sbjct  50   PDDIAELVRHQYPSTEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+N+ SEQWALACGEILRILTHYNRP+YK E+Q+ + +R N    A+TS 
Sbjct  110  ASFISLVCPSSENDYSEQWALACGEILRILTHYNRPIYKTEQQNGDTER-NCLRKATTSG  168

Query  363  SADGGPSLLSP-QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  539
            S    P   SP QHERKPLR LSPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP
Sbjct  169  SPTSEPKAGSPTQHERKPLRPLSPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  228

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            + A SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  229  TIA-SRGSGKHPQLMPSTPRWAVANGAGV  256



>gb|KDO83806.1| hypothetical protein CISIN_1g001216mg [Citrus sinensis]
Length=1122

 Score =   326 bits (835),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 165/206 (80%), Positives = 181/206 (88%), Gaps = 1/206 (0%)
 Frame = +3

Query  12   IAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASF  191
            + +LIR+ YP KE RLFDDVLA F+LHHPEHGHAV  PIISCIIDGTL YDK+SPPFASF
Sbjct  8    LVQLIRSHYPHKERRLFDDVLAMFVLHHPEHGHAVALPIISCIIDGTLVYDKSSPPFASF  67

Query  192  ISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSAD  371
            +SLVCPNS+NE SEQWALAC EILRILTHYNRP+YK E+Q+SE +RS+S SHA+TS S D
Sbjct  68   VSLVCPNSENEYSEQWALACTEILRILTHYNRPIYKTEQQNSEFERSSSSSHATTSDSRD  127

Query  372  GGPSLLS-PQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTA  548
            G  S +   Q ERKPLR LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+ A
Sbjct  128  GELSNMPLVQQERKPLRPLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTIA  187

Query  549  SSRGSGKHPQLIPSTPRWAVANGAGV  626
            SSRGSGKHPQL+ STPRWAVANGAGV
Sbjct  188  SSRGSGKHPQLMLSTPRWAVANGAGV  213



>ref|XP_008793464.1| PREDICTED: protein GIGANTEA-like [Phoenix dactylifera]
Length=1169

 Score =   325 bits (834),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 157/211 (74%), Positives = 177/211 (84%), Gaps = 4/211 (2%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PED+A+LI+N YPSKE RL DDVLA F+LHHPEHGHA++HPI+S IIDGTL YDKN PPF
Sbjct  48   PEDVAQLIQNYYPSKEKRLLDDVLAIFVLHHPEHGHAIVHPILSRIIDGTLVYDKNDPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHAST--  356
            +SFISL   N++ + +EQWALACGEILR+LTHYNRP+YK E   SE DRS+  +HA T  
Sbjct  108  SSFISLFSQNNEKDYNEQWALACGEILRVLTHYNRPIYKSEHHSSEVDRSSCSNHAPTSD  167

Query  357  SKSADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELK  533
            SK  +   SLL  +H+RKPLR LSPWITDILLAAPLGIRSDYFRWC GVMGKYAA GELK
Sbjct  168  SKEKEASNSLLQ-EHDRKPLRPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGELK  226

Query  534  PPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            PP TA SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  227  PPMTACSRGSGKHPQLMPSTPRWAVANGAGV  257



>ref|XP_007199688.1| hypothetical protein PRUPE_ppa000556mg [Prunus persica]
 gb|EMJ00887.1| hypothetical protein PRUPE_ppa000556mg [Prunus persica]
Length=1098

 Score =   324 bits (831),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 154/183 (84%), Positives = 168/183 (92%), Gaps = 1/183 (1%)
 Frame = +3

Query  81   FLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACGEI  260
            F+LHHPEHGHAVI PIISCIIDGTL Y++ SPPFASFISLVCP+S+NE SEQWALACGEI
Sbjct  2    FVLHHPEHGHAVILPIISCIIDGTLAYERTSPPFASFISLVCPSSENEYSEQWALACGEI  61

Query  261  LRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLS-PQHERKPLRLLSPWI  437
            LRILTHYNRP+YKVE+Q+SE +RS+SGSHA+TS S DG  S +   Q ERKP+R LSPWI
Sbjct  62   LRILTHYNRPIYKVEQQNSETERSSSGSHATTSDSVDGESSHIPLVQQERKPIRPLSPWI  121

Query  438  TDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAVANG  617
            TDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQL+PSTPRWAVANG
Sbjct  122  TDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLMPSTPRWAVANG  181

Query  618  AGV  626
            AGV
Sbjct  182  AGV  184



>ref|XP_006306336.1| hypothetical protein CARUB_v10012213mg [Capsella rubella]
 gb|EOA39234.1| hypothetical protein CARUB_v10012213mg [Capsella rubella]
Length=1171

 Score =   324 bits (831),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 157/209 (75%), Positives = 179/209 (86%), Gaps = 3/209 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAEL+R++YPS E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PF
Sbjct  49   PDDIAELVRHQYPSNEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPF  108

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+N+ SEQWALACGEILRILTHYNRP+YK E+Q+ + +R N  + A+TS 
Sbjct  109  ASFISLVCPSSENDYSEQWALACGEILRILTHYNRPIYKTEQQNGDTER-NCLNKATTSG  167

Query  363  SADGGPSLLSPQH-ERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  539
            S       +SP H ERKPLR LSPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP
Sbjct  168  SPPSESKAVSPTHNERKPLRPLSPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  227

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            + A SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  228  TIA-SRGSGKHPQLMPSTPRWAVANGAGV  255



>ref|XP_010915066.1| PREDICTED: protein GIGANTEA-like [Elaeis guineensis]
Length=1171

 Score =   324 bits (830),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 155/210 (74%), Positives = 176/210 (84%), Gaps = 2/210 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PED+A+LI+N YPSKE RL DDVLA F+LHHPEHGHA++HPI+S IIDGTL YDKN PPF
Sbjct  48   PEDVAQLIQNYYPSKEKRLLDDVLAIFVLHHPEHGHAIVHPILSRIIDGTLVYDKNDPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            +SFISL   N++ + +EQWALACGEILR+LTHYNRP+YK E   SE D S+  +HA+TS 
Sbjct  108  SSFISLFSQNNEKDYNEQWALACGEILRVLTHYNRPIYKSEHHSSEVDGSSCSNHATTSD  167

Query  363  SADG-GPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKP  536
            S +    S L  +H+RKPLR LSPWITDILLAAPLGIRSDYFRWC GVMGKYAA GELKP
Sbjct  168  SREKEASSSLLQEHDRKPLRPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGELKP  227

Query  537  PSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            P TA SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  228  PMTACSRGSGKHPQLMPSTPRWAVANGAGV  257



>ref|XP_009115601.1| PREDICTED: protein GIGANTEA [Brassica rapa]
Length=1171

 Score =   324 bits (830),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 161/214 (75%), Positives = 179/214 (84%), Gaps = 16/214 (7%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAEL+RN+YPS E RL DDVLA F+LHHPEHGHAVI PIISC+IDGTL Y K + PF
Sbjct  50   PDDIAELVRNQYPSTEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGTLVYSKEAHPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLV PNS+N+ SEQWALACGEILRILTHYNRP+YK E+Q+ E +     S ASTS 
Sbjct  110  ASFISLVSPNSENDYSEQWALACGEILRILTHYNRPIYKTEQQNGETE-----SKASTS-  163

Query  363  SADGGPSL-----LSP-QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAG  524
               G P+L     +SP QHERKPLR LSPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAG
Sbjct  164  ---GSPTLSEAKAVSPGQHERKPLRPLSPWISDILLAAPLGIRSDYFRWCSGVMGKYAAG  220

Query  525  ELKPPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            ELKPP+ A +RGSGKHPQ +PSTPRWAVANGAGV
Sbjct  221  ELKPPTIA-TRGSGKHPQYMPSTPRWAVANGAGV  253



>emb|CDY21388.1| BnaA09g30390D [Brassica napus]
Length=1171

 Score =   323 bits (828),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 161/214 (75%), Positives = 179/214 (84%), Gaps = 16/214 (7%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAEL+RN+YPS E RL DDVLA F+LHHPEHGHAVI PIISC+IDGTL Y K + PF
Sbjct  50   PDDIAELVRNQYPSTEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGTLVYSKEAHPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLV PNS+N+ SEQWALACGEILRILTHYNRP+YK E+Q+ E +     S ASTS 
Sbjct  110  ASFISLVSPNSENDYSEQWALACGEILRILTHYNRPIYKTEQQNGETE-----SKASTS-  163

Query  363  SADGGPSL-----LSP-QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAG  524
               G P+L     +SP QHERKPLR LSPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAG
Sbjct  164  ---GSPTLSEAKAVSPGQHERKPLRPLSPWISDILLAAPLGIRSDYFRWCSGVMGKYAAG  220

Query  525  ELKPPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            ELKPP+ A +RGSGKHPQ +PSTPRWAVANGAGV
Sbjct  221  ELKPPTIA-TRGSGKHPQYMPSTPRWAVANGAGV  253



>ref|XP_010462850.1| PREDICTED: protein GIGANTEA-like [Camelina sativa]
Length=1138

 Score =   323 bits (827),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 157/209 (75%), Positives = 178/209 (85%), Gaps = 3/209 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAEL+R++YPS E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PF
Sbjct  50   PDDIAELVRHQYPSDEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+N+ SEQWALACGEILRILTHYNRP++K E+Q+ E +R N  + A+TS 
Sbjct  110  ASFISLVCPSSENDYSEQWALACGEILRILTHYNRPIFKTEQQNGEIER-NCLNKATTSG  168

Query  363  SADGGPSLLSP-QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  539
            S       +SP  HERKPLR LSPWI DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP
Sbjct  169  SPPSETKAVSPTHHERKPLRPLSPWICDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  228

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            + A SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  229  TIA-SRGSGKHPQLMPSTPRWAVANGAGV  256



>ref|XP_010535090.1| PREDICTED: protein GIGANTEA [Tarenaya hassleriana]
 ref|XP_010535098.1| PREDICTED: protein GIGANTEA [Tarenaya hassleriana]
 ref|XP_010535104.1| PREDICTED: protein GIGANTEA [Tarenaya hassleriana]
Length=1167

 Score =   323 bits (827),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 154/209 (74%), Positives = 176/209 (84%), Gaps = 2/209 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAEL+RN+YPS E RL DDV+A F+LHHPEHGHAVI PII+CIIDG+L Y+K +PPF
Sbjct  48   PEDIAELVRNQYPSTEKRLLDDVMAMFVLHHPEHGHAVILPIIACIIDGSLVYNKETPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVC +S+N+ SEQWALACGEILRILTHYNRP+YK+EKQ  E +RSN G   +T+ 
Sbjct  108  ASFISLVCSSSENDYSEQWALACGEILRILTHYNRPIYKMEKQLGETERSN-GVCRNTAD  166

Query  363  SADGGPSLLSP-QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  539
                   ++ P Q ERKPLR LSPWI DILLAAPL IRSDYFRW SGVMG+YAAG+L+PP
Sbjct  167  PTHAESKVVPPVQQERKPLRPLSPWIADILLAAPLSIRSDYFRWSSGVMGRYAAGDLRPP  226

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
              ASSRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  227  IIASSRGSGKHPQLMPSTPRWAVANGAGV  255



>ref|XP_010261026.1| PREDICTED: protein GIGANTEA-like isoform X3 [Nelumbo nucifera]
Length=1079

 Score =   322 bits (824),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 152/208 (73%), Positives = 174/208 (84%), Gaps = 2/208 (1%)
 Frame = +3

Query  6    EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFA  185
            EDI ELIR  YPS+  RLFD+VLA F+LHHPEHGHAV+ P+ISCIID TL Y+KNSPPF+
Sbjct  49   EDIGELIRCHYPSQNKRLFDEVLAMFVLHHPEHGHAVLLPLISCIIDDTLAYNKNSPPFS  108

Query  186  SFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKS  365
            SFISLVCP+++NE SEQWA+ACGEILR+LTHYNRP+YK E Q+S  DRS+SG HA++S +
Sbjct  109  SFISLVCPSNENEYSEQWAMACGEILRVLTHYNRPIYKAEHQNS-VDRSSSGIHATSSST  167

Query  366  ADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPS  542
             +G      PQ ++KPLR LSPWITDILLAAPLGIRSDYFRWC GVMGKYAA GELKPP+
Sbjct  168  KEGTCYSALPQQDKKPLRPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGELKPPT  227

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
                 GSGKHPQ IPSTPRWAVANGA V
Sbjct  228  IVCGGGSGKHPQFIPSTPRWAVANGAAV  255



>ref|XP_010498761.1| PREDICTED: protein GIGANTEA [Camelina sativa]
Length=1169

 Score =   322 bits (826),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 159/210 (76%), Positives = 180/210 (86%), Gaps = 4/210 (2%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAEL+R++YPS E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PF
Sbjct  50   PDDIAELVRHQYPSDEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+N+ SEQWALACGEILRILTHYNRP+YK E+Q+ E +R N  S A+TS 
Sbjct  110  ASFISLVCPSSENDYSEQWALACGEILRILTHYNRPIYKTEQQNGETER-NCLSKATTSG  168

Query  363  SADGGPS-LLSP-QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKP  536
            S     +  +SP  HERKPLR LSPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKP
Sbjct  169  SPPPAETKAVSPTHHERKPLRPLSPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKP  228

Query  537  PSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            P+ A SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  229  PTIA-SRGSGKHPQLMPSTPRWAVANGAGV  257



>ref|XP_010477545.1| PREDICTED: protein GIGANTEA-like isoform X3 [Camelina sativa]
Length=1169

 Score =   322 bits (825),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 154/209 (74%), Positives = 175/209 (84%), Gaps = 2/209 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAEL+R++YPS E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PF
Sbjct  50   PDDIAELVRHQYPSDEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+N+ SEQWALACGEILRILTHYNRP+YK E+Q+ E +RS      ++  
Sbjct  110  ASFISLVCPSSENDYSEQWALACGEILRILTHYNRPIYKTEQQNGETERSCLSKATTSGS  169

Query  363  SADGGPSLLSP-QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  539
                    +SP  HERKPLR LSPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP
Sbjct  170  PPPSETKAVSPTHHERKPLRPLSPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  229

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            + A SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  230  TIA-SRGSGKHPQLMPSTPRWAVANGAGV  257



>ref|XP_010477546.1| PREDICTED: protein GIGANTEA-like isoform X4 [Camelina sativa]
Length=1169

 Score =   322 bits (825),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 154/209 (74%), Positives = 175/209 (84%), Gaps = 2/209 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAEL+R++YPS E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PF
Sbjct  50   PDDIAELVRHQYPSDEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+N+ SEQWALACGEILRILTHYNRP+YK E+Q+ E +RS      ++  
Sbjct  110  ASFISLVCPSSENDYSEQWALACGEILRILTHYNRPIYKTEQQNGETERSCLSKATTSGS  169

Query  363  SADGGPSLLSP-QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  539
                    +SP  HERKPLR LSPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP
Sbjct  170  PPPSETKAVSPTHHERKPLRPLSPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  229

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            + A SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  230  TIA-SRGSGKHPQLMPSTPRWAVANGAGV  257



>ref|XP_010261024.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
Length=1174

 Score =   322 bits (825),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 152/208 (73%), Positives = 174/208 (84%), Gaps = 2/208 (1%)
 Frame = +3

Query  6    EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFA  185
            EDI ELIR  YPS+  RLFD+VLA F+LHHPEHGHAV+ P+ISCIID TL Y+KNSPPF+
Sbjct  49   EDIGELIRCHYPSQNKRLFDEVLAMFVLHHPEHGHAVLLPLISCIIDDTLAYNKNSPPFS  108

Query  186  SFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKS  365
            SFISLVCP+++NE SEQWA+ACGEILR+LTHYNRP+YK E Q+S  DRS+SG HA++S +
Sbjct  109  SFISLVCPSNENEYSEQWAMACGEILRVLTHYNRPIYKAEHQNS-VDRSSSGIHATSSST  167

Query  366  ADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPS  542
             +G      PQ ++KPLR LSPWITDILLAAPLGIRSDYFRWC GVMGKYAA GELKPP+
Sbjct  168  KEGTCYSALPQQDKKPLRPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGELKPPT  227

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
                 GSGKHPQ IPSTPRWAVANGA V
Sbjct  228  IVCGGGSGKHPQFIPSTPRWAVANGAAV  255



>emb|CDY04787.1| BnaC05g18020D [Brassica napus]
Length=1170

 Score =   321 bits (822),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 160/214 (75%), Positives = 178/214 (83%), Gaps = 16/214 (7%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAEL+RN+YPS E RL DDVLA F+LHHPEHGHAVI PIISC+IDGTL Y K + PF
Sbjct  50   PDDIAELVRNQYPSTEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGTLVYSKEAHPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLV P S+N+ SEQWALACGEILRILTHYNRP+YK E+Q+ E +     S ASTS 
Sbjct  110  ASFISLVSPTSENDYSEQWALACGEILRILTHYNRPIYKTEQQNGETE-----SKASTS-  163

Query  363  SADGGPSL-----LSP-QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAG  524
               G P+L     +SP QHERKPLR LSPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAG
Sbjct  164  ---GSPTLSETKAVSPGQHERKPLRPLSPWISDILLAAPLGIRSDYFRWCSGVMGKYAAG  220

Query  525  ELKPPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            ELKPP+ A +RGSGKHPQ +PSTPRWAVANGAGV
Sbjct  221  ELKPPTIA-TRGSGKHPQYMPSTPRWAVANGAGV  253



>pir||T00767 hypothetical protein T22J18.6 - Arabidopsis thaliana
 gb|AAC25507.1|AAC25507 T22J18.6 [Arabidopsis thaliana]
Length=1070

 Score =   319 bits (817),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 159/221 (72%), Positives = 180/221 (81%), Gaps = 15/221 (7%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVL------------ATFLLHHPEHGHAVIHPIISCIID  146
            P+DIAEL+R++YPS E RL DDVL            + F+LHHPEHGHAVI PIISC+ID
Sbjct  50   PDDIAELVRHQYPSTEKRLLDDVLGMINIYDPHFSFSMFVLHHPEHGHAVILPIISCLID  109

Query  147  GTLEYDKNSPPFASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEAD  326
            G+L Y K + PFASFISLVCP+S+N+ SEQWALACGEILRILTHYNRP+YK E+Q+ + +
Sbjct  110  GSLVYSKEAHPFASFISLVCPSSENDYSEQWALACGEILRILTHYNRPIYKTEQQNGDTE  169

Query  327  RSNSGSHASTSKSADGGPSLLSP-QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGV  503
            R N  S A+TS S    P   SP QHERKPLR LSPWI+DILLAAPLGIRSDYFRWCSGV
Sbjct  170  R-NCLSKATTSGSPTSEPKAGSPTQHERKPLRPLSPWISDILLAAPLGIRSDYFRWCSGV  228

Query  504  MGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            MGKYAAGELKPP+ A SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  229  MGKYAAGELKPPTIA-SRGSGKHPQLMPSTPRWAVANGAGV  268



>ref|NP_001288824.1| protein GIGANTEA [Brassica rapa]
 gb|AEB33730.1| GIGANTEA [Brassica rapa]
Length=1183

 Score =   320 bits (819),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 161/225 (72%), Positives = 179/225 (80%), Gaps = 26/225 (12%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAEL+RN+YPS E RL DDVLA F+LHHPEHGHAVI PIISC+IDGTL Y K + PF
Sbjct  50   PDDIAELVRNQYPSTEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGTLVYSKEAHPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLV PNS+N+ SEQWALACGEILRILTHYNRP+YK E+Q+ E +     S ASTS 
Sbjct  110  ASFISLVSPNSENDYSEQWALACGEILRILTHYNRPIYKTEQQNGETE-----SKASTS-  163

Query  363  SADGGPSL-----LSP-QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAG  524
               G P+L     +SP QHERKPLR LSPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAG
Sbjct  164  ---GSPTLSEAKAVSPGQHERKPLRPLSPWISDILLAAPLGIRSDYFRWCSGVMGKYAAG  220

Query  525  ELKPP-----------STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            ELKPP           +  S+RGSGKHPQ +PSTPRWAVANGAGV
Sbjct  221  ELKPPTIGECPSPLATTMGSTRGSGKHPQYMPSTPRWAVANGAGV  265



>ref|XP_010681263.1| PREDICTED: protein GIGANTEA [Beta vulgaris subsp. vulgaris]
 ref|XP_010681268.1| PREDICTED: protein GIGANTEA [Beta vulgaris subsp. vulgaris]
Length=1178

 Score =   319 bits (818),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 154/209 (74%), Positives = 173/209 (83%), Gaps = 1/209 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PED+AELIR+RYP  E RLFDDVLATF+LHHPEHGHAV+ PIIS IIDGTL YDK  PPF
Sbjct  48   PEDLAELIRSRYPFDEKRLFDDVLATFVLHHPEHGHAVVLPIISIIIDGTLVYDKERPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISL CPN +NE SEQWALACGEILRILTHYNRP+YK E+Q S  + ++   +A+ S 
Sbjct  108  ASFISLFCPNDENEYSEQWALACGEILRILTHYNRPIYKHERQKSPENCTSCKDYATCSN  167

Query  363  SADGG-PSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  539
            ++D       S Q ER+  R LSPWITDILLAAPLGI+SDYFRWC GVMG+YAAGELKPP
Sbjct  168  ASDAKSSHSSSVQSERRTSRPLSPWITDILLAAPLGIKSDYFRWCGGVMGRYAAGELKPP  227

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
              ASSRG+GKHPQL+PSTPRWAVANGAGV
Sbjct  228  MIASSRGNGKHPQLMPSTPRWAVANGAGV  256



>ref|XP_008672375.1| PREDICTED: uncharacterized protein LOC100272803 isoform X1 [Zea 
mays]
 ref|XP_008672376.1| PREDICTED: uncharacterized protein LOC100272803 isoform X1 [Zea 
mays]
 ref|XP_008672377.1| PREDICTED: uncharacterized protein LOC100272803 isoform X1 [Zea 
mays]
 tpg|DAA53146.1| TPA: gigantea1B [Zea mays]
Length=1160

 Score =   319 bits (817),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 153/210 (73%), Positives = 180/210 (86%), Gaps = 2/210 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PED+A+LI++ YPSKE+RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD++ PPF
Sbjct  50   PEDVAQLIQSSYPSKESRLIDEVLATFVLHHPEHGHAVVHPILSPIIDGTLCYDRHGPPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            +SFISL    S+ E SEQWALACGEILR+LTHYNRP++KVE+Q SEA+ S +   A++S 
Sbjct  110  SSFISLFSHTSEQEYSEQWALACGEILRVLTHYNRPIFKVERQHSEAECSTTSDQATSSD  169

Query  363  SADGGP-SLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKP  536
            S D    + L  + +RKPLR L+PWITDILLAAPLGIRSDYFRWCSGVMGKYAA GELKP
Sbjct  170  STDKKSNNSLGNESDRKPLRPLTPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGGELKP  229

Query  537  PSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            P+TA SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  230  PTTAYSRGSGKHPQLMPSTPRWAVANGAGV  259



>gb|AFW80279.1| gigantea1A isoform 1 [Zea mays]
 gb|AFW80280.1| gigantea1A isoform 2 [Zea mays]
Length=968

 Score =   316 bits (809),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 156/211 (74%), Positives = 180/211 (85%), Gaps = 4/211 (2%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIA+LI++ YPSKENRL D+VLATF+LHHPEHGHAV HPI+S IIDGTL YD++ PPF
Sbjct  50   PEDIAQLIQSSYPSKENRLVDEVLATFVLHHPEHGHAVAHPILSRIIDGTLCYDRHGPPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            +SFISL   NS+ E SEQWALACGEILR+LTHYNRP++KVE+Q +EA+ S++   A++S 
Sbjct  110  SSFISLFSHNSEQEYSEQWALACGEILRVLTHYNRPIFKVERQHTEAECSSTSDQATSSD  169

Query  363  SADGGPSLLSPQHER--KPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELK  533
            S D   S  SP +E   KPLR L+PWITDILLAAPLGIRSDYFRWC GVMGKYAA GELK
Sbjct  170  STDKR-SNNSPGNESDWKPLRPLTPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGELK  228

Query  534  PPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            PP+TA SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  229  PPTTACSRGSGKHPQLMPSTPRWAVANGAGV  259



>ref|XP_010477544.1| PREDICTED: protein GIGANTEA-like isoform X2 [Camelina sativa]
Length=1170

 Score =   319 bits (817),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/210 (74%), Positives = 175/210 (83%), Gaps = 3/210 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAEL+R++YPS E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PF
Sbjct  50   PDDIAELVRHQYPSDEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPF  109

Query  183  ASFISLVCPNS-QNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTS  359
            ASFISLVCP+S QN+ SEQWALACGEILRILTHYNRP+YK E+Q+ E +RS      ++ 
Sbjct  110  ASFISLVCPSSEQNDYSEQWALACGEILRILTHYNRPIYKTEQQNGETERSCLSKATTSG  169

Query  360  KSADGGPSLLSP-QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKP  536
                     +SP  HERKPLR LSPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKP
Sbjct  170  SPPPSETKAVSPTHHERKPLRPLSPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKP  229

Query  537  PSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            P+ A SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  230  PTIA-SRGSGKHPQLMPSTPRWAVANGAGV  258



>ref|XP_010477543.1| PREDICTED: protein GIGANTEA-like isoform X1 [Camelina sativa]
Length=1170

 Score =   319 bits (817),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/210 (74%), Positives = 175/210 (83%), Gaps = 3/210 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAEL+R++YPS E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PF
Sbjct  50   PDDIAELVRHQYPSDEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPF  109

Query  183  ASFISLVCPNS-QNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTS  359
            ASFISLVCP+S QN+ SEQWALACGEILRILTHYNRP+YK E+Q+ E +RS      ++ 
Sbjct  110  ASFISLVCPSSEQNDYSEQWALACGEILRILTHYNRPIYKTEQQNGETERSCLSKATTSG  169

Query  360  KSADGGPSLLSP-QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKP  536
                     +SP  HERKPLR LSPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKP
Sbjct  170  SPPPSETKAVSPTHHERKPLRPLSPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKP  229

Query  537  PSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            P+ A SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  230  PTIA-SRGSGKHPQLMPSTPRWAVANGAGV  258



>ref|XP_009408935.1| PREDICTED: protein GIGANTEA-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=1163

 Score =   318 bits (815),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 153/212 (72%), Positives = 179/212 (84%), Gaps = 6/212 (3%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIA+LI++ YPSKE RL D+VLA F+LHHPEHGHA++HPI+S IIDGTL Y++N+PPF
Sbjct  48   PEDIAQLIQSHYPSKEKRLLDEVLALFILHHPEHGHAIVHPILSLIIDGTLVYNRNNPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            +SFISLV  NS+ + SEQWALACGEILRILTHYNRP++K E  ++  +RSNS +HA+TSK
Sbjct  108  SSFISLVSQNSEKQCSEQWALACGEILRILTHYNRPIFKAECHNTGTERSNSCNHATTSK  167

Query  363  SAD---GGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GEL  530
            S       P L   +H+RKPLR LSPWITDILLA+PLGIRSDYFRWC GVMGKYAA GEL
Sbjct  168  SEKQEANNPIL--QEHDRKPLRPLSPWITDILLASPLGIRSDYFRWCGGVMGKYAAGGEL  225

Query  531  KPPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            KPP+TA S GSGKHP L+PSTPRWAVANGAGV
Sbjct  226  KPPTTACSHGSGKHPLLMPSTPRWAVANGAGV  257



>ref|XP_009408933.1| PREDICTED: protein GIGANTEA-like isoform X1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009408934.1| PREDICTED: protein GIGANTEA-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=1205

 Score =   318 bits (815),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/212 (72%), Positives = 179/212 (84%), Gaps = 6/212 (3%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIA+LI++ YPSKE RL D+VLA F+LHHPEHGHA++HPI+S IIDGTL Y++N+PPF
Sbjct  48   PEDIAQLIQSHYPSKEKRLLDEVLALFILHHPEHGHAIVHPILSLIIDGTLVYNRNNPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            +SFISLV  NS+ + SEQWALACGEILRILTHYNRP++K E  ++  +RSNS +HA+TSK
Sbjct  108  SSFISLVSQNSEKQCSEQWALACGEILRILTHYNRPIFKAECHNTGTERSNSCNHATTSK  167

Query  363  SAD---GGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GEL  530
            S       P L   +H+RKPLR LSPWITDILLA+PLGIRSDYFRWC GVMGKYAA GEL
Sbjct  168  SEKQEANNPIL--QEHDRKPLRPLSPWITDILLASPLGIRSDYFRWCGGVMGKYAAGGEL  225

Query  531  KPPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            KPP+TA S GSGKHP L+PSTPRWAVANGAGV
Sbjct  226  KPPTTACSHGSGKHPLLMPSTPRWAVANGAGV  257



>ref|NP_001140728.1| uncharacterized protein LOC100272803 [Zea mays]
 tpg|DAA06171.1| TPA_inf: gigantea 1B [Zea mays]
Length=1160

 Score =   317 bits (812),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 152/210 (72%), Positives = 179/210 (85%), Gaps = 2/210 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PED+A+LI++ YPSKE+RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD++ PPF
Sbjct  50   PEDVAQLIQSSYPSKESRLIDEVLATFVLHHPEHGHAVVHPILSPIIDGTLCYDRHGPPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            +SFISL    S+ E SEQWALACGEILR+LTHYNRP++KVE+Q SEA+ S +   A++S 
Sbjct  110  SSFISLFSHTSEQEYSEQWALACGEILRVLTHYNRPIFKVERQHSEAECSTTSDQATSSD  169

Query  363  SADGGP-SLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKP  536
            S D    + L  + +RKPLR L+PWITDILLAAPLGIRSDYFRWC GVMGKYAA GELKP
Sbjct  170  STDKKSNNSLGNESDRKPLRPLTPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGELKP  229

Query  537  PSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            P+TA SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  230  PTTAYSRGSGKHPQLMPSTPRWAVANGAGV  259



>gb|ADP92454.1| GIGANTEA 1 [x Doritaenopsis hybrid cultivar]
Length=1160

 Score =   317 bits (812),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 154/209 (74%), Positives = 178/209 (85%), Gaps = 4/209 (2%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIA+LI+  YP KE R+ DDVLA F+LHHPEHGHA++HPI+SCIIDGTL + KN+PPF
Sbjct  48   PEDIAQLIQRHYPVKEKRVLDDVLAIFVLHHPEHGHAIVHPILSCIIDGTLVHGKNNPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            +SFISL+   ++ E SEQWALACGEILR+LT YNRP+YK E  + EA+RS+SGSHA+TS+
Sbjct  108  SSFISLIGQTTEKEYSEQWALACGEILRVLTLYNRPIYKSEHHNIEAERSSSGSHATTSE  167

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKY-AAGELKPP  539
            S  GG S  SP  ERKPLR L+PWITDILLAAP+GIRSDYFRWC GVMGKY AAGELKPP
Sbjct  168  SI-GGESSNSP--ERKPLRPLTPWITDILLAAPVGIRSDYFRWCGGVMGKYAAAGELKPP  224

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            +TA SR SGKHPQL+PSTP WAVANGAGV
Sbjct  225  TTARSRRSGKHPQLMPSTPGWAVANGAGV  253



>dbj|BAD97864.1| GI homologue 1 [Lemna paucicostata]
Length=1115

 Score =   316 bits (809),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 153/209 (73%), Positives = 174/209 (83%), Gaps = 5/209 (2%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PED+A+LI+N YPSKE RL DDVLATF+LHHPEH HA++HPI+SCIIDG+L YDKN PPF
Sbjct  48   PEDVAQLIQNNYPSKEIRLLDDVLATFVLHHPEHSHAIVHPILSCIIDGSLLYDKNEPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            +SFISLV  N++ E SEQWA+ACGEILR+LTHYNRP+YKV+ Q S  + S S + A +S 
Sbjct  108  SSFISLVGQNNEKEYSEQWAMACGEILRVLTHYNRPIYKVDNQGS-GEESRSENSACSSG  166

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPP  539
                 P     ++ERKPLR LS WITDILLAAPLGIRSDYFRWC GVMGKYAA GELKPP
Sbjct  167  ETSRSP---KQENERKPLRPLSAWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGELKPP  223

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
             TASSRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  224  ITASSRGSGKHPQLMPSTPRWAVANGAGV  252



>gb|AFW80281.1| gigantea1A [Zea mays]
Length=1086

 Score =   315 bits (808),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 156/211 (74%), Positives = 180/211 (85%), Gaps = 4/211 (2%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIA+LI++ YPSKENRL D+VLATF+LHHPEHGHAV HPI+S IIDGTL YD++ PPF
Sbjct  50   PEDIAQLIQSSYPSKENRLVDEVLATFVLHHPEHGHAVAHPILSRIIDGTLCYDRHGPPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            +SFISL   NS+ E SEQWALACGEILR+LTHYNRP++KVE+Q +EA+ S++   A++S 
Sbjct  110  SSFISLFSHNSEQEYSEQWALACGEILRVLTHYNRPIFKVERQHTEAECSSTSDQATSSD  169

Query  363  SADGGPSLLSPQHER--KPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELK  533
            S D   S  SP +E   KPLR L+PWITDILLAAPLGIRSDYFRWC GVMGKYAA GELK
Sbjct  170  STDKR-SNNSPGNESDWKPLRPLTPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGELK  228

Query  534  PPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            PP+TA SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  229  PPTTACSRGSGKHPQLMPSTPRWAVANGAGV  259



>gb|AFW80282.1| gigantea1A [Zea mays]
Length=1085

 Score =   315 bits (808),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 156/211 (74%), Positives = 180/211 (85%), Gaps = 4/211 (2%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIA+LI++ YPSKENRL D+VLATF+LHHPEHGHAV HPI+S IIDGTL YD++ PPF
Sbjct  50   PEDIAQLIQSSYPSKENRLVDEVLATFVLHHPEHGHAVAHPILSRIIDGTLCYDRHGPPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            +SFISL   NS+ E SEQWALACGEILR+LTHYNRP++KVE+Q +EA+ S++   A++S 
Sbjct  110  SSFISLFSHNSEQEYSEQWALACGEILRVLTHYNRPIFKVERQHTEAECSSTSDQATSSD  169

Query  363  SADGGPSLLSPQHER--KPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELK  533
            S D   S  SP +E   KPLR L+PWITDILLAAPLGIRSDYFRWC GVMGKYAA GELK
Sbjct  170  STDKR-SNNSPGNESDWKPLRPLTPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGELK  228

Query  534  PPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            PP+TA SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  229  PPTTACSRGSGKHPQLMPSTPRWAVANGAGV  259



>ref|XP_008461912.1| PREDICTED: protein GIGANTEA-like isoform X1 [Cucumis melo]
Length=1168

 Score =   316 bits (810),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 158/207 (76%), Positives = 181/207 (87%), Gaps = 0/207 (0%)
 Frame = +3

Query  6    EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFA  185
            EDIAELIR R+ SKE RLFDDVLA F+LHHPE+GHA+I PIISCII+G LEY++N PPFA
Sbjct  49   EDIAELIRIRFQSKEKRLFDDVLALFVLHHPENGHAIILPIISCIINGALEYNRNDPPFA  108

Query  186  SFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKS  365
            SFISL CP  +N+ SEQWALACGEILRILTHYNRP+YK+E+++ E +RS+S S A+TS +
Sbjct  109  SFISLFCPGIENDYSEQWALACGEILRILTHYNRPIYKMEQKNGETERSSSCSLATTSDT  168

Query  366  ADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPST  545
             D     +  Q ERKP+R LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGEL+PP++
Sbjct  169  DDRELVGVPQQQERKPVRPLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELRPPTS  228

Query  546  ASSRGSGKHPQLIPSTPRWAVANGAGV  626
            ASSRGSGKHPQLIPSTPRWAVANGAGV
Sbjct  229  ASSRGSGKHPQLIPSTPRWAVANGAGV  255



>ref|NP_001288586.1| gigantea like1a [Zea mays]
 ref|XP_008655715.1| PREDICTED: protein GIGANTEA [Zea mays]
 ref|XP_008655716.1| PREDICTED: protein GIGANTEA [Zea mays]
 tpg|DAA06172.1| TPA_inf: gigantea 1A [Zea mays]
 gb|AFW80283.1| gigantea isoform 1 [Zea mays]
 gb|AFW80284.1| gigantea isoform 2 [Zea mays]
Length=1162

 Score =   316 bits (809),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 156/211 (74%), Positives = 180/211 (85%), Gaps = 4/211 (2%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIA+LI++ YPSKENRL D+VLATF+LHHPEHGHAV HPI+S IIDGTL YD++ PPF
Sbjct  50   PEDIAQLIQSSYPSKENRLVDEVLATFVLHHPEHGHAVAHPILSRIIDGTLCYDRHGPPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            +SFISL   NS+ E SEQWALACGEILR+LTHYNRP++KVE+Q +EA+ S++   A++S 
Sbjct  110  SSFISLFSHNSEQEYSEQWALACGEILRVLTHYNRPIFKVERQHTEAECSSTSDQATSSD  169

Query  363  SADGGPSLLSPQHER--KPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELK  533
            S D   S  SP +E   KPLR L+PWITDILLAAPLGIRSDYFRWC GVMGKYAA GELK
Sbjct  170  STDKR-SNNSPGNESDWKPLRPLTPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGELK  228

Query  534  PPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            PP+TA SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  229  PPTTACSRGSGKHPQLMPSTPRWAVANGAGV  259



>gb|ACJ65314.1| GI3 protein [Glycine max]
Length=1155

 Score =   315 bits (806),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 154/210 (73%), Positives = 172/210 (82%), Gaps = 16/210 (8%)
 Frame = +3

Query  6    EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFA  185
            EDIAELIRN YPSKE  LFDD           HGHAV+ PIISCIIDGTL+YDK SPPFA
Sbjct  50   EDIAELIRNHYPSKEMLLFDD-----------HGHAVVLPIISCIIDGTLDYDKTSPPFA  98

Query  186  SFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKS  365
            SFISLVCP ++NE SEQWA+ACGEILRILTHYNRP+YK+E+Q  E + S+  SHA+T+ S
Sbjct  99   SFISLVCPKNENEYSEQWAMACGEILRILTHYNRPIYKMERQYCEPEVSSGKSHATTNDS  158

Query  366  ADGGP---SLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKP  536
             DG     SL+  Q E+KP+R LSPWITDIL AAPLGIRSDYFRWCSGVMGKYAAGELKP
Sbjct  159  VDGESGHNSLM--QQEKKPIRPLSPWITDILRAAPLGIRSDYFRWCSGVMGKYAAGELKP  216

Query  537  PSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            P+  S+RGSGKHPQL+PSTPRWAVANGAGV
Sbjct  217  PTIVSARGSGKHPQLVPSTPRWAVANGAGV  246



>emb|CAA72908.1| hypothetical protein [Arabidopsis thaliana]
Length=1167

 Score =   315 bits (806),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 153/209 (73%), Positives = 174/209 (83%), Gaps = 9/209 (4%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAEL+R++YPS E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PF
Sbjct  50   PDDIAELVRHQYPSTEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+N+ SEQWALACGEILRILTHYNRP+YK E+Q+ + +R N  S A+TS 
Sbjct  110  ASFISLVCPSSENDYSEQWALACGEILRILTHYNRPIYKTEQQNGDTER-NCLSKATTSG  168

Query  363  SADGGPSLLSP-QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  539
            S    P   SP QHERKPLR LSPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP
Sbjct  169  SPTSEPKAGSPTQHERKPLRPLSPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  228

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            +        +HPQL+PSTPRWAVANGAGV
Sbjct  229  TI-------EHPQLMPSTPRWAVANGAGV  250



>ref|XP_004968438.1| PREDICTED: protein GIGANTEA-like [Setaria italica]
Length=1160

 Score =   312 bits (799),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 154/211 (73%), Positives = 178/211 (84%), Gaps = 4/211 (2%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PED+A+LI++ YPSKE RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD++  PF
Sbjct  50   PEDVAQLIQSCYPSKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTLCYDRHGAPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            +SFISL    S+ E SEQWALACGEILR+LTHYNRP++KVE+Q SEA+ S++   A++S 
Sbjct  110  SSFISLFSHTSEKEYSEQWALACGEILRVLTHYNRPIFKVERQHSEAECSSTSDQATSSD  169

Query  363  SADGGPSLLSPQHE--RKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELK  533
            S D   S  SP  E  RKPLR L+PWITDILLAAPLGIRSDYFRWC GVMGKYAA GELK
Sbjct  170  STD-KKSDDSPGTEPDRKPLRPLTPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGELK  228

Query  534  PPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            PP+TA SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  229  PPTTACSRGSGKHPQLMPSTPRWAVANGAGV  259



>gb|ABZ81992.1| gigantea [Zea mays]
Length=1162

 Score =   312 bits (799),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 155/211 (73%), Positives = 179/211 (85%), Gaps = 4/211 (2%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIA+LI++ YPSKENRL  +VLATF+LHHPEHGHAV HPI+S IIDGTL YD++ PPF
Sbjct  50   PEDIAQLIQSSYPSKENRLVGEVLATFVLHHPEHGHAVAHPILSRIIDGTLCYDRHGPPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            +SFISL   NS+ E SEQWALACGEILR+LTHYNRP++KVE+Q +EA+ S++   A++S 
Sbjct  110  SSFISLFSHNSEQEYSEQWALACGEILRVLTHYNRPIFKVERQHTEAECSSTSDQATSSD  169

Query  363  SADGGPSLLSPQHE--RKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELK  533
            S D   S  SP +E  RKPLR L+PWITDILLAAPLGIRSDYFRWC GVMGKYAA GELK
Sbjct  170  STDKR-SNNSPGNESDRKPLRPLTPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGELK  228

Query  534  PPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            PP+TA SRGSGKHPQ +PSTPRWAVANGAGV
Sbjct  229  PPTTACSRGSGKHPQPMPSTPRWAVANGAGV  259



>ref|NP_001042220.1| Os01g0182600 [Oryza sativa Japonica Group]
 sp|Q9AWL7.2|GIGAN_ORYSJ RecName: Full=Protein GIGANTEA [Oryza sativa Japonica Group]
 dbj|BAD68052.1| putative gigantea [Oryza sativa Japonica Group]
 dbj|BAF04134.1| Os01g0182600 [Oryza sativa Japonica Group]
Length=1160

 Score =   312 bits (799),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 154/213 (72%), Positives = 177/213 (83%), Gaps = 8/213 (4%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIA+LI++ YPSKE RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD+N  PF
Sbjct  50   PEDIAQLIQSCYPSKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTLSYDRNGFPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
             SFISL    S+ E SEQWALACGEILR+LTHYNRP++KV+ Q SEA+ S++   AS+ +
Sbjct  110  MSFISLFSHTSEKEYSEQWALACGEILRVLTHYNRPIFKVDHQHSEAECSSTSDQASSCE  169

Query  363  S----ADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GE  527
            S    A+G P     + +RKPLR LSPWITDILLAAPLGIRSDYFRWC GVMGKYAA GE
Sbjct  170  SMEKRANGSP---RNEPDRKPLRPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGE  226

Query  528  LKPPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            LKPP+TA SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  227  LKPPTTAYSRGSGKHPQLMPSTPRWAVANGAGV  259



>gb|EEE54000.1| hypothetical protein OsJ_00641 [Oryza sativa Japonica Group]
Length=1176

 Score =   311 bits (798),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 154/213 (72%), Positives = 177/213 (83%), Gaps = 8/213 (4%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIA+LI++ YPSKE RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD+N  PF
Sbjct  50   PEDIAQLIQSCYPSKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTLSYDRNGFPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
             SFISL    S+ E SEQWALACGEILR+LTHYNRP++KV+ Q SEA+ S++   AS+ +
Sbjct  110  MSFISLFSHTSEKEYSEQWALACGEILRVLTHYNRPIFKVDHQHSEAECSSTSDQASSCE  169

Query  363  S----ADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GE  527
            S    A+G P     + +RKPLR LSPWITDILLAAPLGIRSDYFRWC GVMGKYAA GE
Sbjct  170  SMEKRANGSP---RNEPDRKPLRPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGE  226

Query  528  LKPPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            LKPP+TA SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  227  LKPPTTAYSRGSGKHPQLMPSTPRWAVANGAGV  259



>gb|EEC70061.1| hypothetical protein OsI_00663 [Oryza sativa Indica Group]
Length=1176

 Score =   311 bits (798),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 154/213 (72%), Positives = 177/213 (83%), Gaps = 8/213 (4%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIA+LI++ YPSKE RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD+N  PF
Sbjct  50   PEDIAQLIQSCYPSKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTLSYDRNGFPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
             SFISL    S+ E SEQWALACGEILR+LTHYNRP++KV+ Q SEA+ S++   AS+ +
Sbjct  110  MSFISLFSHTSEKEYSEQWALACGEILRVLTHYNRPIFKVDHQHSEAECSSTSDQASSCE  169

Query  363  S----ADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GE  527
            S    A+G P     + +RKPLR LSPWITDILLAAPLGIRSDYFRWC GVMGKYAA GE
Sbjct  170  SMEKRANGSP---RNEPDRKPLRPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGE  226

Query  528  LKPPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            LKPP+TA SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  227  LKPPTTAYSRGSGKHPQLMPSTPRWAVANGAGV  259



>ref|XP_002524341.1| Protein GIGANTEA, putative [Ricinus communis]
 gb|EEF38081.1| Protein GIGANTEA, putative [Ricinus communis]
Length=1161

 Score =   309 bits (792),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 150/209 (72%), Positives = 169/209 (81%), Gaps = 8/209 (4%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAE+  + +       F    ATF+LHHPEHGHAV+ PIISC+IDGTL YD+++PPF
Sbjct  47   PDDIAEVTASHF-------FSSNPATFVLHHPEHGHAVVLPIISCLIDGTLVYDRSTPPF  99

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+NE SEQWALACGEILR+LTHYNRP+YK E+Q SE ++S  G  A    
Sbjct  100  ASFISLVCPSSENEYSEQWALACGEILRVLTHYNRPIYKKEQQKSETEKSGGGEDAVNGG  159

Query  363  SADGGPSLLSP-QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP  539
             ADG  S   P Q ERKPLR LSPWITDILL APLGIRSDYFRWCSGVMGKYA GELKPP
Sbjct  160  LADGESSHTPPAQQERKPLRPLSPWITDILLTAPLGIRSDYFRWCSGVMGKYAGGELKPP  219

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            +TASS GSGKHPQL+PSTPRWAVANGAGV
Sbjct  220  TTASSHGSGKHPQLMPSTPRWAVANGAGV  248



>ref|XP_006643836.1| PREDICTED: protein GIGANTEA-like isoform X1 [Oryza brachyantha]
 ref|XP_006643837.1| PREDICTED: protein GIGANTEA-like isoform X2 [Oryza brachyantha]
Length=1162

 Score =   309 bits (791),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 152/213 (71%), Positives = 175/213 (82%), Gaps = 8/213 (4%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIA+LI++ YPSKE RL D+VLATF+LHHPEHGHAV+HPI+S IIDGT+ YD+N  PF
Sbjct  50   PEDIAQLIQSCYPSKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTMSYDRNGFPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
             SFISL    S+ E SEQWALACGEILR+LTHYNRP++K E Q  EA+ S++   AS+ +
Sbjct  110  KSFISLFSHTSEKEYSEQWALACGEILRVLTHYNRPIFKAEHQHCEAECSSTSDQASSCE  169

Query  363  S----ADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GE  527
            S    A+G P     + +RKPLR LSPWITDILLAAPLGIRSDYFRWC GVMGKYAA GE
Sbjct  170  SIEKRANGSP---RNEPDRKPLRPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGE  226

Query  528  LKPPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            LKPP+TA SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  227  LKPPTTAYSRGSGKHPQLMPSTPRWAVANGAGV  259



>gb|ACT22765.1| GIGANTEA [Allium cepa]
Length=1109

 Score =   308 bits (789),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 147/210 (70%), Positives = 175/210 (83%), Gaps = 3/210 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PED+A+LI+N YPSKE RL D+VLATF+LHHPEHGHA++HPI+SCIIDGTL YDK+ PPF
Sbjct  48   PEDVAQLIQNHYPSKEQRLLDEVLATFVLHHPEHGHAIVHPILSCIIDGTLVYDKHDPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            +SFISL   NS+ E SEQWALACGEILR+LTHYNRP++K E Q+ + +R +S   A+TS 
Sbjct  108  SSFISLFNQNSEKEYSEQWALACGEILRVLTHYNRPIFKAEHQN-KIERLSSCDQATTSD  166

Query  363  SADGGPSLLS-PQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKP  536
              +      S P+++RKP+R LSPWI DIL+ +PLGIRSDYFRWC GVMGKYAA GELKP
Sbjct  167  PKEEKVHHSSMPENDRKPVRALSPWIADILITSPLGIRSDYFRWCGGVMGKYAAGGELKP  226

Query  537  PSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            P T+SSRGSGKHPQL+ STPRWAVANGAGV
Sbjct  227  PITSSSRGSGKHPQLMQSTPRWAVANGAGV  256



>gb|ACT22764.1| GIGANTEA [Allium cepa]
Length=1109

 Score =   308 bits (789),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 147/210 (70%), Positives = 175/210 (83%), Gaps = 3/210 (1%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PED+A+LI+N YPSKE RL D+VLATF+LHHPEHGHA++HPI+SCIIDGTL YDK+ PPF
Sbjct  48   PEDVAQLIQNHYPSKEQRLLDEVLATFVLHHPEHGHAIVHPILSCIIDGTLVYDKHDPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            +SFISL   NS+ E SEQWALACGEILR+LTHYNRP++K E Q+ + +R +S   A+TS 
Sbjct  108  SSFISLFNQNSEKEYSEQWALACGEILRVLTHYNRPIFKAEHQN-KIERLSSCDQATTSD  166

Query  363  SADGGPSLLS-PQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKP  536
              +      S P+++RKP+R LSPWI DIL+ +PLGIRSDYFRWC GVMGKYAA GELKP
Sbjct  167  PKEEKVHHSSMPENDRKPVRALSPWIADILITSPLGIRSDYFRWCGGVMGKYAAGGELKP  226

Query  537  PSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            P T+SSRGSGKHPQL+ STPRWAVANGAGV
Sbjct  227  PITSSSRGSGKHPQLMQSTPRWAVANGAGV  256



>gb|ABR18021.1| unknown [Picea sitchensis]
Length=1179

 Score =   308 bits (789),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 148/212 (70%), Positives = 173/212 (82%), Gaps = 4/212 (2%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAEL+ + YP+ E  L DDVLA F+LHHPEHGHA+IHP++SCIIDGTL YDK  PPF
Sbjct  48   PDDIAELVHSHYPNGEASLLDDVLAIFVLHHPEHGHAIIHPLLSCIIDGTLIYDKKMPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEK-QDSEADRSNSGSHASTS  359
            +SF SL  P+S+N+ SEQWALACGEILR+LTHYNRPVY+V++    E +R  SG+ ASTS
Sbjct  108  SSFNSLFSPSSENDYSEQWALACGEILRVLTHYNRPVYQVDRTHKQETERCVSGNSASTS  167

Query  360  KSADGGPS--LLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GEL  530
             S + G S   +    ++KPLRLL+PWITDILLAAPLGIRSDYFRWC GV GKYAA GEL
Sbjct  168  NSRENGISGHSIRQDQDKKPLRLLTPWITDILLAAPLGIRSDYFRWCGGVKGKYAAGGEL  227

Query  531  KPPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            KPP+TA  RG GKHPQL+PSTPRWAVANGAGV
Sbjct  228  KPPTTAGGRGPGKHPQLMPSTPRWAVANGAGV  259



>ref|XP_009380419.1| PREDICTED: protein GIGANTEA-like isoform X1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009380420.1| PREDICTED: protein GIGANTEA-like isoform X2 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009380421.1| PREDICTED: protein GIGANTEA-like isoform X3 [Musa acuminata subsp. 
malaccensis]
Length=1162

 Score =   306 bits (785),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 150/208 (72%), Positives = 172/208 (83%), Gaps = 2/208 (1%)
 Frame = +3

Query  6    EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFA  185
            EDIA+LI++ YPSK+ RL D+VLA F+LHHPEHGHA+IHPI+S IIDGTL YD+N  PF 
Sbjct  49   EDIAQLIQSHYPSKDKRLLDEVLAVFVLHHPEHGHAIIHPILSLIIDGTLAYDRNDSPFC  108

Query  186  SFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKS  365
            SFISL   NS+ E SEQWALACGEILR+LTHYNRP++KVE  + E +RSNS + A+TSKS
Sbjct  109  SFISLFKQNSEKEYSEQWALACGEILRVLTHYNRPIHKVEHHNVEYERSNSDNRATTSKS  168

Query  366  ADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPS  542
                 +    Q +RKPLR LSPWITDILLAAPLGIRSDYFRWC GVMGKYAA G+LKPP+
Sbjct  169  KQEEANHPLQQEDRKPLRPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGDLKPPT  228

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
            TA SRGSGKH QL+ STPRWAVANGAGV
Sbjct  229  TACSRGSGKH-QLMQSTPRWAVANGAGV  255



>gb|AGH20049.1| GI [Picea abies]
Length=1179

 Score =   305 bits (780),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 147/212 (69%), Positives = 172/212 (81%), Gaps = 4/212 (2%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAEL+ + YP+ E  L DDVLA F+LH+PEHGHA+IHP++SCIIDGTL YDK   PF
Sbjct  48   PDDIAELVHSHYPNGEASLLDDVLAIFVLHYPEHGHAIIHPLLSCIIDGTLIYDKKMSPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQ-DSEADRSNSGSHASTS  359
            +SF SL  P+S+N+ SEQWALACGEILR+LTHYNRPVYKV++    E +R  SG+ ASTS
Sbjct  108  SSFNSLFSPSSENDYSEQWALACGEILRVLTHYNRPVYKVDRTYKQETERCVSGNSASTS  167

Query  360  KSADGGPS--LLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GEL  530
             S + G S   +    ++KPLRLL+PWITDILLAAPLGIRSDYFRWC GV GKYAA GEL
Sbjct  168  NSRENGISGHSIRQDQDKKPLRLLTPWITDILLAAPLGIRSDYFRWCGGVKGKYAAGGEL  227

Query  531  KPPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            KPP+TA  RG GKHPQL+PSTPRWAVANGAGV
Sbjct  228  KPPTTAGGRGPGKHPQLMPSTPRWAVANGAGV  259



>dbj|BAD97869.1| GI homologue [Lemna gibba]
Length=1116

 Score =   302 bits (774),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 172/209 (82%), Gaps = 11/209 (5%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PED+A+LI+N YPSKE+RL D+VLATF+LHHPEHGHA++HP +SCII+G+L Y KN PPF
Sbjct  48   PEDVAQLIQNHYPSKESRLLDEVLATFVLHHPEHGHAIVHPTLSCIIEGSLVYSKNVPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
             SFISLV  N++ E SEQWALACGEILR+LTHYNRP+YKV+ Q SE +  + G  + + K
Sbjct  108  NSFISLVSQNNEKEYSEQWALACGEILRVLTHYNRPIYKVDHQGSEEESRSEGESSRSPK  167

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPP  539
                       ++ERKPLR LS WITDILLAAPLGIRSDYFRWC GVMGKYAA GELKPP
Sbjct  168  Q----------ENERKPLRPLSAWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGELKPP  217

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
             TASSRG+GKHPQL+PSTPRWAVANGAGV
Sbjct  218  ITASSRGAGKHPQLMPSTPRWAVANGAGV  246



>ref|XP_003564357.1| PREDICTED: protein GIGANTEA [Brachypodium distachyon]
 ref|XP_010230544.1| PREDICTED: protein GIGANTEA [Brachypodium distachyon]
 ref|XP_010230545.1| PREDICTED: protein GIGANTEA [Brachypodium distachyon]
 ref|XP_010230546.1| PREDICTED: protein GIGANTEA [Brachypodium distachyon]
 ref|XP_010230547.1| PREDICTED: protein GIGANTEA [Brachypodium distachyon]
Length=1155

 Score =   300 bits (769),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 144/209 (69%), Positives = 173/209 (83%), Gaps = 6/209 (3%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PED+A+LI++ YP+KE RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD++  PF
Sbjct  50   PEDVAQLIQSCYPAKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTLSYDRHGFPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
             SFISL    S+ E SEQWALACGEILR+LTHYNRP++KV +++S +D++ +    S  +
Sbjct  110  NSFISLFTQTSEKEYSEQWALACGEILRVLTHYNRPIFKVAERNSTSDQATASY--SVQE  167

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPP  539
             A+G P     + +RKPLR LSPWITDILL APLGIRSDYFRWC GVMGKYAA GELKPP
Sbjct  168  KANGSP---GNEPDRKPLRPLSPWITDILLTAPLGIRSDYFRWCGGVMGKYAAGGELKPP  224

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            +TA SRG+GKHPQL+PSTPRWAVANGAGV
Sbjct  225  TTAYSRGAGKHPQLMPSTPRWAVANGAGV  253



>gb|AAW66945.1| gigantea-like protein [Hordeum vulgare]
 gb|AAW66946.1| gigantea-like protein [Hordeum vulgare subsp. vulgare]
Length=1155

 Score =   299 bits (766),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 150/211 (71%), Positives = 171/211 (81%), Gaps = 10/211 (5%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PED+A+LI+  YPSKE RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD +  PF
Sbjct  50   PEDVAQLIQTCYPSKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTLSYDSHGSPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
             SFISL   +S+ E SEQWALACGEILR+LTHYNRP++KV      AD +N+   A+TS 
Sbjct  110  NSFISLFTQSSEKEYSEQWALACGEILRVLTHYNRPIFKV------ADCNNTSDQATTSC  163

Query  363  SADGGPSLLSPQH--ERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELK  533
            SA    +  SP +  ERKPLR LSPWITDILL APLGIRSDYFRWC GVMGKYAA GELK
Sbjct  164  SAQEKAN-YSPGNEPERKPLRPLSPWITDILLTAPLGIRSDYFRWCGGVMGKYAAGGELK  222

Query  534  PPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            PP+TA SRG+GKHPQL+PSTPRWAVANGAGV
Sbjct  223  PPTTAYSRGAGKHPQLMPSTPRWAVANGAGV  253



>emb|CDM81775.1| unnamed protein product [Triticum aestivum]
Length=1155

 Score =   298 bits (763),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 149/211 (71%), Positives = 171/211 (81%), Gaps = 10/211 (5%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PED+A+LI++ YPSKE RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD +  PF
Sbjct  50   PEDVAQLIQSCYPSKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTLSYDSHGSPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
             SFISL   +S+ E SEQWALACGEILR+LTHYNRP++KV      AD +N+   A+ S 
Sbjct  110  NSFISLFTQSSEKEYSEQWALACGEILRVLTHYNRPIFKV------ADCNNTSDQATASC  163

Query  363  SADGGPSLLSPQH--ERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELK  533
            SA    +  SP +  ERKPLR LSPWITDILL APLGIRSDYFRWC GVMGKYAA GELK
Sbjct  164  SAQEKAN-FSPGNEPERKPLRPLSPWITDILLTAPLGIRSDYFRWCGGVMGKYAAGGELK  222

Query  534  PPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            PP+TA SRG+GKHPQL+PSTPRWAVANGAGV
Sbjct  223  PPTTAYSRGAGKHPQLMPSTPRWAVANGAGV  253



>gb|AAT79486.1| gigantea 2 [Triticum aestivum]
Length=1153

 Score =   297 bits (761),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 149/211 (71%), Positives = 171/211 (81%), Gaps = 10/211 (5%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PED+A+LI++ YPSKE RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD +  PF
Sbjct  50   PEDVAQLIQSCYPSKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTLSYDSHGSPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
             SFISL   +S+ E SEQWALACGEILR+LTHYNRP++KV      AD +N+   A+ S 
Sbjct  110  NSFISLFTQSSEKEYSEQWALACGEILRVLTHYNRPIFKV------ADCNNTSDQATASC  163

Query  363  SADGGPSLLSPQH--ERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELK  533
            SA    +  SP +  ERKPLR LSPWITDILL APLGIRSDYFRWC GVMGKYAA GELK
Sbjct  164  SAQEKAN-YSPGNEPERKPLRPLSPWITDILLTAPLGIRSDYFRWCGGVMGKYAAGGELK  222

Query  534  PPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            PP+TA SRG+GKHPQL+PSTPRWAVANGAGV
Sbjct  223  PPTTAYSRGAGKHPQLMPSTPRWAVANGAGV  253



>gb|AAT79487.1| gigantea 3 [Triticum aestivum]
Length=1155

 Score =   297 bits (760),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 168/209 (80%), Gaps = 6/209 (3%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PED+A+LI++ YPSKE RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD +  PF
Sbjct  50   PEDVAQLIQSYYPSKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTLSYDSHGSPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
             SFISL   +S+ E SEQWALACGEILR+LTHYNRP++KV   ++ +D++ +   A    
Sbjct  110  NSFISLFTQSSEKEYSEQWALACGEILRVLTHYNRPIFKVADCNNRSDQATASCSAQEKA  169

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPP  539
            +   G      + ERKPLR LSPWITDILL APLGIRSDYFRWC GVMGKYAA GELKPP
Sbjct  170  NYSPG-----NEPERKPLRPLSPWITDILLTAPLGIRSDYFRWCGGVMGKYAAGGELKPP  224

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            +TA SRG+GKHPQL+PSTPRWAVANGAGV
Sbjct  225  TTAYSRGAGKHPQLMPSTPRWAVANGAGV  253



>emb|CAY26028.1| GIGANTEA [Lolium perenne]
 gb|ABF83898.2| GIGANTEA [Lolium perenne]
Length=1148

 Score =   295 bits (754),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 142/211 (67%), Positives = 169/211 (80%), Gaps = 10/211 (5%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PED+A+LI++ YPSKE RL D+VLATF+LHHPEHGHAV+HPI+S IIDG+L YD++  PF
Sbjct  50   PEDVAQLIQSYYPSKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGSLSYDRHGSPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGS--HAST  356
             SFISL    ++ E SEQWALACGEILR+LTHYNRP++KV + +  +D++ +    H   
Sbjct  110  NSFISLFTQTAEKEYSEQWALACGEILRVLTHYNRPIFKVAECNDTSDQATTSYSLHDKA  169

Query  357  SKSADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELK  533
            + S +  P       ERKPLR LSPWITDILL APLGIRSDYFRWC GVMGKYAA GELK
Sbjct  170  NSSPENEP-------ERKPLRPLSPWITDILLNAPLGIRSDYFRWCGGVMGKYAAGGELK  222

Query  534  PPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            PP+TA SRG+GKHPQL+PSTPRWAVANGAGV
Sbjct  223  PPTTAYSRGAGKHPQLMPSTPRWAVANGAGV  253



>gb|AIC83986.1| gigantea-like protein [Festuca pratensis]
Length=1149

 Score =   295 bits (754),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 142/209 (68%), Positives = 170/209 (81%), Gaps = 6/209 (3%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PED+A+LI++ YPSKE RL D+VLATF+LHHPEHGHAV+HPI+S IIDG+L YD++  PF
Sbjct  50   PEDVAQLIQSCYPSKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGSLSYDRHGSPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
             SFISL    ++ E SEQWALACGEILR+LTHYNRP++KV + +  +D++ +    S  +
Sbjct  110  NSFISLFTQTAEKEYSEQWALACGEILRVLTHYNRPIFKVAECNDTSDQATTS--YSLQE  167

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPP  539
             A+  P     + ERKPLR LSPWITDILL APLGIRSDYFRWC GVMGKYAA GELKPP
Sbjct  168  KANSSP---ENEPERKPLRPLSPWITDILLNAPLGIRSDYFRWCGGVMGKYAAGGELKPP  224

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            +TA SRG+GKHPQL+PSTPRWAVANGAGV
Sbjct  225  TTAYSRGAGKHPQLMPSTPRWAVANGAGV  253



>ref|XP_006434519.1| hypothetical protein CICLE_v10004044mg [Citrus clementina]
 gb|ESR47759.1| hypothetical protein CICLE_v10004044mg [Citrus clementina]
Length=1082

 Score =   294 bits (752),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 163/183 (89%), Gaps = 1/183 (1%)
 Frame = +3

Query  81   FLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACGEI  260
            F+LHHPEHGHAV  PIISCIIDGTL YDK+SPPFASF+SLVCPNS+NE SEQWALAC EI
Sbjct  2    FVLHHPEHGHAVALPIISCIIDGTLVYDKSSPPFASFVSLVCPNSENEYSEQWALACTEI  61

Query  261  LRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLS-PQHERKPLRLLSPWI  437
            LRILTHYNRP+YK E+Q+SE +RS+S SHA+TS S DG  S +   Q ERKPLR LSPWI
Sbjct  62   LRILTHYNRPIYKTEQQNSEFERSSSSSHATTSDSRDGELSNMPLVQQERKPLRPLSPWI  121

Query  438  TDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAVANG  617
            TDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+ ASSRGSGKHPQL+ STPRWAVANG
Sbjct  122  TDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTIASSRGSGKHPQLMLSTPRWAVANG  181

Query  618  AGV  626
            AGV
Sbjct  182  AGV  184



>gb|AGM20686.1| GI1-2 [Populus tomentosa]
Length=1170

 Score =   294 bits (753),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 162/208 (78%), Gaps = 23/208 (11%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIAELIRNRYPSK+  LFDDVL                       DGTL YD +SPPF
Sbjct  61   PDDIAELIRNRYPSKDKHLFDDVL-----------------------DGTLVYDGSSPPF  97

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+NE SEQWALACGEILRILTHYNRP+YK+EKQ+SE DRS+S  H+++ +
Sbjct  98   ASFISLVCPSSENEYSEQWALACGEILRILTHYNRPIYKLEKQNSETDRSSSDGHSTSIE  157

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
            S     ++   Q ERKP R LSPWITD+LLAAPLGIRSDYFRWCSGVMGKYAAGELKPP 
Sbjct  158  SEGKSSTIPLVQQERKPFRPLSPWITDVLLAAPLGIRSDYFRWCSGVMGKYAAGELKPPR  217

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
            T SSR SGKHPQL+PSTPRWAVANGAGV
Sbjct  218  TTSSRVSGKHPQLMPSTPRWAVANGAGV  245



>gb|AEK05801.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   289 bits (740),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 159/208 (76%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIA+LIRNRYPSK   LFDDVLA F+LHHPEHGHAV+ PIISCIIDGTL YD +SPPF
Sbjct  1    PDDIAKLIRNRYPSKNKHLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLVYDGSSPPF  60

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+NE SEQWALACGEILRILTHYNRP+YK+EKQ+SE DRS+S  ++++ +
Sbjct  61   ASFISLVCPSSENEYSEQWALACGEILRILTHYNRPIYKLEKQNSETDRSSSDGNSTSIE  120

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
            S     ++   Q ERKP R LSPW                   CSGVMGKYAAGEL    
Sbjct  121  SEGKSSTIPLVQQERKPFRPLSPWXXXXXXXXXXXXXXXXXXXCSGVMGKYAAGELXXXX  180

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
               SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  181  XXXSRGSGKHPQLVPSTPRWAVANGAGV  208



>gb|AEK05799.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   289 bits (740),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 159/208 (76%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIA+LIRNRYPSK   LFDDVLA F+LHHPEHGHAV+ PIISCIIDGTL YD +SPPF
Sbjct  1    PDDIAKLIRNRYPSKNKHLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLVYDGSSPPF  60

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+NE SEQWALACGEILRILTHYNRP+YK+EKQ+SE DRS+S  ++++ +
Sbjct  61   ASFISLVCPSSENEYSEQWALACGEILRILTHYNRPIYKLEKQNSETDRSSSDGNSTSIE  120

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
            S     ++   Q ERKP R LSPW                   CSGVMGKYAAGEL    
Sbjct  121  SEGKSSTIPLVQQERKPFRPLSPWXXXXXXXXXXXXXXXXXXXCSGVMGKYAAGELXXXX  180

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
               SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  181  XXXSRGSGKHPQLVPSTPRWAVANGAGV  208



>gb|AEK05803.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   289 bits (740),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 159/208 (76%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIA+LIRNRYPSK   LFDDVLA F+LHHPEHGHAV+ PIISCIIDGTL YD +SPPF
Sbjct  1    PDDIAKLIRNRYPSKNKHLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLVYDGSSPPF  60

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+NE SEQWALACGEILRILTHYNRP+YK+EKQ+SE DRS+S  ++++ +
Sbjct  61   ASFISLVCPSSENEYSEQWALACGEILRILTHYNRPIYKLEKQNSETDRSSSDGNSTSIE  120

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
            S     ++   Q ERKP R LSPW                   CSGVMGKYAAGEL    
Sbjct  121  SEGKSSTIPLVQQERKPFRPLSPWXXXXXXXXXXXXXXXXXXXCSGVMGKYAAGELXXXX  180

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
               SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  181  XXXSRGSGKHPQLVPSTPRWAVANGAGV  208



>gb|AEK05793.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05794.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05796.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05797.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05798.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05804.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05805.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05806.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05809.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   289 bits (740),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 159/208 (76%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIA+LIRNRYPSK   LFDDVLA F+LHHPEHGHAV+ PIISCIIDGTL YD +SPPF
Sbjct  1    PDDIAKLIRNRYPSKNKHLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLVYDGSSPPF  60

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+NE SEQWALACGEILRILTHYNRP+YK+EKQ+SE DRS+S  ++++ +
Sbjct  61   ASFISLVCPSSENEYSEQWALACGEILRILTHYNRPIYKLEKQNSETDRSSSDGNSTSIE  120

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
            S     ++   Q ERKP R LSPW                   CSGVMGKYAAGEL    
Sbjct  121  SEGKSSTIPLVQQERKPFRPLSPWXXXXXXXXXXXXXXXXXXXCSGVMGKYAAGELXXXX  180

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
               SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  181  XXXSRGSGKHPQLVPSTPRWAVANGAGV  208



>gb|AEK05802.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   289 bits (739),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 159/208 (76%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIA+LIRNRYPSK   LFDDVLA F+LHHPEHGHAV+ PIISCIIDGTL YD +SPPF
Sbjct  1    PDDIAKLIRNRYPSKNKHLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLVYDGSSPPF  60

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+NE SEQWALACGEILRILTHYNRP+YK+EKQ+SE DRS+S  ++++ +
Sbjct  61   ASFISLVCPSSENEYSEQWALACGEILRILTHYNRPIYKLEKQNSETDRSSSDGNSTSIE  120

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
            S     ++   Q ERKP R LSPW                   CSGVMGKYAAGEL    
Sbjct  121  SEGKSSTIPLVQQERKPFRPLSPWXXXXXXXXXXXXXXXXXXXCSGVMGKYAAGELXXXX  180

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
               SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  181  XXXSRGSGKHPQLVPSTPRWAVANGAGV  208



>gb|AEK05790.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05808.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   289 bits (739),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 159/208 (76%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIA+LIRNRYPSK   LFDDVLA F+LHHPEHGHAV+ PIISCIIDGTL YD +SPPF
Sbjct  1    PDDIAKLIRNRYPSKNKHLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLVYDGSSPPF  60

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+NE SEQWALACGEILRILTHYNRP+YK+EKQ+SE DRS+S  ++++ +
Sbjct  61   ASFISLVCPSSENEYSEQWALACGEILRILTHYNRPIYKLEKQNSETDRSSSDGNSTSIE  120

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
            S     ++   Q ERKP R LSPW                   CSGVMGKYAAGEL    
Sbjct  121  SEGKSSTIPLVQQERKPFRPLSPWXXXXXXXXXXXXXXXXXXXCSGVMGKYAAGELXXXX  180

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
               SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  181  XXXSRGSGKHPQLVPSTPRWAVANGAGV  208



>gb|AEK05807.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05810.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05811.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   289 bits (739),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 159/208 (76%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIA+LIRNRYPSK   LFDDVLA F+LHHPEHGHAV+ PIISCIIDGTL YD +SPPF
Sbjct  1    PDDIAKLIRNRYPSKNKHLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLVYDGSSPPF  60

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+NE SEQWALACGEILRILTHYNRP+YK+EKQ+SE DRS+S  ++++ +
Sbjct  61   ASFISLVCPSSENEYSEQWALACGEILRILTHYNRPIYKLEKQNSETDRSSSDGNSTSIE  120

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
            S     ++   Q ERKP R LSPW                   CSGVMGKYAAGEL    
Sbjct  121  SEGKSSTIPLVQQERKPFRPLSPWXXXXXXXXXXXXXXXXXXXCSGVMGKYAAGELXXXX  180

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
               SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  181  XXXSRGSGKHPQLVPSTPRWAVANGAGV  208



>gb|AEK05791.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05792.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   289 bits (739),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 159/208 (76%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIA+LIRNRYPSK   LFDDVLA F+LHHPEHGHAV+ PIISCIIDGTL YD +SPPF
Sbjct  1    PDDIAKLIRNRYPSKNKHLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLVYDGSSPPF  60

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+NE SEQWALACGEILRILTHYNRP+YK+EKQ+SE DRS+S  ++++ +
Sbjct  61   ASFISLVCPSSENEYSEQWALACGEILRILTHYNRPIYKLEKQNSETDRSSSDGNSTSIE  120

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
            S     ++   Q ERKP R LSPW                   CSGVMGKYAAGEL    
Sbjct  121  SEGKSSTIPLVQQERKPFRPLSPWXXXXXXXXXXXXXXXXXXXCSGVMGKYAAGELXXXX  180

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
               SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  181  XXXSRGSGKHPQLVPSTPRWAVANGAGV  208



>gb|AEK05795.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05800.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   288 bits (738),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 158/208 (76%), Gaps = 0/208 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P+DIA+LIRNRYPSK   LFDDVLA F+LHHPEHGHAV+ PIISCIIDGTL YD +SPPF
Sbjct  1    PDDIAKLIRNRYPSKNKHLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLVYDGSSPPF  60

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
            ASFISLVCP+S+NE SEQWALACGEILRILTHYNRP+YK+EKQ+SE DRS S  ++++ +
Sbjct  61   ASFISLVCPSSENEYSEQWALACGEILRILTHYNRPIYKLEKQNSETDRSXSDGNSTSIE  120

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
            S     ++   Q ERKP R LSPW                   CSGVMGKYAAGEL    
Sbjct  121  SEGKSSTIPLVQQERKPFRPLSPWXXXXXXXXXXXXXXXXXXXCSGVMGKYAAGELXXXX  180

Query  543  TASSRGSGKHPQLIPSTPRWAVANGAGV  626
               SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  181  XXXSRGSGKHPQLVPSTPRWAVANGAGV  208



>ref|XP_010261025.1| PREDICTED: protein GIGANTEA-like isoform X2 [Nelumbo nucifera]
Length=1102

 Score =   288 bits (736),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 155/183 (85%), Gaps = 2/183 (1%)
 Frame = +3

Query  81   FLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACGEI  260
            F+LHHPEHGHAV+ P+ISCIID TL Y+KNSPPF+SFISLVCP+++NE SEQWA+ACGEI
Sbjct  2    FVLHHPEHGHAVLLPLISCIIDDTLAYNKNSPPFSSFISLVCPSNENEYSEQWAMACGEI  61

Query  261  LRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLSPWIT  440
            LR+LTHYNRP+YK E Q+S  DRS+SG HA++S + +G      PQ ++KPLR LSPWIT
Sbjct  62   LRVLTHYNRPIYKAEHQNS-VDRSSSGIHATSSSTKEGTCYSALPQQDKKPLRPLSPWIT  120

Query  441  DILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGKHPQLIPSTPRWAVANG  617
            DILLAAPLGIRSDYFRWC GVMGKYAA GELKPP+     GSGKHPQ IPSTPRWAVANG
Sbjct  121  DILLAAPLGIRSDYFRWCGGVMGKYAAGGELKPPTIVCGGGSGKHPQFIPSTPRWAVANG  180

Query  618  AGV  626
            A V
Sbjct  181  AAV  183



>gb|ADR51711.1| GI [Secale cereale]
Length=1142

 Score =   287 bits (734),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 142/209 (68%), Positives = 164/209 (78%), Gaps = 6/209 (3%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PED+A+LI++ YPSKE RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD +  PF
Sbjct  42   PEDVAQLIQSCYPSKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTLSYDSHGSPF  101

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
             SFISL   +S+ E SEQWALACGEILR+LTHYNRP++KV   +      ++    +   
Sbjct  102  NSFISLFTQSSEKEYSEQWALACGEILRVLTHYNRPIFKVADCNQHLWPGHNKLFCTEKA  161

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPP  539
             A  G      + ERKPLR LSPWITDILL APLGIRSDYFRWC GVMGKYAA GELKPP
Sbjct  162  IALPG-----NEPERKPLRPLSPWITDILLTAPLGIRSDYFRWCGGVMGKYAAGGELKPP  216

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            +TA SRG+GKHPQL+PSTPRWAVANGAGV
Sbjct  217  TTAYSRGAGKHPQLMPSTPRWAVANGAGV  245



>gb|AAQ11738.1| gigantea [Triticum aestivum]
Length=1155

 Score =   286 bits (731),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 140/209 (67%), Positives = 165/209 (79%), Gaps = 6/209 (3%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PED+A+LI++ YPSKE RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD +  PF
Sbjct  50   PEDVAQLIQSCYPSKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTLSYDSHGSPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
             SFISL   +S+ E SEQWALACGEILR+LTHYNRP++KV   + +    +S    +   
Sbjct  110  NSFISLFTQSSEKEYSEQWALACGEILRVLTHYNRPIFKVADCNHQIRPGHSKLFCT---  166

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPP  539
              +   +L   + E KPLR LSPWITDI+L APLGIRSDYFRWC GVMGKYAA GELKPP
Sbjct  167  --EKAITLPGNEPEGKPLRPLSPWITDIVLTAPLGIRSDYFRWCGGVMGKYAAGGELKPP  224

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            +TA SRG+GKHPQL+PSTPRWAVANGAGV
Sbjct  225  TTAYSRGAGKHPQLMPSTPRWAVANGAGV  253



>ref|XP_002961231.1| hypothetical protein SELMODRAFT_140066 [Selaginella moellendorffii]
 gb|EFJ38770.1| hypothetical protein SELMODRAFT_140066 [Selaginella moellendorffii]
Length=1063

 Score =   278 bits (711),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 129/209 (62%), Positives = 156/209 (75%), Gaps = 5/209 (2%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAEL+R+ YP KE  L DDVLATF+LHHPEHGH ++HP++SC+IDGTL Y K +PPF
Sbjct  48   PEDIAELVRDHYPHKEPCLLDDVLATFVLHHPEHGHTILHPLLSCVIDGTLAYSKTTPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
             SF+S+   +S+ +L+EQWALACGEILR+LTHYNRP+YK E       RS+S S     +
Sbjct  108  GSFVSVFGVSSERDLTEQWALACGEILRLLTHYNRPIYKSESSADGEKRSSSDSGDPADR  167

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYA-AGELKPP  539
               G P        R P RLL+PWITD LLAAPLG +SDYFRWC GV+GKYA  G+L+PP
Sbjct  168  DGSGSPD----NGRRAPKRLLTPWITDSLLAAPLGTKSDYFRWCGGVLGKYAGGGDLRPP  223

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            +T   +G GKHPQL+ STPRWAVANGA V
Sbjct  224  TTGDGKGHGKHPQLLSSTPRWAVANGAAV  252



>ref|XP_002969462.1| hypothetical protein SELMODRAFT_170553 [Selaginella moellendorffii]
 gb|EFJ29550.1| hypothetical protein SELMODRAFT_170553 [Selaginella moellendorffii]
Length=1056

 Score =   278 bits (710),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 129/209 (62%), Positives = 156/209 (75%), Gaps = 5/209 (2%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIAEL+R+ YP KE  L DDVLATF+LHHPEHGH ++HP++SC+IDGTL Y K +PPF
Sbjct  48   PEDIAELVRDHYPHKEPCLLDDVLATFVLHHPEHGHTILHPLLSCVIDGTLAYSKTTPPF  107

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
             SF+S+   +S+ +L+EQWALACGEILR+LTHYNRP+YK E       RS+S S     +
Sbjct  108  GSFVSVFGVSSERDLTEQWALACGEILRLLTHYNRPIYKSESSADGEKRSSSDSGDPADR  167

Query  363  SADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYA-AGELKPP  539
               G P        R P RLL+PWITD LLAAPLG +SDYFRWC GV+GKYA  G+L+PP
Sbjct  168  DGSGSPD----NGRRAPKRLLTPWITDSLLAAPLGTKSDYFRWCGGVLGKYAGGGDLRPP  223

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            +T   +G GKHPQL+ STPRWAVANGA V
Sbjct  224  TTGDGKGHGKHPQLLSSTPRWAVANGAAV  252



>dbj|BAP76055.1| putative GI [Cryptomeria japonica]
Length=1197

 Score =   266 bits (679),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 137/220 (62%), Positives = 158/220 (72%), Gaps = 12/220 (5%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            P DIAE+I   YP++E  L DDVLATF+LHHPEHGH  IHP++S IID  + YDK  PPF
Sbjct  48   PHDIAEIIHCHYPNEEVCLLDDVLATFVLHHPEHGHTFIHPLLSLIIDRIVIYDKKIPPF  107

Query  183  ASFISLVCPNS------QNELSEQWALACGEILRILTHYNRPVYKVE---KQDSEADRSN  335
            +SFISL  P+S      Q +  EQW +AC  ILR+LTHYNRP+   E    Q+   +RS 
Sbjct  108  SSFISLFSPSSKLHFPWQKDYPEQWGVACLGILRVLTHYNRPLLDNEVDRAQNGATERSA  167

Query  336  SGSHASTSKSADGGP--SLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMG  509
            SG+ ASTSKS D  P         E+KPLRLL+PWITD LLA  +GIRSDYFRWC GVMG
Sbjct  168  SGNSASTSKSRDKEPLGDCAQQYQEKKPLRLLTPWITDSLLATSMGIRSDYFRWCGGVMG  227

Query  510  KYAA-GELKPPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            KYAA GELKPP TA  +G GKHPQL+PSTPRWAVANGAGV
Sbjct  228  KYAAGGELKPPITAGGQGPGKHPQLMPSTPRWAVANGAGV  267



>emb|CAN81809.1| hypothetical protein VITISV_032939 [Vitis vinifera]
Length=1172

 Score =   257 bits (657),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 142/219 (65%), Positives = 151/219 (69%), Gaps = 19/219 (9%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIIS-------CIIDGTLEY  161
            PEDIAELIR+RYPSKE RL               G      +         C+I   L  
Sbjct  48   PEDIAELIRSRYPSKEQRLLMMSWQRLFFIIRNMGMLSFFQLFRVSLMVHWCMIGVLLLL  107

Query  162  DKNSPPFASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSG  341
              + P  A     V     NE SEQWALACGEILRILTHYNRP+YKVE Q SEADRS+SG
Sbjct  108  PLSFPWSAQAARYV-----NEYSEQWALACGEILRILTHYNRPIYKVEHQSSEADRSSSG  162

Query  342  SHASTSKSADG----GPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMG  509
             HA+TS S DG    GP L   Q+ERKP R LSPWITDILLAAPLGIRSDYFRWC GVMG
Sbjct  163  RHATTSDSVDGKSSQGPLL---QNERKPSRPLSPWITDILLAAPLGIRSDYFRWCGGVMG  219

Query  510  KYAAGELKPPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            KYAAGELKPPSTAS+RGSGKHPQLIPSTPRWAVANGAGV
Sbjct  220  KYAAGELKPPSTASTRGSGKHPQLIPSTPRWAVANGAGV  258


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/58 (59%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  46   KKTDFLMMFWQHFSSIIQSMGMLLFIQLSHVSLMVHWSMIKIVHLLPLSFHWSVQTVR  219
            K+   LMM WQ    II++MGML F QL  VSLMVHW MI ++ LLPLSF WS Q  R
Sbjct  62   KEQRLLMMSWQRLFFIIRNMGMLSFFQLFRVSLMVHWCMIGVLLLLPLSFPWSAQAAR  119



>dbj|BAO66507.1| GIGANTEA [Marchantia polymorpha]
Length=1187

 Score =   253 bits (646),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 121/209 (58%), Positives = 149/209 (71%), Gaps = 2/209 (1%)
 Frame = +3

Query  6    EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFA  185
            +DI EL+R  YP+ E+ L DDVLATF+LHHPEHGHAV+H ++SC+IDGTL Y+K +PPF 
Sbjct  49   DDIGELVRAHYPTNEHCLLDDVLATFVLHHPEHGHAVLHALLSCVIDGTLIYNKKTPPFG  108

Query  186  SFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKS  365
            SF+SL  P+++ + SEQWALACGE LR+LTHYNRP ++ + +       +  S    S  
Sbjct  109  SFVSLFSPSTERDFSEQWALACGETLRVLTHYNRPTFRSDTRQPSGSNPSPSSSGEGSGK  168

Query  366  ADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAG-ELKPPS  542
                 +       R P RLL+PWITD LLAAP  IRSDYF+WC GVMGKY AG EL+PP+
Sbjct  169  CSQERAGWDEYDRRSPTRLLTPWITDSLLAAPPSIRSDYFQWCGGVMGKYTAGEELRPPT  228

Query  543  TA-SSRGSGKHPQLIPSTPRWAVANGAGV  626
            TA   R  GK PQL+PSTPRWAVANGA V
Sbjct  229  TAVGGRSQGKQPQLLPSTPRWAVANGAAV  257



>dbj|BAO74110.1| GIGANTEA, partial [Lotus japonicus]
 dbj|BAO74111.1| GIGANTEA, partial [Lotus japonicus]
 dbj|BAO74112.1| GIGANTEA, partial [Lotus japonicus]
 dbj|BAO74113.1| GIGANTEA, partial [Lotus japonicus]
 dbj|BAO74114.1| GIGANTEA, partial [Lotus japonicus]
 dbj|BAO74115.1| GIGANTEA, partial [Lotus japonicus]
 dbj|BAO74116.1| GIGANTEA, partial [Lotus japonicus]
 dbj|BAO74117.1| GIGANTEA, partial [Lotus japonicus]
Length=976

 Score =   242 bits (617),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 131/151 (87%), Gaps = 5/151 (3%)
 Frame = +3

Query  177  PFASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHAST  356
            PFASFISLVCP ++N+ SEQWALACGEILRILTHYNRP+YK      EA+RS+SGSHA+T
Sbjct  2    PFASFISLVCPKNENDYSEQWALACGEILRILTHYNRPIYK----HVEAERSSSGSHATT  57

Query  357  SKSADGGPSLLS-PQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELK  533
            S  ADG     S  Q E+KP R LSPWI+DILLAAP+GIRSDYFRWCSGVMGKYAAGELK
Sbjct  58   SGPADGKSEHNSLTQQEKKPTRPLSPWISDILLAAPVGIRSDYFRWCSGVMGKYAAGELK  117

Query  534  PPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            PPSTA+SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  118  PPSTAASRGSGKHPQLVPSTPRWAVANGAGV  148



>dbj|BAO74118.1| GIGANTEA, partial [Lotus japonicus]
Length=976

 Score =   241 bits (616),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 131/151 (87%), Gaps = 5/151 (3%)
 Frame = +3

Query  177  PFASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHAST  356
            PFASFISLVCP ++N+ SEQWALACGEILRILTHYNRP+YK      EA+RS+SGSHA+T
Sbjct  2    PFASFISLVCPKNENDYSEQWALACGEILRILTHYNRPIYK----HVEAERSSSGSHATT  57

Query  357  SKSADGGPSLLS-PQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELK  533
            S  ADG     S  Q E+KP R LSPWI+DILLAAP+GIRSDYFRWCSGVMGKYAAGELK
Sbjct  58   SGPADGKSEHNSLTQQEKKPTRPLSPWISDILLAAPVGIRSDYFRWCSGVMGKYAAGELK  117

Query  534  PPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            PPSTA+SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  118  PPSTAASRGSGKHPQLMPSTPRWAVANGAGV  148



>gb|ACJ09481.1| putative gigantea, partial [Oryza sativa Indica Group]
Length=208

 Score =   213 bits (543),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 128/162 (79%), Gaps = 7/162 (4%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIA+LI++ YPSKE RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD+N  PF
Sbjct  50   PEDIAQLIQSCYPSKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTLSYDRNGFPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHAST--  356
             SFISL    S+ E SEQWALACGEILR+LTHYNRP++KV+ Q SEA+ S++   AS+  
Sbjct  110  MSFISLFSHTSEKEYSEQWALACGEILRVLTHYNRPIFKVDHQHSEAECSSTSDQASSCE  169

Query  357  --SKSADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRS  476
               K A+G P     + +RKPLR LSPWITDILLAAPLGIRS
Sbjct  170  SMEKRANGSP---RNEPDRKPLRPLSPWITDILLAAPLGIRS  208



>gb|ACJ09482.1| putative gigantea, partial [Oryza sativa Japonica Group]
Length=208

 Score =   213 bits (542),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 128/162 (79%), Gaps = 7/162 (4%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIA+LI++ YPSKE RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD+N  PF
Sbjct  50   PEDIAQLIQSCYPSKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTLSYDRNGFPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHAST--  356
             SFISL    S+ E SEQWALACGEILR+LTHYNRP++KV+ Q SEA+ S++   AS+  
Sbjct  110  MSFISLFSHTSEKEYSEQWALACGEILRVLTHYNRPIFKVDHQHSEAECSSTSDQASSCE  169

Query  357  --SKSADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRS  476
               K A+G P     + +RKPLR LSPWITDILLAAPLGIRS
Sbjct  170  SMEKRANGSP---RNEPDRKPLRPLSPWITDILLAAPLGIRS  208



>gb|ACJ09478.1| putative gigantea, partial [Oryza sativa Japonica Group]
 gb|ACJ09484.1| putative gigantea, partial [Oryza sativa Japonica Group]
 gb|ACJ09485.1| putative gigantea, partial [Oryza sativa Indica Group]
 gb|ACJ09486.1| putative gigantea, partial [Oryza sativa Indica Group]
 gb|ACJ09487.1| putative gigantea, partial [Oryza sativa]
 gb|ACJ09489.1| putative gigantea, partial [Oryza sativa Japonica Group]
 gb|ACJ09490.1| putative gigantea, partial [Oryza sativa Japonica Group]
 gb|ACJ09491.1| putative gigantea, partial [Oryza sativa Japonica Group]
 gb|ACJ09492.1| putative gigantea, partial [Oryza sativa Japonica Group]
 gb|ACJ09493.1| putative gigantea, partial [Oryza sativa Japonica Group]
Length=208

 Score =   213 bits (542),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 128/162 (79%), Gaps = 7/162 (4%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIA+LI++ YPSKE RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD+N  PF
Sbjct  50   PEDIAQLIQSCYPSKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTLSYDRNGFPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHAST--  356
             SFISL    S+ E SEQWALACGEILR+LTHYNRP++KV+ Q SEA+ S++   AS+  
Sbjct  110  MSFISLFSHTSEKEYSEQWALACGEILRVLTHYNRPIFKVDHQHSEAECSSTSDQASSCE  169

Query  357  --SKSADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRS  476
               K A+G P     + +RKPLR LSPWITDILLAAPLGIRS
Sbjct  170  SMEKRANGSP---RNEPDRKPLRPLSPWITDILLAAPLGIRS  208



>gb|ACJ09480.1| putative gigantea, partial [Oryza sativa Indica Group]
Length=208

 Score =   213 bits (541),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 129/162 (80%), Gaps = 7/162 (4%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIA+LI++ YPSKE RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD+N  PF
Sbjct  50   PEDIAQLIQSCYPSKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTLSYDRNGFPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK  362
             SFISL    S+ E SEQWALACGEILR+LTHYNRP++KV+ Q SEA+ S++   AS+ +
Sbjct  110  MSFISLFSHTSEKEYSEQWALACGEILRVLTHYNRPIFKVDHQHSEAECSSTSDQASSCE  169

Query  363  S----ADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRS  476
            S    A+G P     + +RKPLR LSPWITDILLAAPLGIRS
Sbjct  170  SMEKRANGSP---RNEPDRKPLRPLSPWITDILLAAPLGIRS  208



>gb|ACJ09479.1| putative gigantea, partial [Oryza sativa Japonica Group]
Length=208

 Score =   212 bits (540),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 127/162 (78%), Gaps = 7/162 (4%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIA+LI+  YPSKE RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD+N  PF
Sbjct  50   PEDIAQLIQGCYPSKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTLSYDRNGFPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHAST--  356
             SFISL    S+ E SEQWALACGEILR+LTHYNRP++KV+ Q SEA+ S++   AS+  
Sbjct  110  MSFISLFSHTSEKEYSEQWALACGEILRVLTHYNRPIFKVDHQHSEAECSSTSDQASSCE  169

Query  357  --SKSADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRS  476
               K A+G P     + +RKPLR LSPWITDILLAAPLGIRS
Sbjct  170  PMEKRANGSP---RNEPDRKPLRPLSPWITDILLAAPLGIRS  208



>gb|ACJ09488.1| putative gigantea, partial [Oryza sativa Japonica Group]
Length=208

 Score =   211 bits (538),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 127/162 (78%), Gaps = 7/162 (4%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIA+LI++ YPSKE RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD+N  PF
Sbjct  50   PEDIAQLIQSCYPSKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTLSYDRNGFPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHAST--  356
             SFISL    S+ E SEQWALACGEILR LTHYNRP++KV+ Q SEA+ S++   AS+  
Sbjct  110  MSFISLFSHTSEKEYSEQWALACGEILRALTHYNRPIFKVDHQHSEAECSSTSDQASSCE  169

Query  357  --SKSADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRS  476
               K A+G P     + +RKPLR LSPWITDILLAAPLGIRS
Sbjct  170  SMEKRANGSP---RNEPDRKPLRPLSPWITDILLAAPLGIRS  208



>gb|ACJ09483.1| putative gigantea, partial [Oryza sativa Japonica Group]
Length=208

 Score =   209 bits (533),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 127/162 (78%), Gaps = 7/162 (4%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PEDIA+LI++ YPSKE RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD+N  PF
Sbjct  50   PEDIAQLIQSCYPSKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTLSYDRNGFPF  109

Query  183  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHAST--  356
             SFISL    S+ E SEQWALACGEI R+LTHYNRP++KV+ Q SEA+ S++   AS+  
Sbjct  110  MSFISLFSHTSEKEYSEQWALACGEIPRVLTHYNRPIFKVDHQHSEAECSSTSDQASSCE  169

Query  357  --SKSADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRS  476
               K A+G P     + +RKPLR LSPWITDILLAAPLGIRS
Sbjct  170  SMEKRANGSP---RNEPDRKPLRPLSPWITDILLAAPLGIRS  208



>gb|AEK05888.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05908.1| gigantea-5, partial [Populus balsamifera]
Length=137

 Score =   205 bits (521),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 122/137 (89%), Gaps = 1/137 (1%)
 Frame = +3

Query  6    EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFA  185
            +DI+ELIRNRYPSK+ RLFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YD++SPPFA
Sbjct  1    DDISELIRNRYPSKDKRLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDRSSPPFA  60

Query  186  SFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKS  365
            SFISLVCP S+NE SEQWALACGEILRILTHYNRP+YK E+Q++E DRS+S SHA++S+S
Sbjct  61   SFISLVCPGSENEYSEQWALACGEILRILTHYNRPIYKREQQNNETDRSSSDSHATSSES  120

Query  366  ADGGPSLLS-PQHERKP  413
            A+G  S +   Q ERKP
Sbjct  121  AEGKSSSMPLXQQERKP  137



>gb|AEK05878.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05883.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05893.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05898.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05903.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05913.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05918.1| gigantea-5, partial [Populus balsamifera]
Length=137

 Score =   205 bits (521),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 122/137 (89%), Gaps = 1/137 (1%)
 Frame = +3

Query  6    EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFA  185
            +DI+ELIRNRYPSK+ RLFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YD++SPPFA
Sbjct  1    DDISELIRNRYPSKDKRLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDRSSPPFA  60

Query  186  SFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKS  365
            SFISLVCP S+NE SEQWALACGEILRILTHYNRP+YK E+Q++E DRS+S SHA++S+S
Sbjct  61   SFISLVCPGSENEYSEQWALACGEILRILTHYNRPIYKREQQNNETDRSSSDSHATSSES  120

Query  366  ADGGPSLLS-PQHERKP  413
            A+G  S +   Q ERKP
Sbjct  121  AEGKSSSMPLVQQERKP  137



>gb|AEK05858.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05863.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05868.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05873.1| gigantea-5, partial [Populus balsamifera]
Length=137

 Score =   203 bits (517),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 121/137 (88%), Gaps = 1/137 (1%)
 Frame = +3

Query  6    EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFA  185
            +DI+ELIRNRYPSK+ RLFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YD++SPPFA
Sbjct  1    DDISELIRNRYPSKDKRLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDRSSPPFA  60

Query  186  SFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKS  365
            SFISLVCP S+NE SEQWALACGEILRILTHYNRP+YK E+Q++E DRS+S SHA++S+S
Sbjct  61   SFISLVCPGSENEYSEQWALACGEILRILTHYNRPIYKREQQNNETDRSSSDSHATSSES  120

Query  366  ADGGPSLLS-PQHERKP  413
             +G  S +   Q ERKP
Sbjct  121  VEGKSSSMPLVQQERKP  137



>gb|AEK26574.1| gigantea 5 [Populus tremula]
Length=138

 Score =   201 bits (512),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 121/138 (88%), Gaps = 1/138 (1%)
 Frame = +3

Query  6    EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFA  185
            +DI+ELIRNRYPSK+ RLFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YD++SPPFA
Sbjct  1    DDISELIRNRYPSKDKRLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDRSSPPFA  60

Query  186  SFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKS  365
            SFISLVCP S+NE SEQWALACGEILRILTHYNRP+YK E+Q++E DRS+S SHA++S+S
Sbjct  61   SFISLVCPGSENEYSEQWALACGEILRILTHYNRPIYKREQQNNETDRSSSESHATSSES  120

Query  366  ADGGPSLLS-PQHERKPL  416
             +G  S +   Q ERKP 
Sbjct  121  TEGKSSSMPLVQQERKPF  138



>gb|AEK05813.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05818.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05823.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05828.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05833.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05838.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05843.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05853.1| gigantea-5, partial [Populus balsamifera]
Length=137

 Score =   195 bits (496),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +3

Query  6    EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFA  185
            +DI+ELIRNRYPSK+ RLFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YD++SPPFA
Sbjct  1    DDISELIRNRYPSKDKRLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDRSSPPFA  60

Query  186  SFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADR  329
            SFISLVCP S+NE SEQWALACGEILRILTHYNRP+YK E+Q++E DR
Sbjct  61   SFISLVCPGSENEYSEQWALACGEILRILTHYNRPIYKREQQNNETDR  108



>gb|AEK05848.1| gigantea-5, partial [Populus balsamifera]
Length=137

 Score =   195 bits (495),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +3

Query  6    EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFA  185
            +DI+ELIRNRYPSK+ RLFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YD++SPPFA
Sbjct  1    DDISELIRNRYPSKDKRLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDRSSPPFA  60

Query  186  SFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADR  329
            SFISLVCP S+NE SEQWALACGEILRILTHYNRP+YK E+Q++E DR
Sbjct  61   SFISLVCPGSENEYSEQWALACGEILRILTHYNRPIYKREQQNNETDR  108



>gb|EMT06342.1| hypothetical protein F775_28583 [Aegilops tauschii]
Length=1146

 Score =   196 bits (498),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 113/141 (80%), Gaps = 10/141 (7%)
 Frame = +3

Query  213  SQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLS  392
            +Q E SEQWALACGEILR+LTHYNRP++KV      AD +N+   A+ S SA    +  S
Sbjct  113  AQKEYSEQWALACGEILRVLTHYNRPIFKV------ADCNNTSDQATASCSAQEKANY-S  165

Query  393  PQHE--RKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGS  563
            P +E  RKPLR LSPWITDILL APLGIRSDYFRWC GVMGKYAA GELKPP+TA SRG+
Sbjct  166  PGNEPERKPLRPLSPWITDILLTAPLGIRSDYFRWCGGVMGKYAAGGELKPPTTAYSRGA  225

Query  564  GKHPQLIPSTPRWAVANGAGV  626
            GKHPQL+PSTPRWAVANGAGV
Sbjct  226  GKHPQLMPSTPRWAVANGAGV  246



>gb|EMS55238.1| hypothetical protein TRIUR3_30834 [Triticum urartu]
Length=1126

 Score =   195 bits (495),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 110/139 (79%), Gaps = 6/139 (4%)
 Frame = +3

Query  213  SQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLS  392
            +Q E SEQWALACGEILR+LTHYNRP++KV   ++ +D++ +   A    +   G     
Sbjct  91   AQKEYSEQWALACGEILRVLTHYNRPIFKVADCNNRSDQATASCSAQEKANYSPGN----  146

Query  393  PQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGK  569
             + ERKPLR LSPWITDILL APLGIRSDYFRWC GVMGKYAA GELKPP+TA SRG+GK
Sbjct  147  -EPERKPLRPLSPWITDILLTAPLGIRSDYFRWCGGVMGKYAAGGELKPPTTAYSRGAGK  205

Query  570  HPQLIPSTPRWAVANGAGV  626
            HPQL+PSTPRWAVANGAGV
Sbjct  206  HPQLMPSTPRWAVANGAGV  224



>dbj|BAI40156.1| gigantea-like protein [Diospyros kaki]
Length=102

 Score =   173 bits (438),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 90/105 (86%), Gaps = 5/105 (5%)
 Frame = +3

Query  228  SEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHER  407
            SEQWALACGEILRILTHYNRP+YKVE+Q SEA+RS SGS A+TS S  G       QHE+
Sbjct  1    SEQWALACGEILRILTHYNRPIYKVERQQSEAERSESGSLATTSSSTAG-----DAQHEK  55

Query  408  KPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  542
            KPLR LSPWITDILLAAPLGIRSDYFRWC GVMGKYAAGELKPPS
Sbjct  56   KPLRPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGELKPPS  100



>gb|KJB59490.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
Length=1022

 Score =   182 bits (463),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 98/111 (88%), Gaps = 2/111 (2%)
 Frame = +3

Query  300  VEKQDSEADRSNSGSHASTSKSADGGPSLLSP--QHERKPLRLLSPWITDILLAAPLGIR  473
            +E Q++E DRS+S S A+TS+S DG PS   P  Q ERKPLR LSPWITDILLAAPLGIR
Sbjct  1    MEPQNNETDRSHSSSQATTSESVDGEPSFQIPLMQQERKPLRPLSPWITDILLAAPLGIR  60

Query  474  SDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            SDYFRWCSGVMGKYAAG+LKPP+TASSRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  61   SDYFRWCSGVMGKYAAGDLKPPTTASSRGSGKHPQLMPSTPRWAVANGAGV  111



>gb|KGN44454.1| LATE BLOOMER 1 [Cucumis sativus]
Length=101

 Score =   136 bits (342),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +3

Query  219  NELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQ  398
            N+ SEQWALACGEILRILTHYNRP+YK+E+++ E +RS+SGS A+TS + D     +  Q
Sbjct  11   NDYSEQWALACGEILRILTHYNRPIYKMERKNGETERSSSGSRATTSDTDDRELVGVPQQ  70

Query  399  HERKPLRLLSPWITDILLAAPLGIRSDYFRW  491
             ERKP+R LSPWITDILLAAPLGIRSDYFRW
Sbjct  71   QERKPVRPLSPWITDILLAAPLGIRSDYFRW  101



>emb|CAB56058.1| gigantea homologue [Oryza sativa]
Length=975

 Score =   145 bits (365),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/75 (92%), Positives = 71/75 (95%), Gaps = 1/75 (1%)
 Frame = +3

Query  405  RKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGKHPQL  581
            RKPLR LSPWITDILLAAPLGIRSDYFRWC GVMGKYAA GELKPP+TA SRGSGKHPQL
Sbjct  1    RKPLRPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGELKPPTTAYSRGSGKHPQL  60

Query  582  IPSTPRWAVANGAGV  626
            +PSTPRWAVANGAGV
Sbjct  61   MPSTPRWAVANGAGV  75



>ref|XP_004173872.1| PREDICTED: protein GIGANTEA-like, partial [Cucumis sativus]
Length=92

 Score =   117 bits (292),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +3

Query  6    EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFA  185
            EDIAELIR R+ SKE RLFDDVLA F+LHHPE+GHA+I PIISCI DG LEY++N PPFA
Sbjct  22   EDIAELIRIRFQSKEKRLFDDVLALFVLHHPENGHAIILPIISCIFDGALEYNRNDPPFA  81

Query  186  SFISLVCP  209
            SFISL CP
Sbjct  82   SFISLFCP  89



>gb|ADX35837.1| gigantea, partial [Brachypodium rupestre]
 gb|ADX35838.1| gigantea, partial [Brachypodium retusum]
 gb|ADX35840.1| gigantea, partial [Brachypodium retusum]
 gb|ADX35841.1| gigantea, partial [Brachypodium pinnatum]
 gb|ADX35842.1| gigantea, partial [Brachypodium pinnatum]
 gb|ADX35843.1| gigantea, partial [Brachypodium pinnatum]
 gb|ADX35850.1| gigantea, partial [Brachypodium sylvaticum subsp. glaucovirens]
 gb|ADX35851.1| gigantea, partial [Brachypodium phoenicoides]
 gb|ADX35852.1| gigantea, partial [Brachypodium phoenicoides]
 gb|ADX35853.1| gigantea, partial [Brachypodium sylvaticum]
 gb|ADX35854.1| gigantea, partial [Brachypodium sylvaticum]
 gb|AFB78140.1| gigantea, partial [Brachypodium arbuscula]
 gb|AFB78141.1| gigantea, partial [Brachypodium arbuscula]
Length=110

 Score =   113 bits (283),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PED+A+LI++ YP+KE RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD++  PF
Sbjct  33   PEDVAQLIQSCYPAKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTLSYDRHGSPF  92

Query  183  ASFISLVCPNSQNELSEQ  236
             SFISL    S+ E SEQ
Sbjct  93   NSFISLFTQTSEKEYSEQ  110



>gb|ADX35845.1| gigantea, partial [Brachypodium mexicanum]
Length=110

 Score =   113 bits (283),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PED+A+LI++ YP+KE RL D+VLA F+LHHPEHGHAV+HPI+SCIIDGTL YD++  PF
Sbjct  33   PEDVAQLIQSCYPAKEKRLVDEVLANFVLHHPEHGHAVVHPILSCIIDGTLSYDRHGSPF  92

Query  183  ASFISLVCPNSQNELSEQ  236
             SFISL    S+   SEQ
Sbjct  93   NSFISLFTQTSEKMYSEQ  110



>gb|ADX35839.1| gigantea, partial [Brachypodium retusum]
 gb|AFB78143.1| gigantea, partial [Brachypodium boissieri]
 gb|AFB78144.1| gigantea, partial [Brachypodium boissieri]
Length=110

 Score =   113 bits (282),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PED+A+LI++ YP+KE RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD++  PF
Sbjct  33   PEDVAQLIQSCYPAKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTLCYDRHGSPF  92

Query  183  ASFISLVCPNSQNELSEQ  236
            +SFISL    S+ E SEQ
Sbjct  93   SSFISLFTQTSEKEYSEQ  110



>gb|ADX35848.1| gigantea, partial [Brachypodium distachyon]
 gb|ADX35849.1| gigantea, partial [Brachypodium distachyon]
Length=110

 Score =   112 bits (281),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PED+A+LI++ YP+KE RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD++  PF
Sbjct  33   PEDVAQLIQSCYPAKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTLSYDRHGFPF  92

Query  183  ASFISLVCPNSQNELSEQ  236
             SFISL    S+ E SEQ
Sbjct  93   NSFISLFTQTSEKEYSEQ  110



>gb|ADX35844.1| gigantea, partial [Brachypodium mexicanum]
Length=110

 Score =   112 bits (279),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PED+A+LI++ YP+KE RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD++  PF
Sbjct  33   PEDVAQLIQSCYPAKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTLCYDRHGSPF  92

Query  183  ASFISLVCPNSQNELSEQ  236
             SFISL    S+ E SEQ
Sbjct  93   NSFISLFTQTSEKEYSEQ  110



>gb|ADX35846.1| gigantea, partial [Brachypodium distachyon]
 gb|ADX35847.1| gigantea, partial [Brachypodium distachyon]
Length=110

 Score =   111 bits (278),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PED+A+LI++ YP+KE RL D+VLA F+LHHPEHGHAV+HPI+S IIDGTL YD++  PF
Sbjct  33   PEDVAQLIQSCYPAKEKRLVDEVLANFVLHHPEHGHAVVHPILSRIIDGTLSYDRHGSPF  92

Query  183  ASFISLVCPNSQNELSEQ  236
             SFISL    S+ E SEQ
Sbjct  93   NSFISLFTQTSEKEYSEQ  110



>gb|AFB78142.1| gigantea, partial [Brachypodium boissieri]
Length=110

 Score =   110 bits (276),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +3

Query  3    PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  182
            PED+A+LI++ YP+KE RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD++  PF
Sbjct  33   PEDVAQLIQSCYPAKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTLCYDRHGSPF  92

Query  183  ASFISLVCPNSQNELSEQ  236
            +SFISL    S+ E  EQ
Sbjct  93   SSFISLFTQTSEKEYLEQ  110



>gb|KGN44455.1| hypothetical protein Csa_7G293730 [Cucumis sativus]
Length=284

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/46 (93%), Positives = 46/46 (100%), Gaps = 0/46 (0%)
 Frame = +3

Query  489  WCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            WCSGVMGKYAAGEL+PP++ASSRGSGKHPQLIPSTPRWAVANGAGV
Sbjct  119  WCSGVMGKYAAGELRPPTSASSRGSGKHPQLIPSTPRWAVANGAGV  164



>ref|XP_004163795.1| PREDICTED: protein GIGANTEA-like [Cucumis sativus]
Length=1016

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 58/74 (78%), Gaps = 1/74 (1%)
 Frame = +3

Query  408  KPLRLLSPWITDILLAAP-LGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLI  584
            + + +L  ++ DI+L+   +       + CSGVMGKYAAGEL+PP++ASSRGSGKHPQLI
Sbjct  61   RKITVLIVYVDDIILSGDDIAEIIQLKKRCSGVMGKYAAGELRPPTSASSRGSGKHPQLI  120

Query  585  PSTPRWAVANGAGV  626
            PSTPRWAVANGAGV
Sbjct  121  PSTPRWAVANGAGV  134



>ref|XP_010062090.1| PREDICTED: protein GIGANTEA isoform X2 [Eucalyptus grandis]
 ref|XP_010062091.1| PREDICTED: protein GIGANTEA isoform X2 [Eucalyptus grandis]
Length=983

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +3

Query  492  CSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            C GVMGKYAAGELKPP T++SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  26   CGGVMGKYAAGELKPPITSTSRGSGKHPQLMPSTPRWAVANGAGV  70



>ref|XP_008461913.1| PREDICTED: protein GIGANTEA-like isoform X2 [Cucumis melo]
Length=999

 Score = 61.2 bits (147),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 28/29 (97%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +3

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            S ASSRGSGKHPQLIPSTPRWAVANGAGV
Sbjct  58   SAASSRGSGKHPQLIPSTPRWAVANGAGV  86


 Score = 51.2 bits (121),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = +1

Query  313  IVKQIEVTVAAMLQQVNLLMGALVCCLRNMRGNH*GCCLHGLLIYCWQHL*VLEVTTSGG  492
            +VKQ E  VAA+ +QV  ++G L+ CL N RGN    C  GLLIYC  H    EVT S  
Sbjct  1    MVKQKEAVVAALPRQVTPMIGNLLECLSNKRGNLYDLCPPGLLIYCLPHHWASEVTISAA  60



>dbj|BAD68053.1| putative gigantea [Oryza sativa Japonica Group]
Length=261

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 40/42 (95%), Gaps = 1/42 (2%)
 Frame = +3

Query  504  MGKYAAG-ELKPPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            MGKYAAG ELKPP+TA SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  1    MGKYAAGGELKPPTTAYSRGSGKHPQLMPSTPRWAVANGAGV  42



>ref|XP_009631436.1| PREDICTED: protein GIGANTEA-like isoform X7 [Nicotiana tomentosiformis]
Length=941

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +3

Query  504  MGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            MGKYAAGELKPPSTASS GSGKH QLIPSTPRWAVANGAGV
Sbjct  1    MGKYAAGELKPPSTASSHGSGKHHQLIPSTPRWAVANGAGV  41



>ref|XP_009631435.1| PREDICTED: protein GIGANTEA-like isoform X6 [Nicotiana tomentosiformis]
Length=945

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 39/45 (87%), Gaps = 4/45 (9%)
 Frame = +3

Query  504  MGKYAAGELKPPST----ASSRGSGKHPQLIPSTPRWAVANGAGV  626
            MGKYAAGELKPPST    ASS GSGKH QLIPSTPRWAVANGAGV
Sbjct  1    MGKYAAGELKPPSTDFIVASSHGSGKHHQLIPSTPRWAVANGAGV  45



>gb|ABV55998.1| gigantea1A, partial [Zea mays]
Length=335

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +3

Query  534  PPSTASSRGSGKHPQLIPSTPRWAVANGAGV  626
            PP+TA SRGSGKHPQL+PSTPRWAVANGAGV
Sbjct  1    PPTTACSRGSGKHPQLMPSTPRWAVANGAGV  31



>ref|XP_008461914.1| PREDICTED: protein GIGANTEA-like isoform X3 [Cucumis melo]
Length=954

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/29 (97%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +3

Query  540  STASSRGSGKHPQLIPSTPRWAVANGAGV  626
            S ASSRGSGKHPQLIPSTPRWAVANGAGV
Sbjct  13   SIASSRGSGKHPQLIPSTPRWAVANGAGV  41



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250