BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS066B01

Length=627
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009767734.1|  PREDICTED: uncharacterized protein LOC104218849  77.8    5e-13   Nicotiana sylvestris
ref|XP_009622867.1|  PREDICTED: uncharacterized protein LOC104114193  71.6    6e-11   Nicotiana tomentosiformis
ref|XP_010682345.1|  PREDICTED: uncharacterized protein LOC104897214  64.7    8e-09   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011012451.1|  PREDICTED: uncharacterized protein LOC105116695  64.3    1e-08   Populus euphratica
ref|XP_004237262.1|  PREDICTED: uncharacterized protein LOC101263509  64.3    1e-08   Solanum lycopersicum
ref|XP_006378256.1|  hypothetical protein POPTR_0010s06010g           63.9    1e-08   
ref|XP_006378261.1|  hypothetical protein POPTR_0010s060502g          62.8    2e-08   
ref|XP_004239152.1|  PREDICTED: uncharacterized protein LOC101249174  63.5    2e-08   Solanum lycopersicum
gb|KDP26703.1|  hypothetical protein JCGZ_17861                       61.6    8e-08   Jatropha curcas
ref|XP_006483988.1|  PREDICTED: uncharacterized protein LOC102625551  60.8    1e-07   Citrus sinensis [apfelsine]
ref|XP_006438201.1|  hypothetical protein CICLE_v10030843mg           60.8    1e-07   Citrus clementina [clementine]
gb|KDO82145.1|  hypothetical protein CISIN_1g005245mg                 60.5    2e-07   Citrus sinensis [apfelsine]
gb|ADN32812.1|  sieve element occlusion c                             60.5    2e-07   Solanum phureja [chaucha]
ref|XP_006341794.1|  PREDICTED: uncharacterized protein LOC102602329  60.1    2e-07   Solanum tuberosum [potatoes]
ref|XP_004239153.1|  PREDICTED: uncharacterized protein LOC101249...  58.5    7e-07   Solanum lycopersicum
gb|ADN32811.1|  sieve element occlusion b                             56.6    3e-06   Solanum phureja [chaucha]
ref|XP_007159683.1|  hypothetical protein PHAVU_002G258300g           55.8    6e-06   Phaseolus vulgaris [French bean]
emb|CAN65891.1|  hypothetical protein VITISV_041167                   55.5    9e-06   Vitis vinifera
ref|XP_010663068.1|  PREDICTED: uncharacterized protein LOC100243366  55.1    1e-05   Vitis vinifera
emb|CBI14908.3|  unnamed protein product                              55.1    1e-05   Vitis vinifera
gb|KHN29013.1|  hypothetical protein glysoja_008348                   55.1    1e-05   Glycine soja [wild soybean]
ref|XP_011034021.1|  PREDICTED: uncharacterized protein LOC105132310  55.1    1e-05   Populus euphratica
ref|NP_001240968.1|  uncharacterized protein LOC100799626             55.1    1e-05   Glycine max [soybeans]
gb|KJB75974.1|  hypothetical protein B456_012G066300                  53.9    3e-05   Gossypium raimondii
ref|XP_010320950.1|  PREDICTED: uncharacterized protein LOC101249...  53.5    3e-05   Solanum lycopersicum
ref|XP_006378263.1|  hypothetical protein POPTR_0010s06060g           52.8    6e-05   
gb|KHG12713.1|  hypothetical protein F383_04328                       52.8    6e-05   Gossypium arboreum [tree cotton]
ref|XP_006379953.1|  hypothetical protein POPTR_0008s18360g           52.4    8e-05   
ref|XP_002298572.2|  hypothetical protein POPTR_0001s35880g           52.0    1e-04   Populus trichocarpa [western balsam poplar]
ref|XP_011014801.1|  PREDICTED: uncharacterized protein LOC105118...  52.0    1e-04   Populus euphratica
ref|XP_011014800.1|  PREDICTED: uncharacterized protein LOC105118...  52.0    1e-04   Populus euphratica
ref|XP_002298571.2|  hypothetical protein POPTR_0001s35870g           52.0    1e-04   
ref|XP_006369946.1|  hypothetical protein POPTR_0001s35860g           51.6    2e-04   
ref|XP_006369945.1|  hypothetical protein POPTR_0001s35850g           51.6    2e-04   
ref|XP_011014132.1|  PREDICTED: uncharacterized protein LOC105117991  51.6    2e-04   Populus euphratica
ref|XP_011013686.1|  PREDICTED: uncharacterized protein LOC105117652  51.6    2e-04   Populus euphratica
emb|CBI34823.3|  unnamed protein product                              51.6    2e-04   Vitis vinifera
emb|CAN62582.1|  hypothetical protein VITISV_034667                   51.2    2e-04   Vitis vinifera
gb|KJB75975.1|  hypothetical protein B456_012G066400                  51.2    2e-04   Gossypium raimondii
ref|XP_011014351.1|  PREDICTED: uncharacterized protein LOC105118161  51.2    2e-04   Populus euphratica
ref|XP_003633839.2|  PREDICTED: uncharacterized protein LOC100254392  51.2    3e-04   Vitis vinifera
ref|XP_007031665.1|  Uncharacterized protein TCM_017020               50.8    3e-04   
ref|XP_011016134.1|  PREDICTED: uncharacterized protein LOC105119666  50.8    3e-04   Populus euphratica
ref|XP_010660833.1|  PREDICTED: uncharacterized protein LOC100245845  50.4    4e-04   Vitis vinifera
emb|CBI34821.3|  unnamed protein product                              50.4    4e-04   Vitis vinifera
ref|XP_006369948.1|  hypothetical protein POPTR_0001s35900g           50.4    5e-04   Populus trichocarpa [western balsam poplar]
ref|XP_003633822.1|  PREDICTED: uncharacterized protein LOC100249294  50.1    6e-04   Vitis vinifera
ref|XP_011013023.1|  PREDICTED: uncharacterized protein LOC105117152  49.7    7e-04   Populus euphratica
ref|XP_010660832.1|  PREDICTED: uncharacterized protein LOC100268167  49.7    8e-04   Vitis vinifera



>ref|XP_009767734.1| PREDICTED: uncharacterized protein LOC104218849 [Nicotiana sylvestris]
Length=793

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 60/94 (64%), Gaps = 5/94 (5%)
 Frame = +3

Query  345  VNPIPAGRYLRNRRGD--LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAN  518
            +NP    R +  RRGD  L  +S+D  MM H+  TH  D   + VKPLLH IEDI+ RA 
Sbjct  82   INPRTTNR-IHPRRGDHHLFLTSDDNAMMKHIEDTHSPDGRDFDVKPLLHTIEDIVHRAP  140

Query  519  AAIPGHVQTILTQPARLDAILEEKVLHSGLSEVV  620
            AAIPGH+     Q A L+A LEEKV HSGLSE++
Sbjct  141  AAIPGHLHGGQAQ-AHLEA-LEEKVPHSGLSEIL  172



>ref|XP_009622867.1| PREDICTED: uncharacterized protein LOC104114193 [Nicotiana tomentosiformis]
 gb|AFN06073.1| sieve element occlusion protein 2 [Nicotiana tabacum]
Length=786

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 59/94 (63%), Gaps = 6/94 (6%)
 Frame = +3

Query  345  VNPIPAGRYLRNRRGD--LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAN  518
            +NP    R +  RRGD  L  +S+D  MM H+  TH  D   + VKPLLH IEDI+ RA 
Sbjct  76   INPRTPNR-IHPRRGDHHLFLTSDDNAMMKHIEDTHSPDGRDFDVKPLLHTIEDIVHRA-  133

Query  519  AAIPGHVQTILTQPARLDAILEEKVLHSGLSEVV  620
             AIPGH+     Q A L+A LEEKV HSGLSE++
Sbjct  134  PAIPGHLHGGQAQ-AHLEA-LEEKVPHSGLSEIL  165



>ref|XP_010682345.1| PREDICTED: uncharacterized protein LOC104897214 [Beta vulgaris 
subsp. vulgaris]
Length=706

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 38/82 (46%), Positives = 52/82 (63%), Gaps = 6/82 (7%)
 Frame = +3

Query  384  RGD--LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTILTQ  557
            RGD  L +SS+DTTM++ +RATH  D     V+PL H+IEDI  RA   IPG  Q    +
Sbjct  14   RGDRHLFSSSDDTTMLNQLRATHAPDGRDIDVRPLFHIIEDIFHRAAPTIPGSNQG--AE  71

Query  558  PARLDAILEEKVLHSGLSEVVE  623
            P  LDA L++K L +G  +++E
Sbjct  72   P-HLDA-LDDKTLQAGYGDLIE  91



>ref|XP_011012451.1| PREDICTED: uncharacterized protein LOC105116695 [Populus euphratica]
Length=715

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 36/83 (43%), Positives = 48/83 (58%), Gaps = 3/83 (4%)
 Frame = +3

Query  381  RRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAI--PGHVQTILT  554
            R   + +SS+DT MM  ++ATH  D   + VKPLLH++EDI  RA  A+     VQ    
Sbjct  10   RERSMFSSSDDTAMMKQIQATHAPDGREFSVKPLLHIVEDIFLRATPALGMTSIVQQQGA  69

Query  555  QPARLDAILEEKVLHSGLSEVVE  623
              A+LD  LEEK L +G  E +E
Sbjct  70   HQAQLDE-LEEKALQNGFHETIE  91



>ref|XP_004237262.1| PREDICTED: uncharacterized protein LOC101263509 [Solanum lycopersicum]
Length=788

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 54/85 (64%), Gaps = 5/85 (6%)
 Frame = +3

Query  372  LRNRRGD--LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQT  545
            L +RRGD  +  +S+D TMM H+  TH  D   + VKPL+H+IEDI+ RA   I GHV  
Sbjct  86   LPHRRGDHRMFLASDDNTMMKHIEETHIPDGRDFDVKPLVHIIEDIVHRAT-PIAGHVHE  144

Query  546  ILTQPARLDAILEEKVLHSGLSEVV  620
               Q A L A L+EK  HSGL+E++
Sbjct  145  AKVQ-AHLQA-LDEKAPHSGLTEIL  167



>ref|XP_006378256.1| hypothetical protein POPTR_0010s06010g [Populus trichocarpa]
 gb|ERP56053.1| hypothetical protein POPTR_0010s06010g [Populus trichocarpa]
Length=706

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 36/83 (43%), Positives = 48/83 (58%), Gaps = 3/83 (4%)
 Frame = +3

Query  381  RRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAI--PGHVQTILT  554
            R   + +SS+DT MM  ++ATH  D   + VKPLLH++EDI  RA  A+     VQ    
Sbjct  10   RERSMFSSSDDTAMMKQIQATHAPDGREFPVKPLLHIVEDIFLRATPALGMTSIVQQQGA  69

Query  555  QPARLDAILEEKVLHSGLSEVVE  623
              A+LD  LEEK L +G  E +E
Sbjct  70   HQAQLDE-LEEKALQNGFHETIE  91



>ref|XP_006378261.1| hypothetical protein POPTR_0010s060502g, partial [Populus trichocarpa]
 gb|ERP56058.1| hypothetical protein POPTR_0010s060502g, partial [Populus trichocarpa]
Length=340

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 48/83 (58%), Gaps = 3/83 (4%)
 Frame = +3

Query  381  RRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAI--PGHVQTILT  554
            R   + +SS+DT MM  ++ATH  D   + VKPLLH++EDI  RA  A+     VQ    
Sbjct  13   RERSMFSSSDDTAMMKQIQATHAPDGREFSVKPLLHIVEDIFLRATPALGMTSIVQQQGA  72

Query  555  QPARLDAILEEKVLHSGLSEVVE  623
              A+LD  LEEK L +G  E +E
Sbjct  73   HQAQLDE-LEEKALQNGFHETIE  94



>ref|XP_004239152.1| PREDICTED: uncharacterized protein LOC101249174 [Solanum lycopersicum]
Length=795

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 54/85 (64%), Gaps = 5/85 (6%)
 Frame = +3

Query  372  LRNRRGD--LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQT  545
            L +RRGD  +  +S+D  MM H+  TH  D   + VKPL+H+IEDI+ RA   I GHV  
Sbjct  93   LPHRRGDHHMFLTSDDNAMMKHIEETHIPDGRDFDVKPLVHIIEDIVHRA-TPIAGHVHE  151

Query  546  ILTQPARLDAILEEKVLHSGLSEVV  620
               Q A L+A LEEK  HSGL++++
Sbjct  152  AKVQ-AHLEA-LEEKAPHSGLTDIL  174



>gb|KDP26703.1| hypothetical protein JCGZ_17861 [Jatropha curcas]
Length=709

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 50/81 (62%), Gaps = 8/81 (10%)
 Frame = +3

Query  393  LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL----TQP  560
            + +SS+D TMM  ++ATH  D   + VKPLLH++EDI  RA    P  + T++       
Sbjct  15   MFSSSDDNTMMKQIQATHAPDGREFAVKPLLHVVEDIFQRAK---PTGLATLVHHQGAHQ  71

Query  561  ARLDAILEEKVLHSGLSEVVE  623
            A+LDA LEEK L +G  E++E
Sbjct  72   AQLDA-LEEKALQNGFYEMLE  91



>ref|XP_006483988.1| PREDICTED: uncharacterized protein LOC102625551 [Citrus sinensis]
Length=706

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 36/89 (40%), Positives = 54/89 (61%), Gaps = 9/89 (10%)
 Frame = +3

Query  357  PAGRYLRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGH  536
            PAGR        + A+S+D  M+  V+ATH  D   + VKPLL++IEDI  RA  + PG 
Sbjct  12   PAGR-----ERHMFATSDDNAMLRQVQATHAPDGREFNVKPLLYIIEDIFQRAAPSFPGF  66

Query  537  VQTILTQPARLDAILEEKVLHSGLSEVVE  623
            +Q   TQ A+LD +L++K   SG  ++++
Sbjct  67   IQE--TQ-AQLD-VLDDKAFQSGFFDMLD  91



>ref|XP_006438201.1| hypothetical protein CICLE_v10030843mg [Citrus clementina]
 gb|ESR51441.1| hypothetical protein CICLE_v10030843mg [Citrus clementina]
Length=706

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 36/89 (40%), Positives = 54/89 (61%), Gaps = 9/89 (10%)
 Frame = +3

Query  357  PAGRYLRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGH  536
            PAGR        + A+S+D  M+  V+ATH  D   + VKPLL++IEDI  RA  + PG 
Sbjct  12   PAGR-----ERHMFATSDDNAMLRQVQATHAPDGREFNVKPLLYIIEDIFQRAAPSFPGF  66

Query  537  VQTILTQPARLDAILEEKVLHSGLSEVVE  623
            +Q   TQ A+LD +L++K   SG  ++++
Sbjct  67   IQE--TQ-AQLD-VLDDKAFQSGFFDMLD  91



>gb|KDO82145.1| hypothetical protein CISIN_1g005245mg [Citrus sinensis]
Length=706

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 33/81 (41%), Positives = 51/81 (63%), Gaps = 4/81 (5%)
 Frame = +3

Query  381  RRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTILTQP  560
            R   + A+S+D  M+  V+ATH  D   + VKPLL++IEDI  RA  + PG +Q   TQ 
Sbjct  15   RERHMFATSDDNAMLRQVQATHAPDGREFNVKPLLYIIEDIFQRAAPSFPGFIQE--TQ-  71

Query  561  ARLDAILEEKVLHSGLSEVVE  623
            A+LD +L++K   SG  ++++
Sbjct  72   AQLD-VLDDKAFQSGFFDMLD  91



>gb|ADN32812.1| sieve element occlusion c [Solanum phureja]
Length=818

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 52/83 (63%), Gaps = 5/83 (6%)
 Frame = +3

Query  378  NRRGD--LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  551
            +RRGD  +  +S+D  MM H+  TH  D   + VKPL+H+IEDI+ RA   I G V    
Sbjct  118  HRRGDHHMFLTSDDNAMMKHIVETHIPDGRDFDVKPLVHIIEDIVHRA-TPIAGRVHEAK  176

Query  552  TQPARLDAILEEKVLHSGLSEVV  620
             Q A L+A LEEK  HSGL+E++
Sbjct  177  VQ-AHLEA-LEEKAPHSGLTEIL  197



>ref|XP_006341794.1| PREDICTED: uncharacterized protein LOC102602329 [Solanum tuberosum]
Length=811

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 52/83 (63%), Gaps = 5/83 (6%)
 Frame = +3

Query  378  NRRGD--LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  551
            +RRGD  +  +S+D  MM H+  TH  D   + VKPL+H+IEDI+ RA   I G V    
Sbjct  111  HRRGDHHMFLTSDDNAMMKHIVETHIPDGRDFDVKPLVHIIEDIVHRA-TPIAGRVHEAK  169

Query  552  TQPARLDAILEEKVLHSGLSEVV  620
             Q A L+A LEEK  HSGL+E++
Sbjct  170  VQ-AHLEA-LEEKAPHSGLTEIL  190



>ref|XP_004239153.1| PREDICTED: uncharacterized protein LOC101249457 isoform X1 [Solanum 
lycopersicum]
Length=789

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 52/85 (61%), Gaps = 5/85 (6%)
 Frame = +3

Query  372  LRNRRGD--LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQT  545
            L +RRGD  +  +S+D  MM H+  TH  D   + VKPL+H+IEDI+ RA   I GHV  
Sbjct  87   LPHRRGDHHMFLTSDDNAMMKHIEETHIPDGRDFDVKPLVHIIEDIVHRA-TPIAGHVHE  145

Query  546  ILTQPARLDAILEEKVLHSGLSEVV  620
               Q A L+A LEEK  H+ L E++
Sbjct  146  AKVQ-AHLEA-LEEKAPHNELIEIL  168



>gb|ADN32811.1| sieve element occlusion b [Solanum phureja]
Length=823

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 50/82 (61%), Gaps = 5/82 (6%)
 Frame = +3

Query  381  RRGD--LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTILT  554
            RRGD  +  +S+D  MM H+  TH  D   + VKPL+ +IEDI+ RA   I G V     
Sbjct  123  RRGDHHMFLTSDDNAMMRHIEETHIPDGRDFDVKPLVDIIEDIVHRA-TPIAGRVHEAKV  181

Query  555  QPARLDAILEEKVLHSGLSEVV  620
            Q A L+A LEEK  HSGL+E++
Sbjct  182  Q-AHLEA-LEEKAPHSGLTELL  201



>ref|XP_007159683.1| hypothetical protein PHAVU_002G258300g [Phaseolus vulgaris]
 gb|ESW31677.1| hypothetical protein PHAVU_002G258300g [Phaseolus vulgaris]
Length=702

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 51/78 (65%), Gaps = 4/78 (5%)
 Frame = +3

Query  390  DLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTILTQPARL  569
            ++ ++S+DTTM  +VRATH  D  H +V+PLL++++DI+ R  + IP  VQ    +P + 
Sbjct  15   NIFSASDDTTMTKNVRATHAPDDRHVEVRPLLNVVQDILHRVASLIPDIVQ---GKPVQT  71

Query  570  DAILEEKVLHSGLSEVVE  623
             A+ E+    S L+EV++
Sbjct  72   GAV-EDSNHQSDLAEVLD  88



>emb|CAN65891.1| hypothetical protein VITISV_041167 [Vitis vinifera]
Length=693

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 31/77 (40%), Positives = 45/77 (58%), Gaps = 4/77 (5%)
 Frame = +3

Query  393  LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTILTQPARLD  572
             L  S+DTTMM  ++ATH  D    +VKP++ +IEDI+  A  AI G   T+   P  L+
Sbjct  25   FLRMSDDTTMMKQIQATHTPDGREVEVKPIVQVIEDILNHATPAIDG---TLYGNPXHLE  81

Query  573  AILEEKVLHSGLSEVVE  623
            A LE++    GL  ++E
Sbjct  82   A-LEDRSSQDGLXGILE  97



>ref|XP_010663068.1| PREDICTED: uncharacterized protein LOC100243366 [Vitis vinifera]
Length=706

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 31/77 (40%), Positives = 45/77 (58%), Gaps = 4/77 (5%)
 Frame = +3

Query  393  LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTILTQPARLD  572
             L  S+DTTMM  ++ATH  D    +VKP++ +IEDI+  A  AI G   T+   P  L+
Sbjct  25   FLRMSDDTTMMKQIQATHTPDGREVEVKPIVQVIEDILNHATPAIDG---TLYGNPPHLE  81

Query  573  AILEEKVLHSGLSEVVE  623
            A LE++    GL  ++E
Sbjct  82   A-LEDRSSQDGLHGILE  97



>emb|CBI14908.3| unnamed protein product [Vitis vinifera]
Length=708

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 31/77 (40%), Positives = 45/77 (58%), Gaps = 4/77 (5%)
 Frame = +3

Query  393  LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTILTQPARLD  572
             L  S+DTTMM  ++ATH  D    +VKP++ +IEDI+  A  AI G   T+   P  L+
Sbjct  25   FLRMSDDTTMMKQIQATHTPDGREVEVKPIVQVIEDILNHATPAIDG---TLYGNPPHLE  81

Query  573  AILEEKVLHSGLSEVVE  623
            A LE++    GL  ++E
Sbjct  82   A-LEDRSSQDGLHGILE  97



>gb|KHN29013.1| hypothetical protein glysoja_008348 [Glycine soja]
Length=696

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/77 (38%), Positives = 49/77 (64%), Gaps = 4/77 (5%)
 Frame = +3

Query  393  LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTILTQPARLD  572
            + ++S+DTTM  ++RATH     H  V+PLLH+++DI  RA + IPG VQ    +  ++D
Sbjct  9    IFSASDDTTMTKNIRATHAPVDGHIGVRPLLHVVQDIFHRAASLIPGIVQ---GKQVQMD  65

Query  573  AILEEKVLHSGLSEVVE  623
            A +++    S L+ V++
Sbjct  66   A-MKDSAYQSDLANVID  81



>ref|XP_011034021.1| PREDICTED: uncharacterized protein LOC105132310 [Populus euphratica]
Length=706

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 32/83 (39%), Positives = 49/83 (59%), Gaps = 3/83 (4%)
 Frame = +3

Query  381  RRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAA--IPGHVQTILT  554
            R   + A+S++  MM  ++ATH  D   + VK LLH++EDI  R  +A  I   VQ   +
Sbjct  10   RERTVFAASDENVMMKQIQATHAPDGREFSVKLLLHIVEDIFHRTTSAPGITDFVQHQGS  69

Query  555  QPARLDAILEEKVLHSGLSEVVE  623
              A+L   LEEKVL +G +E+++
Sbjct  70   HQAQLYE-LEEKVLQNGFNEMID  91



>ref|NP_001240968.1| uncharacterized protein LOC100799626 [Glycine max]
 gb|ADN32787.1| sieve element occlusion e [Glycine max]
Length=703

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/77 (38%), Positives = 49/77 (64%), Gaps = 4/77 (5%)
 Frame = +3

Query  393  LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTILTQPARLD  572
            + ++S+DTTM  ++RATH     H  V+PLLH+++DI  RA + IPG VQ    +  ++D
Sbjct  16   IFSASDDTTMTKNIRATHAPVDGHIGVRPLLHVVQDIFHRAASLIPGIVQ---GKQVQMD  72

Query  573  AILEEKVLHSGLSEVVE  623
            A +++    S L+ V++
Sbjct  73   A-MKDSAYQSDLANVID  88



>gb|KJB75974.1| hypothetical protein B456_012G066300 [Gossypium raimondii]
Length=807

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 49/85 (58%), Gaps = 4/85 (5%)
 Frame = +3

Query  372  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  551
            +R+ RG +L+ S+D  MM  + ATH  D   + V+PLL+L+EDI+ RA+     HV  ++
Sbjct  102  IRSDRGSMLSLSDDNVMMKQILATHAPDGREFDVRPLLNLVEDILNRASQ----HVDFLV  157

Query  552  TQPARLDAILEEKVLHSGLSEVVEA  626
                +    +EEK L +    ++EA
Sbjct  158  KGTTQAQIEMEEKALQANHIVMLEA  182



>ref|XP_010320950.1| PREDICTED: uncharacterized protein LOC101249457 isoform X2 [Solanum 
lycopersicum]
Length=694

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 46/76 (61%), Gaps = 3/76 (4%)
 Frame = +3

Query  393  LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTILTQPARLD  572
            +  +S+D  MM H+  TH  D   + VKPL+H+IEDI+ RA   I GHV     Q A L+
Sbjct  1    MFLTSDDNAMMKHIEETHIPDGRDFDVKPLVHIIEDIVHRAT-PIAGHVHEAKVQ-AHLE  58

Query  573  AILEEKVLHSGLSEVV  620
            A LEEK  H+ L E++
Sbjct  59   A-LEEKAPHNELIEIL  73



>ref|XP_006378263.1| hypothetical protein POPTR_0010s06060g [Populus trichocarpa]
 gb|ERP56060.1| hypothetical protein POPTR_0010s06060g [Populus trichocarpa]
Length=685

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 23/49 (47%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +3

Query  381  RRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAI  527
            R   + +SS+DT MM  ++ATH  D   + VKPLLH++EDI  RA  A+
Sbjct  9    RERSMFSSSDDTAMMKQIQATHAPDGREFSVKPLLHIVEDIFLRAAPAL  57



>gb|KHG12713.1| hypothetical protein F383_04328 [Gossypium arboreum]
Length=762

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 38/62 (61%), Gaps = 0/62 (0%)
 Frame = +3

Query  372  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  551
            +R  RG +L+ S+D  MM+ + ATH  D   + V+PLL+L+EDI+ RA   +   V+  L
Sbjct  143  IRGDRGSMLSMSDDNVMMNQILATHAPDGREFDVRPLLYLVEDILNRATQHVDFLVKGTL  202

Query  552  TQ  557
             Q
Sbjct  203  DQ  204



>ref|XP_006379953.1| hypothetical protein POPTR_0008s18360g [Populus trichocarpa]
 gb|ERP57750.1| hypothetical protein POPTR_0008s18360g [Populus trichocarpa]
Length=706

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 30/83 (36%), Positives = 47/83 (57%), Gaps = 3/83 (4%)
 Frame = +3

Query  381  RRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTILTQP  560
            R   + A+S++  MM  ++ATH  D   + VK LL ++EDI  RA  A PG    +  Q 
Sbjct  10   RERTVFAASDENVMMKQIQATHAPDGREFSVKLLLQIVEDIFHRATPA-PGITDFVQHQG  68

Query  561  ARLDAI--LEEKVLHSGLSEVVE  623
            +    +  LEEKVL +G +E+++
Sbjct  69   SHQAQLYELEEKVLQNGFNEMID  91



>ref|XP_002298572.2| hypothetical protein POPTR_0001s35880g [Populus trichocarpa]
 gb|EEE83377.2| hypothetical protein POPTR_0001s35880g [Populus trichocarpa]
Length=723

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 28/85 (33%), Positives = 45/85 (53%), Gaps = 5/85 (6%)
 Frame = +3

Query  372  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  551
            +++ RG +L  S+D  MM+ +  TH  D     VKPLL L+EDI+ RA   I   + T  
Sbjct  21   IKSDRGSMLTMSDDNVMMNQIVGTHAPDGREVDVKPLLLLVEDILKRATLQIDSSLTT--  78

Query  552  TQPARLDAILEEKVLHSGLSEVVEA  626
               ++  A +E+K  H     +++A
Sbjct  79   ---SKAHAEMEDKTYHVNFVSMLDA  100



>ref|XP_011014801.1| PREDICTED: uncharacterized protein LOC105118522 isoform X2 [Populus 
euphratica]
Length=722

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 44/85 (52%), Gaps = 5/85 (6%)
 Frame = +3

Query  372  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  551
            +++ RG +L  S+D  MM  +  TH  D     VKPLLHL+EDI+ RA   I   + T  
Sbjct  21   IKSDRGSMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLHLVEDILKRATLQIDSSLTT--  78

Query  552  TQPARLDAILEEKVLHSGLSEVVEA  626
               ++  A LE+K        +++A
Sbjct  79   ---SQAHAELEDKTHQVNFVSMLDA  100



>ref|XP_011014800.1| PREDICTED: uncharacterized protein LOC105118522 isoform X1 [Populus 
euphratica]
Length=722

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 44/85 (52%), Gaps = 5/85 (6%)
 Frame = +3

Query  372  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  551
            +++ RG +L  S+D  MM  +  TH  D     VKPLLHL+EDI+ RA   I   + T  
Sbjct  21   IKSDRGSMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLHLVEDILKRATLQIDSSLTT--  78

Query  552  TQPARLDAILEEKVLHSGLSEVVEA  626
               ++  A LE+K        +++A
Sbjct  79   ---SQAHAELEDKTHQVNFVSMLDA  100



>ref|XP_002298571.2| hypothetical protein POPTR_0001s35870g [Populus trichocarpa]
 gb|EEE83376.2| hypothetical protein POPTR_0001s35870g [Populus trichocarpa]
Length=723

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 44/85 (52%), Gaps = 5/85 (6%)
 Frame = +3

Query  372  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  551
            +++ RG +L  S+D  MM  +  TH  D     VKPLLHL+EDI+ RA   I   + T  
Sbjct  21   IKSDRGSMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLHLVEDILKRATQQIDTSLTT--  78

Query  552  TQPARLDAILEEKVLHSGLSEVVEA  626
               ++  A LE+K        +++A
Sbjct  79   ---SQAHAELEDKTHQVNFVSMLDA  100



>ref|XP_006369946.1| hypothetical protein POPTR_0001s35860g [Populus trichocarpa]
 gb|ERP66515.1| hypothetical protein POPTR_0001s35860g [Populus trichocarpa]
Length=722

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 44/85 (52%), Gaps = 5/85 (6%)
 Frame = +3

Query  372  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  551
            +++ RG +L  S+D  MM  +  TH  D     VKPLLHL+EDI+ RA   I   + T  
Sbjct  21   IKSDRGSMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLHLVEDILKRATQQIDTSLTT--  78

Query  552  TQPARLDAILEEKVLHSGLSEVVEA  626
               ++  A LE+K        +++A
Sbjct  79   ---SQAHAELEDKTHQVNFVSMLDA  100



>ref|XP_006369945.1| hypothetical protein POPTR_0001s35850g [Populus trichocarpa]
 gb|ERP66514.1| hypothetical protein POPTR_0001s35850g [Populus trichocarpa]
Length=722

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 44/85 (52%), Gaps = 5/85 (6%)
 Frame = +3

Query  372  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  551
            +++ RG +L  S+D  MM  +  TH  D     VKPLLHL+EDI+ RA   I   + T  
Sbjct  21   IKSDRGSMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLHLVEDILKRATQQIDTSLTT--  78

Query  552  TQPARLDAILEEKVLHSGLSEVVEA  626
               ++  A LE+K        +++A
Sbjct  79   ---SQAHAELEDKTHQVNFVSMLDA  100



>ref|XP_011014132.1| PREDICTED: uncharacterized protein LOC105117991 [Populus euphratica]
Length=723

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 43/85 (51%), Gaps = 5/85 (6%)
 Frame = +3

Query  372  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  551
            +++ RG +L  S+D  MM  +  TH  D     VKPLL L+EDI+ RA   I   + T  
Sbjct  21   IKSDRGSMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLLLVEDILKRATLQIDSSLTTSQ  80

Query  552  TQPARLDAILEEKVLHSGLSEVVEA  626
             Q     A +E+K  H     +++A
Sbjct  81   AQ-----AEMEDKTYHVNFVSMLDA  100



>ref|XP_011013686.1| PREDICTED: uncharacterized protein LOC105117652 [Populus euphratica]
Length=723

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 44/85 (52%), Gaps = 5/85 (6%)
 Frame = +3

Query  372  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  551
            +++ RG +L  S+D  MM  +  TH  D     VKPLLHL+EDI+ RA   I   + T  
Sbjct  21   IKSDRGTMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLHLVEDILKRATQQIDTSLTT--  78

Query  552  TQPARLDAILEEKVLHSGLSEVVEA  626
               ++  A LE+K        +++A
Sbjct  79   ---SQAHAELEDKTHQVNFVSMLDA  100



>emb|CBI34823.3| unnamed protein product [Vitis vinifera]
Length=1392

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/61 (38%), Positives = 35/61 (57%), Gaps = 1/61 (2%)
 Frame = +3

Query  345  VNPIPAGRYLRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAA  524
            +NP+P  +  R+ R  ++  S+D  MM  + ATH  D   + VKPL  L+EDI+ RA   
Sbjct  55   INPVPLHQLTRHDR-SMITMSDDNIMMKQIHATHAPDGREFDVKPLFQLVEDILNRATPG  113

Query  525  I  527
            +
Sbjct  114  V  114



>emb|CAN62582.1| hypothetical protein VITISV_034667 [Vitis vinifera]
Length=802

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/61 (38%), Positives = 35/61 (57%), Gaps = 1/61 (2%)
 Frame = +3

Query  345  VNPIPAGRYLRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAA  524
            +NP+P  +  R+ R  ++  S+D  MM  + ATH  D   + VKPL  L+EDI+ RA   
Sbjct  55   INPVPLHQLTRHDR-SMITMSDDNIMMKQIHATHAPDGREFDVKPLFQLVEDILNRATPG  113

Query  525  I  527
            +
Sbjct  114  V  114



>gb|KJB75975.1| hypothetical protein B456_012G066400 [Gossypium raimondii]
Length=865

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 37/62 (60%), Gaps = 0/62 (0%)
 Frame = +3

Query  372  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  551
            +R  RG +L+ S+D  MM+ +  TH  D   + V+PLL+L+EDI+ RA   +   V+  L
Sbjct  161  IRGDRGSMLSMSDDNVMMNQILTTHAPDGREFDVRPLLYLVEDILNRATQHVDFLVKGTL  220

Query  552  TQ  557
             Q
Sbjct  221  DQ  222



>ref|XP_011014351.1| PREDICTED: uncharacterized protein LOC105118161 [Populus euphratica]
Length=722

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 43/85 (51%), Gaps = 5/85 (6%)
 Frame = +3

Query  372  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  551
            ++  RG +L  S+D  MM  +  TH  D     VKPLLHL+EDI+ RA   I   + T  
Sbjct  21   IKGDRGSMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLHLVEDILKRATQQIDTSLTT--  78

Query  552  TQPARLDAILEEKVLHSGLSEVVEA  626
               ++  A LE+K        +++A
Sbjct  79   ---SQAHAELEDKTHQINFVSMLDA  100



>ref|XP_003633839.2| PREDICTED: uncharacterized protein LOC100254392 [Vitis vinifera]
Length=766

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/61 (38%), Positives = 35/61 (57%), Gaps = 1/61 (2%)
 Frame = +3

Query  345  VNPIPAGRYLRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAA  524
            +NP+P  +  R+ R  ++  S+D  MM  + ATH  D   + VKPL  L+EDI+ RA   
Sbjct  55   INPVPLHQLTRHDR-SMITMSDDNIMMKQIHATHAPDGREFDVKPLFQLVEDILNRATPG  113

Query  525  I  527
            +
Sbjct  114  V  114



>ref|XP_007031665.1| Uncharacterized protein TCM_017020 [Theobroma cacao]
 gb|EOY02591.1| Uncharacterized protein TCM_017020 [Theobroma cacao]
Length=814

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 45/85 (53%), Gaps = 5/85 (6%)
 Frame = +3

Query  372  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  551
            +R+ RG +L+ S+D  MM  +  TH  D     V+PLL+L+EDI+ RA   +   V+  L
Sbjct  110  IRSDRGSMLSMSDDNVMMKQIMTTHAPDGREVDVRPLLYLVEDILNRATQHVDFLVKGTL  169

Query  552  TQPARLDAILEEKVLHSGLSEVVEA  626
             Q       LEEK   +    ++EA
Sbjct  170  AQIE-----LEEKAQQANYIAMLEA  189



>ref|XP_011016134.1| PREDICTED: uncharacterized protein LOC105119666 [Populus euphratica]
Length=724

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 44/85 (52%), Gaps = 4/85 (5%)
 Frame = +3

Query  372  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  551
            +++ RG +L  S+D  MM  +  TH  D     VKPLL L+EDI+ RA   I   + T  
Sbjct  21   IKSDRGSMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLLLVEDILKRATLQIDSSLTTS-  79

Query  552  TQPARLDAILEEKVLHSGLSEVVEA  626
              PA ++   E+K  H     +++A
Sbjct  80   QAPAEME---EDKTYHVNFVSMLDA  101



>ref|XP_010660833.1| PREDICTED: uncharacterized protein LOC100245845 [Vitis vinifera]
Length=712

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 29/92 (32%), Positives = 48/92 (52%), Gaps = 5/92 (5%)
 Frame = +3

Query  351  PIPAGRYLRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIP  530
            PI   + ++  R  ++  S+D  MM  + ATH  D     V+PL  L+EDI+   N + P
Sbjct  3    PISLQQMIKGDR-SMITMSDDNAMMKQIHATHAHDGRQIDVRPLYQLVEDIL---NRSTP  58

Query  531  GHVQTILTQPARLDAILEEKVLHSGLSEVVEA  626
            G    + T   R++  LE++  H+G   ++EA
Sbjct  59   GVDAIVTTTETRVEP-LEDRTQHAGFIAMIEA  89



>emb|CBI34821.3| unnamed protein product [Vitis vinifera]
Length=1487

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 29/92 (32%), Positives = 48/92 (52%), Gaps = 5/92 (5%)
 Frame = +3

Query  351  PIPAGRYLRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIP  530
            PI   + ++  R  ++  S+D  MM  + ATH  D     V+PL  L+EDI+   N + P
Sbjct  848  PISLQQMIKGDR-SMITMSDDNAMMKQIHATHAHDGRQIDVRPLYQLVEDIL---NRSTP  903

Query  531  GHVQTILTQPARLDAILEEKVLHSGLSEVVEA  626
            G    + T   R++  LE++  H+G   ++EA
Sbjct  904  GVDAIVTTTETRVEP-LEDRTQHAGFIAMIEA  934


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 36/61 (59%), Gaps = 1/61 (2%)
 Frame = +3

Query  345  VNPIPAGRYLRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAA  524
            +NP+P  + +++ R  ++  S+D  M+  + ATH  D   + VKPL  L+EDI+ RA   
Sbjct  78   INPVPLQQLIKHDR-SMITMSDDNIMVKQIHATHAPDGREFDVKPLFQLVEDILNRATPG  136

Query  525  I  527
            +
Sbjct  137  V  137



>ref|XP_006369948.1| hypothetical protein POPTR_0001s35900g [Populus trichocarpa]
 gb|ERP66517.1| hypothetical protein POPTR_0001s35900g [Populus trichocarpa]
Length=722

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 28/85 (33%), Positives = 44/85 (52%), Gaps = 5/85 (6%)
 Frame = +3

Query  372  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  551
            +++ RG +L  S+D  MM  +  TH  D     VKPLL L+EDI+ RA   I   + T  
Sbjct  20   IKSDRGSMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLLLVEDILKRATLQIDSSLTT--  77

Query  552  TQPARLDAILEEKVLHSGLSEVVEA  626
               ++  A +E+K  H     +++A
Sbjct  78   ---SQAHAEMEDKTSHVNFVSMLDA  99



>ref|XP_003633822.1| PREDICTED: uncharacterized protein LOC100249294 [Vitis vinifera]
Length=752

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 36/61 (59%), Gaps = 1/61 (2%)
 Frame = +3

Query  345  VNPIPAGRYLRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAA  524
            +NP+P  + +++ R  ++  S+D  M+  + ATH  D   + VKPL  L+EDI+ RA   
Sbjct  41   INPVPLQKLIKHDR-SMITMSDDNMMVKQIHATHAPDGREFDVKPLFQLVEDILNRATPG  99

Query  525  I  527
            +
Sbjct  100  V  100



>ref|XP_011013023.1| PREDICTED: uncharacterized protein LOC105117152 [Populus euphratica]
Length=724

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 44/85 (52%), Gaps = 4/85 (5%)
 Frame = +3

Query  372  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  551
            +++ RG +L  S+D  MM  +  TH  D     VKPLL L+EDI+ RA   I   + T  
Sbjct  21   IKSDRGSMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLLLVEDILKRATLQIDSSL-TNS  79

Query  552  TQPARLDAILEEKVLHSGLSEVVEA  626
              PA ++   E+K  H     +++A
Sbjct  80   QAPAEME---EDKTYHVNFVSMLDA  101



>ref|XP_010660832.1| PREDICTED: uncharacterized protein LOC100268167 [Vitis vinifera]
Length=743

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 36/61 (59%), Gaps = 1/61 (2%)
 Frame = +3

Query  345  VNPIPAGRYLRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAA  524
            +NP+P  + +++ R  ++  S+D  M+  + ATH  D   + VKPL  L+EDI+ RA   
Sbjct  32   INPVPLQQLIKHDR-SMITMSDDNIMVKQIHATHAPDGREFDVKPLFQLVEDILNRATPG  90

Query  525  I  527
            +
Sbjct  91   V  91



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250