BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS065H06

Length=642
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAI47574.1|  zeta-carotene desaturase                               288   4e-90   Ipomoea sp. Kenyan
ref|XP_010323855.1|  PREDICTED: zeta-carotene desaturase, chlorop...    262   2e-81   
gb|AIX87520.1|  zeta-carotene desaturase                                265   3e-81   Lycium ruthenicum
gb|AHA58685.1|  zeta-carotene desaturase                                264   5e-81   Nicotiana tabacum [American tobacco]
gb|AEG73891.1|  zeta-carotene desaturase                                264   5e-81   Nicotiana tabacum [American tobacco]
ref|XP_009588416.1|  PREDICTED: zeta-carotene desaturase, chlorop...    264   5e-81   Nicotiana tomentosiformis
ref|XP_009792956.1|  PREDICTED: zeta-carotene desaturase, chlorop...    264   5e-81   Nicotiana sylvestris
gb|AGO05927.1|  plastid zeta-carotene desaturase                        263   9e-81   Solanum lycopersicum
gb|ABR57231.1|  zeta-carotene desaturase                                263   1e-80   Solanum lycopersicum
ref|NP_001234383.1|  zeta-carotene desaturase, chloroplastic/chro...    263   1e-80   
gb|ABD67160.1|  zeta-carotene desaturase                                263   1e-80   Solanum lycopersicum
ref|XP_006347795.1|  PREDICTED: zeta-carotene desaturase, chlorop...    263   1e-80   
sp|Q9SMJ3.1|ZDS_CAPAN  RecName: Full=Zeta-carotene desaturase, ch...    261   5e-80   Capsicum annuum
prf||2121278A  zeta carotene desaturase                                 261   5e-80
gb|AIX87496.1|  zeta-carotene desaturase                                261   7e-80   Lycium barbarum [Duke of Argyll's teatree]
gb|AGN03856.1|  zeta-carotene desaturase                                258   1e-78   Scutellaria baicalensis [Baikal skullcap]
gb|AAT76050.1|  zeta-carotene desaturase                                247   3e-78   Citrus clementina [clementine]
emb|CAD55814.2|  putative zeta-carotene desaturase                      256   5e-78   Helianthus annuus
gb|AHA36972.1|  zeta-carotene desaturase                                254   3e-77   Helianthus annuus
emb|CAD27442.1|  putative zeta-carotene desaturase                      254   4e-77   Helianthus annuus
gb|ABB52070.1|  putative zeta carotene desaturase                       253   6e-77   Daucus carota subsp. sativus
emb|CBI34203.3|  unnamed protein product                                252   7e-77   Vitis vinifera
gb|KEH43038.1|  zeta-carotene desaturase                                249   1e-76   Medicago truncatula
emb|CDP08546.1|  unnamed protein product                                253   1e-76   Coffea canephora [robusta coffee]
sp|Q9FV46.1|ZDS_TARER  RecName: Full=Zeta-carotene desaturase, ch...    253   1e-76   Tagetes erecta [big marigold]
emb|CAN65781.1|  hypothetical protein VITISV_010561                     252   1e-76   Vitis vinifera
ref|XP_002277348.2|  PREDICTED: zeta-carotene desaturase, chlorop...    252   2e-76   Vitis vinifera
gb|AFP28797.1|  zeta-carotene desaturase 1                              251   3e-76   Vitis vinifera
ref|XP_002319628.1|  hypothetical protein POPTR_0013s03470g             251   3e-76   
dbj|BAE79555.1|  zeta-carotene desaturase                               251   5e-76   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_010025059.1|  PREDICTED: zeta-carotene desaturase, chlorop...    251   5e-76   Eucalyptus grandis [rose gum]
ref|XP_010041364.1|  PREDICTED: zeta-carotene desaturase, chlorop...    251   6e-76   Eucalyptus grandis [rose gum]
gb|AAK51557.1|AF372617_1  zeta-carotene desaturase precursor            250   7e-76   Citrus x paradisi [grapefruit]
dbj|BAA88843.1|  zeta-Carotene Desaturase                               251   7e-76   Gentiana lutea
ref|XP_004495784.1|  PREDICTED: zeta-carotene desaturase, chlorop...    250   8e-76   Cicer arietinum [garbanzo]
gb|KEH43037.1|  zeta-carotene desaturase                                249   1e-75   Medicago truncatula
gb|ACE79169.1|  zeta carotene desaturase                                249   1e-75   Citrus maxima [buntan]
gb|KJB82544.1|  hypothetical protein B456_013G201600                    249   1e-75   Gossypium raimondii
ref|XP_003591015.1|  Zeta-carotene desaturase                           250   1e-75   
ref|NP_001275793.1|  ZDS                                                249   1e-75   Citrus sinensis [apfelsine]
gb|KHG06842.1|  Zeta-carotene desaturase, chloroplastic/chromopla...    249   1e-75   Gossypium arboreum [tree cotton]
gb|AES61266.2|  zeta-carotene desaturase                                249   2e-75   Medicago truncatula
dbj|BAB68552.1|  zeta-carotene desaturase                               249   2e-75   Citrus unshiu [satsuma mandarin]
gb|ABC33728.1|  zeta-carotene desaturase                                248   3e-75   Citrus unshiu [satsuma mandarin]
ref|XP_007030628.1|  Zeta-carotene desaturase                           249   3e-75   
ref|XP_011032463.1|  PREDICTED: zeta-carotene desaturase, chlorop...    249   3e-75   Populus euphratica
ref|XP_006382767.1|  hypothetical protein POPTR_0005s05230g             249   4e-75   Populus trichocarpa [western balsam poplar]
gb|AEW70738.1|  zeta-carotene desaturase                                249   4e-75   Ficus carica
gb|KJB45011.1|  hypothetical protein B456_007G284900                    243   5e-75   Gossypium raimondii
gb|KJB45012.1|  hypothetical protein B456_007G284900                    244   5e-75   Gossypium raimondii
gb|KDP23635.1|  hypothetical protein JCGZ_23468                         248   5e-75   Jatropha curcas
gb|KJB45013.1|  hypothetical protein B456_007G284900                    244   5e-75   Gossypium raimondii
gb|AFK39985.1|  unknown                                                 248   6e-75   Medicago truncatula
gb|ACO40527.1|  zeta-carotene desaturase                                248   7e-75   Carica papaya [mamon]
ref|XP_011091935.1|  PREDICTED: zeta-carotene desaturase, chlorop...    248   8e-75   Sesamum indicum [beniseed]
gb|AFH53817.1|  zeta-carotene desaturase                                247   1e-74   Narcissus tazetta subsp. chinensis
ref|XP_004142522.1|  PREDICTED: zeta-carotene desaturase, chlorop...    247   1e-74   Cucumis sativus [cucumbers]
ref|XP_010550937.1|  PREDICTED: zeta-carotene desaturase, chlorop...    247   1e-74   Tarenaya hassleriana [spider flower]
sp|O49901.1|ZDS_NARPS  RecName: Full=Zeta-carotene desaturase, ch...    247   1e-74   Narcissus pseudonarcissus
gb|ACB87206.1|  zeta-carotene desaturase                                247   1e-74   Narcissus tazetta subsp. chinensis
ref|XP_008462722.1|  PREDICTED: zeta-carotene desaturase, chlorop...    247   2e-74   
gb|ACR61394.1|  zeta-carotene desaturase protein                        246   2e-74   Fragaria x ananassa
ref|XP_010256023.1|  PREDICTED: zeta-carotene desaturase, chlorop...    246   2e-74   Nelumbo nucifera [Indian lotus]
gb|AJB84621.1|  zeta-carotene desaturase                                246   2e-74   Camellia sinensis [black tea]
ref|XP_004155720.1|  PREDICTED: LOW QUALITY PROTEIN: zeta-caroten...    247   3e-74   
ref|XP_010256022.1|  PREDICTED: zeta-carotene desaturase, chlorop...    246   3e-74   Nelumbo nucifera [Indian lotus]
ref|XP_008218201.1|  PREDICTED: zeta-carotene desaturase, chlorop...    246   3e-74   Prunus mume [ume]
gb|AEK86566.1|  chloroplast zeta-carotene desaturase                    246   4e-74   Cucurbita moschata [ayote]
gb|AFH53814.1|  zeta-carotene desaturase                                245   6e-74   Narcissus tazetta subsp. chinensis
gb|KHG15309.1|  Zeta-carotene desaturase, chloroplastic/chromopla...    245   6e-74   Gossypium arboreum [tree cotton]
ref|XP_010090263.1|  Zeta-carotene desaturase                           245   7e-74   Morus notabilis
gb|KJB45010.1|  hypothetical protein B456_007G284900                    245   7e-74   Gossypium raimondii
ref|XP_007144812.1|  hypothetical protein PHAVU_007G186000g             245   8e-74   Phaseolus vulgaris [French bean]
gb|ABG72806.2|  zeta-carotene desaturase protein                        244   8e-74   Carica papaya [mamon]
gb|ABB52083.1|  zeta carotene desaturase                                244   2e-73   Daucus carota subsp. sativus
ref|XP_011005691.1|  PREDICTED: zeta-carotene desaturase, chlorop...    244   3e-73   Populus euphratica
gb|KHN16183.1|  Zeta-carotene desaturase, chloroplastic/chromopla...    243   3e-73   Glycine soja [wild soybean]
ref|XP_003536112.1|  PREDICTED: zeta-carotene desaturase, chlorop...    243   3e-73   Glycine max [soybeans]
ref|XP_003556484.1|  PREDICTED: zeta-carotene desaturase, chlorop...    243   4e-73   Glycine max [soybeans]
emb|CDY41905.1|  BnaC05g46990D                                          243   4e-73   Brassica napus [oilseed rape]
gb|AFH53813.1|  zeta-carotene desaturase                                243   5e-73   Narcissus tazetta subsp. chinensis
ref|XP_007204989.1|  hypothetical protein PRUPE_ppa003478mg             243   5e-73   Prunus persica
ref|XP_004302025.1|  PREDICTED: zeta-carotene desaturase, chlorop...    242   7e-73   Fragaria vesca subsp. vesca
ref|XP_002512239.1|  Zeta-carotene desaturase, chloroplast precur...    248   7e-73   
ref|XP_010674842.1|  PREDICTED: zeta-carotene desaturase, chlorop...    242   1e-72   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAJ96277.1|  predicted protein                                      241   1e-72   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACT87979.1|  zeta carotene desaturase                                242   2e-72   Jatropha curcas
ref|XP_009124205.1|  PREDICTED: zeta-carotene desaturase, chlorop...    241   2e-72   Brassica rapa
ref|NP_187138.1|  zeta-carotene desaturase                              241   2e-72   Arabidopsis thaliana [mouse-ear cress]
gb|ACM68701.1|  zeta-carotene desaturase                                241   2e-72   Brassica rapa subsp. pekinensis [bai cai]
gb|AAM63349.1|  putative zeta-carotene desaturase precursor             241   2e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011078737.1|  PREDICTED: zeta-carotene desaturase, chlorop...    241   2e-72   Sesamum indicum [beniseed]
ref|XP_004955783.1|  PREDICTED: zeta-carotene desaturase, chlorop...    241   2e-72   Setaria italica
gb|ABX45112.1|  zeta-carotene desaturase                                241   2e-72   Narcissus tazetta subsp. chinensis
gb|AAF85796.1|AF121947_1  zeta-carotene desaturase precursor            241   2e-72   Arabidopsis thaliana [mouse-ear cress]
gb|AEN94305.1|  zeta-carotene desaturase                                241   3e-72   Brassica napus [oilseed rape]
ref|XP_010419722.1|  PREDICTED: zeta-carotene desaturase, chlorop...    240   3e-72   
ref|XP_010463975.1|  PREDICTED: zeta-carotene desaturase, chlorop...    240   3e-72   Camelina sativa [gold-of-pleasure]
ref|XP_003557406.1|  PREDICTED: zeta-carotene desaturase, chlorop...    240   4e-72   Brachypodium distachyon [annual false brome]
ref|NP_001059145.1|  Os07g0204900                                       240   6e-72   
dbj|BAC79799.1|  putative zeta-carotene desaturase precursor            240   6e-72   Oryza sativa Japonica Group [Japonica rice]
gb|ACI04664.1|  zeta-carotene desaturase                                240   6e-72   Triticum aestivum [Canadian hard winter wheat]
gb|AEI26314.1|  zeta-carotene desaturase                                239   8e-72   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006297343.1|  hypothetical protein CARUB_v10013363mg             239   8e-72   Capsella rubella
ref|XP_002882378.1|  zeta-carotene desaturase precursor                 239   9e-72   
ref|XP_009364531.1|  PREDICTED: zeta-carotene desaturase, chlorop...    239   9e-72   Pyrus x bretschneideri [bai li]
ref|NP_001280951.1|  zeta-carotene desaturase, chloroplastic/chro...    239   1e-71   Malus domestica [apple tree]
gb|AAA91161.1|  zeta-carotene desaturase precursor                      239   1e-71   Arabidopsis thaliana [mouse-ear cress]
gb|EYU22642.1|  hypothetical protein MIMGU_mgv1a003845mg                239   1e-71   Erythranthe guttata [common monkey flower]
ref|XP_008388655.1|  PREDICTED: zeta-carotene desaturase, chlorop...    239   2e-71   Malus domestica [apple tree]
tpg|DAA59952.1|  TPA: zeta-carotene desaturase, /chromoplastic Pr...    239   2e-71   
ref|XP_006858905.1|  hypothetical protein AMTR_s00068p00029180          238   3e-71   Amborella trichopoda
ref|XP_010485876.1|  PREDICTED: zeta-carotene desaturase, chlorop...    238   3e-71   
ref|XP_008813000.1|  PREDICTED: zeta-carotene desaturase, chlorop...    238   5e-71   Phoenix dactylifera
ref|XP_010934924.1|  PREDICTED: zeta-carotene desaturase, chlorop...    237   8e-71   Elaeis guineensis
ref|XP_010934915.1|  PREDICTED: zeta-carotene desaturase, chlorop...    237   1e-70   Elaeis guineensis
gb|AAX56323.1|  zeta-carotene desaturase                                236   2e-70   Sorghum bicolor [broomcorn]
ref|XP_002459524.1|  hypothetical protein SORBIDRAFT_02g006100          236   2e-70   Sorghum bicolor [broomcorn]
gb|ACG46735.1|  zeta-carotene desaturase                                236   2e-70   Zea mays [maize]
ref|XP_009396830.1|  PREDICTED: zeta-carotene desaturase, chlorop...    235   6e-70   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABR18432.1|  unknown                                                 232   9e-69   Picea sitchensis
gb|AAQ04224.1|  zeta-carotene desaturase ZDS1                           228   3e-67   Malus domestica [apple tree]
ref|XP_009364533.1|  PREDICTED: zeta-carotene desaturase, chlorop...    228   3e-67   Pyrus x bretschneideri [bai li]
ref|XP_008370678.1|  PREDICTED: zeta-carotene desaturase, chlorop...    228   3e-67   
sp|C3VEQ0.1|ZDS_ONCHC  RecName: Full=Zeta-carotene desaturase, ch...    225   2e-66   Oncidium hybrid cultivar
ref|XP_006408139.1|  hypothetical protein EUTSA_v10020402mg             224   5e-66   Eutrema salsugineum [saltwater cress]
ref|XP_001776850.1|  predicted protein                                  223   2e-65   
ref|XP_006658387.1|  PREDICTED: zeta-carotene desaturase, chlorop...    222   3e-65   
gb|EPS57847.1|  hypothetical protein M569_16970                         221   3e-65   Genlisea aurea
gb|EMT13673.1|  Zeta-carotene desaturase, chloroplastic/chromopla...    223   3e-65   
gb|EYU22998.1|  hypothetical protein MIMGU_mgv1a003605mg                221   6e-65   Erythranthe guttata [common monkey flower]
ref|XP_001780369.1|  predicted protein                                  220   1e-64   
gb|ADN65328.1|  zeta-carotene desaturase                                213   1e-64   Manihot esculenta [manioc]
ref|XP_001772345.1|  predicted protein                                  221   1e-64   
gb|EMS67399.1|  Zeta-carotene desaturase, chloroplastic/chromopla...    216   3e-63   Triticum urartu
ref|XP_002978356.1|  hypothetical protein SELMODRAFT_108745             216   9e-63   
ref|XP_002970191.1|  hypothetical protein SELMODRAFT_146971             216   1e-62   Selaginella moellendorffii
ref|XP_006471842.1|  PREDICTED: zeta-carotene desaturase, chlorop...    205   1e-62   
ref|NP_001105609.1|  zeta-carotene desaturase, chloroplastic/chro...    214   5e-62   
gb|KDO38850.1|  hypothetical protein CISIN_1g0233862mg                  171   1e-50   Citrus sinensis [apfelsine]
gb|EYU45246.1|  hypothetical protein MIMGU_mgv1a005547mg                172   5e-47   Erythranthe guttata [common monkey flower]
gb|ACI14289.1|  zeta-carotene desaturase                                167   4e-45   Linum usitatissimum
ref|XP_005843062.1|  hypothetical protein CHLNCDRAFT_141585             165   1e-44   Chlorella variabilis
gb|ADR82201.1|  zeta-carotene desaturase                                166   2e-44   Auxenochlorella protothecoides
ref|XP_011396566.1|  Zeta-carotene desaturase, chloroplastic/chro...    165   5e-44   Auxenochlorella protothecoides
ref|XP_008813001.1|  PREDICTED: zeta-carotene desaturase, chlorop...    162   4e-43   Phoenix dactylifera
gb|ABC87740.1|  zeta carotene desaturase                                152   2e-42   Coffea canephora [robusta coffee]
ref|WP_010873021.1|  zeta-carotene desaturase                           158   8e-42   Synechocystis
ref|XP_005650492.1|  zeta-carotene desaturase                           158   2e-41   Coccomyxa subellipsoidea C-169
ref|WP_028947937.1|  zeta-carotene desaturase                           157   2e-41   Synechocystis sp. PCC 6714
gb|KIY97244.1|  zeta-carotene desaturase                                152   9e-41   Monoraphidium neglectum
gb|KDO39191.1|  hypothetical protein CISIN_1g034688mg                   145   1e-40   Citrus sinensis [apfelsine]
ref|XP_002954228.1|  hypothetical protein VOLCADRAFT_95071              155   1e-40   Volvox carteri f. nagariensis
ref|XP_001700786.1|  zeta-carotene desaturase                           154   4e-40   Chlamydomonas reinhardtii
ref|WP_006101879.1|  zeta-carotene desaturase                           153   5e-40   Coleofasciculus chthonoplastes
ref|WP_021829644.1|  Pro-zeta-carotene desaturase, prolycopene pr...    147   7e-40   
ref|WP_019505779.1|  zeta-carotene desaturase                           151   4e-39   Pleurocapsa sp. PCC 7319
ref|WP_012306160.1|  zeta-carotene desaturase                           150   4e-39   Synechococcus
ref|WP_036479960.1|  zeta-carotene desaturase                           150   4e-39   Myxosarcina sp. GI1
ref|WP_006509674.1|  carotene 7,8-desaturase                            150   8e-39   Xenococcus sp. PCC 7305
ref|WP_030005806.1|  zeta-carotene desaturase                           150   9e-39   Synechococcus sp. NKBG042902
ref|WP_012598084.1|  zeta-carotene desaturase                           149   1e-38   Cyanothece sp. PCC 7424
ref|WP_015172316.1|  zeta-carotene desaturase                           149   2e-38   Geitlerinema sp. PCC 7407
ref|WP_009544536.1|  MULTISPECIES: zeta-carotene desaturase             149   2e-38   Cyanothece
ref|WP_008276389.1|  zeta-carotene desaturase                           149   2e-38   Cyanothece sp. CCY0110
ref|WP_015132414.1|  zeta-carotene desaturase                           149   2e-38   Leptolyngbya sp. PCC 7376
ref|WP_012596658.1|  MULTISPECIES: zeta-carotene desaturase             149   3e-38   Cyanothece
gb|AFI09269.1|  carotene desaturase                                     142   3e-38   Gardenia jasminoides
ref|WP_015146661.1|  zeta-carotene desaturase                           148   5e-38   Oscillatoria acuminata
ref|WP_015220074.1|  zeta-carotene desaturase                           147   5e-38   Cyanobacterium aponinum
ref|WP_039727183.1|  MULTISPECIES: zeta-carotene desaturase             147   8e-38   Lyngbya confervoides
ref|WP_028083991.1|  zeta-carotene desaturase                           147   1e-37   Dolichospermum circinale
ref|WP_007303963.1|  zeta-carotene desaturase                           147   1e-37   Crocosphaera watsonii
ref|WP_035372164.1|  zeta-carotene desaturase                           146   1e-37   Dolichospermum circinale
ref|WP_007352889.1|  MULTISPECIES: zeta-carotene desaturase             146   1e-37   Kamptonema
ref|WP_011613311.1|  zeta-carotene desaturase                           146   2e-37   Trichodesmium erythraeum
ref|WP_015181504.1|  carotene 7,8-desaturase                            145   3e-37   Microcoleus sp. PCC 7113
ref|WP_015166147.1|  zeta-carotene desaturase                           145   3e-37   Pseudanabaena sp. PCC 7367
ref|WP_015192125.1|  zeta-carotene desaturase                           145   3e-37   Stanieria cyanosphaera
ref|WP_008181727.1|  zeta-carotene desaturase                           145   3e-37   Moorea producens
ref|WP_015144007.1|  carotene 7,8-desaturase                            145   3e-37   Pleurocapsa minor
ref|WP_015175312.1|  carotene 7,8-desaturase                            145   4e-37   Oscillatoria nigro-viridis
ref|WP_002800446.1|  zeta-carotene desaturase                           145   4e-37   Microcystis aeruginosa
ref|WP_008196176.1|  zeta-carotene desaturase                           145   4e-37   Microcystis sp. T1-4
dbj|GAL91277.1|  pro-zeta-carotene desaturase, prolycopene producing    145   5e-37   Microcystis aeruginosa NIES-44
ref|WP_002796087.1|  zeta-carotene desaturase                           145   5e-37   Microcystis
ref|WP_002744950.1|  carotene 7,8-desaturase                            145   5e-37   Microcystis aeruginosa
ref|WP_002738691.1|  carotene 7,8-desaturase                            145   5e-37   Microcystis aeruginosa
ref|WP_002755392.1|  zeta-carotene desaturase                           145   5e-37   Microcystis aeruginosa
ref|WP_024970325.1|  zeta-carotene desaturase                           145   5e-37   Microcystis aeruginosa
ref|WP_002792824.1|  zeta-carotene desaturase                           145   5e-37   Microcystis aeruginosa
ref|WP_002780881.1|  Zeta-carotene desaturase                           145   5e-37   Microcystis aeruginosa
ref|WP_015226977.1|  zeta-carotene desaturase                           145   5e-37   Halothece sp. PCC 7418
ref|WP_002764632.1|  zeta-carotene desaturase                           145   5e-37   Microcystis aeruginosa
ref|WP_002759655.1|  zeta-carotene desaturase                           145   5e-37   Microcystis aeruginosa
ref|WP_002787023.1|  zeta-carotene desaturase                           145   5e-37   Microcystis aeruginosa
ref|WP_015222888.1|  zeta-carotene desaturase                           145   5e-37   
ref|WP_018399171.1|  zeta-carotene desaturase                           145   6e-37   filamentous cyanobacterium ESFC-1
ref|WP_017305968.1|  zeta-carotene desaturase                           144   7e-37   Spirulina subsalsa
ref|WP_008312128.1|  carotene 7,8-desaturase                            144   1e-36   Leptolyngbya sp. PCC 6406
ref|WP_029959080.1|  zeta-carotene desaturase                           136   1e-36   
ref|WP_006632676.1|  zeta-carotene desaturase                           144   1e-36   Microcoleus vaginatus
ref|WP_002778277.1|  zeta-carotene desaturase                           144   1e-36   Microcystis aeruginosa
ref|WP_029983587.1|  zeta-carotene desaturase                           135   1e-36   
ref|WP_044106302.1|  zeta-carotene desaturase                           144   1e-36   cyanobacterium endosymbiont of Epithemia turgida
ref|WP_039743588.1|  zeta-carotene desaturase                           144   1e-36   
ref|WP_015228996.1|  carotene 7,8-desaturase                            143   2e-36   Dactylococcopsis salina
ref|WP_015170063.1|  carotene 7,8-desaturase                            143   2e-36   Synechococcus sp. PCC 7502
ref|WP_011822978.1|  zeta-carotene desaturase                           143   2e-36   Prochlorococcus marinus
ref|WP_017296227.1|  zeta-carotene desaturase                           143   3e-36   Geminocystis herdmanii
ref|WP_006616919.1|  zeta-carotene desaturase                           143   3e-36   Arthrospira platensis
ref|WP_014274504.1|  zeta-carotene desaturase                           143   3e-36   Arthrospira platensis
ref|WP_036901689.1|  zeta-carotene desaturase                           143   3e-36   Prochlorococcus sp. MIT 0601
ref|WP_026785642.1|  MULTISPECIES: zeta-carotene desaturase             142   3e-36   Planktothrix
ref|WP_042153636.1|  zeta-carotene desaturase                           142   4e-36   Planktothrix agardhii
ref|WP_026796254.1|  zeta-carotene desaturase                           142   4e-36   Planktothrix
ref|WP_026796095.1|  MULTISPECIES: zeta-carotene desaturase             142   4e-36   Planktothrix
ref|WP_038650792.1|  zeta-carotene desaturase                           142   5e-36   Prochlorococcus sp. MIT 0801
ref|WP_011294117.1|  zeta-carotene desaturase                           142   5e-36   Prochlorococcus marinus
ref|WP_036904745.1|  zeta-carotene desaturase                           142   5e-36   Prochlorococcus marinus
ref|WP_012194687.1|  zeta-carotene desaturase                           142   6e-36   Prochlorococcus marinus
ref|WP_017717674.1|  zeta-carotene desaturase                           142   6e-36   Oscillatoria sp. PCC 10802
dbj|BAD07272.1|  zeta-carotene desaturase                               135   7e-36   Citrus unshiu [satsuma mandarin]
ref|WP_006624376.1|  MULTISPECIES: zeta-carotene desaturase             142   7e-36   Arthrospira
ref|WP_011131754.1|  zeta-carotene desaturase                           142   7e-36   Prochlorococcus marinus
ref|WP_027842846.1|  zeta-carotene desaturase                           141   8e-36   Mastigocoleus testarum
ref|WP_017655161.1|  zeta-carotene desaturase                           141   9e-36   Fortiea contorta
ref|WP_017660852.1|  zeta-carotene desaturase                           141   1e-35   Geitlerinema sp. PCC 7105
dbj|BAD07280.1|  zeta-carotene desaturase                               135   1e-35   Citrus sinensis [apfelsine]
ref|WP_019503087.1|  zeta-carotene desaturase                           141   1e-35   Pseudanabaena sp. PCC 6802
ref|WP_025937920.1|  zeta-carotene desaturase                           141   1e-35   
ref|WP_025905874.1|  zeta-carotene desaturase                           141   1e-35   
ref|WP_032523894.1|  zeta-carotene desaturase                           141   1e-35   Prochlorococcus marinus
ref|WP_025979527.1|  zeta-carotene desaturase                           141   1e-35   
ref|WP_025936184.1|  zeta-carotene desaturase                           141   1e-35   
ref|WP_025945602.1|  zeta-carotene desaturase                           140   2e-35   
ref|XP_005712997.1|  zeta-carotene desaturase                           140   2e-35   Chondrus crispus [carageen]
ref|WP_036922357.1|  zeta-carotene desaturase                           140   2e-35   
ref|WP_019475733.1|  zeta-carotene desaturase                           140   2e-35   
ref|WP_016951556.1|  zeta-carotene desaturase                           140   2e-35   Anabaena sp. PCC 7108
gb|EFA72095.1|  hypothetical protein CRD_02617                          133   2e-35   Raphidiopsis brookii D9
ref|WP_023068890.1|  9,9'-di-cis-zeta-carotene desaturase               140   2e-35   Lyngbya aestuarii
gb|ABB49180.1|  zeta-carotene desaturase                                140   2e-35   Prochlorococcus marinus str. MIT 9312
ref|WP_017324264.1|  hypothetical protein                               140   2e-35   Synechococcus sp. PCC 7336
ref|WP_036916414.1|  MULTISPECIES: zeta-carotene desaturase             140   3e-35   Prochlorococcus
ref|WP_006526943.1|  carotene 7,8-desaturase                            140   3e-35   Gloeocapsa sp. PCC 73106
ref|WP_009786389.1|  zeta-carotene desaturase                           140   3e-35   Lyngbya sp. PCC 8106
ref|WP_027403635.1|  zeta-carotene desaturase                           140   3e-35   Aphanizomenon flos-aquae
ref|WP_013192972.1|  zeta-carotene desaturase                           140   4e-35   Trichormus azollae
ref|WP_019478374.1|  zeta-carotene desaturase                           140   4e-35   
ref|WP_032516794.1|  zeta-carotene desaturase                           139   5e-35   Prochlorococcus marinus
ref|WP_036924468.1|  zeta-carotene desaturase                           139   5e-35   Prochlorococcus marinus
ref|WP_011934112.1|  zeta-carotene desaturase                           139   5e-35   Synechococcus sp. WH 7803
ref|WP_032519772.1|  zeta-carotene desaturase                           139   5e-35   Prochlorococcus marinus
ref|WP_025963149.1|  zeta-carotene desaturase                           139   5e-35   
ref|WP_025952229.1|  zeta-carotene desaturase                           139   5e-35   
ref|WP_025962778.1|  MULTISPECIES: zeta-carotene desaturase             139   5e-35   
ref|WP_025955073.1|  MULTISPECIES: zeta-carotene desaturase             139   5e-35   
ref|WP_025954278.1|  zeta-carotene desaturase                           139   5e-35   
ref|WP_025890273.1|  MULTISPECIES: zeta-carotene desaturase             139   5e-35   
ref|WP_025880230.1|  MULTISPECIES: zeta-carotene desaturase             139   5e-35   Prochlorococcus
ref|WP_011862158.1|  zeta-carotene desaturase                           139   5e-35   Prochlorococcus marinus
ref|WP_025932286.1|  MULTISPECIES: zeta-carotene desaturase             139   6e-35   
ref|WP_032522962.1|  zeta-carotene desaturase                           139   6e-35   Prochlorococcus marinus
ref|WP_025971586.1|  zeta-carotene desaturase                           139   6e-35   
ref|WP_025956429.1|  MULTISPECIES: zeta-carotene desaturase             139   6e-35   
ref|WP_042849604.1|  zeta-carotene desaturase                           139   6e-35   Prochlorococcus sp. MIT 0604
ref|WP_025939866.1|  zeta-carotene desaturase                           139   6e-35   
ref|WP_025932943.1|  zeta-carotene desaturase                           139   6e-35   
ref|WP_025924976.1|  zeta-carotene desaturase                           139   6e-35   
ref|WP_019490788.1|  zeta-carotene desaturase                           139   6e-35   Calothrix sp. PCC 7103
ref|WP_025893773.1|  zeta-carotene desaturase                           139   6e-35   
ref|WP_025973661.1|  zeta-carotene desaturase                           139   6e-35   
ref|WP_025953053.1|  zeta-carotene desaturase                           139   6e-35   
ref|WP_025941175.1|  zeta-carotene desaturase                           139   6e-35   
dbj|BAM54881.1|  zeta-carotene desaturase                               139   6e-35   Bacillus subtilis BEST7613
ref|WP_025931278.1|  zeta-carotene desaturase                           139   6e-35   
ref|WP_011365287.1|  zeta-carotene desaturase                           139   6e-35   Synechococcus sp. CC9605
ref|WP_015079855.1|  carotene 7,8-desaturase                            139   6e-35   Anabaena sp. 90
ref|WP_028952928.1|  zeta-carotene desaturase                           139   7e-35   
gb|AHF64768.1|  Carotene 7,8-desaturase                                 139   7e-35   
ref|WP_038552845.1|  zeta-carotene desaturase                           139   8e-35   
ref|WP_012628567.1|  zeta-carotene desaturase                           139   8e-35   
ref|WP_015200559.1|  zeta-carotene desaturase                           139   9e-35   
ref|WP_009458269.1|  MULTISPECIES: zeta-carotene desaturase             138   1e-34   
ref|WP_019476153.1|  zeta-carotene desaturase                           138   1e-34   
ref|WP_025921324.1|  zeta-carotene desaturase                           138   1e-34   
ref|WP_012407300.1|  zeta-carotene desaturase                           138   1e-34   
ref|WP_032514724.1|  zeta-carotene desaturase                           138   1e-34   
ref|WP_025923867.1|  zeta-carotene desaturase                           138   1e-34   
ref|WP_017322437.1|  zeta-carotene desaturase                           138   2e-34   
ref|WP_009626851.1|  zeta-carotene desaturase                           138   2e-34   
ref|WP_011429564.1|  zeta-carotene desaturase                           138   2e-34   
ref|WP_036899170.1|  zeta-carotene desaturase                           138   2e-34   
ref|WP_006194399.1|  zeta-carotene desaturase                           138   2e-34   
ref|WP_019474796.1|  zeta-carotene desaturase                           138   2e-34   
ref|WP_038546976.1|  zeta-carotene desaturase                           138   2e-34   
ref|WP_009633167.1|  carotene 7,8-desaturase                            138   2e-34   
ref|WP_011934693.1|  zeta-carotene desaturase                           137   2e-34   
ref|WP_032515874.1|  zeta-carotene desaturase                           137   2e-34   
ref|WP_025924062.1|  MULTISPECIES: zeta-carotene desaturase             137   2e-34   
ref|WP_025922039.1|  MULTISPECIES: zeta-carotene desaturase             137   2e-34   
ref|WP_019477173.1|  zeta-carotene desaturase                           137   2e-34   
ref|WP_011432691.1|  zeta-carotene desaturase                           137   2e-34   
ref|WP_025957514.1|  zeta-carotene desaturase                           137   2e-34   
ref|WP_006276633.1|  zeta-carotene desaturase                           137   3e-34   
ref|WP_011124291.1|  MULTISPECIES: zeta-carotene desaturase             137   3e-34   
ref|WP_029637206.1|  zeta-carotene desaturase [                         137   3e-34   
ref|WP_015140745.1|  carotene 7,8-desaturase                            137   3e-34   
ref|WP_006043052.1|  zeta-carotene desaturase                           137   3e-34   
ref|WP_011129069.1|  zeta-carotene desaturase                           137   4e-34   
ref|WP_011359164.1|  zeta-carotene desaturase                           137   4e-34   
ref|WP_032525823.1|  zeta-carotene desaturase                           137   4e-34   
ref|WP_009788218.1|  zeta-carotene desaturase                           137   5e-34   
ref|WP_010311530.1|  zeta-carotene desaturase                           137   5e-34   
ref|WP_025934707.1|  zeta-carotene desaturase                           137   5e-34   
ref|WP_037221580.1|  zeta-carotene desaturase                           136   5e-34   
ref|WP_008232862.1|  Pro-zeta-carotene desaturase, prolycopene pr...    136   5e-34   
gb|KGG16821.1|  Pro-zeta-carotene desaturase                            136   5e-34   
ref|WP_008229377.1|  Pro-zeta-carotene desaturase, prolycopene pr...    136   5e-34   
ref|WP_016867700.1|  zeta-carotene desaturase                           136   5e-34   
ref|WP_043693134.1|  zeta-carotene desaturase                           136   6e-34   
ref|WP_011620462.1|  zeta-carotene desaturase                           136   7e-34   
ref|WP_015158175.1|  carotene 7,8-desaturase                            136   7e-34   
ref|WP_015211255.1|  zeta-carotene desaturase                           136   8e-34   
ref|WP_010996538.1|  zeta-carotene desaturase                           136   8e-34   
ref|WP_015130469.1|  zeta-carotene desaturase                           135   9e-34   
ref|WP_011317089.1|  zeta-carotene desaturase                           135   9e-34   
ref|WP_002805954.1|  zeta-carotene desaturase                           135   1e-33   
ref|WP_011817608.1|  zeta-carotene desaturase                           135   1e-33   
ref|WP_006854570.1|  zeta-carotene desaturase                           135   1e-33   
ref|WP_035156290.1|  zeta-carotene desaturase                           135   1e-33   
ref|WP_012006931.1|  zeta-carotene desaturase                           135   1e-33   
ref|WP_011819453.1|  zeta-carotene desaturase                           135   1e-33   
emb|CAB56041.1|  zeta-carotene desaturase                               135   2e-33   
ref|YP_002048946.1|  zeta-carotene desaturase                           134   3e-33   
ref|WP_015110467.1|  carotene 7,8-desaturase                            134   3e-33   
gb|ERN42097.1|  carotene 7,8-desaturase                                 134   3e-33   
ref|WP_026135055.1|  zeta-carotene desaturase                           134   3e-33   
ref|WP_040655267.1|  zeta-carotene desaturase                           134   3e-33   
ref|XP_005836476.1|  hypothetical protein GUITHDRAFT_93434              134   4e-33   
ref|WP_016872384.1|  zeta-carotene desaturase                           134   4e-33   
ref|WP_015115824.1|  zeta-carotene desaturase                           134   4e-33   
ref|WP_010469723.1|  zeta-carotene desaturase                           134   4e-33   
gb|KIE07965.1|  zeta-carotene desaturase                                134   5e-33   
ref|WP_012164067.1|  zeta-carotene desaturase                           134   5e-33   
ref|WP_039715937.1|  zeta-carotene desaturase                           134   5e-33   
ref|XP_005760283.1|  hypothetical protein EMIHUDRAFT_258445             128   7e-33   
ref|WP_017311524.1|  zeta-carotene desaturase                           132   1e-32   
ref|WP_044452849.1|  zeta-carotene desaturase                           132   1e-32   
ref|WP_035833559.1|  zeta-carotene desaturase                           132   1e-32   
ref|WP_026722453.1|  zeta-carotene desaturase                           132   1e-32   
ref|WP_015153689.1|  zeta-carotene desaturase                           132   1e-32   
dbj|BAK22395.1|  zeta carotene desaturase                               126   1e-32   
dbj|BAH10588.1|  zeta-carotene desaturase                               132   2e-32   
ref|WP_015122754.1|  zeta-carotene desaturase                           132   3e-32   
ref|WP_040943538.1|  zeta-carotene desaturase                           131   3e-32   
ref|WP_026732974.1|  zeta-carotene desaturase                           131   3e-32   
ref|XP_009033554.1|  hypothetical protein AURANDRAFT_6909               122   1e-31   
ref|WP_017316100.1|  zeta-carotene desaturase                           129   2e-31   
ref|XP_005705885.1|  zeta-carotene desaturase                           127   2e-31   
ref|WP_041034621.1|  zeta-carotene desaturase                           128   4e-31   
ref|XP_005767829.1|  hypothetical protein EMIHUDRAFT_421941             129   5e-31   
gb|KIJ82480.1|  zeta-carotene desaturase                                127   7e-31   
emb|CAB65434.1|  zeta carotene desaturase                               124   2e-30   
gb|ADK95008.1|  chloroplast zeta-carotene desaturase                    127   2e-30   
ref|WP_011244807.1|  zeta-carotene desaturase                           125   4e-30   
ref|WP_011378061.1|  MULTISPECIES: zeta-carotene desaturase             125   4e-30   
ref|WP_009767765.1|  zeta-carotene desaturase                           125   5e-30   
gb|AIN50101.1|  zeta-carotene desaturase                                119   6e-30   
ref|XP_002293738.1|  predicted protein                                  124   3e-29   
ref|WP_017287792.1|  zeta-carotene desaturase                           123   4e-29   
ref|WP_035997160.1|  zeta-carotene desaturase                           122   9e-29   
ref|WP_006172229.1|  zeta-carotene desaturase                           121   1e-28   
ref|WP_007099059.1|  zeta-carotene desaturase                           121   1e-28   
ref|WP_038001819.1|  zeta-carotene desaturase                           121   1e-28   
gb|EAQ68236.1|  zeta-carotene desaturase                                120   2e-28   
ref|XP_005539120.1|  zeta-carotene desaturase                           122   2e-28   
ref|XP_002176685.1|  zeta-carotene desaturase                           122   2e-28   
ref|WP_017714696.1|  zeta-carotene desaturase                           119   6e-28   
gb|EJK64522.1|  hypothetical protein THAOC_14736                        121   8e-28   
gb|EDY38499.1|  carotene 7,8-desaturase                                 119   8e-28   
emb|CBN76924.1|  zeta-carotene desaturase, chloroplast precursor        120   9e-28   
ref|WP_011827195.1|  zeta-carotene desaturase                           119   9e-28   
ref|WP_036913831.1|  MULTISPECIES: zeta-carotene desaturase             119   1e-27   
ref|WP_010313236.1|  zeta-carotene desaturase                           119   1e-27   
ref|WP_011131333.1|  zeta-carotene desaturase                           118   1e-27   
ref|WP_043370035.1|  zeta-carotene desaturase                           119   1e-27   
ref|WP_011056192.1|  zeta-carotene desaturase                           118   1e-27   
gb|EWM29966.1|  zeta-carotene desaturase                                119   2e-27   
ref|WP_015204957.1|  zeta-carotene desaturase                           117   3e-27   
ref|WP_015124123.1|  zeta-carotene desaturase                           117   3e-27   
ref|WP_024123886.1|  carotene 7,8-desaturase CrtQ                       116   6e-27   
ref|WP_015214429.1|  zeta-carotene desaturase                           114   6e-26   
gb|AII46264.1|  zeta-carotene desaturase                                112   3e-25   
gb|KDO37078.1|  hypothetical protein CISIN_1g046976mg                   105   3e-25   
ref|WP_025945002.1|  hypothetical protein                               107   5e-25   
ref|XP_011005715.1|  PREDICTED: zeta-carotene desaturase, chlorop...    107   2e-24   
ref|XP_006432993.1|  hypothetical protein CICLE_v10002974mg             103   2e-24   
ref|XP_006432999.1|  hypothetical protein CICLE_v10003502mg             102   3e-24   
ref|XP_006433004.1|  hypothetical protein CICLE_v10002967mg             102   3e-24   
ref|XP_006471711.1|  PREDICTED: zeta-carotene desaturase, chlorop...    102   4e-24   
ref|XP_008230988.1|  PREDICTED: zeta-carotene desaturase, chlorop...    103   7e-24   
ref|XP_006471924.1|  PREDICTED: protein tesmin/TSO1-like CXC 2-like     101   2e-22   
ref|WP_012508488.1|  zeta-carotene desaturase                         95.5    2e-19   
ref|WP_012465874.1|  zeta-carotene desaturase                         95.1    3e-19   
ref|WP_011362607.1|  zeta-carotene desaturase                         94.7    3e-19   
ref|WP_035399863.1|  zeta-carotene desaturase                         94.7    4e-19   
ref|WP_011358146.1|  zeta-carotene desaturase                         94.4    5e-19   
ref|WP_012500238.1|  zeta-carotene desaturase                         94.0    6e-19   
ref|WP_006366988.1|  zeta-carotene desaturase                         92.0    3e-18   
ref|WP_010933081.1|  zeta-carotene desaturase                         92.0    4e-18   
ref|WP_012474382.1|  zeta-carotene desaturase                         90.9    9e-18   
ref|WP_012502001.1|  zeta-carotene desaturase                         90.5    1e-17   
ref|WP_012506077.1|  zeta-carotene desaturase                         89.7    2e-17   
ref|WP_016863210.1|  zeta-carotene desaturase                         89.0    4e-17   
ref|WP_036916436.1|  MULTISPECIES: phytoene desaturase                87.4    2e-16   
ref|XP_005704373.1|  phytoene dehydrogenase, phytoene desaturase      87.8    2e-16   
gb|EGJ31992.1|  zeta-carotene desaturase                              87.4    2e-16   
ref|WP_044493680.1|  phytoene desaturase                              87.0    2e-16   
ref|WP_011131369.1|  15-cis-phytoene desaturase                       87.0    2e-16   
ref|WP_036911507.1|  MULTISPECIES: phytoene desaturase                86.3    4e-16   
gb|KGG28551.1|  Phytoene desaturase                                   86.3    4e-16   
gb|KIE10443.1|  phytoene desaturase                                   82.4    4e-16   
gb|KIY99406.1|  phytoene dehydrogenase, phytoenedesaturase            84.7    5e-16   
ref|WP_015203840.1|  phytoene desaturase                              85.9    6e-16   
ref|XP_011398349.1|  15-cis-phytoene desaturase, chloroplastic/ch...  85.9    8e-16   
gb|ACI45964.1|  putative plastid phytoene desaturase precursor        85.9    8e-16   
ref|WP_011827238.1|  15-cis-phytoene desaturase                       85.5    8e-16   
ref|WP_015120184.1|  phytoene desaturase                              85.5    8e-16   
emb|CAK27141.1|  Phytoene dehydrogenase                               85.1    1e-15   
ref|WP_017719350.1|  15-cis-phytoene desaturase                       85.1    1e-15   
gb|KIJ84755.1|  phytoene desaturase                                   85.1    1e-15   
ref|WP_038650865.1|  phytoene desaturase                              84.7    1e-15   
ref|WP_012194715.1|  15-cis-phytoene desaturase                       84.7    1e-15   
ref|WP_017304112.1|  15-cis-phytoene desaturase                       84.7    1e-15   
emb|CBN77338.1|  Phytoene desaturase, chloroplast precursor           85.1    2e-15   
ref|WP_014098773.1|  hypothetical protein                             84.3    2e-15   
ref|WP_023068390.1|  phytoene desaturase                              84.3    2e-15   
ref|WP_011744709.1|  zeta-carotene desaturase                         84.0    2e-15   
ref|WP_017320903.1|  15-cis-phytoene desaturase                       84.3    2e-15   
ref|WP_009545089.1|  MULTISPECIES: 15-cis-phytoene desaturase         84.0    2e-15   
ref|WP_017659860.1|  15-cis-phytoene desaturase                       84.0    3e-15   
gb|EAW37904.1|  phytoene desaturase                                   84.0    3e-15   
ref|WP_039895657.1|  phytoene desaturase                              83.6    3e-15   
gb|EWM23892.1|  phytoene desaturase                                   84.3    3e-15   
ref|WP_008277236.1|  15-cis-phytoene desaturase                       83.6    3e-15   
ref|XP_005850369.1|  hypothetical protein CHLNCDRAFT_34420            84.0    3e-15   
ref|WP_011124322.1|  MULTISPECIES: 15-cis-phytoene desaturase         83.6    4e-15   
ref|WP_011244423.1|  15-cis-phytoene desaturase                       83.6    4e-15   
ref|WP_007357652.1|  MULTISPECIES: 15-cis-phytoene desaturase         83.6    4e-15   
ref|WP_011378266.1|  MULTISPECIES: 15-cis-phytoene desaturase         83.6    4e-15   
ref|WP_006102673.1|  15-cis-phytoene desaturase                       83.2    4e-15   
ref|WP_016875939.1|  15-cis-phytoene desaturase                       83.6    4e-15   
ref|WP_036486091.1|  phytoene desaturase                              83.2    4e-15   
ref|WP_007308080.1|  15-cis-phytoene desaturase                       83.2    4e-15   
ref|WP_007313063.1|  15-cis-phytoene desaturase                       83.2    4e-15   
ref|WP_033365614.1|  phytoene desaturase                              83.2    4e-15   
ref|WP_021831442.1|  Phytoene desaturase, pro-zeta-carotene produ...  83.2    4e-15   
ref|WP_015134557.1|  three-step phytoene desaturase                   83.2    5e-15   
ref|WP_006172268.1|  15-cis-phytoene desaturase                       83.2    5e-15   
ref|WP_030006437.1|  phytoene desaturase                              83.2    5e-15   
ref|WP_002740681.1|  phytoene desaturase                              83.2    5e-15   
ref|WP_008206009.1|  15-cis-phytoene desaturase                       83.2    5e-15   
ref|WP_002787326.1|  15-cis-phytoene desaturase                       82.8    6e-15   
dbj|GAL95683.1|  phytoene desaturase, pro-zeta-carotene producing     82.8    6e-15   
ref|WP_036901635.1|  phytoene desaturase                              82.8    6e-15   
ref|WP_002792672.1|  15-cis-phytoene desaturase                       82.8    6e-15   
ref|WP_002762566.1|  15-cis-phytoene desaturase                       82.8    6e-15   
ref|WP_041041142.1|  phytoene desaturase                              82.8    6e-15   
ref|WP_002783707.1|  Phytoene dehydrogenase                           82.8    6e-15   
ref|WP_011294143.1|  15-cis-phytoene desaturase                       82.8    6e-15   
ref|WP_024546170.1|  phytoene desaturase                              82.8    6e-15   
ref|WP_012307545.1|  15-cis-phytoene desaturase                       82.8    6e-15   
ref|WP_015194460.1|  phytoene desaturase                              82.8    6e-15   
ref|WP_011823004.1|  15-cis-phytoene desaturase                       82.8    7e-15   
ref|WP_017714083.1|  15-cis-phytoene desaturase                       82.8    7e-15   
ref|WP_036904708.1|  phytoene desaturase                              82.4    7e-15   
ref|WP_012409301.1|  15-cis-phytoene desaturase                       82.8    7e-15   
ref|WP_018396665.1|  15-cis-phytoene desaturase                       82.4    8e-15   
ref|WP_012593685.1|  15-cis-phytoene desaturase                       82.4    8e-15   
ref|XP_008337492.1|  PREDICTED: phytoene dehydrogenase, chloropla...  82.0    8e-15   
ref|WP_011934160.1|  15-cis-phytoene desaturase                       82.4    8e-15   
ref|WP_012796738.1|  15-cis-phytoene desaturase                       82.4    8e-15   
ref|WP_043736439.1|  phytoene desaturase                              82.0    1e-14   
ref|WP_015114894.1|  three-step phytoene desaturase                   82.0    1e-14   
gb|ADC32153.1|  phytoene desaturase                                   82.4    1e-14   
ref|WP_044106256.1|  phytoene desaturase                              82.0    1e-14   
ref|WP_015179275.1|  phytoene desaturase                              82.0    1e-14   
ref|WP_016953107.1|  15-cis-phytoene desaturase                       82.0    1e-14   
gb|ADR82199.1|  phytoene desaturase                                   82.4    1e-14   
sp|Q40406.1|CRTI_NARPS  RecName: Full=Phytoene dehydrogenase, chl...  82.4    1e-14   
ref|WP_036535830.1|  phytoene desaturase                              82.0    1e-14   
ref|XP_006421059.1|  hypothetical protein CICLE_v10007114mg           80.1    1e-14   
ref|WP_002795539.1|  15-cis-phytoene desaturase                       82.0    1e-14   
ref|WP_002801855.1|  15-cis-phytoene desaturase                       82.0    1e-14   
emb|CDX90267.1|  BnaA08g17170D                                        79.7    1e-14   
ref|WP_024969991.1|  phytoene desaturase                              82.0    1e-14   
ref|WP_012505465.1|  zeta-carotene desaturase                         81.6    1e-14   
ref|WP_002769731.1|  15-cis-phytoene desaturase                       82.0    1e-14   



>dbj|BAI47574.1| zeta-carotene desaturase [Ipomoea sp. Kenyan]
Length=588

 Score =   288 bits (736),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 165/172 (96%), Positives = 166/172 (97%), Gaps = 0/172 (0%)
 Frame = +2

Query  125  MaaassasICFPATRKGTDFrsgstglllrsglrvstglrsrKSVIRSDLDSMVSDMSTN  304
            MAAASSAS+CFPATRKG DFRSGSTGLL RS  RVST L SRKSVIRSDLDSMVSDMSTN
Sbjct  1    MAAASSASMCFPATRKGADFRSGSTGLLRRSNCRVSTRLTSRKSVIRSDLDSMVSDMSTN  60

Query  305  APKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFV  484
            APKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFV
Sbjct  61   APKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFV  120

Query  485  DRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            DRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE
Sbjct  121  DRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  172



>ref|XP_010323855.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
isoform X1 [Solanum lycopersicum]
Length=482

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/130 (95%), Positives = 130/130 (100%), Gaps = 0/130 (0%)
 Frame = +2

Query  251  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  430
            KSVIR+DLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  45   KSVIRADLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  104

Query  431  VDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHT  610
            VDIY+S++FIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRL+KKVGAEKNLLVK+HTHT
Sbjct  105  VDIYESRTFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLLKKVGAEKNLLVKEHTHT  164

Query  611  FVNKGGDIGE  640
            FVNKGG+IGE
Sbjct  165  FVNKGGEIGE  174



>gb|AIX87520.1| zeta-carotene desaturase [Lycium ruthenicum]
Length=588

 Score =   265 bits (677),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/130 (95%), Positives = 130/130 (100%), Gaps = 0/130 (0%)
 Frame = +2

Query  251  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  430
            KSVIR+DLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  45   KSVIRADLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  104

Query  431  VDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHT  610
            VDIY+S++FIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRL+KKVGAEKNLLVKDHTHT
Sbjct  105  VDIYESRTFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLLKKVGAEKNLLVKDHTHT  164

Query  611  FVNKGGDIGE  640
            FVNKGG+IGE
Sbjct  165  FVNKGGEIGE  174



>gb|AHA58685.1| zeta-carotene desaturase [Nicotiana tabacum]
Length=588

 Score =   264 bits (675),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 124/130 (95%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +2

Query  251  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  430
            KSVIR+DLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  45   KSVIRADLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  104

Query  431  VDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHT  610
            VDIY+S+ FIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRL+KKVGAEKNLLVKDHTHT
Sbjct  105  VDIYESRPFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLLKKVGAEKNLLVKDHTHT  164

Query  611  FVNKGGDIGE  640
            FVNKGG+IGE
Sbjct  165  FVNKGGEIGE  174



>gb|AEG73891.1| zeta-carotene desaturase [Nicotiana tabacum]
Length=588

 Score =   264 bits (675),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 124/130 (95%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +2

Query  251  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  430
            KSVIR+DLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  45   KSVIRADLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  104

Query  431  VDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHT  610
            VDIY+S+ FIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRL+KKVGAEKNLLVKDHTHT
Sbjct  105  VDIYESRPFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLLKKVGAEKNLLVKDHTHT  164

Query  611  FVNKGGDIGE  640
            FVNKGG+IGE
Sbjct  165  FVNKGGEIGE  174



>ref|XP_009588416.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
[Nicotiana tomentosiformis]
Length=588

 Score =   264 bits (675),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 124/130 (95%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +2

Query  251  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  430
            KSVIR+DLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  45   KSVIRADLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  104

Query  431  VDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHT  610
            VDIY+S+ FIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRL+KKVGAEKNLLVKDHTHT
Sbjct  105  VDIYESRPFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLLKKVGAEKNLLVKDHTHT  164

Query  611  FVNKGGDIGE  640
            FVNKGG+IGE
Sbjct  165  FVNKGGEIGE  174



>ref|XP_009792956.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
[Nicotiana sylvestris]
Length=588

 Score =   264 bits (674),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 124/130 (95%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +2

Query  251  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  430
            KSVIR+DLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  45   KSVIRADLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  104

Query  431  VDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHT  610
            VDIY+S+ FIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRL+KKVGAEKNLLVKDHTHT
Sbjct  105  VDIYESRPFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLLKKVGAEKNLLVKDHTHT  164

Query  611  FVNKGGDIGE  640
            FVNKGG+IGE
Sbjct  165  FVNKGGEIGE  174



>gb|AGO05927.1| plastid zeta-carotene desaturase [Solanum lycopersicum]
Length=588

 Score =   263 bits (673),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 123/130 (95%), Positives = 130/130 (100%), Gaps = 0/130 (0%)
 Frame = +2

Query  251  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  430
            KSVIR+DLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  45   KSVIRADLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  104

Query  431  VDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHT  610
            VDIY+S++FIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRL+KKVGAEKNLLVK+HTHT
Sbjct  105  VDIYESRTFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLLKKVGAEKNLLVKEHTHT  164

Query  611  FVNKGGDIGE  640
            FVNKGG+IGE
Sbjct  165  FVNKGGEIGE  174



>gb|ABR57231.1| zeta-carotene desaturase [Solanum lycopersicum]
Length=588

 Score =   263 bits (673),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/130 (95%), Positives = 130/130 (100%), Gaps = 0/130 (0%)
 Frame = +2

Query  251  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  430
            KSVIR+DLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  45   KSVIRADLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  104

Query  431  VDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHT  610
            VDIY+S++FIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRL+KKVGAEKNLLVK+HTHT
Sbjct  105  VDIYESRTFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLLKKVGAEKNLLVKEHTHT  164

Query  611  FVNKGGDIGE  640
            FVNKGG+IGE
Sbjct  165  FVNKGGEIGE  174



>ref|NP_001234383.1| zeta-carotene desaturase, chloroplastic/chromoplastic [Solanum 
lycopersicum]
 sp|Q9SE20.1|ZDS_SOLLC RecName: Full=Zeta-carotene desaturase, chloroplastic/chromoplastic; 
AltName: Full=9,9'-di-cis-zeta-carotene desaturase; 
AltName: Full=Carotene 7,8-desaturase; Flags: Precursor [Solanum 
lycopersicum]
 gb|AAF13698.1|AF195507_1 zeta-carotene desaturase [Solanum lycopersicum]
Length=588

 Score =   263 bits (673),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/130 (95%), Positives = 130/130 (100%), Gaps = 0/130 (0%)
 Frame = +2

Query  251  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  430
            KSVIR+DLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  45   KSVIRADLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  104

Query  431  VDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHT  610
            VDIY+S++FIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRL+KKVGAEKNLLVK+HTHT
Sbjct  105  VDIYESRTFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLLKKVGAEKNLLVKEHTHT  164

Query  611  FVNKGGDIGE  640
            FVNKGG+IGE
Sbjct  165  FVNKGGEIGE  174



>gb|ABD67160.1| zeta-carotene desaturase [Solanum lycopersicum]
Length=588

 Score =   263 bits (673),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/130 (95%), Positives = 130/130 (100%), Gaps = 0/130 (0%)
 Frame = +2

Query  251  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  430
            KSVIR+DLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  45   KSVIRADLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  104

Query  431  VDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHT  610
            VDIY+S++FIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRL+KKVGAEKNLLVK+HTHT
Sbjct  105  VDIYESRTFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLLKKVGAEKNLLVKEHTHT  164

Query  611  FVNKGGDIGE  640
            FVNKGG+IGE
Sbjct  165  FVNKGGEIGE  174



>ref|XP_006347795.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic-like 
[Solanum tuberosum]
Length=588

 Score =   263 bits (672),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/130 (95%), Positives = 130/130 (100%), Gaps = 0/130 (0%)
 Frame = +2

Query  251  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  430
            KSVIR+DLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  45   KSVIRADLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  104

Query  431  VDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHT  610
            VDIY+S++FIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRL+KKVGAEKNLLVK+HTHT
Sbjct  105  VDIYESRTFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLLKKVGAEKNLLVKEHTHT  164

Query  611  FVNKGGDIGE  640
            FVNKGG+IGE
Sbjct  165  FVNKGGEIGE  174



>sp|Q9SMJ3.1|ZDS_CAPAN RecName: Full=Zeta-carotene desaturase, chloroplastic/chromoplastic; 
AltName: Full=9,9'-di-cis-zeta-carotene desaturase; 
AltName: Full=Carotene 7,8-desaturase; Flags: Precursor [Capsicum 
annuum]
 gb|AAB35386.1| zeta-carotene desaturase, CapZDS=phytoene desaturase homolog 
[Capsicum annuum, early ripening fruit, Peptide, 588 aa]
 emb|CAA61985.1| zeta-carotene /neurosporene dehydrogenase (desaturase) [Capsicum 
annuum]
Length=588

 Score =   261 bits (668),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 130/130 (100%), Gaps = 0/130 (0%)
 Frame = +2

Query  251  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  430
            KSVIR+DL+SMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  45   KSVIRADLNSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  104

Query  431  VDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHT  610
            VDIY+S++FIGGKVGSFVD+RGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVK+HTHT
Sbjct  105  VDIYESRTFIGGKVGSFVDKRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKEHTHT  164

Query  611  FVNKGGDIGE  640
            FVNKGG+IGE
Sbjct  165  FVNKGGEIGE  174



>prf||2121278A zeta carotene desaturase
Length=588

 Score =   261 bits (668),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 130/130 (100%), Gaps = 0/130 (0%)
 Frame = +2

Query  251  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  430
            KSVIR+DL+SMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  45   KSVIRADLNSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  104

Query  431  VDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHT  610
            VDIY+S++FIGGKVGSFVD+RGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVK+HTHT
Sbjct  105  VDIYESRTFIGGKVGSFVDKRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKEHTHT  164

Query  611  FVNKGGDIGE  640
            FVNKGG+IGE
Sbjct  165  FVNKGGEIGE  174



>gb|AIX87496.1| zeta-carotene desaturase [Lycium barbarum]
Length=588

 Score =   261 bits (667),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 123/130 (95%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +2

Query  251  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  430
            KSVIR+DLDSMVSDM TNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  45   KSVIRADLDSMVSDMGTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  104

Query  431  VDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHT  610
            VDIY S++FIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRL+KKVGAEKNLLVKDHTHT
Sbjct  105  VDIYGSRTFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLLKKVGAEKNLLVKDHTHT  164

Query  611  FVNKGGDIGE  640
            FVNKGG+IGE
Sbjct  165  FVNKGGEIGE  174



>gb|AGN03856.1| zeta-carotene desaturase [Scutellaria baicalensis]
Length=574

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/128 (95%), Positives = 126/128 (98%), Gaps = 0/128 (0%)
 Frame = +2

Query  257  VIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  436
             +RSDLDS VSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD
Sbjct  37   TLRSDLDSNVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  96

Query  437  IYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFV  616
            IYDS+SFIGGKVGSFVD++GNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFV
Sbjct  97   IYDSRSFIGGKVGSFVDKKGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFV  156

Query  617  NKGGDIGE  640
            NKGG+IGE
Sbjct  157  NKGGEIGE  164



>gb|AAT76050.1| zeta-carotene desaturase [Citrus clementina]
Length=263

 Score =   247 bits (631),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 115/128 (90%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +2

Query  257  VIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  436
             +R+ LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD
Sbjct  28   CVRASLDANVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  87

Query  437  IYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFV  616
            IY+S+SFIGGKVGSFVD+RGNHIEMGLHVFFGCYNNLFRLMKKVGA+KNLLVKDHTHTFV
Sbjct  88   IYESRSFIGGKVGSFVDKRGNHIEMGLHVFFGCYNNLFRLMKKVGADKNLLVKDHTHTFV  147

Query  617  NKGGDIGE  640
            N+GG+IGE
Sbjct  148  NQGGEIGE  155



>emb|CAD55814.2| putative zeta-carotene desaturase [Helianthus annuus]
 gb|AEI70832.1| zeta-carotene desaturase [Helianthus annuus]
Length=587

 Score =   256 bits (654),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 145/167 (87%), Gaps = 3/167 (2%)
 Frame = +2

Query  149  ICFPATRKG---TDFrsgstglllrsglrvstglrsrKSVIRSDLDSMVSDMSTNAPKGL  319
            +CFPAT      + F + ++ LL     R  T L+ RK+VIRSDLD  VSDM TNAPKGL
Sbjct  11   LCFPATSAAGTRSSFHTTTSTLLRCRRSRQLTRLKVRKAVIRSDLDRDVSDMRTNAPKGL  70

Query  320  FPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGN  499
            FPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIY+S++FIGGKVGSFVD++GN
Sbjct  71   FPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYESRTFIGGKVGSFVDKQGN  130

Query  500  HIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            HIEMGLHVFFGCYNNLFRL+KKVGAEKNLLVKDHTHTFVNKGG++GE
Sbjct  131  HIEMGLHVFFGCYNNLFRLLKKVGAEKNLLVKDHTHTFVNKGGELGE  177



>gb|AHA36972.1| zeta-carotene desaturase [Helianthus annuus]
Length=587

 Score =   254 bits (649),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 145/167 (87%), Gaps = 3/167 (2%)
 Frame = +2

Query  149  ICFPATRKG---TDFrsgstglllrsglrvstglrsrKSVIRSDLDSMVSDMSTNAPKGL  319
            +CFPAT      + F + ++ LL     R  T L+ RK+VIRSDLD  VSDM TNAPKGL
Sbjct  11   LCFPATSAAGTRSSFHTTTSTLLRCRRSRQLTRLKVRKAVIRSDLDRDVSDMRTNAPKGL  70

Query  320  FPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGN  499
            FPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIY+S++FIGGKVGSFVD++GN
Sbjct  71   FPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYESRTFIGGKVGSFVDKQGN  130

Query  500  HIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            HIEMGLHVFFGCYNNLFRL+KKVGA+KNLLVKDHTHTFVNKGG++GE
Sbjct  131  HIEMGLHVFFGCYNNLFRLLKKVGAKKNLLVKDHTHTFVNKGGELGE  177



>emb|CAD27442.1| putative zeta-carotene desaturase [Helianthus annuus]
Length=587

 Score =   254 bits (648),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 145/167 (87%), Gaps = 3/167 (2%)
 Frame = +2

Query  149  ICFPATRKG---TDFrsgstglllrsglrvstglrsrKSVIRSDLDSMVSDMSTNAPKGL  319
            +CFPAT      + F + ++ LL     R  T L+ RK+VIRSDLD  VSDM TNAPKGL
Sbjct  11   LCFPATSAAGTRSSFHTTTSTLLRCRRSRQLTRLKVRKAVIRSDLDRDVSDMRTNAPKGL  70

Query  320  FPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGN  499
            FPPEPEHYRGPKLKVAIIGAGLAGMSTAVELL+QGHEVDIY+S++FIGGKVGSFVD++GN
Sbjct  71   FPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLNQGHEVDIYESRTFIGGKVGSFVDKQGN  130

Query  500  HIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            HIEMGLHVFFGCYNNLFRL+KKVGAEKNLLVKDHTHTFVNKGG++GE
Sbjct  131  HIEMGLHVFFGCYNNLFRLLKKVGAEKNLLVKDHTHTFVNKGGELGE  177



>gb|ABB52070.1| putative zeta carotene desaturase [Daucus carota subsp. sativus]
Length=575

 Score =   253 bits (646),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +2

Query  257  VIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  436
            V+RSDL+  VSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD
Sbjct  39   VVRSDLEKNVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  98

Query  437  IYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFV  616
            IY+S+ FIGGKVGSFVD+RGNHIEMGLHVFFGCYNNLFRL+KKVGAEKNLLVKDHTHTFV
Sbjct  99   IYESRPFIGGKVGSFVDKRGNHIEMGLHVFFGCYNNLFRLLKKVGAEKNLLVKDHTHTFV  158

Query  617  NKGGDIGE  640
            NKGG+IGE
Sbjct  159  NKGGEIGE  166



>emb|CBI34203.3| unnamed protein product [Vitis vinifera]
Length=552

 Score =   252 bits (644),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 119/127 (94%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            +RS LDS VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  12   VRSSLDSDVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  71

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            Y+S+SFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGA+KNLLVKDHTHTFVN
Sbjct  72   YESRSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGADKNLLVKDHTHTFVN  131

Query  620  KGGDIGE  640
            KGG IGE
Sbjct  132  KGGQIGE  138



>gb|KEH43038.1| zeta-carotene desaturase [Medicago truncatula]
Length=446

 Score =   249 bits (636),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +2

Query  251  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  430
            K  +R  LDS VSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  37   KPRVRCSLDSNVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  96

Query  431  VDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHT  610
            VDIY+S++FIGGKVGSFVD+RGNHIEMGLHVFFGCYNNLFRL+KKVGAE NLLVKDHTHT
Sbjct  97   VDIYESRTFIGGKVGSFVDKRGNHIEMGLHVFFGCYNNLFRLLKKVGAENNLLVKDHTHT  156

Query  611  FVNKGGDIGE  640
            FVNKGG IGE
Sbjct  157  FVNKGGQIGE  166



>emb|CDP08546.1| unnamed protein product [Coffea canephora]
Length=594

 Score =   253 bits (645),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/129 (92%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = +2

Query  254  SVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEV  433
            S++RSDLDS VSDM  NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEV
Sbjct  52   SIVRSDLDSNVSDMRNNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEV  111

Query  434  DIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTF  613
            DIY+S SFIGGKVGSFVD+RGNHIEMGLHVFFGCYNNLFRLMKKVGA+KNLLVKDHTHTF
Sbjct  112  DIYESHSFIGGKVGSFVDKRGNHIEMGLHVFFGCYNNLFRLMKKVGADKNLLVKDHTHTF  171

Query  614  VNKGGDIGE  640
            VNKGG+IGE
Sbjct  172  VNKGGEIGE  180



>sp|Q9FV46.1|ZDS_TARER RecName: Full=Zeta-carotene desaturase, chloroplastic/chromoplastic; 
AltName: Full=9,9'-di-cis-zeta-carotene desaturase; 
AltName: Full=Carotene 7,8-desaturase; Flags: Precursor [Tagetes 
erecta]
 gb|AAG10425.1| zeta desaturase [Tagetes erecta]
Length=587

 Score =   253 bits (645),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 143/167 (86%), Gaps = 4/167 (2%)
 Frame = +2

Query  149  ICFPATRKG---TDFrsgstglllrsglrvstglrsrKSVIRSDLDSMVSDMSTNAPKGL  319
            +CFPAT      T FR+  T L  R   +++      K+V+RSDLD  VSDM TNAPKGL
Sbjct  12   LCFPATSAAGARTSFRTTDTFLRYRRSRQLTRLKVR-KAVVRSDLDRDVSDMRTNAPKGL  70

Query  320  FPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGN  499
            FPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIY+S++FIGGKVGSFVD++GN
Sbjct  71   FPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYESRTFIGGKVGSFVDKQGN  130

Query  500  HIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            HIEMGLHVFFGCYNNLFRL+KKVGAEKNLLVKDHTHTFVN+GG++GE
Sbjct  131  HIEMGLHVFFGCYNNLFRLLKKVGAEKNLLVKDHTHTFVNRGGELGE  177



>emb|CAN65781.1| hypothetical protein VITISV_010561 [Vitis vinifera]
Length=576

 Score =   252 bits (644),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/127 (94%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            +RS LDS VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  43   VRSSLDSDVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  102

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            Y+S+SFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGA+KNLLVKDHTHTFVN
Sbjct  103  YESRSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGADKNLLVKDHTHTFVN  162

Query  620  KGGDIGE  640
            KGG IGE
Sbjct  163  KGGQIGE  169



>ref|XP_002277348.2| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
[Vitis vinifera]
Length=583

 Score =   252 bits (644),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/127 (94%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            +RS LDS VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  43   VRSSLDSDVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  102

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            Y+S+SFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGA+KNLLVKDHTHTFVN
Sbjct  103  YESRSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGADKNLLVKDHTHTFVN  162

Query  620  KGGDIGE  640
            KGG IGE
Sbjct  163  KGGQIGE  169



>gb|AFP28797.1| zeta-carotene desaturase 1 [Vitis vinifera]
Length=583

 Score =   251 bits (642),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/127 (93%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            +RS LDS VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD+
Sbjct  43   VRSSLDSDVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDV  102

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            Y+S+SFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGA+KNLLVKDHTHTFVN
Sbjct  103  YESRSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGADKNLLVKDHTHTFVN  162

Query  620  KGGDIGE  640
            KGG IGE
Sbjct  163  KGGQIGE  169



>ref|XP_002319628.1| hypothetical protein POPTR_0013s03470g [Populus trichocarpa]
 gb|EEE95551.1| hypothetical protein POPTR_0013s03470g [Populus trichocarpa]
Length=582

 Score =   251 bits (642),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 125/131 (95%), Gaps = 3/131 (2%)
 Frame = +2

Query  257  VIRSDLDSM---VSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGH  427
             +RS LDS+   VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGH
Sbjct  38   TVRSALDSLETNVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGH  97

Query  428  EVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTH  607
            EVDIYDS+SFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGA+KNLLVKDHTH
Sbjct  98   EVDIYDSRSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGADKNLLVKDHTH  157

Query  608  TFVNKGGDIGE  640
            TFVNKGG+IGE
Sbjct  158  TFVNKGGEIGE  168



>dbj|BAE79555.1| zeta-carotene desaturase [Chrysanthemum x morifolium]
Length=584

 Score =   251 bits (641),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 131/173 (76%), Positives = 145/173 (84%), Gaps = 1/173 (1%)
 Frame = +2

Query  125  MaaassasICFPATRK-GTDFrsgstglllrsglrvstglrsrKSVIRSDLDSMVSDMST  301
            MA +S++S+CFPAT   GT     +    LR     +  L   K V+RSDLD  VSDM T
Sbjct  2    MATSSTSSLCFPATSAAGTRHSFPTNDTFLRCNRHRNRQLNRLKFVVRSDLDKDVSDMRT  61

Query  302  NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSF  481
            NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIY+S++FIGGKVGSF
Sbjct  62   NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYESRTFIGGKVGSF  121

Query  482  VDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            VD+ GNHIEMGLHVFFGCYNNLFRL+KKVGAEKNLLVKDHTHTFVN+GG+IGE
Sbjct  122  VDKGGNHIEMGLHVFFGCYNNLFRLLKKVGAEKNLLVKDHTHTFVNRGGEIGE  174



>ref|XP_010025059.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic-like 
[Eucalyptus grandis]
 gb|KCW61653.1| hypothetical protein EUGRSUZ_H04384 [Eucalyptus grandis]
Length=581

 Score =   251 bits (641),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +2

Query  257  VIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  436
             +RS LDS VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD
Sbjct  39   CVRSSLDSNVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  98

Query  437  IYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFV  616
            IY+S+SFIGGKVGSFVD+RGNH+EMGLHVFFGCYNNLFRLMKKVGAE+NLLVKDH+HTFV
Sbjct  99   IYESRSFIGGKVGSFVDKRGNHVEMGLHVFFGCYNNLFRLMKKVGAEQNLLVKDHSHTFV  158

Query  617  NKGGDIGE  640
            NKGG+IGE
Sbjct  159  NKGGEIGE  166



>ref|XP_010041364.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic-like 
[Eucalyptus grandis]
 gb|KCW44410.1| hypothetical protein EUGRSUZ_L02103 [Eucalyptus grandis]
Length=581

 Score =   251 bits (640),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +2

Query  257  VIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  436
             +RS LDS VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD
Sbjct  39   CVRSSLDSNVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  98

Query  437  IYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFV  616
            IY+S+SFIGGKVGSFVD+RGNH+EMGLHVFFGCYNNLFRLMKKVGAE+NLLVKDH+HTFV
Sbjct  99   IYESRSFIGGKVGSFVDKRGNHVEMGLHVFFGCYNNLFRLMKKVGAEQNLLVKDHSHTFV  158

Query  617  NKGGDIGE  640
            NKGG+IGE
Sbjct  159  NKGGEIGE  166



>gb|AAK51557.1|AF372617_1 zeta-carotene desaturase precursor [Citrus x paradisi]
Length=570

 Score =   250 bits (639),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +2

Query  257  VIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  436
             +R+ LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD
Sbjct  28   CVRASLDANVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  87

Query  437  IYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFV  616
            IY+S+SFIGGKVGSFVD+RGNHIEMGLHVFFGCYNNLFRLMKKVGA+KNLLVKDHTHTFV
Sbjct  88   IYESRSFIGGKVGSFVDKRGNHIEMGLHVFFGCYNNLFRLMKKVGADKNLLVKDHTHTFV  147

Query  617  NKGGDIGE  640
            NKGG+IGE
Sbjct  148  NKGGEIGE  155



>dbj|BAA88843.1| zeta-Carotene Desaturase [Gentiana lutea]
 gb|ACF21785.1| zeta-carotene desaturase [Gentiana lutea]
Length=587

 Score =   251 bits (640),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +2

Query  257  VIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  436
             +RSDLDS VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD
Sbjct  46   TVRSDLDSNVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  105

Query  437  IYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFV  616
            IY+S+ FIGGKVGSFVD+ GNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFV
Sbjct  106  IYESRPFIGGKVGSFVDKGGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFV  165

Query  617  NKGGDIGE  640
            NKGG+IGE
Sbjct  166  NKGGEIGE  173



>ref|XP_004495784.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic-like 
isoform X1 [Cicer arietinum]
 ref|XP_004495785.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic-like 
isoform X2 [Cicer arietinum]
Length=582

 Score =   250 bits (639),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +2

Query  251  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  430
            K+ +RS LDS VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  40   KARVRSSLDSNVSDMSINAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  99

Query  431  VDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHT  610
            VDIY+S+SFIGGKVGSFVD+RGNHIEMGLHVFFGCYNNLFRLMKKVGA+ NLLVKDHTHT
Sbjct  100  VDIYESRSFIGGKVGSFVDKRGNHIEMGLHVFFGCYNNLFRLMKKVGADNNLLVKDHTHT  159

Query  611  FVNKGGDIGE  640
            FVNKGG IGE
Sbjct  160  FVNKGGQIGE  169



>gb|KEH43037.1| zeta-carotene desaturase [Medicago truncatula]
Length=557

 Score =   249 bits (637),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +2

Query  251  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  430
            K  +R  LDS VSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  37   KPRVRCSLDSNVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  96

Query  431  VDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHT  610
            VDIY+S++FIGGKVGSFVD+RGNHIEMGLHVFFGCYNNLFRL+KKVGAE NLLVKDHTHT
Sbjct  97   VDIYESRTFIGGKVGSFVDKRGNHIEMGLHVFFGCYNNLFRLLKKVGAENNLLVKDHTHT  156

Query  611  FVNKGGDIGE  640
            FVNKGG IGE
Sbjct  157  FVNKGGQIGE  166



>gb|ACE79169.1| zeta carotene desaturase [Citrus maxima]
Length=570

 Score =   249 bits (637),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/128 (90%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +2

Query  257  VIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  436
             +R+ LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD
Sbjct  28   CVRASLDANVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  87

Query  437  IYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFV  616
            +Y+S+SFIGGKVGSFVD+RGNHIEMGLHVFFGCYNNLFRLMKKVGA+KNLLVKDHTHTFV
Sbjct  88   VYESRSFIGGKVGSFVDKRGNHIEMGLHVFFGCYNNLFRLMKKVGADKNLLVKDHTHTFV  147

Query  617  NKGGDIGE  640
            NKGG+IGE
Sbjct  148  NKGGEIGE  155



>gb|KJB82544.1| hypothetical protein B456_013G201600 [Gossypium raimondii]
Length=566

 Score =   249 bits (637),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            ++S LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  26   VKSSLDNNVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  85

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            Y+S+SFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGA+KNLLVKDHTHTFVN
Sbjct  86   YESRSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGADKNLLVKDHTHTFVN  145

Query  620  KGGDIGE  640
            KGG++GE
Sbjct  146  KGGELGE  152



>ref|XP_003591015.1| Zeta-carotene desaturase [Medicago truncatula]
Length=587

 Score =   250 bits (638),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +2

Query  251  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  430
            K  +R  LDS VSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  37   KPRVRCSLDSNVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  96

Query  431  VDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHT  610
            VDIY+S++FIGGKVGSFVD+RGNHIEMGLHVFFGCYNNLFRL+KKVGAE NLLVKDHTHT
Sbjct  97   VDIYESRTFIGGKVGSFVDKRGNHIEMGLHVFFGCYNNLFRLLKKVGAENNLLVKDHTHT  156

Query  611  FVNKGGDIGE  640
            FVNKGG IGE
Sbjct  157  FVNKGGQIGE  166



>ref|NP_001275793.1| ZDS [Citrus sinensis]
 emb|CAC85667.1| zeta-carotene desaturase [Citrus sinensis]
Length=570

 Score =   249 bits (637),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/128 (90%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +2

Query  257  VIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  436
             +R+ LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD
Sbjct  28   CVRASLDANVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  87

Query  437  IYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFV  616
            IY+S+SFIGGKVGSFVD+RGNHIEMGLHVFFGCYNNLFRLMKKVGA+KNLLVKDHTHTFV
Sbjct  88   IYESRSFIGGKVGSFVDKRGNHIEMGLHVFFGCYNNLFRLMKKVGADKNLLVKDHTHTFV  147

Query  617  NKGGDIGE  640
            N+GG+IGE
Sbjct  148  NQGGEIGE  155



>gb|KHG06842.1| Zeta-carotene desaturase, chloroplastic/chromoplastic [Gossypium 
arboreum]
Length=566

 Score =   249 bits (636),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            ++S LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  26   VKSSLDNNVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  85

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            Y+S+SFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGA+KNLLVKDHTHTFVN
Sbjct  86   YESRSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGADKNLLVKDHTHTFVN  145

Query  620  KGGDIGE  640
            KGG++GE
Sbjct  146  KGGELGE  152



>gb|AES61266.2| zeta-carotene desaturase [Medicago truncatula]
Length=579

 Score =   249 bits (637),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +2

Query  251  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  430
            K  +R  LDS VSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  37   KPRVRCSLDSNVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  96

Query  431  VDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHT  610
            VDIY+S++FIGGKVGSFVD+RGNHIEMGLHVFFGCYNNLFRL+KKVGAE NLLVKDHTHT
Sbjct  97   VDIYESRTFIGGKVGSFVDKRGNHIEMGLHVFFGCYNNLFRLLKKVGAENNLLVKDHTHT  156

Query  611  FVNKGGDIGE  640
            FVNKGG IGE
Sbjct  157  FVNKGGQIGE  166



>dbj|BAB68552.1| zeta-carotene desaturase [Citrus unshiu]
Length=570

 Score =   249 bits (636),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/128 (90%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +2

Query  257  VIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  436
             +R+ LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD
Sbjct  28   CVRASLDANVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  87

Query  437  IYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFV  616
            IY+S+SFIGGKVGSFVD+RGNHIEMGLHVFFGCYNNLFRLMKKVGA+KNLLVKDHTHTFV
Sbjct  88   IYESRSFIGGKVGSFVDKRGNHIEMGLHVFFGCYNNLFRLMKKVGADKNLLVKDHTHTFV  147

Query  617  NKGGDIGE  640
            N+GG+IGE
Sbjct  148  NQGGEIGE  155



>gb|ABC33728.1| zeta-carotene desaturase [Citrus unshiu]
Length=570

 Score =   248 bits (634),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/128 (89%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +2

Query  257  VIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  436
             +R+ LD+ VSDMS NAP+GLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD
Sbjct  28   CVRASLDANVSDMSVNAPQGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  87

Query  437  IYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFV  616
            IY+S+SFIGGKVGSFVD+RGNHIEMGLHVFFGCYNNLFRLMKKVGA+KNLLVKDHTHTFV
Sbjct  88   IYESRSFIGGKVGSFVDKRGNHIEMGLHVFFGCYNNLFRLMKKVGADKNLLVKDHTHTFV  147

Query  617  NKGGDIGE  640
            N+GG+IGE
Sbjct  148  NQGGEIGE  155



>ref|XP_007030628.1| Zeta-carotene desaturase [Theobroma cacao]
 gb|EOY11130.1| Zeta-carotene desaturase [Theobroma cacao]
Length=580

 Score =   249 bits (635),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = +2

Query  251  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  430
            K  ++S LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  23   KLFVKSSLDTSVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  82

Query  431  VDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHT  610
            VDIY+S+SFIGGKVGSFVDR+GNHIEMGLHVFFGCYNNLFRLMKKVGA+KNLLVKDHTHT
Sbjct  83   VDIYESRSFIGGKVGSFVDRKGNHIEMGLHVFFGCYNNLFRLMKKVGADKNLLVKDHTHT  142

Query  611  FVNKGGDIG  637
            FVNKGG+IG
Sbjct  143  FVNKGGEIG  151



>ref|XP_011032463.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
[Populus euphratica]
Length=589

 Score =   249 bits (635),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 124/131 (95%), Gaps = 3/131 (2%)
 Frame = +2

Query  257  VIRSDLDSM---VSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGH  427
             +RS LDS+   VSDMS NAPKGLFPPEP HYRGPKLKVAIIGAGLAGMSTAVELLDQGH
Sbjct  45   TVRSALDSLETKVSDMSVNAPKGLFPPEPAHYRGPKLKVAIIGAGLAGMSTAVELLDQGH  104

Query  428  EVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTH  607
            EVDIYDS+SFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGA+KNLLVKDHTH
Sbjct  105  EVDIYDSRSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGADKNLLVKDHTH  164

Query  608  TFVNKGGDIGE  640
            TFVNKGG+IGE
Sbjct  165  TFVNKGGEIGE  175



>ref|XP_006382767.1| hypothetical protein POPTR_0005s05230g [Populus trichocarpa]
 gb|ERP60564.1| hypothetical protein POPTR_0005s05230g [Populus trichocarpa]
Length=589

 Score =   249 bits (635),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 124/131 (95%), Gaps = 3/131 (2%)
 Frame = +2

Query  257  VIRSDLDSM---VSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGH  427
             +RS LDS+   VSDMS NAPKGLFPPEP HYRGPKLKVAIIGAGLAGMSTAVELLDQGH
Sbjct  45   TVRSALDSLETKVSDMSVNAPKGLFPPEPAHYRGPKLKVAIIGAGLAGMSTAVELLDQGH  104

Query  428  EVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTH  607
            EVDIYDS+SFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGA+KNLLVKDHTH
Sbjct  105  EVDIYDSRSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGADKNLLVKDHTH  164

Query  608  TFVNKGGDIGE  640
            TFVNKGG+IGE
Sbjct  165  TFVNKGGEIGE  175



>gb|AEW70738.1| zeta-carotene desaturase [Ficus carica]
Length=581

 Score =   249 bits (635),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            +RS LDS +SDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  42   VRSSLDSNISDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  101

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            Y+S+ FIGGKVGSFVD+RGNHIEMGLHVFFGCYNNLFRLMKKVGA++NLLVKDHTHTFVN
Sbjct  102  YESRPFIGGKVGSFVDKRGNHIEMGLHVFFGCYNNLFRLMKKVGADQNLLVKDHTHTFVN  161

Query  620  KGGDIGE  640
            KGG+IGE
Sbjct  162  KGGEIGE  168



>gb|KJB45011.1| hypothetical protein B456_007G284900 [Gossypium raimondii]
Length=401

 Score =   243 bits (621),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            ++S LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  26   VKSSLDTNVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  85

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            ++S+ FIGGKVGSFVDR+GNHIEMGLHVFFGCYNNLFRLMKKVGA++NLLVKDHTHTFVN
Sbjct  86   FESRPFIGGKVGSFVDRKGNHIEMGLHVFFGCYNNLFRLMKKVGADQNLLVKDHTHTFVN  145

Query  620  KGGDIGE  640
            KGG+IGE
Sbjct  146  KGGEIGE  152



>gb|KJB45012.1| hypothetical protein B456_007G284900 [Gossypium raimondii]
Length=430

 Score =   244 bits (623),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            ++S LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  26   VKSSLDTNVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  85

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            ++S+ FIGGKVGSFVDR+GNHIEMGLHVFFGCYNNLFRLMKKVGA++NLLVKDHTHTFVN
Sbjct  86   FESRPFIGGKVGSFVDRKGNHIEMGLHVFFGCYNNLFRLMKKVGADQNLLVKDHTHTFVN  145

Query  620  KGGDIGE  640
            KGG+IGE
Sbjct  146  KGGEIGE  152



>gb|KDP23635.1| hypothetical protein JCGZ_23468 [Jatropha curcas]
Length=586

 Score =   248 bits (634),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 125/132 (95%), Gaps = 3/132 (2%)
 Frame = +2

Query  254  SVIRSDLDSM---VSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQG  424
            S +RS LDS+   VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQG
Sbjct  41   SFVRSALDSLETKVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQG  100

Query  425  HEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHT  604
            HEVDIY+S+SFIGGKVGSFVD+RGNHIEMGLHVFFGCYNNLFRLMKKVGA+KNLLVKDHT
Sbjct  101  HEVDIYESRSFIGGKVGSFVDKRGNHIEMGLHVFFGCYNNLFRLMKKVGADKNLLVKDHT  160

Query  605  HTFVNKGGDIGE  640
            HTFVNKGG IGE
Sbjct  161  HTFVNKGGKIGE  172



>gb|KJB45013.1| hypothetical protein B456_007G284900 [Gossypium raimondii]
Length=432

 Score =   244 bits (623),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            ++S LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  26   VKSSLDTNVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  85

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            ++S+ FIGGKVGSFVDR+GNHIEMGLHVFFGCYNNLFRLMKKVGA++NLLVKDHTHTFVN
Sbjct  86   FESRPFIGGKVGSFVDRKGNHIEMGLHVFFGCYNNLFRLMKKVGADQNLLVKDHTHTFVN  145

Query  620  KGGDIGE  640
            KGG+IGE
Sbjct  146  KGGEIGE  152



>gb|AFK39985.1| unknown [Medicago truncatula]
Length=579

 Score =   248 bits (633),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +2

Query  251  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  430
            K  +R  LDS VSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  37   KPRVRCSLDSNVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  96

Query  431  VDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHT  610
            VDIY+S++FIG KVGSFVD+RGNHIEMGLHVFFGCYNNLFRL+KKVGAE NLLVKDHTHT
Sbjct  97   VDIYESRTFIGAKVGSFVDKRGNHIEMGLHVFFGCYNNLFRLLKKVGAENNLLVKDHTHT  156

Query  611  FVNKGGDIGE  640
            FVNKGG IGE
Sbjct  157  FVNKGGQIGE  166



>gb|ACO40527.1| zeta-carotene desaturase [Carica papaya]
Length=572

 Score =   248 bits (632),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 125/133 (94%), Gaps = 3/133 (2%)
 Frame = +2

Query  251  KSVIRSDLDSM---VSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQ  421
            +  +RS LDS+   VSDMS NAPKGLFPPEPEHYRGPKLKVAI+GAGLAGMSTAVELLDQ
Sbjct  26   RVCVRSSLDSLETNVSDMSVNAPKGLFPPEPEHYRGPKLKVAIVGAGLAGMSTAVELLDQ  85

Query  422  GHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDH  601
            GHEVDIYD +SFIGGKVGSFVD+RGNHIEMGLHVFFGCYNNLFRLMKKVGA+KNLLVKDH
Sbjct  86   GHEVDIYDCRSFIGGKVGSFVDKRGNHIEMGLHVFFGCYNNLFRLMKKVGADKNLLVKDH  145

Query  602  THTFVNKGGDIGE  640
            THTFVN+GG+IGE
Sbjct  146  THTFVNEGGEIGE  158



>ref|XP_011091935.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic-like 
[Sesamum indicum]
Length=573

 Score =   248 bits (632),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +2

Query  257  VIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  436
            V+RSDLDS VSDMS NA KGLFPPEPE YRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD
Sbjct  36   VVRSDLDSNVSDMSVNAAKGLFPPEPERYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  95

Query  437  IYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFV  616
            IY+S+SFIGGKVGSFVD++GNHIEMGLHVFFGCYNNLFRLMKKVGA+KNLLVKDHTHTFV
Sbjct  96   IYESRSFIGGKVGSFVDKQGNHIEMGLHVFFGCYNNLFRLMKKVGADKNLLVKDHTHTFV  155

Query  617  NKGGDIGE  640
            NKGG+IGE
Sbjct  156  NKGGEIGE  163



>gb|AFH53817.1| zeta-carotene desaturase [Narcissus tazetta var. chinensis]
Length=574

 Score =   247 bits (630),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            IRS LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  33   IRSALDTKVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  92

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            Y+S+ FIGGKVGSFVD+RGNHIEMGLHVFFGCYNNLFRLMKKVGA++NLLVKDHTHTFVN
Sbjct  93   YESRQFIGGKVGSFVDKRGNHIEMGLHVFFGCYNNLFRLMKKVGADENLLVKDHTHTFVN  152

Query  620  KGGDIGE  640
            +GG+IGE
Sbjct  153  RGGEIGE  159



>ref|XP_004142522.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic-like 
[Cucumis sativus]
 gb|KGN66802.1| hypothetical protein Csa_1G695370 [Cucumis sativus]
Length=576

 Score =   247 bits (630),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +2

Query  251  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  430
            K +++S LD  VSDMS NAPKGLFPPEPE YRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  37   KFLVKSSLDKDVSDMSVNAPKGLFPPEPERYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  96

Query  431  VDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHT  610
            VDIY+S++FIGGKVGSFVD+RGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHT
Sbjct  97   VDIYESRTFIGGKVGSFVDKRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHT  156

Query  611  FVNKGGDIGE  640
            FVNKGG+IGE
Sbjct  157  FVNKGGEIGE  166



>ref|XP_010550937.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
[Tarenaya hassleriana]
Length=569

 Score =   247 bits (630),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  257  VIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  436
             +RS LD+ VSDMS NAPKGLFPPEPE Y+GPKLKVAIIGAGLAGMSTAVELLDQGHEVD
Sbjct  27   CLRSSLDTDVSDMSVNAPKGLFPPEPEPYKGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  86

Query  437  IYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFV  616
            IY+S+ FIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFV
Sbjct  87   IYESRPFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFV  146

Query  617  NKGGDIGE  640
            NKGG+IGE
Sbjct  147  NKGGEIGE  154



>sp|O49901.1|ZDS_NARPS RecName: Full=Zeta-carotene desaturase, chloroplastic/chromoplastic; 
AltName: Full=9,9'-di-cis-zeta-carotene desaturase; 
AltName: Full=Carotene 7,8-desaturase; Flags: Precursor [Narcissus 
pseudonarcissus]
 emb|CAA12062.1| zeta-carotene desaturase [Narcissus pseudonarcissus]
Length=574

 Score =   247 bits (630),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            IRS LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  33   IRSALDTKVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  92

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            Y+S+ FIGGKVGSFVD+RGNHIEMGLHVFFGCYNNLFRLMKKVGA++NLLVKDHTHTFVN
Sbjct  93   YESRQFIGGKVGSFVDKRGNHIEMGLHVFFGCYNNLFRLMKKVGADENLLVKDHTHTFVN  152

Query  620  KGGDIGE  640
            +GG+IGE
Sbjct  153  RGGEIGE  159



>gb|ACB87206.1| zeta-carotene desaturase [Narcissus tazetta var. chinensis]
Length=574

 Score =   247 bits (630),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            IRS LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  33   IRSALDTKVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  92

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            Y+S+ FIGGKVGSFVD+RGNHIEMGLHVFFGCYNNLFRLMKKVGA++NLLVKDHTHTFVN
Sbjct  93   YESRQFIGGKVGSFVDKRGNHIEMGLHVFFGCYNNLFRLMKKVGADENLLVKDHTHTFVN  152

Query  620  KGGDIGE  640
            +GG+IGE
Sbjct  153  RGGEIGE  159



>ref|XP_008462722.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
[Cucumis melo]
 gb|AID51465.1| zeta-carotene desaturase [Cucumis melo var. makuwa]
Length=576

 Score =   247 bits (630),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +2

Query  251  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  430
            K +++S LD  VSDMS NAPKGLFPPEPE YRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  37   KFLVKSSLDKDVSDMSVNAPKGLFPPEPERYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  96

Query  431  VDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHT  610
            VDIY+S++FIGGKVGSFVD+RGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHT
Sbjct  97   VDIYESRTFIGGKVGSFVDKRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHT  156

Query  611  FVNKGGDIGE  640
            FVNKGG+IGE
Sbjct  157  FVNKGGEIGE  166



>gb|ACR61394.1| zeta-carotene desaturase protein [Fragaria x ananassa]
Length=569

 Score =   246 bits (629),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = +2

Query  263  RSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIY  442
            RS LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIY
Sbjct  32   RSSLDTNVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIY  91

Query  443  DSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVNK  622
            +S+ FIGGKVGSFVD+RGNHIEMGLHVFFGCY+NLFRLMKKVGAE+NLLVKDHTHTFVNK
Sbjct  92   ESRPFIGGKVGSFVDKRGNHIEMGLHVFFGCYSNLFRLMKKVGAEENLLVKDHTHTFVNK  151

Query  623  GGDIGE  640
            GG IGE
Sbjct  152  GGQIGE  157



>ref|XP_010256023.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
isoform X2 [Nelumbo nucifera]
Length=546

 Score =   246 bits (627),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            +RS LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  46   VRSSLDTNVSDMSINAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  105

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            Y+S+SFIGGKVGSFVD+ GNHIEMGLHVFFGCYNNLFRLMKKVGA++NLLVKDHTHTFVN
Sbjct  106  YESRSFIGGKVGSFVDKHGNHIEMGLHVFFGCYNNLFRLMKKVGADRNLLVKDHTHTFVN  165

Query  620  KGGDIGE  640
            KGG IGE
Sbjct  166  KGGQIGE  172



>gb|AJB84621.1| zeta-carotene desaturase [Camellia sinensis]
Length=582

 Score =   246 bits (629),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            +R  LDS VSDMS NAPKGLFP EPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  45   VRCSLDSNVSDMSVNAPKGLFPSEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  104

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            Y+S+SFIGGKVGSFVD+RGNHIEMGLHVFFGCYNNLFRLMKKVGA+KNLLVKDHTHTFVN
Sbjct  105  YESRSFIGGKVGSFVDKRGNHIEMGLHVFFGCYNNLFRLMKKVGADKNLLVKDHTHTFVN  164

Query  620  KGGDIGE  640
            KGG+IGE
Sbjct  165  KGGEIGE  171



>ref|XP_004155720.1| PREDICTED: LOW QUALITY PROTEIN: zeta-carotene desaturase, chloroplastic/chromoplastic-like 
[Cucumis sativus]
Length=612

 Score =   247 bits (630),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +2

Query  251  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  430
            K +++S LD  VSDMS NAPKGLFPPEPE YRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  73   KFLVKSSLDKDVSDMSVNAPKGLFPPEPERYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  132

Query  431  VDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHT  610
            VDIY+S++FIGGKVGSFVD+RGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHT
Sbjct  133  VDIYESRTFIGGKVGSFVDKRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHT  192

Query  611  FVNKGGDIGE  640
            FVNKGG+IGE
Sbjct  193  FVNKGGEIGE  202



>ref|XP_010256022.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
isoform X1 [Nelumbo nucifera]
Length=586

 Score =   246 bits (629),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            +RS LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  46   VRSSLDTNVSDMSINAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  105

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            Y+S+SFIGGKVGSFVD+ GNHIEMGLHVFFGCYNNLFRLMKKVGA++NLLVKDHTHTFVN
Sbjct  106  YESRSFIGGKVGSFVDKHGNHIEMGLHVFFGCYNNLFRLMKKVGADRNLLVKDHTHTFVN  165

Query  620  KGGDIGE  640
            KGG IGE
Sbjct  166  KGGQIGE  172



>ref|XP_008218201.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
[Prunus mume]
Length=571

 Score =   246 bits (627),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/128 (89%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +2

Query  257  VIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  436
             +RS LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD
Sbjct  30   CVRSSLDANVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  89

Query  437  IYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFV  616
            IY+S+ FIGGKVGSFVD+RGNHIEMGLHVFFGCY+NLFRLMKKVGA++NLLVKDHTHTFV
Sbjct  90   IYESRPFIGGKVGSFVDKRGNHIEMGLHVFFGCYSNLFRLMKKVGADENLLVKDHTHTFV  149

Query  617  NKGGDIGE  640
            NKGG+IGE
Sbjct  150  NKGGNIGE  157



>gb|AEK86566.1| chloroplast zeta-carotene desaturase [Cucurbita moschata]
Length=573

 Score =   246 bits (627),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 115/128 (90%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +2

Query  257  VIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  436
            ++RS LD+ VSDMS NAPK LFPPEPE YRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD
Sbjct  36   LVRSSLDTDVSDMSVNAPKELFPPEPERYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  95

Query  437  IYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFV  616
            IY+S++FIGGKVGSFVD+RGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFV
Sbjct  96   IYESRTFIGGKVGSFVDKRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFV  155

Query  617  NKGGDIGE  640
            NKGG+IGE
Sbjct  156  NKGGEIGE  163



>gb|AFH53814.1| zeta-carotene desaturase [Narcissus tazetta var. chinensis]
 gb|AFH53818.1| zeta-carotene desaturase [Narcissus tazetta var. chinensis]
Length=574

 Score =   245 bits (626),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            IRS LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  33   IRSALDTKVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  92

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            ++S+ FIGGKVGSFVD+RGNHIEMGLHVFFGCYNNLFRLMKKVGA++NLLVKDHTHTFVN
Sbjct  93   FESRQFIGGKVGSFVDKRGNHIEMGLHVFFGCYNNLFRLMKKVGADENLLVKDHTHTFVN  152

Query  620  KGGDIGE  640
            +GG+IGE
Sbjct  153  RGGEIGE  159



>gb|KHG15309.1| Zeta-carotene desaturase, chloroplastic/chromoplastic [Gossypium 
arboreum]
Length=564

 Score =   245 bits (625),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            ++S LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  26   VKSSLDTNVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  85

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            ++S+ FIGGKVGSFVDR+GNHIEMGLHVFFGCYNNLFRLMKKVGA++NLLVKDHTHTFVN
Sbjct  86   FESRPFIGGKVGSFVDRKGNHIEMGLHVFFGCYNNLFRLMKKVGADQNLLVKDHTHTFVN  145

Query  620  KGGDIGE  640
            KGG+IGE
Sbjct  146  KGGEIGE  152



>ref|XP_010090263.1| Zeta-carotene desaturase [Morus notabilis]
 gb|EXB39201.1| Zeta-carotene desaturase [Morus notabilis]
Length=581

 Score =   245 bits (626),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            +RS LD  VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  41   VRSSLDGNVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  100

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            Y+S+ FIGGKVGSFVD+RGNHIEMGLHVFFGCYNNLFRLMKKVGA++NLLVK+HTHTFVN
Sbjct  101  YESRPFIGGKVGSFVDKRGNHIEMGLHVFFGCYNNLFRLMKKVGADQNLLVKEHTHTFVN  160

Query  620  KGGDIGE  640
            KGG+IGE
Sbjct  161  KGGEIGE  167



>gb|KJB45010.1| hypothetical protein B456_007G284900 [Gossypium raimondii]
Length=566

 Score =   245 bits (625),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            ++S LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  26   VKSSLDTNVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  85

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            ++S+ FIGGKVGSFVDR+GNHIEMGLHVFFGCYNNLFRLMKKVGA++NLLVKDHTHTFVN
Sbjct  86   FESRPFIGGKVGSFVDRKGNHIEMGLHVFFGCYNNLFRLMKKVGADQNLLVKDHTHTFVN  145

Query  620  KGGDIGE  640
            KGG+IGE
Sbjct  146  KGGEIGE  152



>ref|XP_007144812.1| hypothetical protein PHAVU_007G186000g [Phaseolus vulgaris]
 gb|ESW16806.1| hypothetical protein PHAVU_007G186000g [Phaseolus vulgaris]
Length=581

 Score =   245 bits (625),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +2

Query  251  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  430
            KS +R  LD  VSDMS NAPKGLFPPEPEHYRGPKLKVAI+GAGLAGMSTAVELLDQGHE
Sbjct  39   KSRLRCSLDDNVSDMSVNAPKGLFPPEPEHYRGPKLKVAIVGAGLAGMSTAVELLDQGHE  98

Query  431  VDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHT  610
            VDIY+S+SFIGGKVGSFVD+RGNHIEMGLHVFFGCYNNLFRL+KKVGA  NLLVKDHTHT
Sbjct  99   VDIYESRSFIGGKVGSFVDKRGNHIEMGLHVFFGCYNNLFRLLKKVGAHNNLLVKDHTHT  158

Query  611  FVNKGGDIGE  640
            FVNKGG IGE
Sbjct  159  FVNKGGQIGE  168



>gb|ABG72806.2| zeta-carotene desaturase protein [Carica papaya]
Length=552

 Score =   244 bits (623),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 124/133 (93%), Gaps = 3/133 (2%)
 Frame = +2

Query  251  KSVIRSDLDSM---VSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQ  421
            +  +RS LDS+   VSDMS NAPKGLFPPEPEHYRGPKL+VAI+GAGLAGMSTAVELLDQ
Sbjct  26   RVCVRSSLDSLETNVSDMSVNAPKGLFPPEPEHYRGPKLEVAIVGAGLAGMSTAVELLDQ  85

Query  422  GHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDH  601
            GHEVDIYD +SFIGGKVGSF D+RGNHIEMGLHVFFGCYNNLFRLMKKVGA+KNLLVKDH
Sbjct  86   GHEVDIYDCRSFIGGKVGSFADKRGNHIEMGLHVFFGCYNNLFRLMKKVGADKNLLVKDH  145

Query  602  THTFVNKGGDIGE  640
            THTFVN+GG+IGE
Sbjct  146  THTFVNEGGEIGE  158



>gb|ABB52083.1| zeta carotene desaturase [Daucus carota subsp. sativus]
Length=573

 Score =   244 bits (622),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +2

Query  257  VIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  436
            ++RSDLD  VSDMS+NAPKGLFPPEP+ YRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD
Sbjct  37   LVRSDLDQNVSDMSSNAPKGLFPPEPQLYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  96

Query  437  IYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFV  616
            IY+S+ FIGGKVGSF D+RGNHIEMGLHVFFGCYNNLFRL+KKVGA+KNLLVK+HTHTFV
Sbjct  97   IYESRPFIGGKVGSFTDKRGNHIEMGLHVFFGCYNNLFRLLKKVGADKNLLVKEHTHTFV  156

Query  617  NKGGDIGE  640
            NKGG+IGE
Sbjct  157  NKGGEIGE  164



>ref|XP_011005691.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic-like 
[Populus euphratica]
 ref|XP_011005692.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic-like 
[Populus euphratica]
Length=592

 Score =   244 bits (622),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 124/130 (95%), Gaps = 3/130 (2%)
 Frame = +2

Query  260  IRSDLDSM---VSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  430
            +R+ LDS+   VSDMS NAPKGLFPPEPEH+RGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  49   VRAALDSLETNVSDMSVNAPKGLFPPEPEHHRGPKLKVAIIGAGLAGMSTAVELLDQGHE  108

Query  431  VDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHT  610
            VDIYDS+SFIGGKVGSFVDR GNHIEMGLHVFFGCYNNLFRLMKKVGA+KNLLVKDHTHT
Sbjct  109  VDIYDSRSFIGGKVGSFVDRCGNHIEMGLHVFFGCYNNLFRLMKKVGADKNLLVKDHTHT  168

Query  611  FVNKGGDIGE  640
            FVNKGG+IGE
Sbjct  169  FVNKGGEIGE  178



>gb|KHN16183.1| Zeta-carotene desaturase, chloroplastic/chromoplastic [Glycine 
soja]
Length=570

 Score =   243 bits (621),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +2

Query  251  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  430
            KS +R  LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  28   KSRLRCSLDANVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  87

Query  431  VDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHT  610
            VDIY+S+ FIGGKVGSFVD+ GNHIEMGLHVFFGCYNNLFRL+KKVGAE NLLVKDHTHT
Sbjct  88   VDIYESRPFIGGKVGSFVDKGGNHIEMGLHVFFGCYNNLFRLLKKVGAENNLLVKDHTHT  147

Query  611  FVNKGGDIGE  640
            FVNKGG IGE
Sbjct  148  FVNKGGQIGE  157



>ref|XP_003536112.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic-like 
[Glycine max]
Length=570

 Score =   243 bits (621),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +2

Query  251  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  430
            KS +R  LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  28   KSRLRCSLDANVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  87

Query  431  VDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHT  610
            VDIY+S+ FIGGKVGSFVD+ GNHIEMGLHVFFGCYNNLFRL+KKVGAE NLLVKDHTHT
Sbjct  88   VDIYESRPFIGGKVGSFVDKGGNHIEMGLHVFFGCYNNLFRLLKKVGAENNLLVKDHTHT  147

Query  611  FVNKGGDIGE  640
            FVNKGG IGE
Sbjct  148  FVNKGGQIGE  157



>ref|XP_003556484.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic-like 
[Glycine max]
 gb|KHN14723.1| Zeta-carotene desaturase, chloroplastic/chromoplastic [Glycine 
soja]
Length=570

 Score =   243 bits (620),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +2

Query  251  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  430
            KS +R  LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  28   KSRLRCSLDANVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  87

Query  431  VDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHT  610
            VDIY+S+ FIGGKVGSFVD+ GNHIEMGLHVFFGCYNNLFRLMKKVGA+ NLLVKDHTHT
Sbjct  88   VDIYESRPFIGGKVGSFVDKGGNHIEMGLHVFFGCYNNLFRLMKKVGADNNLLVKDHTHT  147

Query  611  FVNKGGDIGE  640
            FVNKGG IGE
Sbjct  148  FVNKGGQIGE  157



>emb|CDY41905.1| BnaC05g46990D [Brassica napus]
Length=561

 Score =   243 bits (619),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            +RS LD+ VSDMS NAPKGLFPPEP  Y+GPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  30   VRSSLDADVSDMSVNAPKGLFPPEPVPYKGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  89

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            YDS++FIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGA+KNLLVKDHTHTF+N
Sbjct  90   YDSRTFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGADKNLLVKDHTHTFIN  149

Query  620  KGGDIGE  640
            KG +IGE
Sbjct  150  KGSEIGE  156



>gb|AFH53813.1| zeta-carotene desaturase [Narcissus tazetta var. chinensis]
Length=574

 Score =   243 bits (620),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            IRS LD+ VSDMS NAPKGLFPPEPE+YRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  33   IRSALDTKVSDMSVNAPKGLFPPEPEYYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  92

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            Y+S+ FIGGKVGSFVD+RGNHIEMGLHVFFGCYNNLFRLMKKVGA++NLLVKDHTHTFVN
Sbjct  93   YESRQFIGGKVGSFVDKRGNHIEMGLHVFFGCYNNLFRLMKKVGADENLLVKDHTHTFVN  152

Query  620  KGGDIG  637
            +GG+IG
Sbjct  153  RGGEIG  158



>ref|XP_007204989.1| hypothetical protein PRUPE_ppa003478mg [Prunus persica]
 gb|EMJ06188.1| hypothetical protein PRUPE_ppa003478mg [Prunus persica]
Length=571

 Score =   243 bits (620),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  257  VIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  436
             +RS LD+ VSDMS NAPKGLFP EPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD
Sbjct  30   CVRSSLDTNVSDMSVNAPKGLFPAEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  89

Query  437  IYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFV  616
            IY+S+ FIGGKVGSFVD+RGNHIEMGLHVFFGCY+NLFRLMKKVGA++NLLVKDHTHTFV
Sbjct  90   IYESRPFIGGKVGSFVDKRGNHIEMGLHVFFGCYSNLFRLMKKVGADENLLVKDHTHTFV  149

Query  617  NKGGDIGE  640
            NKGG+IGE
Sbjct  150  NKGGNIGE  157



>ref|XP_004302025.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
[Fragaria vesca subsp. vesca]
Length=569

 Score =   242 bits (618),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 113/123 (92%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +2

Query  272  LDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSK  451
            LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIY+S+
Sbjct  35   LDTNVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYESR  94

Query  452  SFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGD  631
             FIGGKVGSFVD+RGNHIEMGLHVFFGCY+NLFRLMKKVGAE+NLLVKDHTHTFVNKGG 
Sbjct  95   PFIGGKVGSFVDKRGNHIEMGLHVFFGCYSNLFRLMKKVGAEENLLVKDHTHTFVNKGGQ  154

Query  632  IGE  640
            IGE
Sbjct  155  IGE  157



>ref|XP_002512239.1| Zeta-carotene desaturase, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF49691.1| Zeta-carotene desaturase, chloroplast precursor, putative [Ricinus 
communis]
Length=964

 Score =   248 bits (634),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 125/130 (96%), Gaps = 3/130 (2%)
 Frame = +2

Query  260  IRSDLDSM---VSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  430
            +RS LDS+   VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  45   VRSALDSLETKVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  104

Query  431  VDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHT  610
            VDIY+S++FIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGA+KNLLVK+HTHT
Sbjct  105  VDIYESRTFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGADKNLLVKEHTHT  164

Query  611  FVNKGGDIGE  640
            FVNKGGDIGE
Sbjct  165  FVNKGGDIGE  174



>ref|XP_010674842.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
[Beta vulgaris subsp. vulgaris]
Length=569

 Score =   242 bits (617),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            +R  LD+ VSDMSTNAPKGLFPPEP  Y+GPKLK+AIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  31   VRCSLDTDVSDMSTNAPKGLFPPEPALYKGPKLKIAIIGAGLAGMSTAVELLDQGHEVDI  90

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            Y+S+ F+GGKVGSFVD+RGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN
Sbjct  91   YESRPFVGGKVGSFVDKRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  150

Query  620  KGGDIGE  640
            KGG+IGE
Sbjct  151  KGGEIGE  157



>dbj|BAJ96277.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=568

 Score =   241 bits (616),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/128 (87%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  257  VIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  436
            V+R  LDS VSDM+ NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD
Sbjct  30   VVRCSLDSKVSDMAVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  89

Query  437  IYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFV  616
            +YDS++FIGGKVGSFVD++GNHIEMGLHVFFGCY+NLFRLMKKVGA+ NLLVK+HTHTFV
Sbjct  90   LYDSRTFIGGKVGSFVDKQGNHIEMGLHVFFGCYSNLFRLMKKVGADNNLLVKEHTHTFV  149

Query  617  NKGGDIGE  640
            NKGG +GE
Sbjct  150  NKGGIVGE  157



>gb|ACT87979.1| zeta carotene desaturase [Jatropha curcas]
Length=586

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 123/132 (93%), Gaps = 3/132 (2%)
 Frame = +2

Query  254  SVIRSDLDSM---VSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQG  424
            S +R+ LDS+   VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQG
Sbjct  41   SFVRAALDSLETKVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQG  100

Query  425  HEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHT  604
            HEVDIY+S+SFIGGKVGSFVD+RGNHIEMGLH  FGCYNNLFRLMKKVGA+KNLLVKDHT
Sbjct  101  HEVDIYESRSFIGGKVGSFVDKRGNHIEMGLHGLFGCYNNLFRLMKKVGADKNLLVKDHT  160

Query  605  HTFVNKGGDIGE  640
            HTFVNKGG IGE
Sbjct  161  HTFVNKGGKIGE  172



>ref|XP_009124205.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
[Brassica rapa]
Length=561

 Score =   241 bits (615),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            +R  LD+ VSDMS NAPKGLFPPEP  Y+GPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  30   VRCSLDADVSDMSVNAPKGLFPPEPVPYKGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  89

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            YDS++FIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGA+KNLLVKDHTHTF+N
Sbjct  90   YDSRTFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGADKNLLVKDHTHTFIN  149

Query  620  KGGDIGE  640
            KG +IGE
Sbjct  150  KGSEIGE  156



>ref|NP_187138.1| zeta-carotene desaturase [Arabidopsis thaliana]
 ref|NP_974222.1| zeta-carotene desaturase [Arabidopsis thaliana]
 sp|Q38893.3|ZDS_ARATH RecName: Full=Zeta-carotene desaturase, chloroplastic/chromoplastic; 
AltName: Full=9,9'-di-cis-zeta-carotene desaturase; 
AltName: Full=Carotene 7,8-desaturase; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG51402.1|AC009465_2 putative zeta-carotene desaturase precursor; 62103-58756 [Arabidopsis 
thaliana]
 gb|AAL24402.1| putative zeta-carotene desaturase precursor [Arabidopsis thaliana]
 gb|AAL59918.1| putative zeta-carotene desaturase precursor [Arabidopsis thaliana]
 gb|AAM20233.1| putative zeta-carotene desaturase precursor [Arabidopsis thaliana]
 gb|AEE74148.1| zeta-carotene desaturase [Arabidopsis thaliana]
 gb|AEE74149.1| zeta-carotene desaturase [Arabidopsis thaliana]
Length=558

 Score =   241 bits (615),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            + S LDS VSDMS NAPKGLFPPEP  Y+GPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  25   VNSSLDSDVSDMSVNAPKGLFPPEPVPYKGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  84

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            YDS++FIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTF+N
Sbjct  85   YDSRTFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFIN  144

Query  620  KGGDIGE  640
            K G IGE
Sbjct  145  KDGTIGE  151



>gb|ACM68701.1| zeta-carotene desaturase [Brassica rapa subsp. pekinensis]
Length=561

 Score =   241 bits (615),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            +R  LD+ VSDMS NAPKGLFPPEP  Y+GPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  30   VRCSLDADVSDMSVNAPKGLFPPEPVPYKGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  89

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            YDS++FIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGA+KNLLVKDHTHTF+N
Sbjct  90   YDSRTFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGADKNLLVKDHTHTFIN  149

Query  620  KGGDIGE  640
            KG +IGE
Sbjct  150  KGSEIGE  156



>gb|AAM63349.1| putative zeta-carotene desaturase precursor [Arabidopsis thaliana]
Length=558

 Score =   241 bits (615),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            + S LDS VSDMS NAPKGLFPPEP  Y+GPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  25   VNSSLDSDVSDMSVNAPKGLFPPEPVPYKGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  84

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            YDS++FIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTF+N
Sbjct  85   YDSRTFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFIN  144

Query  620  KGGDIGE  640
            K G IGE
Sbjct  145  KDGTIGE  151



>ref|XP_011078737.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
[Sesamum indicum]
Length=582

 Score =   241 bits (616),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            IRSDL+S VSDM  NAPKGLFPPEPEHY+GPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  49   IRSDLESNVSDMRVNAPKGLFPPEPEHYKGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  108

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            Y+S+SF+GGKVGS+VD++GNHIEMGLHVFFGCYNNLFRLMKKVGA+KNL+VKDHTH+FVN
Sbjct  109  YESRSFVGGKVGSYVDKQGNHIEMGLHVFFGCYNNLFRLMKKVGADKNLIVKDHTHSFVN  168

Query  620  KGGDIGE  640
            KGG IGE
Sbjct  169  KGGHIGE  175



>ref|XP_004955783.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic-like 
[Setaria italica]
Length=575

 Score =   241 bits (615),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +2

Query  254  SVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEV  433
            +V+R  LDS VSDM  NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEV
Sbjct  36   AVVRCSLDSNVSDMGVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEV  95

Query  434  DIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTF  613
            D+Y+S+ FIGGKVGSFVDR+GNHIEMGLHVFFGCY+NLFRLMKKVGA+ NLLVK+HTHTF
Sbjct  96   DLYESRPFIGGKVGSFVDRQGNHIEMGLHVFFGCYSNLFRLMKKVGADNNLLVKEHTHTF  155

Query  614  VNKGGDIGE  640
            VNKGG IGE
Sbjct  156  VNKGGTIGE  164



>gb|ABX45112.1| zeta-carotene desaturase [Narcissus tazetta var. chinensis]
Length=574

 Score =   241 bits (615),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            IRS LD+ VSDMS NAPKGLFPPEPE+YRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  33   IRSALDTKVSDMSVNAPKGLFPPEPEYYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  92

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            Y+S+ FIGGKVGSFVD+RGNHIEMGLHVFFGCYNNLFRLMKKVGA+++LLVKDHTHTFVN
Sbjct  93   YESRQFIGGKVGSFVDKRGNHIEMGLHVFFGCYNNLFRLMKKVGADEDLLVKDHTHTFVN  152

Query  620  KGGDIG  637
            +GG+IG
Sbjct  153  RGGEIG  158



>gb|AAF85796.1|AF121947_1 zeta-carotene desaturase precursor [Arabidopsis thaliana]
Length=558

 Score =   241 bits (614),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            + S LDS VSDMS NAPKGLFPPEP  Y+GPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  25   VNSSLDSDVSDMSVNAPKGLFPPEPVPYKGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  84

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            YDS++FIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTF+N
Sbjct  85   YDSRTFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFIN  144

Query  620  KGGDIGE  640
            K G IGE
Sbjct  145  KDGTIGE  151



>gb|AEN94305.1| zeta-carotene desaturase [Brassica napus]
 gb|AEN94306.1| zeta-carotene desaturase [Brassica napus]
 emb|CDY50762.1| BnaAnng10690D [Brassica napus]
Length=561

 Score =   241 bits (614),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            +R  LD+ VSDMS NAPKGLFPPEP  Y+GPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  30   VRCSLDADVSDMSVNAPKGLFPPEPVPYKGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  89

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            YDS++FIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGA+KNLLVKDHTHTF+N
Sbjct  90   YDSRTFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGADKNLLVKDHTHTFIN  149

Query  620  KGGDIGE  640
            KG +IGE
Sbjct  150  KGSEIGE  156



>ref|XP_010419722.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic-like 
[Camelina sativa]
 ref|XP_010419792.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic-like 
[Camelina sativa]
Length=562

 Score =   240 bits (613),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            + S LD+ VSDMS NAPKGLFPPEP  Y+GPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  29   VCSSLDADVSDMSVNAPKGLFPPEPVQYKGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  88

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            YDS++FIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTF+N
Sbjct  89   YDSRTFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFIN  148

Query  620  KGGDIGE  640
            K G IGE
Sbjct  149  KDGTIGE  155



>ref|XP_010463975.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
[Camelina sativa]
Length=562

 Score =   240 bits (613),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            + S LD+ VSDMS NAPKGLFPPEP  Y+GPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  29   VCSSLDADVSDMSVNAPKGLFPPEPVQYKGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  88

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            YDS++FIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTF+N
Sbjct  89   YDSRTFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFIN  148

Query  620  KGGDIGE  640
            K G IGE
Sbjct  149  KDGTIGE  155



>ref|XP_003557406.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
[Brachypodium distachyon]
Length=570

 Score =   240 bits (613),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  257  VIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  436
            V+R  LDS VSDM+ NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD
Sbjct  32   VVRCSLDSKVSDMAVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  91

Query  437  IYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFV  616
            +YD+++FIGGKVGSFVD++GNHIEMGLHVFFGCY+NLFRLMKKVGA+ NLLVK+HTHTFV
Sbjct  92   LYDTRTFIGGKVGSFVDKQGNHIEMGLHVFFGCYSNLFRLMKKVGADNNLLVKEHTHTFV  151

Query  617  NKGGDIGE  640
            N+GG +GE
Sbjct  152  NRGGKVGE  159



>ref|NP_001059145.1| Os07g0204900 [Oryza sativa Japonica Group]
 dbj|BAF21059.1| Os07g0204900 [Oryza sativa Japonica Group]
Length=578

 Score =   240 bits (612),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            +R  LDS VSDM+ NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD+
Sbjct  41   VRCSLDSNVSDMAVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDL  100

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            Y+S+ FIGGKVGSFVDR+GNHIEMGLHVFFGCY+NLFRLMKKVGA+ NLLVK+HTHTFVN
Sbjct  101  YESRPFIGGKVGSFVDRKGNHIEMGLHVFFGCYSNLFRLMKKVGADNNLLVKEHTHTFVN  160

Query  620  KGGDIGE  640
            KGG IGE
Sbjct  161  KGGTIGE  167



>dbj|BAC79799.1| putative zeta-carotene desaturase precursor [Oryza sativa Japonica 
Group]
 gb|EEC81707.1| hypothetical protein OsI_25316 [Oryza sativa Indica Group]
 gb|EEE66770.1| hypothetical protein OsJ_23495 [Oryza sativa Japonica Group]
Length=576

 Score =   240 bits (612),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            +R  LDS VSDM+ NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD+
Sbjct  39   VRCSLDSNVSDMAVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDL  98

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            Y+S+ FIGGKVGSFVDR+GNHIEMGLHVFFGCY+NLFRLMKKVGA+ NLLVK+HTHTFVN
Sbjct  99   YESRPFIGGKVGSFVDRKGNHIEMGLHVFFGCYSNLFRLMKKVGADNNLLVKEHTHTFVN  158

Query  620  KGGDIGE  640
            KGG IGE
Sbjct  159  KGGTIGE  165



>gb|ACI04664.1| zeta-carotene desaturase [Triticum aestivum]
 emb|CAX36915.1| zeta-carotene desaturase enzyme [Triticum aestivum]
 gb|AEI26316.1| zeta-carotene desaturase [Triticum aestivum]
 gb|AEI26317.1| zeta-carotene desaturase [Triticum aestivum]
Length=568

 Score =   240 bits (612),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 111/128 (87%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  257  VIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  436
            V+R  LDS VSDM+ NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD
Sbjct  30   VVRCSLDSKVSDMAINAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  89

Query  437  IYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFV  616
            +YDS++FIGGKVGSFVD+ GNHIEMGLHVFFGCY+NLFRLMKKVGA+ NLLVK+HTHTFV
Sbjct  90   LYDSRTFIGGKVGSFVDKHGNHIEMGLHVFFGCYSNLFRLMKKVGADNNLLVKEHTHTFV  149

Query  617  NKGGDIGE  640
            NKGG +GE
Sbjct  150  NKGGIVGE  157



>gb|AEI26314.1| zeta-carotene desaturase [Triticum aestivum]
 gb|AEI26315.1| zeta-carotene desaturase [Triticum aestivum]
Length=568

 Score =   239 bits (611),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            +R  LDS VSDM+ NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD+
Sbjct  31   VRCSLDSKVSDMAINAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDL  90

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            YDS++FIGGKVGSFVD++GNHIEMGLHVFFGCY+NLFRLMKKVGA+ NLLVK+HTHTFVN
Sbjct  91   YDSRTFIGGKVGSFVDKQGNHIEMGLHVFFGCYSNLFRLMKKVGADNNLLVKEHTHTFVN  150

Query  620  KGGDIGE  640
            KGG +GE
Sbjct  151  KGGIVGE  157



>ref|XP_006297343.1| hypothetical protein CARUB_v10013363mg [Capsella rubella]
 gb|EOA30241.1| hypothetical protein CARUB_v10013363mg [Capsella rubella]
Length=561

 Score =   239 bits (611),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            + S LD+ VSDMS NAPKGLFPPEP  Y+GPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  28   VCSSLDTDVSDMSVNAPKGLFPPEPVPYKGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  87

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            YDS++FIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTF+N
Sbjct  88   YDSRTFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFIN  147

Query  620  KGGDIGE  640
            K G IGE
Sbjct  148  KDGTIGE  154



>ref|XP_002882378.1| zeta-carotene desaturase precursor [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58637.1| zeta-carotene desaturase precursor [Arabidopsis lyrata subsp. 
lyrata]
Length=561

 Score =   239 bits (610),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            + S LDS VSDMS NAPKGLFPPEP  Y+GPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  28   VNSSLDSDVSDMSVNAPKGLFPPEPVPYKGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  87

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            YDS++FIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGA+KNLLVKDHTHTF+N
Sbjct  88   YDSRTFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGADKNLLVKDHTHTFIN  147

Query  620  KGGDIGE  640
            K G +GE
Sbjct  148  KDGTVGE  154



>ref|XP_009364531.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009364532.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
isoform X1 [Pyrus x bretschneideri]
Length=571

 Score =   239 bits (611),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            +RS LD+ VSDM  NAPKGLFPPEPE YRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  31   VRSSLDTNVSDMGVNAPKGLFPPEPERYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  90

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            Y+S+ FIGGKVGSFVD++GNHIEMGLHVFFGCY+NLFRLMKKVGA++NLLVKDHTHTFVN
Sbjct  91   YESRPFIGGKVGSFVDKKGNHIEMGLHVFFGCYSNLFRLMKKVGADENLLVKDHTHTFVN  150

Query  620  KGGDIGE  640
            KGG+IGE
Sbjct  151  KGGNIGE  157



>ref|NP_001280951.1| zeta-carotene desaturase, chloroplastic/chromoplastic-like [Malus 
domestica]
 gb|AAQ04225.1| zeta-carotene desaturase ZDS2 [Malus domestica]
Length=571

 Score =   239 bits (611),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            +RS LD+ VSDM  NAPKGLFPPEPE YRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  31   VRSSLDTNVSDMRVNAPKGLFPPEPEFYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  90

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            Y+S+ FIGGKVGSFVD++GNHIEMGLHVFFGCY+NLFRLMKKVGA++NLLVKDHTHTFVN
Sbjct  91   YESRPFIGGKVGSFVDKKGNHIEMGLHVFFGCYSNLFRLMKKVGADENLLVKDHTHTFVN  150

Query  620  KGGDIGE  640
            KGG+IGE
Sbjct  151  KGGNIGE  157



>gb|AAA91161.1| zeta-carotene desaturase precursor [Arabidopsis thaliana]
Length=558

 Score =   239 bits (610),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            + S LDS VSDMS NAPKGLFPPEP  Y+GPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  25   VNSSLDSDVSDMSVNAPKGLFPPEPVPYKGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  84

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            YDS++FIG KVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTF+N
Sbjct  85   YDSRTFIGAKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFIN  144

Query  620  KGGDIGE  640
            K G IGE
Sbjct  145  KDGTIGE  151



>gb|EYU22642.1| hypothetical protein MIMGU_mgv1a003845mg [Erythranthe guttata]
Length=560

 Score =   239 bits (609),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            +RSDL++ VSDMS NAPKGLFPPEP+HY+GPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  32   VRSDLETNVSDMSVNAPKGLFPPEPKHYKGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  91

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            Y+S+SFIGGKVGS VD++GNHIEMGLHVFFGCYNNLFRLMKKVGA+KNLLVKDH H+FVN
Sbjct  92   YESRSFIGGKVGSTVDKQGNHIEMGLHVFFGCYNNLFRLMKKVGADKNLLVKDHIHSFVN  151

Query  620  KGGDIGE  640
            KGG+IGE
Sbjct  152  KGGEIGE  158



>ref|XP_008388655.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
[Malus domestica]
Length=571

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            +RS LD+ VSDM  NAPKGLFPPEPE YRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  31   VRSSLDTNVSDMGVNAPKGLFPPEPERYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  90

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            Y+S+ FIGGKVGSFVD++GNHIEMGLHVFFGCY+NLFRLMKKVGA++NLLVKDHTHTFVN
Sbjct  91   YESRPFIGGKVGSFVDKKGNHIEMGLHVFFGCYSNLFRLMKKVGADENLLVKDHTHTFVN  150

Query  620  KGGDIGE  640
            KGG IGE
Sbjct  151  KGGSIGE  157



>tpg|DAA59952.1| TPA: zeta-carotene desaturase, /chromoplastic Precursor [Zea 
mays]
Length=572

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = +2

Query  254  SVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEV  433
            S +R  LD  VSDM  NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEV
Sbjct  33   SAVRCSLDRNVSDMGVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEV  92

Query  434  DIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTF  613
            D+Y+S+ FIGGKVGSFVDR+GNHIEMGLHVFFGCY+NLFRLMKKVGA+ NLLVK+HTHTF
Sbjct  93   DLYESRPFIGGKVGSFVDRQGNHIEMGLHVFFGCYSNLFRLMKKVGADNNLLVKEHTHTF  152

Query  614  VNKGGDIGE  640
            VNKGG IGE
Sbjct  153  VNKGGTIGE  161



>ref|XP_006858905.1| hypothetical protein AMTR_s00068p00029180 [Amborella trichopoda]
 gb|ERN20372.1| hypothetical protein AMTR_s00068p00029180 [Amborella trichopoda]
Length=573

 Score =   238 bits (608),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +2

Query  263  RSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIY  442
            R  L+  VSDM  NAPKGLFPPEPEHYRGPKLKVA+IGAGLAGMSTAVELLDQGHEVDIY
Sbjct  40   RCSLEEKVSDMRVNAPKGLFPPEPEHYRGPKLKVAVIGAGLAGMSTAVELLDQGHEVDIY  99

Query  443  DSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVNK  622
            +S+ FIGGKVGSF DRRGNHIEMGLHVFFGCYNNL+RLMKKVGA+KNLLVKDHTHTF+NK
Sbjct  100  ESRQFIGGKVGSFQDRRGNHIEMGLHVFFGCYNNLYRLMKKVGADKNLLVKDHTHTFINK  159

Query  623  GGDIGE  640
            GG +GE
Sbjct  160  GGQVGE  165



>ref|XP_010485876.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic-like 
[Camelina sativa]
Length=562

 Score =   238 bits (607),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            + S LD+ VSDMS NAPKGLFPPEP  Y+GPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  29   VCSSLDADVSDMSVNAPKGLFPPEPVQYKGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  88

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            YDS++FIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGA++NLLVKDHTHTF+N
Sbjct  89   YDSRTFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGADQNLLVKDHTHTFIN  148

Query  620  KGGDIGE  640
            K G IGE
Sbjct  149  KDGTIGE  155



>ref|XP_008813000.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
isoform X1 [Phoenix dactylifera]
Length=588

 Score =   238 bits (607),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = +2

Query  257  VIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  436
             +R+ LD  VSDM  NAPKGLFPPEPEHY+GPKLKVAIIGAGLAGMSTAVELLDQGHEVD
Sbjct  47   TVRASLDIKVSDMGVNAPKGLFPPEPEHYKGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  106

Query  437  IYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFV  616
            IYD+++FIGGKVGSFVD+RGNHIEMGLHVFFGCY+NLFRLMKKVGA++NLL KDHTHTFV
Sbjct  107  IYDTRTFIGGKVGSFVDKRGNHIEMGLHVFFGCYSNLFRLMKKVGADENLLAKDHTHTFV  166

Query  617  NKGGDIGE  640
            NK G+IGE
Sbjct  167  NKWGEIGE  174



>ref|XP_010934924.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
isoform X2 [Elaeis guineensis]
Length=588

 Score =   237 bits (605),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  257  VIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  436
             +R+ LD+ VSDM   APKGLFPPEPEHYRGPKLK+AIIGAGLAGMSTAVELLDQGHEV+
Sbjct  47   TVRASLDAKVSDMGVKAPKGLFPPEPEHYRGPKLKIAIIGAGLAGMSTAVELLDQGHEVE  106

Query  437  IYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFV  616
            IY+S++FIGGKVGSFVD+RGNHIEMGLHVFFGCY+NLFRLMKKVGA++NLLVKDHTH FV
Sbjct  107  IYESRTFIGGKVGSFVDKRGNHIEMGLHVFFGCYSNLFRLMKKVGADENLLVKDHTHMFV  166

Query  617  NKGGDIGE  640
            NKGG+IGE
Sbjct  167  NKGGEIGE  174



>ref|XP_010934915.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
isoform X1 [Elaeis guineensis]
Length=602

 Score =   237 bits (605),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  257  VIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  436
             +R+ LD+ VSDM   APKGLFPPEPEHYRGPKLK+AIIGAGLAGMSTAVELLDQGHEV+
Sbjct  47   TVRASLDAKVSDMGVKAPKGLFPPEPEHYRGPKLKIAIIGAGLAGMSTAVELLDQGHEVE  106

Query  437  IYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFV  616
            IY+S++FIGGKVGSFVD+RGNHIEMGLHVFFGCY+NLFRLMKKVGA++NLLVKDHTH FV
Sbjct  107  IYESRTFIGGKVGSFVDKRGNHIEMGLHVFFGCYSNLFRLMKKVGADENLLVKDHTHMFV  166

Query  617  NKGGDIGE  640
            NKGG+IGE
Sbjct  167  NKGGEIGE  174



>gb|AAX56323.1| zeta-carotene desaturase [Sorghum bicolor]
Length=574

 Score =   236 bits (602),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            +R  LDS VSDM  NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD+
Sbjct  37   VRCSLDSNVSDMGVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDL  96

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            Y+S+ FIGGKVGSFVD++GNHIEMGLHVFFGCY+NLFRLMKKVGA+ NLLVK+HTHTFVN
Sbjct  97   YESRPFIGGKVGSFVDKQGNHIEMGLHVFFGCYSNLFRLMKKVGADNNLLVKEHTHTFVN  156

Query  620  KGGDIGE  640
            KGG IGE
Sbjct  157  KGGVIGE  163



>ref|XP_002459524.1| hypothetical protein SORBIDRAFT_02g006100 [Sorghum bicolor]
 gb|EER96045.1| hypothetical protein SORBIDRAFT_02g006100 [Sorghum bicolor]
Length=577

 Score =   236 bits (602),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            +R  LDS VSDM  NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD+
Sbjct  40   VRCSLDSNVSDMGVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDL  99

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            Y+S+ FIGGKVGSFVD++GNHIEMGLHVFFGCY+NLFRLMKKVGA+ NLLVK+HTHTFVN
Sbjct  100  YESRPFIGGKVGSFVDKQGNHIEMGLHVFFGCYSNLFRLMKKVGADNNLLVKEHTHTFVN  159

Query  620  KGGDIGE  640
            KGG IGE
Sbjct  160  KGGVIGE  166



>gb|ACG46735.1| zeta-carotene desaturase [Zea mays]
Length=572

 Score =   236 bits (601),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = +2

Query  254  SVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEV  433
            S +R  LD  VSDM  NAPKGLFPPEPEHYRGPKLK+AIIGAGLAGMSTAVELLDQGHEV
Sbjct  33   SAVRCSLDRNVSDMGVNAPKGLFPPEPEHYRGPKLKLAIIGAGLAGMSTAVELLDQGHEV  92

Query  434  DIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTF  613
            D+Y+S  FIGGKVGSFVDR+GNHIEMGLHVFFGCY+NLFRLMKKVGA+ NLLVK+HTHTF
Sbjct  93   DLYESCPFIGGKVGSFVDRQGNHIEMGLHVFFGCYSNLFRLMKKVGADNNLLVKEHTHTF  152

Query  614  VNKGGDIGE  640
            VNKGG IGE
Sbjct  153  VNKGGTIGE  161



>ref|XP_009396830.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
[Musa acuminata subsp. malaccensis]
 ref|XP_009396831.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
[Musa acuminata subsp. malaccensis]
Length=576

 Score =   235 bits (599),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 108/129 (84%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = +2

Query  254  SVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEV  433
            + +R  LDS VSDM  NAPKGLFPPEPEHY GPKLKVAI+G GLAGMSTAVELLDQGHEV
Sbjct  34   AAVRCSLDSQVSDMRINAPKGLFPPEPEHYTGPKLKVAIVGGGLAGMSTAVELLDQGHEV  93

Query  434  DIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTF  613
            DIY+S+ FIGGKVGSFVD++GNHIEMGLHVFFGCY+NLFRLMKKVGA +NLLVKDHTHTF
Sbjct  94   DIYESRPFIGGKVGSFVDKQGNHIEMGLHVFFGCYSNLFRLMKKVGANENLLVKDHTHTF  153

Query  614  VNKGGDIGE  640
            VN+GG IGE
Sbjct  154  VNRGGGIGE  162



>gb|ABR18432.1| unknown [Picea sitchensis]
Length=591

 Score =   232 bits (592),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            +  +L + VSDMS+ APKGLFPPEPE Y GPKLKVAIIG+GLAG+STAVELLDQGHEVDI
Sbjct  51   VSCNLKAKVSDMSSKAPKGLFPPEPEKYEGPKLKVAIIGSGLAGLSTAVELLDQGHEVDI  110

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            Y+S+SFIGGKVGSFVD+RGNHIEMGLHVFFGCYNNLFRLMKKVGA++NLLVK+HTHTFVN
Sbjct  111  YESRSFIGGKVGSFVDKRGNHIEMGLHVFFGCYNNLFRLMKKVGADENLLVKEHTHTFVN  170

Query  620  KGGDIGE  640
            KGG IGE
Sbjct  171  KGGQIGE  177



>gb|AAQ04224.1| zeta-carotene desaturase ZDS1 [Malus domestica]
Length=568

 Score =   228 bits (580),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 118/127 (93%), Gaps = 3/127 (2%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            +RS LD+ VSDM  N   GLFPPEPE YRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  31   VRSSLDTNVSDMRVN---GLFPPEPEFYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  87

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            Y+S+ FIGGKVGSFVD++GNHIEMGLHVFFGCY+NLFRLMKKVGA++NLLVKDHTHTFVN
Sbjct  88   YESRPFIGGKVGSFVDKKGNHIEMGLHVFFGCYSNLFRLMKKVGADENLLVKDHTHTFVN  147

Query  620  KGGDIGE  640
            KGG+IGE
Sbjct  148  KGGNIGE  154



>ref|XP_009364533.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
isoform X2 [Pyrus x bretschneideri]
Length=568

 Score =   228 bits (580),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 118/127 (93%), Gaps = 3/127 (2%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            +RS LD+ VSDM  N   GLFPPEPE YRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  31   VRSSLDTNVSDMGVN---GLFPPEPERYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  87

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            Y+S+ FIGGKVGSFVD++GNHIEMGLHVFFGCY+NLFRLMKKVGA++NLLVKDHTHTFVN
Sbjct  88   YESRPFIGGKVGSFVDKKGNHIEMGLHVFFGCYSNLFRLMKKVGADENLLVKDHTHTFVN  147

Query  620  KGGDIGE  640
            KGG+IGE
Sbjct  148  KGGNIGE  154



>ref|XP_008370678.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic-like 
isoform X2 [Malus domestica]
Length=568

 Score =   228 bits (580),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 118/127 (93%), Gaps = 3/127 (2%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            +RS LD+ VSDM  N   GLFPPEPE YRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  31   VRSSLDTNVSDMRVN---GLFPPEPEFYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  87

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            Y+S+ FIGGKVGSFVD++GNHIEMGLHVFFGCY+NLFRLMKKVGA++NLLVKDHTHTFVN
Sbjct  88   YESRPFIGGKVGSFVDKKGNHIEMGLHVFFGCYSNLFRLMKKVGADENLLVKDHTHTFVN  147

Query  620  KGGDIGE  640
            KGG+IGE
Sbjct  148  KGGNIGE  154



>sp|C3VEQ0.1|ZDS_ONCHC RecName: Full=Zeta-carotene desaturase, chloroplastic/chromoplastic; 
Short=OgZDS; AltName: Full=9,9'-di-cis-zeta-carotene 
desaturase; AltName: Full=Carotene 7,8-desaturase; Flags: Precursor 
[Oncidium hybrid cultivar]
 gb|ACP27625.1| carotene desaturase [Oncidium hybrid cultivar]
Length=563

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  266  SDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYD  445
            + LD  VSDMS NAPKGLFPPEP+ Y GPKL+VAIIG+GLAGMSTAVELLDQGH+VDIY+
Sbjct  28   ASLDRKVSDMSVNAPKGLFPPEPDIYSGPKLRVAIIGSGLAGMSTAVELLDQGHQVDIYE  87

Query  446  SKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVNKG  625
            S+ FIGGKV SFVD+ GNHIEMGLHVFFGCY+NLFRLMKKVGA+ NLLVKDHTHTFVNKG
Sbjct  88   SRQFIGGKVASFVDKHGNHIEMGLHVFFGCYSNLFRLMKKVGADGNLLVKDHTHTFVNKG  147

Query  626  GDIGE  640
            GDIGE
Sbjct  148  GDIGE  152



>ref|XP_006408139.1| hypothetical protein EUTSA_v10020402mg [Eutrema salsugineum]
 gb|ESQ49592.1| hypothetical protein EUTSA_v10020402mg [Eutrema salsugineum]
Length=566

 Score =   224 bits (571),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +2

Query  299  TNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGS  478
             NAPKGLFPPEP  Y+GPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDS++FIGGKVGS
Sbjct  41   VNAPKGLFPPEPVPYKGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSRTFIGGKVGS  100

Query  479  FVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            FVD+RGNHIEMGLHVFFGCYNNLFRLMKKVGA+KNLLVKDHTHTF+NKG +IGE
Sbjct  101  FVDKRGNHIEMGLHVFFGCYNNLFRLMKKVGADKNLLVKDHTHTFINKGSEIGE  154



>ref|XP_001776850.1| predicted protein [Physcomitrella patens]
 gb|EDQ58400.1| predicted protein [Physcomitrella patens]
Length=593

 Score =   223 bits (569),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            + + L S+VSDMS  APKGLFPPEPE Y+GPKLKVAIIGAGLAGMSTAVELL+QGHEVDI
Sbjct  51   VSASLQSLVSDMSKKAPKGLFPPEPETYKGPKLKVAIIGAGLAGMSTAVELLEQGHEVDI  110

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            Y+S+ FIGGKVGSF D+ GNHIEMGLHVFFGCYNNLFRL+ KVGA+ NLLVKDH HTF+N
Sbjct  111  YESRKFIGGKVGSFKDKNGNHIEMGLHVFFGCYNNLFRLLTKVGADNNLLVKDHIHTFIN  170

Query  620  KGGDIGE  640
            KGG++GE
Sbjct  171  KGGNVGE  177



>ref|XP_006658387.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic-like 
[Oryza brachyantha]
Length=543

 Score =   222 bits (565),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +2

Query  302  NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSF  481
            +APKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD+Y+S+ FIGGKVGSF
Sbjct  20   SAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDLYESRPFIGGKVGSF  79

Query  482  VDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            VDR+GNHIEMGLHVFFGCY+NLFRLMKKVGA++NLLVK+HTHTFVNKGG IGE
Sbjct  80   VDRKGNHIEMGLHVFFGCYSNLFRLMKKVGADENLLVKEHTHTFVNKGGTIGE  132



>gb|EPS57847.1| hypothetical protein M569_16970, partial [Genlisea aurea]
Length=506

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/112 (91%), Positives = 110/112 (98%), Gaps = 0/112 (0%)
 Frame = +2

Query  305  APKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFV  484
            APKGLFPPEPE Y GPKLKVAIIGAGLAGMSTAVELLDQGHEVDIY+S+SFIGGKVGSFV
Sbjct  3    APKGLFPPEPESYLGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYESRSFIGGKVGSFV  62

Query  485  DRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            D++GNH+EMGLHVFFGCYNNLFRLMKKVGA+KNLL+KDHTHTFVNKGG+IGE
Sbjct  63   DKKGNHVEMGLHVFFGCYNNLFRLMKKVGADKNLLLKDHTHTFVNKGGEIGE  114



>gb|EMT13673.1| Zeta-carotene desaturase, chloroplastic/chromoplastic [Aegilops 
tauschii]
Length=627

 Score =   223 bits (569),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/116 (88%), Positives = 112/116 (97%), Gaps = 0/116 (0%)
 Frame = +2

Query  293  MSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKV  472
            +S  APKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD+YDS++FIGGKV
Sbjct  101  LSATAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDLYDSRTFIGGKV  160

Query  473  GSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            GSFVD++GNHIEMGLHVFFGCY+NLFRLMKKVGA+ NLLVK+HTHTFVNKGG +GE
Sbjct  161  GSFVDKQGNHIEMGLHVFFGCYSNLFRLMKKVGADNNLLVKEHTHTFVNKGGIVGE  216



>gb|EYU22998.1| hypothetical protein MIMGU_mgv1a003605mg [Erythranthe guttata]
Length=574

 Score =   221 bits (564),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 102/128 (80%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = +2

Query  257  VIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  436
             +RSDL+S V DM+T+APKG+FPPEPE Y GPKLKVAIIGAGLAGMS A+ELLDQGHEVD
Sbjct  44   TLRSDLESNVCDMTTHAPKGIFPPEPEKYGGPKLKVAIIGAGLAGMSAAIELLDQGHEVD  103

Query  437  IYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFV  616
            IYD +S +GGKVGS+VD+RGNHIEMGLHVFFGCY+NLFRLM+KVGA+KN LVKDHT+ FV
Sbjct  104  IYDKRSSVGGKVGSYVDKRGNHIEMGLHVFFGCYSNLFRLMRKVGADKNFLVKDHTNIFV  163

Query  617  NKGGDIGE  640
            NKGGD+ E
Sbjct  164  NKGGDVRE  171



>ref|XP_001780369.1| predicted protein [Physcomitrella patens]
 gb|EDQ54823.1| predicted protein [Physcomitrella patens]
Length=528

 Score =   220 bits (560),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = +2

Query  281  MVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFI  460
            MVSDMS  APKGLFPPEPE Y+GPKLKVAIIGAGLAGMSTAVELL+QGHEVDIY+S+ FI
Sbjct  1    MVSDMSRKAPKGLFPPEPEAYKGPKLKVAIIGAGLAGMSTAVELLEQGHEVDIYESRKFI  60

Query  461  GGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            GGKVGSF D+ GNHIEMGLHVFFGCYNNLFRL+ KVGA+ NLL+KDHTHTF+NKGG++GE
Sbjct  61   GGKVGSFKDKDGNHIEMGLHVFFGCYNNLFRLLAKVGADNNLLLKDHTHTFINKGGNVGE  120



>gb|ADN65328.1| zeta-carotene desaturase [Manihot esculenta]
Length=275

 Score =   213 bits (541),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/108 (93%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +2

Query  317  LFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRG  496
            LFPPEPE YRGPKLKVAIIG+GLAGMSTAVELLDQGHEVDIY+S++FIGGKVGSFVDR G
Sbjct  1    LFPPEPERYRGPKLKVAIIGSGLAGMSTAVELLDQGHEVDIYESRTFIGGKVGSFVDRGG  60

Query  497  NHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            NHIEMGLHVFFGCYNNLFRLMKKVGA+KNLLVKDHTHTFVNKGG+IGE
Sbjct  61   NHIEMGLHVFFGCYNNLFRLMKKVGADKNLLVKDHTHTFVNKGGEIGE  108



>ref|XP_001772345.1| predicted protein [Physcomitrella patens]
 gb|EDQ62816.1| predicted protein [Physcomitrella patens]
Length=597

 Score =   221 bits (563),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            + + L SM+SDMS  APKGLFPPEPE Y+GPKLKVAIIGAGLAGMSTAVELL+QGHEVDI
Sbjct  59   VSASLQSMMSDMSRKAPKGLFPPEPEAYKGPKLKVAIIGAGLAGMSTAVELLEQGHEVDI  118

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            Y+ + FIGGK GSF D+ GNHIEMGLHVFFGCYNNLFRL+ KVGA+ NLL+KDHTHTF+N
Sbjct  119  YELRKFIGGKAGSFKDKNGNHIEMGLHVFFGCYNNLFRLLAKVGADNNLLLKDHTHTFIN  178

Query  620  KGGDIGE  640
            KGGD+GE
Sbjct  179  KGGDVGE  185



>gb|EMS67399.1| Zeta-carotene desaturase, chloroplastic/chromoplastic [Triticum 
urartu]
Length=528

 Score =   216 bits (551),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/112 (88%), Positives = 108/112 (96%), Gaps = 0/112 (0%)
 Frame = +2

Query  305  APKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFV  484
            +PKGLFPPEPEHYRGPKLKVAIIGAGLAGMS AVELLDQGHEVD+YDS++FIGGKVGSFV
Sbjct  6    SPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSAAVELLDQGHEVDLYDSRTFIGGKVGSFV  65

Query  485  DRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            D+ GNHIEMGLHVFFGCY+NLFRLMKKVGA+ NLLVK+HTHTFVNKGG +GE
Sbjct  66   DKHGNHIEMGLHVFFGCYSNLFRLMKKVGADNNLLVKEHTHTFVNKGGIVGE  117



>ref|XP_002978356.1| hypothetical protein SELMODRAFT_108745 [Selaginella moellendorffii]
 gb|EFJ20342.1| hypothetical protein SELMODRAFT_108745 [Selaginella moellendorffii]
Length=564

 Score =   216 bits (549),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            +   L++MVSDM   APKGLFPPEPE Y GPKLKVAI+GAGLAGMSTAVELLDQGHEVDI
Sbjct  22   VSCSLEAMVSDMGKGAPKGLFPPEPESYTGPKLKVAIVGAGLAGMSTAVELLDQGHEVDI  81

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            YD++SFIGGKVGS+ D+ GNHIEMGLHVFFGCY NL+RLM KVGA++NLL+KDH HTF+N
Sbjct  82   YDTRSFIGGKVGSYQDKNGNHIEMGLHVFFGCYCNLYRLMSKVGADENLLLKDHIHTFIN  141

Query  620  KGGDIGE  640
            KGG  GE
Sbjct  142  KGGLTGE  148



>ref|XP_002970191.1| hypothetical protein SELMODRAFT_146971 [Selaginella moellendorffii]
 gb|EFJ28321.1| hypothetical protein SELMODRAFT_146971 [Selaginella moellendorffii]
Length=586

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            +   L++MVSDM   APKGLFPPEPE Y GPKLKVAI+GAGLAGMSTAVELLDQGHEVDI
Sbjct  44   VSCSLEAMVSDMGKGAPKGLFPPEPESYTGPKLKVAIVGAGLAGMSTAVELLDQGHEVDI  103

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            YD++SFIGGKVGS+ D+ GNHIEMGLHVFFGCY NL+RLM KVGA++NLL+KDH HTF+N
Sbjct  104  YDTRSFIGGKVGSYQDKNGNHIEMGLHVFFGCYCNLYRLMSKVGADENLLLKDHIHTFIN  163

Query  620  KGGDIGE  640
            KGG  GE
Sbjct  164  KGGLTGE  170



>ref|XP_006471842.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic-like 
[Citrus sinensis]
Length=204

 Score =   205 bits (522),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 111/127 (87%), Gaps = 4/127 (3%)
 Frame = +2

Query  260  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  439
            +R+ LD+ VSDMS      +FPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  29   VRASLDTNVSDMSVK----VFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  84

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            Y+ +SFIGGKV SFV + GNHIE+ LHVFFGC NNLFRL KKVGA++NLL+KDHTH FVN
Sbjct  85   YELRSFIGGKVASFVGKHGNHIEISLHVFFGCCNNLFRLTKKVGADENLLMKDHTHKFVN  144

Query  620  KGGDIGE  640
            KGG+IGE
Sbjct  145  KGGEIGE  151



>ref|NP_001105609.1| zeta-carotene desaturase, chloroplastic/chromoplastic [Zea mays]
 sp|Q9ZTP4.1|ZDS_MAIZE RecName: Full=Zeta-carotene desaturase, chloroplastic/chromoplastic; 
AltName: Full=9,9'-di-cis-zeta-carotene desaturase; 
AltName: Full=Carotene 7,8-desaturase; Flags: Precursor [Zea 
mays]
 gb|AAD02462.1| zeta-carotene desaturase precursor [Zea mays]
 gb|AAV91511.1| zeta-carotene desaturase [Zea mays]
Length=570

 Score =   214 bits (544),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +2

Query  317  LFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRG  496
            LFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD+Y+S+ FIGGKVGSFVDR+G
Sbjct  52   LFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDLYESRPFIGGKVGSFVDRQG  111

Query  497  NHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            NHIEMGLHVFFGCY+NLFRLMKKVGA+ NLLVK+HTHTFVNKGG IGE
Sbjct  112  NHIEMGLHVFFGCYSNLFRLMKKVGADNNLLVKEHTHTFVNKGGTIGE  159



>gb|KDO38850.1| hypothetical protein CISIN_1g0233862mg, partial [Citrus sinensis]
 gb|KDO38851.1| hypothetical protein CISIN_1g0233862mg, partial [Citrus sinensis]
 gb|KDO38852.1| hypothetical protein CISIN_1g0233862mg, partial [Citrus sinensis]
Length=106

 Score =   171 bits (433),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +2

Query  296  STNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVG  475
            ST  PK LFPPEPEHY GPKLKVAIIGAGLAGMSTAVELLDQGHEVDIY+S+SFIGGKVG
Sbjct  11   STEDPKCLFPPEPEHYGGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYESRSFIGGKVG  70

Query  476  SFVDRRGNHIEMGLHVFFGCYNNLFRLMKK  565
            SF+D+ GNHIEMGLH+FFGCYNNLFRLMKK
Sbjct  71   SFIDKHGNHIEMGLHIFFGCYNNLFRLMKK  100



>gb|EYU45246.1| hypothetical protein MIMGU_mgv1a005547mg [Erythranthe guttata]
Length=479

 Score =   172 bits (436),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 80/83 (96%), Positives = 83/83 (100%), Gaps = 0/83 (0%)
 Frame = +2

Query  392  MSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVG  571
            MSTAVELLDQGHEVDIYDSKSF+GGKVGSFVD++GNHIEMGLHVFFGCYNNLFRLMKKVG
Sbjct  1    MSTAVELLDQGHEVDIYDSKSFVGGKVGSFVDKQGNHIEMGLHVFFGCYNNLFRLMKKVG  60

Query  572  AEKNLLVKDHTHTFVNKGGDIGE  640
            AEKNLLVKDHTHTFVNKGGDIGE
Sbjct  61   AEKNLLVKDHTHTFVNKGGDIGE  83



>gb|ACI14289.1| zeta-carotene desaturase [Linum usitatissimum]
Length=481

 Score =   167 bits (423),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +2

Query  383  LAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMK  562
            +AGMSTAVELLDQGHEVDIY+S++FIGGKVGSFVD+ GNHIEMGLHVFFGCYNNLFRLMK
Sbjct  1    VAGMSTAVELLDQGHEVDIYESRTFIGGKVGSFVDKGGNHIEMGLHVFFGCYNNLFRLMK  60

Query  563  KVGAEKNLLVKDHTHTFVNKGGDIGE  640
            KVGA+KNLLVK+H+HTFVNKGGDIGE
Sbjct  61   KVGADKNLLVKEHSHTFVNKGGDIGE  86



>ref|XP_005843062.1| hypothetical protein CHLNCDRAFT_141585 [Chlorella variabilis]
 gb|EFN50960.1| hypothetical protein CHLNCDRAFT_141585 [Chlorella variabilis]
Length=459

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 103/133 (77%), Gaps = 3/133 (2%)
 Frame = +2

Query  251  KSVIRSDLDSMVSDMSTNAP-KGLFPPEPEHYR--GPKLKVAIIGAGLAGMSTAVELLDQ  421
            ++  RSD+ ++ +    + P + LFP +P   R   PKLKVAI+G+GLAG+STAVELLDQ
Sbjct  43   QAPTRSDVGNVNNVGLKDVPLRSLFPEDPGTPRPGAPKLKVAIVGSGLAGLSTAVELLDQ  102

Query  422  GHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDH  601
            G+EVDIY+S+ F+GGKV S+ DR GN IEMGLHVFFGCY NLFRLM K G  +NLL+K+H
Sbjct  103  GYEVDIYESRPFVGGKVASYRDRNGNDIEMGLHVFFGCYFNLFRLMAKCGVLENLLLKEH  162

Query  602  THTFVNKGGDIGE  640
            THTF NKGGD+ E
Sbjct  163  THTFCNKGGDVRE  175



>gb|ADR82201.1| zeta-carotene desaturase [Auxenochlorella protothecoides]
 gb|ADR82202.1| zeta-carotene desaturase [Auxenochlorella protothecoides]
Length=584

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 100/124 (81%), Gaps = 3/124 (2%)
 Frame = +2

Query  278  SMVSDMS-TNAP-KGLFPPEPEHYRG-PKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDS  448
            S VSD++  + P + LFP  P    G PKLKVAI+G+GLAG+STAVELLDQG+EVDIY+S
Sbjct  52   SNVSDVALKDVPLRSLFPDVPTICPGAPKLKVAIVGSGLAGLSTAVELLDQGYEVDIYES  111

Query  449  KSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVNKGG  628
            + +IGGKV SF D+ GN IEMGLHVFFGCY NLFRLM K G  +NLL+KDHTHTF+NKGG
Sbjct  112  RPWIGGKVASFKDKDGNDIEMGLHVFFGCYFNLFRLMAKCGVLENLLLKDHTHTFINKGG  171

Query  629  DIGE  640
            D+ E
Sbjct  172  DVRE  175



>ref|XP_011396566.1| Zeta-carotene desaturase, chloroplastic/chromoplastic [Auxenochlorella 
protothecoides]
 gb|KFM23692.1| Zeta-carotene desaturase, chloroplastic/chromoplastic [Auxenochlorella 
protothecoides]
Length=586

 Score =   165 bits (418),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 93/114 (82%), Gaps = 3/114 (3%)
 Frame = +2

Query  302  NAP-KGLFPPEPEHYR--GPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKV  472
            +AP + L+P EP       P+LKVAI+G GLAG+STAVELLDQG+EVDIY+S+ +IGGKV
Sbjct  61   DAPLRSLYPEEPSRPEPGAPRLKVAIVGGGLAGLSTAVELLDQGYEVDIYESRPWIGGKV  120

Query  473  GSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDI  634
             SF D+ GNHIEMGLHVFFGCY+NLFRLM K G  +NLLVK+HTH FVN GGD+
Sbjct  121  ASFKDKEGNHIEMGLHVFFGCYHNLFRLMAKCGVLENLLVKEHTHKFVNAGGDV  174



>ref|XP_008813001.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
isoform X2 [Phoenix dactylifera]
Length=497

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 73/83 (88%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = +2

Query  392  MSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVG  571
            MSTAVELLDQGHEVDIYD+++FIGGKVGSFVD+RGNHIEMGLHVFFGCY+NLFRLMKKVG
Sbjct  1    MSTAVELLDQGHEVDIYDTRTFIGGKVGSFVDKRGNHIEMGLHVFFGCYSNLFRLMKKVG  60

Query  572  AEKNLLVKDHTHTFVNKGGDIGE  640
            A++NLL KDHTHTFVNK G+IGE
Sbjct  61   ADENLLAKDHTHTFVNKWGEIGE  83



>gb|ABC87740.1| zeta carotene desaturase [Coffea canephora]
Length=156

 Score =   152 bits (383),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/78 (92%), Positives = 76/78 (97%), Gaps = 0/78 (0%)
 Frame = +2

Query  407  ELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNL  586
            ELLDQGHEVDIY+S SFIGGKVGSFVD+RGNHI MGLHVFFGCYNNLFRLMKKVGA+KNL
Sbjct  1    ELLDQGHEVDIYESHSFIGGKVGSFVDKRGNHIGMGLHVFFGCYNNLFRLMKKVGADKNL  60

Query  587  LVKDHTHTFVNKGGDIGE  640
            LVKDHTHTFVNKGG+IGE
Sbjct  61   LVKDHTHTFVNKGGEIGE  78



>ref|WP_010873021.1| zeta-carotene desaturase [Synechocystis sp. PCC 6803]
 ref|NP_441720.1| zeta-carotene desaturase [Synechocystis sp. PCC 6803]
 sp|P74306.1|ZDS_SYNY3 RecName: Full=Zeta-carotene desaturase; AltName: Full=9,9'-di-cis-zeta-carotene 
desaturase; AltName: Full=Carotene 7,8-desaturase 
[Synechocystis sp. PCC 6803 substr. Kazusa]
 dbj|BAA18400.1| zeta-carotene desaturase precursor [Synechocystis sp. PCC 6803]
 dbj|BAK50574.1| zeta-carotene desaturase [Synechocystis sp. PCC 6803]
 dbj|BAL29573.1| zeta-carotene desaturase [Synechocystis sp. PCC 6803 substr. 
GT-I]
 dbj|BAL32742.1| zeta-carotene desaturase [Synechocystis sp. PCC 6803 substr. 
PCC-N]
 dbj|BAL35911.1| zeta-carotene desaturase [Synechocystis sp. PCC 6803 substr. 
PCC-P]
 gb|AGF52088.1| zeta-carotene desaturase precursor [Synechocystis sp. PCC 6803]
Length=489

 Score =   158 bits (400),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI+GAGLAGM+TAVEL+D GHEV++Y+++SFIGGKVGS+VD  GNHIEMGLHVFFGC
Sbjct  1    MRVAIVGAGLAGMATAVELVDAGHEVELYEARSFIGGKVGSWVDGDGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y NLF LM+KVGA++NL +K+HTHTFVN+GG IGE
Sbjct  61   YYNLFNLMEKVGAKQNLRLKEHTHTFVNQGGRIGE  95



>ref|XP_005650492.1| zeta-carotene desaturase [Coccomyxa subellipsoidea C-169]
 gb|EIE25948.1| zeta-carotene desaturase [Coccomyxa subellipsoidea C-169]
Length=541

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 99/130 (76%), Gaps = 4/130 (3%)
 Frame = +2

Query  260  IRSDLDSMVSDMST-NAP-KGLFPPEPEHYRG-PKLKVAIIGAGLAGMSTAVELLDQGHE  430
            +R  L   V D+   +AP + LFP  P    G PKLKVAI+G+GLAG+STAVELLDQG+E
Sbjct  11   VRPTLKPGVDDVGLKDAPLRSLFPEIPNIAPGAPKLKVAIVGSGLAGLSTAVELLDQGYE  70

Query  431  VDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHT  610
            VD+Y+S+ FIGGKV S+  + GNH+EMGLHVFFGCY NLFRLM K G  +NLL+K+H HT
Sbjct  71   VDVYESRPFIGGKVASW-QKDGNHVEMGLHVFFGCYFNLFRLMAKCGVLQNLLLKEHVHT  129

Query  611  FVNKGGDIGE  640
            FVN GGD+ E
Sbjct  130  FVNTGGDVRE  139



>ref|WP_028947937.1| zeta-carotene desaturase [Synechocystis sp. PCC 6714]
 gb|AIE74580.1| Pro-zeta-carotene desaturase, prolycopene producing [Synechocystis 
sp. PCC 6714]
Length=489

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI+GAGLAGM+TAVEL+D GHEV++Y+++SFIGGKVGS+VD  GNHIEMGLHVFFGC
Sbjct  1    MRVAIVGAGLAGMATAVELVDAGHEVELYEARSFIGGKVGSWVDGDGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y NLF LM+KVGA++NL +K+HTHTF+N+GG IGE
Sbjct  61   YYNLFALMEKVGAKQNLRLKEHTHTFINQGGRIGE  95



>gb|KIY97244.1| zeta-carotene desaturase [Monoraphidium neglectum]
Length=310

 Score =   152 bits (383),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +2

Query  353  KLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFG  532
            KL+VAI+G GLAG+STAVELLDQGHEVDIY+ + ++GGKV SF D+ GNHIEMGLHVFFG
Sbjct  80   KLRVAILGGGLAGLSTAVELLDQGHEVDIYEGRQWVGGKVASFKDKDGNHIEMGLHVFFG  139

Query  533  CYNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            CY NLFRLM K G  +NLL+KDHTHTF N  GD+ E
Sbjct  140  CYFNLFRLMAKCGVLENLLLKDHTHTFCNLDGDVRE  175



>gb|KDO39191.1| hypothetical protein CISIN_1g034688mg [Citrus sinensis]
Length=87

 Score =   145 bits (366),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  392  MSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVG  571
            MSTAVELLDQGHEVDIY+ +SFIGGKV SFV +RGNHIE+ LHVFFGCYNNLFRL KKVG
Sbjct  1    MSTAVELLDQGHEVDIYELRSFIGGKVASFVCKRGNHIEISLHVFFGCYNNLFRLTKKVG  60

Query  572  AEKNLLVKDHTHTFVNKGGDIG  637
            A++NLL+KDHTH FVNKGG+IG
Sbjct  61   ADENLLMKDHTHKFVNKGGEIG  82



>ref|XP_002954228.1| hypothetical protein VOLCADRAFT_95071 [Volvox carteri f. nagariensis]
 gb|EFJ44652.1| hypothetical protein VOLCADRAFT_95071 [Volvox carteri f. nagariensis]
Length=592

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            LKVAI+G GLAG+STAVELLDQG+EVDIY+ + +IGGKV SFVD+ GNHIEMGLHVFFGC
Sbjct  84   LKVAIVGGGLAGLSTAVELLDQGYEVDIYEGRQWIGGKVASFVDKNGNHIEMGLHVFFGC  143

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y NLFRLM K G  +NLL+KDHTHTF N  GD+ E
Sbjct  144  YFNLFRLMAKCGVLENLLLKDHTHTFCNNDGDVRE  178



>ref|XP_001700786.1| zeta-carotene desaturase [Chlamydomonas reinhardtii]
 gb|EDP07040.1| zeta-carotene desaturase [Chlamydomonas reinhardtii]
Length=582

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            LKVAI+G GLAG+STAVELLDQG+EVDIY+ + +IGGKV SFVD+ GNHIEMGLHVFFGC
Sbjct  79   LKVAIVGGGLAGLSTAVELLDQGYEVDIYEGRQWIGGKVASFVDKDGNHIEMGLHVFFGC  138

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y NLFRLM K G  +NLLVK+HTHTF N  GD+ E
Sbjct  139  YFNLFRLMAKCGVLENLLVKEHTHTFCNNDGDVRE  173



>ref|WP_006101879.1| zeta-carotene desaturase [Coleofasciculus chthonoplastes]
 gb|EDX74548.1| carotene 7,8-desaturase [Coleofasciculus chthonoplastes PCC 7420]
Length=489

 Score =   153 bits (387),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI+GAGLAGM+TAVEL+D GHEV+I++S+ F+GGKVGS+VD  GNHIEMGLHVFFGC
Sbjct  1    MRVAIVGAGLAGMATAVELVDAGHEVEIFESRPFVGGKVGSWVDAEGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y NLF LM+KVGA +NL +K+HTHTF+N+GG  GE
Sbjct  61   YYNLFDLMQKVGALENLRLKEHTHTFINRGGRTGE  95



>ref|WP_021829644.1| Pro-zeta-carotene desaturase, prolycopene producing [Crocosphaera 
watsonii]
 emb|CCQ49749.1| Pro-zeta-carotene desaturase, prolycopene producing [Crocosphaera 
watsonii WH 8502]
Length=211

 Score =   147 bits (370),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI+GAGLAGM+TA++L+D+G EV+I++S+ F+GGKVGS+VD+ GNHIEMGLHVFFGC
Sbjct  1    MRVAIVGAGLAGMATAMDLVDRGCEVEIFESRPFVGGKVGSWVDKDGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y NLF LMKKVGA  NL +K HTHTF+N GG IGE
Sbjct  61   YYNLFALMKKVGAIDNLRLKQHTHTFINSGGKIGE  95



>ref|WP_019505779.1| zeta-carotene desaturase [Pleurocapsa sp. PCC 7319]
Length=485

 Score =   151 bits (381),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI+GAGLAGM+TA++L+D G EV+I++S+ F+GGKVGS+VD+ GNHIEMGLHVFFGC
Sbjct  1    MRVAIVGAGLAGMATAIDLVDAGAEVEIFESRPFVGGKVGSWVDKEGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y NLF LMKKVGA +NL +K+HTHTF+N+GG IGE
Sbjct  61   YYNLFGLMKKVGAIENLRLKEHTHTFINEGGRIGE  95



>ref|WP_012306160.1| zeta-carotene desaturase [Synechococcus sp. PCC 7002]
 gb|ACA98536.1| zeta-carotene desaturase [Synechococcus sp. PCC 7002]
Length=487

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI+GAGLAG+STAVEL+D GHEV+I++++ F+GGKVGS+VD+ GNHIEMGLHVFFGC
Sbjct  1    MRVAIVGAGLAGLSTAVELVDAGHEVEIFEARPFVGGKVGSWVDKDGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y NLF LM+KVGA  NL +K+HTH F+N+GG IGE
Sbjct  61   YYNLFSLMEKVGAGNNLRLKEHTHQFINEGGKIGE  95



>ref|WP_036479960.1| zeta-carotene desaturase [Myxosarcina sp. GI1]
Length=485

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI+GAGLAGM+TA+EL D G EV+I++S+ F+GGKVGS++D+ GNH+EMGLHVFFGC
Sbjct  1    MRVAIVGAGLAGMTTAIELADAGAEVEIFESRPFVGGKVGSWIDKDGNHLEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y NLF LMKKVGA  NL +K+HTHTF+NKGG +GE
Sbjct  61   YYNLFELMKKVGAIDNLRLKEHTHTFINKGGRVGE  95



>ref|WP_006509674.1| carotene 7,8-desaturase [Xenococcus sp. PCC 7305]
 gb|ELS03230.1| carotene 7,8-desaturase [Xenococcus sp. PCC 7305]
Length=477

 Score =   150 bits (378),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI+GAGLAGM+TA++L+D GHEV+I++S+ F+GGKVGS+VD+ GNH+EMGLHVFFGC
Sbjct  1    MRVAIVGAGLAGMATAIDLVDAGHEVEIFESRPFVGGKVGSWVDKDGNHVEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y NLF LMKKVGA  NL +K+H+HTF+N GG +GE
Sbjct  61   YYNLFALMKKVGAIDNLRLKEHSHTFINNGGKVGE  95



>ref|WP_030005806.1| zeta-carotene desaturase [Synechococcus sp. NKBG042902]
Length=487

 Score =   150 bits (378),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI+GAGLAG+STA+EL+D GHEV+I++++ F+GGKVGS+VD+ GNHIEMGLHVFFGC
Sbjct  1    MRVAIVGAGLAGLSTAIELVDAGHEVEIFEARPFVGGKVGSWVDKDGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y NLF LM+KVGA  NL +K+HTH F+N+GG IGE
Sbjct  61   YYNLFALMEKVGAGDNLRLKEHTHQFINEGGKIGE  95



>ref|WP_012598084.1| zeta-carotene desaturase [Cyanothece sp. PCC 7424]
 gb|ACK69137.1| carotene 7,8-desaturase [Cyanothece sp. PCC 7424]
Length=489

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI+GAGLAGM+TA++L+D G EV+I++S+ F+GGKVGS++D  GNHIEMGLHVFFGC
Sbjct  1    MRVAIVGAGLAGMATAIDLVDAGCEVEIFESRPFVGGKVGSWIDSEGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y NLF LMKKVGA +NL +K+HTHTF+N+GG +GE
Sbjct  61   YYNLFELMKKVGAIENLRLKEHTHTFINEGGRVGE  95



>ref|WP_015172316.1| zeta-carotene desaturase [Geitlerinema sp. PCC 7407]
 gb|AFY66751.1| zeta-carotene desaturase [Geitlerinema sp. PCC 7407]
Length=490

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI+GAGLAGM+TAV+L+D GHEV+I++S+ F+GGKVGS+VD  GNHIEMGLHVFFGC
Sbjct  1    MRVAIVGAGLAGMATAVDLVDAGHEVEIFESRPFVGGKVGSWVDADGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIG  637
            Y NLF LMKKV A ++L +K+HTHTF+N+GGD+G
Sbjct  61   YYNLFELMKKVDAFQHLRLKEHTHTFINRGGDVG  94



>ref|WP_009544536.1| MULTISPECIES: zeta-carotene desaturase [Cyanothece]
 gb|ACB52127.1| zeta-carotene desaturase [Cyanothece sp. ATCC 51142]
Length=490

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI+GAGLAGM+TA++L+D G EV+I++S+ F+GGKVGS+VD+ GNHIEMGLHVFFGC
Sbjct  1    MRVAIVGAGLAGMATAIDLVDAGCEVEIFESRPFVGGKVGSWVDKDGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y NLF LM+KVGA  NL +K+HTHTF+N+GG IGE
Sbjct  61   YYNLFALMRKVGAIDNLRLKEHTHTFINRGGKIGE  95



>ref|WP_008276389.1| zeta-carotene desaturase [Cyanothece sp. CCY0110]
 gb|EAZ90456.1| zeta-carotene desaturase [Cyanothece sp. CCY0110]
Length=490

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI+GAGLAGM+TA++L+D G EV+I++S+ FIGGKVGS+VD+ GNHIEMGLHVFFGC
Sbjct  1    MRVAIVGAGLAGMATAIDLVDAGCEVEIFESRPFIGGKVGSWVDKDGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y NLF LM+KVGA  NL +K+HTHTF+N+GG IGE
Sbjct  61   YYNLFALMEKVGAIDNLRLKEHTHTFINRGGKIGE  95



>ref|WP_015132414.1| zeta-carotene desaturase [Leptolyngbya sp. PCC 7376]
 gb|AFY36627.1| zeta-carotene desaturase [Leptolyngbya sp. PCC 7376]
Length=487

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI+GAGLAG+STA+EL+D GHEV+I++++ F+GGKVGS+VD+ GNHIEMGLHVFFGC
Sbjct  1    MRVAIVGAGLAGLSTAIELVDAGHEVEIFEARPFVGGKVGSWVDKDGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y NLF LM+KVGA  NL +K+HTH F+N+GG +GE
Sbjct  61   YYNLFALMEKVGAGNNLRLKEHTHQFINEGGKLGE  95



>ref|WP_012596658.1| MULTISPECIES: zeta-carotene desaturase [Cyanothece]
 gb|ACK67398.1| carotene 7,8-desaturase [Cyanothece sp. PCC 8801]
 gb|ACV01546.1| carotene 7,8-desaturase [Cyanothece sp. PCC 8802]
Length=490

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI+GAGLAGM+TA++L+D G EV+I++S+ F+GGKVGS+VD  GNH+EMGLHVFFGC
Sbjct  1    MRVAIVGAGLAGMTTAIDLVDAGCEVEIFESRPFVGGKVGSWVDNDGNHLEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y NLF LMKKVGA +NL +K+HTHTF+N+GG +GE
Sbjct  61   YYNLFELMKKVGAIENLRLKEHTHTFINQGGRVGE  95



>gb|AFI09269.1| carotene desaturase, partial [Gardenia jasminoides]
Length=203

 Score =   142 bits (358),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 64/73 (88%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = +2

Query  422  GHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDH  601
            GHEVDIY+S+ FIGGKVGSFVD+RGNHIEMGLHVFFGCYNNLFRLMKKVGA +NLLVKDH
Sbjct  1    GHEVDIYESRPFIGGKVGSFVDKRGNHIEMGLHVFFGCYNNLFRLMKKVGANENLLVKDH  60

Query  602  THTFVNKGGDIGE  640
            THTF+NKGG +GE
Sbjct  61   THTFINKGGQVGE  73



>ref|WP_015146661.1| zeta-carotene desaturase [Oscillatoria acuminata]
 gb|AFY80011.1| zeta-carotene desaturase [Oscillatoria acuminata PCC 6304]
Length=490

 Score =   148 bits (373),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI GAGLAGMSTA+EL+D GHEV+I++S+ F+GGKVGS+VD  GNH+EMGLHVFFGC
Sbjct  1    MRVAIAGAGLAGMSTAIELVDAGHEVEIFESRPFVGGKVGSWVDAEGNHLEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y NLF LMKKVGA  +L +KDHTH F+N+GG  GE
Sbjct  61   YYNLFDLMKKVGAIDHLRLKDHTHIFINEGGKTGE  95



>ref|WP_015220074.1| zeta-carotene desaturase [Cyanobacterium aponinum]
 gb|AFZ54350.1| zeta-carotene desaturase [Cyanobacterium aponinum PCC 10605]
Length=483

 Score =   147 bits (372),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI+GAGLAG++TA+EL+D G EV+I++S+ F+GGKVGS+VD  GNHIEMGLHVFFGC
Sbjct  1    MRVAIVGAGLAGLATAIELVDAGCEVEIFESRPFVGGKVGSWVDNDGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y NLF LM+KVGA +NL +K+HTHTF+N+GG +GE
Sbjct  61   YYNLFALMEKVGAIENLRLKEHTHTFINQGGRVGE  95



>ref|WP_039727183.1| MULTISPECIES: zeta-carotene desaturase [Oscillatoriophycideae]
 gb|KIF15203.1| zeta-carotene desaturase [Aphanocapsa montana BDHKU210001]
 gb|KIF40116.1| zeta-carotene desaturase [Lyngbya confervoides BDU141951]
Length=478

 Score =   147 bits (371),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI+GAGLAG+STAVEL D GHEV+I++S+ F+GGKVGS+VD+ GNH+EMGLHVFFGC
Sbjct  1    MRVAIVGAGLAGLSTAVELADAGHEVEIFESRPFVGGKVGSWVDKDGNHVEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y NLF LM++V A ++L +K+HTHTFVN+GG  GE
Sbjct  61   YYNLFALMQRVDAFQHLRLKEHTHTFVNRGGQTGE  95



>ref|WP_028083991.1| zeta-carotene desaturase [Dolichospermum circinale]
Length=481

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI+GAGLAG+STAV+L+D+G EV+I++S+ F+GGKV S+VD  GNHIEMGLHVFFGC
Sbjct  1    MRVAIVGAGLAGLSTAVDLVDRGCEVEIFESRPFVGGKVSSWVDNDGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIG  637
            Y NLF LM+KVGA +NLL+K+H+HTFVNKGG  G
Sbjct  61   YYNLFALMEKVGAGENLLIKEHSHTFVNKGGKTG  94



>ref|WP_007303963.1| zeta-carotene desaturase [Crocosphaera watsonii]
 gb|EAM52310.1| Carotene 7,8-desaturase [Crocosphaera watsonii WH 8501]
 gb|EHJ14435.1| Pro-zeta-carotene desaturase, prolycopene producing [Crocosphaera 
watsonii WH 0003]
 emb|CCQ63427.1| Pro-zeta-carotene desaturase, prolycopene producing [Crocosphaera 
watsonii WH 0401]
 emb|CCQ54548.1| Pro-zeta-carotene desaturase, prolycopene producing [Crocosphaera 
watsonii WH 0005]
 emb|CCQ66212.1| Pro-zeta-carotene desaturase, prolycopene producing [Crocosphaera 
watsonii WH 0402]
Length=490

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI+GAGLAGM+TA++L+D G EV+I++S+ F+GGKVGS+VD+ GNHIEMGLHVFFGC
Sbjct  1    MRVAIVGAGLAGMATAMDLVDGGCEVEIFESRPFVGGKVGSWVDKDGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y NLF LMKKVGA  NL +K HTHTF+N GG IGE
Sbjct  61   YYNLFALMKKVGAIDNLRLKQHTHTFINSGGKIGE  95



>ref|WP_035372164.1| zeta-carotene desaturase, partial [Dolichospermum circinale]
Length=483

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI+GAGLAG+STAV+L+D+G EV+I++S+ F+GGKV S+VD  GNHIEMGLHVFFGC
Sbjct  1    MRVAIVGAGLAGLSTAVDLVDRGCEVEIFESRPFVGGKVSSWVDNDGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIG  637
            Y NLF LM+KVGA +NLL+K+H+HTF+NKGG  G
Sbjct  61   YYNLFALMEKVGAGENLLIKEHSHTFINKGGKTG  94



>ref|WP_007352889.1| MULTISPECIES: zeta-carotene desaturase [Kamptonema]
 emb|CBN53658.1| zeta-carotene desaturase [ [[Oscillatoria] sp. PCC 6506]
Length=479

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI GAGLAGM+ A++L+D GHEV+I++S+ F+GGKVGS+VD  GNH+EMGLHVFFGC
Sbjct  1    MRVAIAGAGLAGMTCAIDLVDAGHEVEIFESRPFVGGKVGSWVDPDGNHVEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIG  637
            Y NLF +MKKVGA  NLL+K+HTHTF+N+GG+ G
Sbjct  61   YYNLFEVMKKVGAFDNLLLKEHTHTFINRGGETG  94



>ref|WP_011613311.1| zeta-carotene desaturase [Trichodesmium erythraeum]
 gb|ABG52981.1| zeta-carotene desaturase [Trichodesmium erythraeum IMS101]
Length=483

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI GAGLAGM+TAVEL D GH+V+I++S+ F+GGKVGS+VD+ GNH+EMGLHVFFGC
Sbjct  1    MRVAIAGAGLAGMATAVELADAGHQVEIFESRPFVGGKVGSWVDKNGNHVEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIG  637
            Y  LF LMKKVGA KNL +K+H+H F+NKGG  G
Sbjct  61   YYQLFELMKKVGAFKNLRLKEHSHNFINKGGKTG  94



>ref|WP_015181504.1| carotene 7,8-desaturase [Microcoleus sp. PCC 7113]
 gb|AFZ17348.1| carotene 7,8-desaturase [Microcoleus sp. PCC 7113]
Length=489

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI+GAGLAGM+TAVEL+D GHEV++++S+ F+GGKVGS+VD  GNH+EMGLHVFFGC
Sbjct  1    MRVAIVGAGLAGMATAVELVDAGHEVELFESRPFVGGKVGSWVDADGNHVEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIG  637
            Y  LF LMKKVGA  NL +K+HTH FVNKGG  G
Sbjct  61   YYQLFDLMKKVGAIDNLRLKEHTHVFVNKGGRTG  94



>ref|WP_015166147.1| zeta-carotene desaturase [Pseudanabaena sp. PCC 7367]
 gb|AFY71191.1| zeta-carotene desaturase [Pseudanabaena sp. PCC 7367]
Length=473

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++ AIIGAGLAG+STAVEL D+G+ V+I++S+ F+GGKVGS++D+ GNHIEMGLHVFFGC
Sbjct  1    MRAAIIGAGLAGLSTAVELCDRGYAVEIFESRPFVGGKVGSWIDQDGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y NLF LM+KVGA ++LL K+HTHTF+N+GG  GE
Sbjct  61   YYNLFSLMQKVGAFEHLLRKEHTHTFINRGGRTGE  95



>ref|WP_015192125.1| zeta-carotene desaturase [Stanieria cyanosphaera]
 gb|AFZ34452.1| zeta-carotene desaturase [Stanieria cyanosphaera PCC 7437]
Length=490

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI+GAGLAGM+TA++L+D G +V+I++S+ F+GGKVGS+VD  GNHIEMGLHVFFGC
Sbjct  1    MRVAIVGAGLAGMATAIDLVDAGWDVEIFESRPFVGGKVGSWVDAEGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y NLF LM+KVGA  NL +K+HTHTF+N+GG  GE
Sbjct  61   YYNLFELMRKVGAIDNLRLKEHTHTFINEGGKKGE  95



>ref|WP_008181727.1| zeta-carotene desaturase [Moorea producens]
 gb|EGJ33784.1| zeta-carotene desaturase [Moorea producens 3L]
Length=478

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            +++AI+GAGLAGM+TA+EL+D GHEV+I++S+ F+GGKVGS+VD+ GNHIEMGLHVFFGC
Sbjct  1    MRLAIVGAGLAGMATAIELVDAGHEVEIFESRPFVGGKVGSWVDKDGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y NLF LMKKVGA + L +K+HTHTF+N  G  GE
Sbjct  61   YYNLFELMKKVGAFQFLRLKEHTHTFINNDGRKGE  95



>ref|WP_015144007.1| carotene 7,8-desaturase [Pleurocapsa minor]
 gb|AFY77704.1| carotene 7,8-desaturase [Pleurocapsa sp. PCC 7327]
Length=490

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI+GAGLAGM+TAV+L+D G EV+I++S+ F+GGKVGS++D  GNHIEMGLHVFFGC
Sbjct  1    MRVAIVGAGLAGMATAVDLVDAGCEVEIFESRPFVGGKVGSWIDTDGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y  LF LMKKVGA +NL +K+HTHTF+N GG +GE
Sbjct  61   YYQLFDLMKKVGAFENLRLKEHTHTFINDGGRVGE  95



>ref|WP_015175312.1| carotene 7,8-desaturase [Oscillatoria nigro-viridis]
 gb|AFZ05991.1| carotene 7,8-desaturase [Oscillatoria nigro-viridis PCC 7112]
Length=478

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI GAGLAGM+TAV+L++ GHEV+I++S+ F+GGKVGS+VD  GNH+EMGLHVFFGC
Sbjct  1    MRVAIAGAGLAGMTTAVDLVEAGHEVEIFESRPFVGGKVGSWVDPDGNHVEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIG  637
            Y NLF LMKKVGA  +LL+K+H HTF+N+GG+ G
Sbjct  61   YYNLFALMKKVGAFDDLLLKEHVHTFINRGGETG  94



>ref|WP_002800446.1| zeta-carotene desaturase [Microcystis aeruginosa]
 emb|CCI35373.1| Zeta-carotene desaturase [Microcystis aeruginosa PCC 9701]
Length=486

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++V I+GAGLAGM+TA++L+D G  V+I +S+ F+GGKVGS+VD  GNHIEMGLHVFFGC
Sbjct  1    MRVVIVGAGLAGMATAIDLVDAGCTVEILESRPFVGGKVGSWVDTDGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y NLF LMKKVGA ++LL+K+HTHTF+N+GG IGE
Sbjct  61   YYNLFELMKKVGAFQSLLLKEHTHTFINEGGKIGE  95



>ref|WP_008196176.1| zeta-carotene desaturase [Microcystis sp. T1-4]
 emb|CCI30359.1| Zeta-carotene desaturase [Microcystis sp. T1-4]
Length=486

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++V I+GAGLAGM+TA++L+D G  V+I +S+ F+GGKVGS+VD  GNHIEMGLHVFFGC
Sbjct  1    MRVVIVGAGLAGMATAIDLVDAGCTVEILESRPFVGGKVGSWVDADGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y NLF LMKKVGA ++LL+K+HTHTF+N+GG IGE
Sbjct  61   YYNLFELMKKVGAFQSLLLKEHTHTFINEGGKIGE  95



>dbj|GAL91277.1| pro-zeta-carotene desaturase, prolycopene producing [Microcystis 
aeruginosa NIES-44]
Length=486

 Score =   145 bits (366),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++V I+GAGLAGM+TA++L+D G  V+I +S+ F+GGKVGS+VD  GNHIEMGLHVFFGC
Sbjct  1    MRVVIVGAGLAGMATAIDLVDAGCTVEILESRPFVGGKVGSWVDADGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y NLF LMKKVGA ++LL+K+HTHTF+N+GG IGE
Sbjct  61   YYNLFELMKKVGAFQSLLLKEHTHTFINEGGKIGE  95



>ref|WP_002796087.1| zeta-carotene desaturase [Microcystis aeruginosa]
 dbj|BAG05132.1| zeta-carotene desaturase [Microcystis aeruginosa NIES-843]
 emb|CCI22562.1| Zeta-carotene desaturase [Microcystis aeruginosa PCC 9809]
Length=486

 Score =   145 bits (365),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++V I+GAGLAGM+TA++L+D G  V+I +S+ F+GGKVGS+VD  GNHIEMGLHVFFGC
Sbjct  1    MRVVIVGAGLAGMATAIDLVDAGCTVEILESRPFVGGKVGSWVDADGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y NLF LMKKVGA ++LL+K+HTHTF+N+GG IGE
Sbjct  61   YYNLFELMKKVGAFQSLLLKEHTHTFINEGGKIGE  95



>ref|WP_002744950.1| carotene 7,8-desaturase [Microcystis aeruginosa]
 emb|CAO90779.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 gb|ELS47265.1| carotene 7,8-desaturase [Microcystis aeruginosa DIANCHI905]
Length=486

 Score =   145 bits (365),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++V I+GAGLAGM+TA++L+D G  V+I +S+ F+GGKVGS+VD  GNHIEMGLHVFFGC
Sbjct  1    MRVVIVGAGLAGMATAIDLVDAGCTVEILESRPFVGGKVGSWVDADGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y NLF LMKKVGA ++LL+K+HTHTF+N+GG IGE
Sbjct  61   YYNLFELMKKVGAFQSLLLKEHTHTFINEGGKIGE  95



>ref|WP_002738691.1| carotene 7,8-desaturase [Microcystis aeruginosa]
 gb|ELP52735.1| carotene 7,8-desaturase [Microcystis aeruginosa TAIHU98]
Length=486

 Score =   145 bits (365),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++V I+GAGLAGM+TA++L+D G  V+I +S+ F+GGKVGS+VD  GNHIEMGLHVFFGC
Sbjct  1    MRVVIVGAGLAGMATAIDLVDAGCTVEILESRPFVGGKVGSWVDADGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y NLF LMKKVGA ++LL+K+HTHTF+N+GG IGE
Sbjct  61   YYNLFELMKKVGAFQSLLLKEHTHTFINEGGKIGE  95



>ref|WP_002755392.1| zeta-carotene desaturase [Microcystis aeruginosa]
 emb|CCH93531.1| Zeta-carotene desaturase [Microcystis aeruginosa PCC 9432]
 gb|EPF19421.1| 15-cis-phytoene desaturase [Microcystis aeruginosa SPC777]
Length=486

 Score =   145 bits (365),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++V I+GAGLAGM+TA++L+D G  V+I +S+ F+GGKVGS+VD  GNHIEMGLHVFFGC
Sbjct  1    MRVVIVGAGLAGMATAIDLVDAGCTVEILESRPFVGGKVGSWVDADGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y NLF LMKKVGA ++LL+K+HTHTF+N+GG IGE
Sbjct  61   YYNLFELMKKVGAFQSLLLKEHTHTFINEGGKIGE  95



>ref|WP_024970325.1| zeta-carotene desaturase [Microcystis aeruginosa]
Length=486

 Score =   145 bits (365),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++V I+GAGLAGM+TA++L+D G  V+I +S+ F+GGKVGS+VD  GNHIEMGLHVFFGC
Sbjct  1    MRVVIVGAGLAGMATAIDLVDAGCTVEILESRPFVGGKVGSWVDADGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y NLF LMKKVGA ++LL+K+HTHTF+N+GG IGE
Sbjct  61   YYNLFELMKKVGAFQSLLLKEHTHTFINEGGKIGE  95



>ref|WP_002792824.1| zeta-carotene desaturase [Microcystis aeruginosa]
 emb|CCI22908.1| Zeta-carotene desaturase [Microcystis aeruginosa PCC 9808]
Length=486

 Score =   145 bits (365),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++V I+GAGLAGM+TA++L+D G  V+I +S+ F+GGKVGS+VD  GNHIEMGLHVFFGC
Sbjct  1    MRVVIVGAGLAGMATAIDLVDAGCTVEILESRPFVGGKVGSWVDADGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y NLF LMKKVGA ++LL+K+HTHTF+N+GG IGE
Sbjct  61   YYNLFELMKKVGAFQSLLLKEHTHTFINEGGKIGE  95



>ref|WP_002780881.1| Zeta-carotene desaturase [Microcystis aeruginosa]
 emb|CCI14844.1| Zeta-carotene desaturase [Microcystis aeruginosa PCC 9806]
Length=486

 Score =   145 bits (365),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++V I+GAGLAGM+TA++L+D G  V+I +S+ F+GGKVGS+VD  GNHIEMGLHVFFGC
Sbjct  1    MRVVIVGAGLAGMATAIDLVDAGCTVEILESRPFVGGKVGSWVDADGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y NLF LMKKVGA ++LL+K+HTHTF+N+GG IGE
Sbjct  61   YYNLFELMKKVGAFQSLLLKEHTHTFINEGGKIGE  95



>ref|WP_015226977.1| zeta-carotene desaturase [Halothece sp. PCC 7418]
 gb|AFZ45104.1| zeta-carotene desaturase [Halothece sp. PCC 7418]
Length=478

 Score =   145 bits (365),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI+GAGLAG+STAV L D G EV+IY+S+ F+GGKVGS+VD  GNH+EMGLHVFFGC
Sbjct  1    MRVAIVGAGLAGLSTAVNLADAGWEVEIYESRPFVGGKVGSWVDADGNHVEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y +LFRLM+KVGA  +L +K+HTHTF+N+GG +GE
Sbjct  61   YYHLFRLMEKVGAIAHLRLKEHTHTFINEGGKVGE  95



>ref|WP_002764632.1| zeta-carotene desaturase [Microcystis aeruginosa]
 emb|CCI00634.1| Zeta-carotene desaturase [Microcystis aeruginosa PCC 9443]
Length=486

 Score =   145 bits (365),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++V I+GAGLAGM+TA++L+D G  V+I +S+ F+GGKVGS+VD  GNHIEMGLHVFFGC
Sbjct  1    MRVVIVGAGLAGMATAIDLVDAGCTVEILESRPFVGGKVGSWVDADGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y NLF LMKKVGA ++LL+K+HTHTF+N+GG IGE
Sbjct  61   YYNLFELMKKVGAFQSLLLKEHTHTFINEGGKIGE  95



>ref|WP_002759655.1| zeta-carotene desaturase [Microcystis aeruginosa]
 emb|CCH97203.1| Zeta-carotene desaturase [Microcystis aeruginosa PCC 9717]
Length=486

 Score =   145 bits (365),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++V I+GAGLAGM+TA++L+D G  V+I +S+ F+GGKVGS+VD  GNHIEMGLHVFFGC
Sbjct  1    MRVVIVGAGLAGMATAIDLVDAGCTVEILESRPFVGGKVGSWVDADGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y NLF LMKKVGA ++LL+K+HTHTF+N+GG IGE
Sbjct  61   YYNLFELMKKVGAFQSLLLKEHTHTFINEGGKIGE  95



>ref|WP_002787023.1| zeta-carotene desaturase [Microcystis aeruginosa]
 emb|CCI16789.1| Zeta-carotene desaturase [Microcystis aeruginosa PCC 9807]
Length=486

 Score =   145 bits (365),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++V I+GAGLAGM+TA++L+D G  V+I +S+ F+GGKVGS+VD  GNHIEMGLHVFFGC
Sbjct  1    MRVVIVGAGLAGMATAIDLVDAGCTVEILESRPFVGGKVGSWVDADGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y NLF LMKKVGA ++LL+K+HTHTF+N+GG IGE
Sbjct  61   YYNLFELMKKVGAFQSLLLKEHTHTFINEGGKIGE  95



>ref|WP_015222888.1| zeta-carotene desaturase [Cyanobacterium stanieri]
 gb|AFZ47571.1| zeta-carotene desaturase [Cyanobacterium stanieri PCC 7202]
Length=477

 Score =   145 bits (365),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI+GAGLAG++TA++L+D G EV+I++S+ F+GGKVGS+VD+ GNHIEMGLHVFFGC
Sbjct  1    MRVAIVGAGLAGLATAIDLVDAGCEVEIFESRPFVGGKVGSWVDKDGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y NLF LM+KVGA  NL +K HTHTF+N+GG +GE
Sbjct  61   YYNLFALMEKVGAIDNLRLKQHTHTFINEGGRVGE  95



>ref|WP_018399171.1| zeta-carotene desaturase [filamentous cyanobacterium ESFC-1]
Length=490

 Score =   145 bits (365),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI+GAGLAGM+TA+EL D G EV+I++S+ F+GGKV S+ D+ GNH+EMGLHVFFGC
Sbjct  1    MRVAIVGAGLAGMATAIELADAGCEVEIFESRPFVGGKVSSWTDKDGNHLEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y NLF LM+KVGA  NL +KDH HTF+N+GG IGE
Sbjct  61   YYNLFELMEKVGAIANLRLKDHVHTFINEGGRIGE  95



>ref|WP_017305968.1| zeta-carotene desaturase [Spirulina subsalsa]
Length=480

 Score =   144 bits (364),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI+GAGLAGM+TAV+L+D G EV+I++S+ F+GGKVGS+VD  GNH+EMGLHVFFGC
Sbjct  1    MRVAIVGAGLAGMATAVDLVDAGCEVEIFESRPFLGGKVGSWVDGDGNHVEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y NLF LM+KVGA  NL +K+HTHTF+N GG IGE
Sbjct  61   YYNLFGLMEKVGALDNLRLKEHTHTFINTGGRIGE  95



>ref|WP_008312128.1| carotene 7,8-desaturase [Leptolyngbya sp. PCC 6406]
Length=484

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI+GAGLAG+STAV+L D GHEV+I++S+ F+GGKVGS+VD+ GNHIEMGLHVFF  
Sbjct  1    MRVAIVGAGLAGLSTAVDLADAGHEVEIFESRPFVGGKVGSWVDQDGNHIEMGLHVFFNN  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIG  637
            Y NLF LM++VGA +NLL KDH HTF+N+GG+I 
Sbjct  61   YTNLFALMQRVGAFENLLPKDHVHTFINRGGEIA  94



>ref|WP_029959080.1| zeta-carotene desaturase, partial [Prochlorococcus sp. scB241_526B19]
Length=143

 Score =   136 bits (343),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            +K+AI+G+GLAG++ AV L+D+GHEV+IY+S+SF GGKVGS+ D+ GNHIEMGLHVFF  
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVEIYESRSFWGGKVGSWEDKDGNHIEMGLHVFFYN  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDI  634
            Y NLF+LMKKVGA  NLL KDHTH F+N GG++
Sbjct  61   YANLFKLMKKVGALDNLLPKDHTHLFINNGGNL  93



>ref|WP_006632676.1| zeta-carotene desaturase [Microcoleus vaginatus]
 gb|EGK88869.1| carotene 7,8-desaturase [Microcoleus vaginatus FGP-2]
Length=478

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI GAGLAGM+TAV+L++ GH+V+I++S+ F+GGKVGS+VD  GNH+EMGLHVFFGC
Sbjct  1    MRVAIAGAGLAGMTTAVDLVEAGHQVEIFESRPFVGGKVGSWVDPDGNHVEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIG  637
            Y NLF LMKKVGA  +LL+K+H HTF+N+GG+ G
Sbjct  61   YYNLFALMKKVGAFDDLLLKEHVHTFINRGGETG  94



>ref|WP_002778277.1| zeta-carotene desaturase [Microcystis aeruginosa]
 emb|CCI08478.1| Zeta-carotene desaturase [Microcystis aeruginosa PCC 7941]
Length=486

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++V I+GAGLAGM+TA++L+D G  ++I +S+ F+GGKVGS+VD  GNHIEMGLHVFFGC
Sbjct  1    MRVVIVGAGLAGMATAIDLVDAGCTLEILESRPFVGGKVGSWVDADGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y NLF LMKKVGA ++LL+K+HTHTF+N+GG IGE
Sbjct  61   YYNLFELMKKVGAFQSLLLKEHTHTFINEGGKIGE  95



>ref|WP_029983587.1| zeta-carotene desaturase, partial [Prochlorococcus sp. scB243_495N4]
Length=114

 Score =   135 bits (340),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            +K+AI+G+GLAG++ AV L+D+GHEV+IY+S+SF GGKVGS+ D+ GNHIEMGLHVFF  
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVEIYESRSFWGGKVGSWGDKDGNHIEMGLHVFFYN  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDI  634
            Y NLF+LMKKVGA  NLL KDHTH F+N GG++
Sbjct  61   YANLFKLMKKVGALDNLLPKDHTHLFINNGGNL  93



>ref|WP_044106302.1| zeta-carotene desaturase [cyanobacterium endosymbiont of Epithemia 
turgida]
 dbj|BAP17577.1| zeta-carotene desaturase [cyanobacterium endosymbiont of Epithemia 
turgida isolate EtSB Lake Yunoko]
Length=477

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++V I+GAGLAG++TA++L+D G+EV+I +S+ FIGGKVGS+ D  GNHIEMGLHVFFGC
Sbjct  1    MRVVIVGAGLAGLTTAIDLVDAGYEVEILESRPFIGGKVGSWTDDEGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y NLF LM+KVGA +NL +K H HTF+NKGG +GE
Sbjct  61   YYNLFTLMEKVGASQNLRLKQHIHTFINKGGRVGE  95



>ref|WP_039743588.1| zeta-carotene desaturase [Hassallia byssoidea]
 gb|KIF35873.1| zeta-carotene desaturase [Hassallia byssoidea VB512170]
Length=478

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI+GAGLAG++TAV+L D G EV I++S+ F+GGKVGS+VD  GNH+EMGLHVFFGC
Sbjct  1    MRVAIVGAGLAGLATAVDLADAGCEVQIFESRPFVGGKVGSWVDNDGNHVEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y  LF LMKKVGA  NL +K+HTHTF+NKGG  GE
Sbjct  61   YYQLFELMKKVGAFDNLRLKEHTHTFINKGGQTGE  95



>ref|WP_015228996.1| carotene 7,8-desaturase [Dactylococcopsis salina]
 gb|AFZ49990.1| carotene 7,8-desaturase [Dactylococcopsis salina PCC 8305]
Length=485

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI+GAGLAG+STAV L D G EV+IY+S+ F+GGKVGS+VD+ GNH+EMGLHVFFGC
Sbjct  1    MRVAIVGAGLAGLSTAVNLADAGWEVEIYESRPFVGGKVGSWVDQDGNHLEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y +LF LM+KVGA ++L +K HTHTFVN+GG +GE
Sbjct  61   YYHLFSLMEKVGAIEHLRLKQHTHTFVNEGGKLGE  95



>ref|WP_015170063.1| carotene 7,8-desaturase [Synechococcus sp. PCC 7502]
 gb|AFY75412.1| carotene 7,8-desaturase [Synechococcus sp. PCC 7502]
Length=462

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            +KVAIIGAGLAGM+TA+EL D+GHEV+I++S+ F+GGKVGS++D  GNHIEMGLHVFFGC
Sbjct  1    MKVAIIGAGLAGMTTALELCDRGHEVEIFESRPFVGGKVGSWLDTDGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIG  637
            Y NLF LM+KVGA  +LL+K+HTHTF+ K    G
Sbjct  61   YYNLFALMEKVGALDHLLLKEHTHTFIQKDAKTG  94



>ref|WP_011822978.1| zeta-carotene desaturase [Prochlorococcus marinus]
 gb|ABM74753.1| zeta-carotene desaturase [Prochlorococcus marinus str. NATL1A]
Length=486

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            +K+AIIGAGLAG++ AV+L+D+GH+VD+Y++K FIGGKVGS+ D  GNHIEMGLHVFF  
Sbjct  1    MKIAIIGAGLAGLTAAVDLVDEGHDVDLYEAKPFIGGKVGSWEDSDGNHIEMGLHVFFFN  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDI  634
            Y NLF LM+KVGA +NLL KDHTH FVNKGGDI
Sbjct  61   YANLFSLMRKVGAFENLLPKDHTHLFVNKGGDI  93



>ref|WP_017296227.1| zeta-carotene desaturase [Geminocystis herdmanii]
Length=483

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI+GAGLAG++TA++L+D G +V+I++S+ F+GGKVGS+VD  GNHIEMGLHVFFGC
Sbjct  1    MRVAIVGAGLAGLATAIDLVDAGWDVEIFESRPFVGGKVGSWVDSDGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y NLF LM+KVGA  NL +K HTHTF+N+GG +GE
Sbjct  61   YYNLFALMEKVGAIDNLRLKQHTHTFINEGGRVGE  95



>ref|WP_006616919.1| zeta-carotene desaturase [Arthrospira platensis]
 gb|KDR57699.1| zeta-carotene desaturase [Arthrospira platensis str. Paraca]
Length=490

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI GAGLAGM+TAV+L+D GHEV++++S+ F+GGKVGS+VD  GNH+EMGLHVFFGC
Sbjct  1    MRVAIAGAGLAGMATAVDLVDAGHEVELFESRPFVGGKVGSWVDPEGNHVEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIG  637
            Y  LF LMKKVGA +NL +KDH H FVN GG IG
Sbjct  61   YYQLFDLMKKVGAFENLRLKDHIHCFVNPGGVIG  94



>ref|WP_014274504.1| zeta-carotene desaturase [Arthrospira platensis]
 dbj|BAI88855.1| zeta-carotene desaturase [Arthrospira platensis NIES-39]
Length=490

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI GAGLAGM+TAV+L+D GHEV++++S+ F+GGKVGS+VD  GNH+EMGLHVFFGC
Sbjct  1    MRVAIAGAGLAGMATAVDLVDAGHEVELFESRPFVGGKVGSWVDPEGNHVEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIG  637
            Y  LF LMKKVGA +NL +KDH H FVN GG IG
Sbjct  61   YYQLFDLMKKVGAFENLRLKDHIHCFVNPGGVIG  94



>ref|WP_036901689.1| zeta-carotene desaturase [Prochlorococcus sp. MIT 0601]
 gb|KGG13259.1| Pro-zeta-carotene desaturase [Prochlorococcus sp. MIT 0601]
Length=486

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            +KVAI+GAGLAG++ AV+L+D GHEVDIY+++ F+GGKVGS+ D +GNHIEMGLHVFF  
Sbjct  1    MKVAIVGAGLAGLTAAVDLVDAGHEVDIYEARPFLGGKVGSWEDSQGNHIEMGLHVFFFN  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDI  634
            Y NLF LMKKVGA +NLL KDHTH FVNKGG++
Sbjct  61   YANLFALMKKVGALENLLPKDHTHLFVNKGGNV  93



>ref|WP_026785642.1| MULTISPECIES: zeta-carotene desaturase [Planktothrix]
Length=489

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI GAGLAGM+TA++L+D GHEV+I++S+ F+GGKV S++D  GNHIEMGLHVFFGC
Sbjct  1    MRVAIAGAGLAGMATAIDLVDAGHEVEIFESRPFVGGKVSSWIDPEGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIG  637
            Y NLF LM+KVGA  NL +KDHTH F+N GG  G
Sbjct  61   YYNLFELMRKVGAIDNLGLKDHTHIFINTGGKTG  94



>ref|WP_042153636.1| zeta-carotene desaturase [Planktothrix agardhii]
 gb|KEI66726.1| CrtQ [Planktothrix agardhii NIVA-CYA 126/8]
Length=489

 Score =   142 bits (359),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI GAGLAGM+TA++L+D GHEV+I++S+ F+GGKV S++D  GNHIEMGLHVFFGC
Sbjct  1    MRVAIAGAGLAGMATAIDLVDAGHEVEIFESRPFVGGKVSSWIDPEGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIG  637
            Y NLF LM+KVGA  NL +KDHTH F+N GG  G
Sbjct  61   YYNLFELMRKVGAIDNLGLKDHTHIFINTGGKTG  94



>ref|WP_026796254.1| zeta-carotene desaturase [Planktothrix prolifica]
Length=489

 Score =   142 bits (359),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI GAGLAGM+TA++L+D GHEV+I++S+ F+GGKV S++D  GNHIEMGLHVFFGC
Sbjct  1    MRVAIAGAGLAGMATAIDLVDAGHEVEIFESRPFVGGKVSSWIDPEGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIG  637
            Y NLF LM+KVGA  NL +KDHTH F+N GG  G
Sbjct  61   YYNLFELMRKVGAIDNLGLKDHTHIFINTGGKTG  94



>ref|WP_026796095.1| MULTISPECIES: zeta-carotene desaturase [Planktothrix]
Length=489

 Score =   142 bits (359),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI GAGLAGM+TA++L+D GHEV+I++S+ F+GGKV S++D  GNHIEMGLHVFFGC
Sbjct  1    MRVAIAGAGLAGMATAIDLVDAGHEVEIFESRPFVGGKVSSWIDPEGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIG  637
            Y NLF LM+KVGA  NL +KDHTH F+N GG  G
Sbjct  61   YYNLFELMRKVGAIDNLGLKDHTHIFINTGGKTG  94



>ref|WP_038650792.1| zeta-carotene desaturase [Prochlorococcus sp. MIT 0801]
 gb|AIQ96296.1| Pro-zeta-carotene desaturase [Prochlorococcus sp. MIT 0801]
Length=486

 Score =   142 bits (358),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            +K+AIIGAGLAG++ AV+L+D+GH+VD+Y++K F+GGKVGS+ D  GNHIEMGLHVFF  
Sbjct  1    MKIAIIGAGLAGLTAAVDLVDEGHDVDLYEAKPFMGGKVGSWEDSDGNHIEMGLHVFFFN  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDI  634
            Y NLF LM+KVGA +NLL KDHTH FVNKGGDI
Sbjct  61   YANLFELMRKVGAFENLLPKDHTHLFVNKGGDI  93



>ref|WP_011294117.1| zeta-carotene desaturase [Prochlorococcus marinus]
 gb|AAZ58972.1| zeta-carotene desaturase [Prochlorococcus marinus str. NATL2A]
Length=486

 Score =   142 bits (358),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            +K+AIIGAGLAG++ AV+L+D+GH+VD+Y++K F+GGKVGS+ D  GNHIEMGLHVFF  
Sbjct  1    MKIAIIGAGLAGLTAAVDLVDEGHDVDLYEAKPFMGGKVGSWEDSDGNHIEMGLHVFFFN  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDI  634
            Y NLF LM+KVGA +NLL KDHTH FVNKGGDI
Sbjct  61   YANLFELMRKVGAFENLLPKDHTHLFVNKGGDI  93



>ref|WP_036904745.1| zeta-carotene desaturase [Prochlorococcus marinus]
 gb|KGG21733.1| Pro-zeta-carotene desaturase [Prochlorococcus marinus str. PAC1]
Length=486

 Score =   142 bits (358),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            +K+AIIGAGLAG++ AV+L+D+GH+VD+Y++K F+GGKVGS+ D  GNHIEMGLHVFF  
Sbjct  1    MKIAIIGAGLAGLTAAVDLVDEGHDVDLYEAKPFMGGKVGSWEDSDGNHIEMGLHVFFFN  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDI  634
            Y NLF LM+KVGA +NLL KDHTH FVNKGGDI
Sbjct  61   YANLFSLMRKVGAFENLLPKDHTHLFVNKGGDI  93



>ref|WP_012194687.1| zeta-carotene desaturase [Prochlorococcus marinus]
 gb|ABX08062.1| zeta-carotene desaturase [Prochlorococcus marinus str. MIT 9211]
Length=478

 Score =   142 bits (357),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            +KVAI+G+GLAG+S AV+LLD GH VD+Y+++ F+GGKVGS+ D  GNHIEMGLHVFF  
Sbjct  1    MKVAIVGSGLAGLSAAVDLLDAGHSVDLYEARPFVGGKVGSWEDPEGNHIEMGLHVFFFN  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDI  634
            Y NLF LMKKVGA +NLL KDHTH FVNKGGD+
Sbjct  61   YTNLFSLMKKVGAIENLLPKDHTHLFVNKGGDL  93



>ref|WP_017717674.1| zeta-carotene desaturase [Oscillatoria sp. PCC 10802]
Length=489

 Score =   142 bits (357),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI GAGLAGM+TAV+L+D GHEV+I++S+ F+GGKVGS+ D  GNHIEMGLHVFFGC
Sbjct  1    MRVAIAGAGLAGMATAVDLVDAGHEVEIFESRPFVGGKVGSWTDADGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIG  637
            Y NLF LM KVGA  NL +K+HTH FVN+GG  G
Sbjct  61   YYNLFELMGKVGAIDNLRLKEHTHMFVNRGGTTG  94



>dbj|BAD07272.1| zeta-carotene desaturase [Citrus unshiu]
 dbj|BAD07288.1| zeta-carotene desaturase [Citrus limon]
Length=191

 Score =   135 bits (341),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 62/67 (93%), Positives = 67/67 (100%), Gaps = 0/67 (0%)
 Frame = +2

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            Y+S+SFIGGKVGSFVD+RGNHIEMGLHVFFGCYNNLFRLMKKVGA+KNLLVKDHTHTFVN
Sbjct  1    YESRSFIGGKVGSFVDKRGNHIEMGLHVFFGCYNNLFRLMKKVGADKNLLVKDHTHTFVN  60

Query  620  KGGDIGE  640
            KGG+IGE
Sbjct  61   KGGEIGE  67



>ref|WP_006624376.1| MULTISPECIES: zeta-carotene desaturase [Arthrospira]
 gb|EDZ95718.1| carotene 7,8-desaturase [Arthrospira maxima CS-328]
 emb|CCE17718.1| Zeta-carotene desaturase [Arthrospira sp. PCC 8005]
 gb|EKD07656.1| carotene 78-desaturase [Arthrospira platensis C1]
 emb|CDM96563.1| Zeta-carotene desaturase [Arthrospira sp. PCC 8005]
Length=490

 Score =   142 bits (357),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI GAGLAGM+TAV+L+D GHEV++++S+ F+GGKVGS+VD  GNH+EMGLHVFFGC
Sbjct  1    MRVAIAGAGLAGMATAVDLVDAGHEVELFESRPFVGGKVGSWVDPEGNHVEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIG  637
            Y  LF LMKKVGA +NL +KDH H FVN+ G IG
Sbjct  61   YYQLFDLMKKVGAFENLRLKDHIHCFVNRDGVIG  94



>ref|WP_011131754.1| zeta-carotene desaturase [Prochlorococcus marinus]
 emb|CAE18574.1| zeta-carotene desaturase [Prochlorococcus marinus subsp. pastoris 
str. CCMP1986]
 gb|KGF88132.1| Pro-zeta-carotene desaturase [Prochlorococcus marinus str. EQPAC1]
Length=484

 Score =   142 bits (357),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            +K+AI+G+GLAG++ AV L+D+GHEV+IY+S+SF GGKVGS+ D+ GNHIEMGLHVFF  
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVEIYESRSFWGGKVGSWEDKDGNHIEMGLHVFFYN  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDI  634
            Y NLF+LMKKVGA  NLL K+HTH FVNKGGD+
Sbjct  61   YANLFKLMKKVGALDNLLPKEHTHLFVNKGGDL  93



>ref|WP_027842846.1| zeta-carotene desaturase [Mastigocoleus testarum]
Length=479

 Score =   141 bits (356),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI+GAGLAG+ TA++L+D G EV I++S+ F+GGKVGS+VD+ GNHIEMGLHVFFGC
Sbjct  1    MRVAIVGAGLAGLVTAMDLVDAGCEVSIFESRPFVGGKVGSWVDKDGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y  LF LM+KVGA ++L +K+HTHTF+NKGG  GE
Sbjct  61   YYQLFELMEKVGAVEHLRIKEHTHTFINKGGKTGE  95



>ref|WP_017655161.1| zeta-carotene desaturase [Microchaete sp. PCC 7126]
Length=479

 Score =   141 bits (356),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI+GAGLAG++TAV+L D G EV I++S+ F+GGKVGS+VD  GNHIEMGLHVFFGC
Sbjct  1    MRVAIVGAGLAGLATAVDLADAGCEVHIFESRPFVGGKVGSWVDSDGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIG  637
            Y  LF LMKKVGA +NL +K+HTHTF+NKGG  G
Sbjct  61   YYQLFDLMKKVGALENLRLKEHTHTFINKGGRTG  94



>ref|WP_017660852.1| zeta-carotene desaturase [Geitlerinema sp. PCC 7105]
Length=478

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI GAGLAG++TA+ L D GHEV+I++S+ F+GGKVGS+VD  GNH+EMGLHVFFGC
Sbjct  1    MRVAIAGAGLAGLTTAINLADAGHEVEIFESRPFVGGKVGSWVDADGNHLEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            Y NLF LM+KVGA + L +K+HTHTF+N+GG +G+
Sbjct  61   YYNLFALMEKVGALEYLRLKEHTHTFINQGGRVGQ  95



>dbj|BAD07280.1| zeta-carotene desaturase [Citrus sinensis]
Length=191

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/67 (91%), Positives = 67/67 (100%), Gaps = 0/67 (0%)
 Frame = +2

Query  440  YDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVN  619
            Y+S+SFIGGKVGSFVD+RGNHIEMGLHVFFGCYNNLFRLMKK+GA+KNLLVKDHTHTFVN
Sbjct  1    YESRSFIGGKVGSFVDKRGNHIEMGLHVFFGCYNNLFRLMKKIGADKNLLVKDHTHTFVN  60

Query  620  KGGDIGE  640
            KGG+IGE
Sbjct  61   KGGEIGE  67



>ref|WP_019503087.1| zeta-carotene desaturase [Pseudanabaena sp. PCC 6802]
Length=486

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI+GAGLAGMSTAVEL D+G++V+I++S+ F+GGKVGS+VD  GNH+EMGLHVFFG 
Sbjct  1    MRVAIVGAGLAGMSTAVELCDRGYQVEIFESRPFVGGKVGSWVDPDGNHVEMGLHVFFGN  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIG  637
            Y  LF LM+KVGA K+LL K+H HTFVN+GG IG
Sbjct  61   YYQLFALMQKVGAFKSLLRKEHVHTFVNEGGRIG  94



>ref|WP_025937920.1| zeta-carotene desaturase [Prochlorococcus sp. scB245a_519A13]
Length=484

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            +K+AI+G+GLAG++ AV L+D+GHEV+IY+S+SF GGKVGS+ D+ GNHIEMGLHVFF  
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVEIYESRSFWGGKVGSWEDKDGNHIEMGLHVFFYN  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDI  634
            Y NLF+LMKKVGA  NLL KDHTH F+N GGD+
Sbjct  61   YANLFKLMKKVGALDNLLPKDHTHLFINNGGDL  93



>ref|WP_025905874.1| zeta-carotene desaturase [Prochlorococcus sp. scB245a_519B7]
Length=484

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            +K+AI+G+GLAG++ AV L+D+GHEVDIY+S+SF GGKVGS+ D+ GNHIEMGLHVFF  
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVDIYESRSFWGGKVGSWEDKDGNHIEMGLHVFFYN  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDI  634
            Y NLF+LMKKVGA  NLL KDHTH F+N GG++
Sbjct  61   YANLFKLMKKVGALDNLLPKDHTHLFINNGGNL  93



>ref|WP_032523894.1| zeta-carotene desaturase [Prochlorococcus marinus]
 gb|KGF88355.1| Pro-zeta-carotene desaturase [Prochlorococcus marinus str. GP2]
Length=484

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            +K+AI+G+GLAG++ AV L+D+GHEVDIY+S+SF GGKVGS+ D+ GNHIEMGLHVFF  
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVDIYESRSFWGGKVGSWEDKDGNHIEMGLHVFFYN  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDI  634
            Y NLF+LMKKVGA  NLL KDHTH F+N GG++
Sbjct  61   YANLFKLMKKVGALDNLLPKDHTHLFINNGGNL  93



>ref|WP_025979527.1| zeta-carotene desaturase [Prochlorococcus sp. scB243_498B23]
Length=484

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            +K+AI+G+GLAG++ AV L+D+GHEVDIY+S+SF GGKVGS+ D+ GNHIEMGLHVFF  
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVDIYESRSFWGGKVGSWEDKDGNHIEMGLHVFFYN  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDI  634
            Y NLF+LMKKVGA  NLL KDHTH F+N GG++
Sbjct  61   YANLFKLMKKVGALDNLLPKDHTHLFINNGGNL  93



>ref|WP_025936184.1| zeta-carotene desaturase [Prochlorococcus sp. scB245a_518D8]
Length=484

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            +K+AI+G+GLAG++ AV L+D+GHEVDIY+S+SF GGKVGS+ D+ GNHIEMGLHVFF  
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVDIYESRSFWGGKVGSWEDKDGNHIEMGLHVFFYN  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDI  634
            Y NLF+LMKKVGA  NLL KDHTH F+N GG++
Sbjct  61   YANLFKLMKKVGALDNLLPKDHTHLFINNGGNL  93



>ref|WP_025945602.1| zeta-carotene desaturase [Prochlorococcus sp. scB241_528N17]
Length=484

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            +K+AI+G+GLAG++ AV L+D+GHEVDIY+S+SF GGKVGS+ D+ GNHIEMGLHVFF  
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVDIYESRSFWGGKVGSWEDKDGNHIEMGLHVFFYN  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDI  634
            Y NLF+LMKKVGA  NLL KDHTH F+N GG++
Sbjct  61   YANLFKLMKKVGALDNLLPKDHTHLFINNGGNL  93



>ref|XP_005712997.1| zeta-carotene desaturase [Chondrus crispus]
 emb|CDF33194.1| zeta-carotene desaturase [Chondrus crispus]
Length=511

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 82/105 (78%), Gaps = 2/105 (2%)
 Frame = +2

Query  326  PEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHI  505
            P P   RG +  VAI+GAGLAG+ TA+EL D G  V +YD++ F GGKVGS+VDR GNHI
Sbjct  14   PAPPRARGKR--VAIVGAGLAGLVTAMELADAGCAVTLYDTRPFAGGKVGSWVDRDGNHI  71

Query  506  EMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIGE  640
            EMGLHVFFGCY +LF +M KVGA K+LL+K+HTH FVNKGG  GE
Sbjct  72   EMGLHVFFGCYYDLFDVMAKVGAFKHLLLKEHTHQFVNKGGVKGE  116



>ref|WP_036922357.1| zeta-carotene desaturase [Prochlorococcus marinus]
Length=485

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            +K+AI+G+GLAG++ AV+L+D GHEV+IY+S+ F GGKVGS+VD+ GNHIEMGLHVFF  
Sbjct  1    MKIAIVGSGLAGLTAAVDLVDNGHEVEIYESRPFWGGKVGSWVDKEGNHIEMGLHVFFYN  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDI  634
            Y NLF+LMKKVGA  NLL KDHTH F+N+GG++
Sbjct  61   YANLFKLMKKVGAFDNLLPKDHTHLFINEGGNL  93



>ref|WP_019475733.1| zeta-carotene desaturase [Prochlorococcus sp. W3]
Length=485

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            +K+AI+G+GLAG++ AV+L+D GHEV+IY+S+ F GGKVGS+VD+ GNHIEMGLHVFF  
Sbjct  1    MKIAIVGSGLAGLTAAVDLVDNGHEVEIYESRPFWGGKVGSWVDKEGNHIEMGLHVFFYN  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDI  634
            Y NLF+LMKKVGA  NLL KDHTH F+N+GG++
Sbjct  61   YANLFKLMKKVGAFNNLLPKDHTHLFINEGGNL  93



>ref|WP_016951556.1| zeta-carotene desaturase [Anabaena sp. PCC 7108]
Length=484

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI+GAGLAG++TAV+L D G EV I++S+ F+GGKVGS+VD  GNHIEMGLHVFFGC
Sbjct  1    MRVAIVGAGLAGLATAVDLADAGCEVQIFESRPFVGGKVGSWVDGDGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIG  637
            Y NLF LM+KVGA +NL +K+H+HTF+NKGG  G
Sbjct  61   YYNLFELMQKVGAGENLRLKEHSHTFINKGGLTG  94



>gb|EFA72095.1| hypothetical protein CRD_02617 [Raphidiopsis brookii D9]
Length=138

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++V I+GAGLAG++TAV+L D G +V+I++++ F+GGKV S+VD  GNHIEMGLHVFFGC
Sbjct  1    MRVVIVGAGLAGLATAVDLADAGWDVEIFEARPFVGGKVSSWVDGDGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIG  637
            Y NLF LM KVGA  NL +K+HTH FVNKGG+ G
Sbjct  61   YYNLFELMAKVGAGNNLRLKEHTHVFVNKGGNTG  94



>ref|WP_023068890.1| 9,9'-di-cis-zeta-carotene desaturase [Lyngbya aestuarii]
 gb|ERT04874.1| 9,9'-di-cis-zeta-carotene desaturase [Lyngbya aestuarii BL J]
Length=489

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI GAGLAGM+TAV+L++ GH+V+I++S+ F+GGKVGS+VD  GNH+EMGLHVFFGC
Sbjct  1    MRVAIAGAGLAGMATAVDLVEAGHQVEIFESRPFVGGKVGSWVDPDGNHVEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIG  637
            Y +LF LMKKVGA +NL +K+H+HTF+N+GG  G
Sbjct  61   YYHLFDLMKKVGALENLRLKEHSHTFINRGGITG  94



>gb|ABB49180.1| zeta-carotene desaturase [Prochlorococcus marinus str. MIT 9312]
 gb|KGF99580.1| Pro-zeta-carotene desaturase [Prochlorococcus marinus str. MIT 
9311]
Length=499

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = +2

Query  353  KLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFG  532
            K+K+AI+G+GLAG++ AV L+D+GHEV+IY+S+SF GGKVGS+ D+ GNHIEMGLHVFF 
Sbjct  15   KVKIAIVGSGLAGLTAAVNLVDEGHEVEIYESRSFWGGKVGSWEDKDGNHIEMGLHVFFY  74

Query  533  CYNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDI  634
             Y NLF+LMKKVGA  NLL KDHTH F+N GG++
Sbjct  75   NYANLFKLMKKVGALDNLLPKDHTHLFINNGGNL  108



>ref|WP_017324264.1| hypothetical protein [Synechococcus sp. PCC 7336]
Length=481

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            + VAI+GAGLAG++TAV L++ GH V+I++++ F+GGKVGS++D+ GNHIEMGLHVFFGC
Sbjct  1    MHVAIVGAGLAGLNTAVNLVEAGHTVEIFENRPFVGGKVGSWIDKDGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIG  637
            Y NLF LM KVGA  +LL K HTHTFVN+GG++G
Sbjct  61   YYNLFGLMAKVGALDHLLTKQHTHTFVNRGGELG  94



>ref|WP_036916414.1| MULTISPECIES: zeta-carotene desaturase [Prochlorococcus]
 gb|KGG18205.1| Pro-zeta-carotene desaturase [Prochlorococcus sp. MIT 0603]
Length=486

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            +KVAI+GAGLAG+S AV+L+D+GHEVD+Y+++ F+GGKVGS+ D+ GNHIEMGLHVFF  
Sbjct  1    MKVAIVGAGLAGLSAAVDLVDEGHEVDLYEARPFLGGKVGSWEDKDGNHIEMGLHVFFFN  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDI  634
            Y NLF LMKKVGA +NLL K+H H FVNKGG++
Sbjct  61   YANLFALMKKVGALENLLPKEHMHLFVNKGGEV  93



>ref|WP_006526943.1| carotene 7,8-desaturase [Gloeocapsa sp. PCC 73106]
 gb|ELS00237.1| carotene 7,8-desaturase [Gloeocapsa sp. PCC 73106]
Length=481

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI+GAGLAG+S AV+L D G EV+I++S+ F+GGKVGS+VD  GNHIEMGLHVFFGC
Sbjct  1    MRVAIVGAGLAGLSAAVDLADSGVEVEIFESRPFVGGKVGSWVDSDGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIG  637
            Y  LF LMKKVGA +NL +K+HTHTF+N GG  G
Sbjct  61   YYQLFDLMKKVGALENLRLKEHTHTFINTGGKTG  94



>ref|WP_009786389.1| zeta-carotene desaturase [Lyngbya sp. PCC 8106]
 gb|EAW35008.1| Amine oxidase [Lyngbya sp. PCC 8106]
Length=489

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI GAGLAGM+TAV+L++ GH+V+I++S+ F+GGKVGS+VD  GNH+EMGLHVFFGC
Sbjct  1    MRVAIAGAGLAGMATAVDLVEAGHQVEIFESRPFVGGKVGSWVDPDGNHVEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIG  637
            Y +LF LMKKVGA +NL +K+H+HTF+N+GG  G
Sbjct  61   YYHLFDLMKKVGAFENLRLKEHSHTFINRGGMTG  94



>ref|WP_027403635.1| zeta-carotene desaturase [Aphanizomenon flos-aquae]
Length=484

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI+GAGLAG++TAV+L+D G EV+I++S+ F+GGKV S+VD  GNHIEMGLHVFFGC
Sbjct  1    MRVAIVGAGLAGLATAVDLVDAGCEVEIFESRPFVGGKVSSWVDGDGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIG  637
            Y NLF LM+KVGA  NL +K+H+HTF+NKGG  G
Sbjct  61   YYNLFELMEKVGAGDNLRLKEHSHTFINKGGQTG  94



>ref|WP_013192972.1| zeta-carotene desaturase [Trichormus azollae]
 gb|ADI65962.1| carotene 7,8-desaturase ['Nostoc azollae' 0708]
Length=479

 Score =   140 bits (352),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            ++VAI+GAGLAG+STAV+L D G EV I++S+ F+GGKVGS+VD  GNHIEMGLHVFFGC
Sbjct  1    MRVAIVGAGLAGLSTAVDLADAGCEVQIFESRPFVGGKVGSWVDGDGNHIEMGLHVFFGC  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDIG  637
            Y NLF LM+KVGA +NL +K+H+HTF+NKG   G
Sbjct  61   YYNLFELMEKVGAGENLRLKEHSHTFINKGARTG  94



>ref|WP_019478374.1| zeta-carotene desaturase [Prochlorococcus sp. W8]
Length=485

 Score =   140 bits (352),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +2

Query  356  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMGLHVFFGC  535
            +K+AI+G+GLAG++ AV+L+D GHE++IY+S+ F GGKVGS+VD+ GNHIEMGLHVFF  
Sbjct  1    MKIAIVGSGLAGLTAAVDLVDNGHEIEIYESRPFWGGKVGSWVDKEGNHIEMGLHVFFYN  60

Query  536  YNNLFRLMKKVGAEKNLLVKDHTHTFVNKGGDI  634
            Y NLF+LMKKVGA  NLL KDHTH F+N+GG++
Sbjct  61   YANLFKLMKKVGAFDNLLPKDHTHLFINEGGNL  93



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 960833956375