BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS065A02

Length=620
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009788524.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    342   1e-108   Nicotiana sylvestris
ref|XP_009606207.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    342   3e-108   Nicotiana tomentosiformis
ref|XP_006352881.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    337   1e-106   
ref|XP_004245918.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    334   3e-105   Solanum lycopersicum
ref|XP_011070302.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    326   2e-102   Sesamum indicum [beniseed]
ref|XP_002277503.2|  PREDICTED: alpha,alpha-trehalose-phosphate s...    323   3e-101   Vitis vinifera
emb|CAN61971.1|  hypothetical protein VITISV_016593                     322   6e-101   Vitis vinifera
ref|XP_010245191.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    321   2e-100   
ref|XP_002527658.1|  trehalose-6-phosphate synthase, putative           319   4e-100   
ref|XP_007210367.1|  hypothetical protein PRUPE_ppa001305mg             316   1e-98    Prunus persica
gb|AJO70167.1|  alpha,alpha-trehalose-phosphate synthase 5              314   7e-98    Camellia sinensis [black tea]
ref|XP_004300232.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    314   7e-98    Fragaria vesca subsp. vesca
ref|XP_006432795.1|  hypothetical protein CICLE_v10000247mg             311   1e-97    
ref|XP_008238210.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    312   5e-97    Prunus mume [ume]
ref|XP_006432796.1|  hypothetical protein CICLE_v10000247mg             312   5e-97    
ref|XP_009371197.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    311   1e-96    Pyrus x bretschneideri [bai li]
gb|EYU33434.1|  hypothetical protein MIMGU_mgv1a001209mg                310   4e-96    Erythranthe guttata [common monkey flower]
ref|XP_007040645.1|  Trehalose phosphatase/synthase 5 isoform 3         305   3e-95    
ref|XP_007040643.1|  Trehalose phosphatase/synthase 5 isoform 1         306   6e-95    
ref|XP_002304347.1|  glycosyl transferase family 20 family protein      306   1e-94    
ref|XP_009401244.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    305   2e-94    
gb|KDP26189.1|  hypothetical protein JCGZ_22685                         303   2e-93    Jatropha curcas
ref|XP_010096957.1|  Alpha,alpha-trehalose-phosphate synthase [UD...    301   7e-93    Morus notabilis
gb|KHG14108.1|  Alpha,alpha-trehalose-phosphate synthase [UDP-for...    297   2e-92    Gossypium arboreum [tree cotton]
ref|XP_011028148.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    295   4e-92    Populus euphratica
ref|XP_011028149.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    295   5e-92    Populus euphratica
ref|XP_006605933.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    298   7e-92    Glycine max [soybeans]
gb|KHN42432.1|  Alpha,alpha-trehalose-phosphate synthase [UDP-for...    298   8e-92    Glycine soja [wild soybean]
gb|KCW71761.1|  hypothetical protein EUGRSUZ_E00259                     294   1e-91    Eucalyptus grandis [rose gum]
gb|KCW71760.1|  hypothetical protein EUGRSUZ_E00259                     293   1e-91    Eucalyptus grandis [rose gum]
gb|KHG01348.1|  Alpha,alpha-trehalose-phosphate synthase [UDP-for...    298   1e-91    Gossypium arboreum [tree cotton]
gb|KJB25286.1|  hypothetical protein B456_004G183400                    295   2e-91    Gossypium raimondii
ref|XP_008800104.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    297   3e-91    
gb|KJB25285.1|  hypothetical protein B456_004G183400                    296   6e-91    Gossypium raimondii
ref|XP_010908489.1|  PREDICTED: LOW QUALITY PROTEIN: alpha,alpha-...    295   8e-91    Elaeis guineensis
ref|XP_011028143.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    295   9e-91    Populus euphratica
ref|XP_010055292.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    293   5e-90    Eucalyptus grandis [rose gum]
ref|XP_006589670.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    293   7e-90    Glycine max [soybeans]
gb|KJB39837.1|  hypothetical protein B456_007G033200                    293   7e-90    Gossypium raimondii
gb|KHN06692.1|  Alpha,alpha-trehalose-phosphate synthase [UDP-for...    293   7e-90    Glycine soja [wild soybean]
ref|XP_006368376.1|  hypothetical protein POPTR_0001s02190g             292   1e-89    Populus trichocarpa [western balsam poplar]
gb|KEH44193.1|  trehalose-6-phosphate synthase domain protein           292   1e-89    Medicago truncatula
ref|XP_004497053.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    291   3e-89    
ref|XP_004497050.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    291   4e-89    Cicer arietinum [garbanzo]
ref|XP_010276860.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    289   2e-88    Nelumbo nucifera [Indian lotus]
ref|XP_004148747.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    288   7e-88    Cucumis sativus [cucumbers]
ref|XP_008448661.1|  PREDICTED: LOW QUALITY PROTEIN: alpha,alpha-...    287   1e-87    Cucumis melo [Oriental melon]
ref|XP_011018523.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    287   2e-87    Populus euphratica
ref|XP_006854042.1|  hypothetical protein AMTR_s00048p00069850          285   6e-87    Amborella trichopoda
ref|XP_010677331.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    283   6e-86    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006849789.1|  hypothetical protein AMTR_s00176p00032980          281   2e-85    Amborella trichopoda
emb|CBI33857.3|  unnamed protein product                                263   3e-85    Vitis vinifera
gb|AAX16014.1|  trehalose-6-phosphate synthase                          280   9e-85    Ginkgo biloba [ginkgo]
emb|CDX90449.1|  BnaA03g43320D                                          275   4e-83    
emb|CAB10557.1|  trehalose-6-phosphate synthase like protein            273   2e-82    Arabidopsis thaliana [mouse-ear cress]
gb|ABD65165.1|  trehalose-6-phosphate synthase, putative                273   2e-82    Brassica oleracea
ref|XP_009136870.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    272   3e-82    Brassica rapa
ref|NP_567538.1|  putative trehalose phosphatase/synthase 5             272   4e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010449561.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    271   7e-82    Camelina sativa [gold-of-pleasure]
ref|XP_010434619.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    271   7e-82    Camelina sativa [gold-of-pleasure]
ref|XP_010449562.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    271   8e-82    
ref|XP_002527520.1|  trehalose-6-phosphate synthase, putative           269   1e-81    
ref|XP_010449559.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    271   1e-81    
ref|XP_002870086.1|  ATTPS5                                             271   2e-81    Arabidopsis lyrata subsp. lyrata
ref|XP_006283097.1|  hypothetical protein CARUB_v10004115mg             270   2e-81    Capsella rubella
ref|XP_010439943.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    269   6e-81    Camelina sativa [gold-of-pleasure]
ref|XP_008381762.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    268   1e-80    
ref|XP_009595830.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    268   1e-80    Nicotiana tomentosiformis
ref|XP_009351564.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    268   2e-80    
ref|XP_011021750.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    267   3e-80    Populus euphratica
ref|XP_006414189.1|  hypothetical protein EUTSA_v10024381mg             266   5e-80    Eutrema salsugineum [saltwater cress]
ref|XP_011021751.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    266   6e-80    Populus euphratica
ref|XP_010271238.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    266   6e-80    Nelumbo nucifera [Indian lotus]
ref|XP_002314777.2|  hypothetical protein POPTR_0010s11510g             266   6e-80    Populus trichocarpa [western balsam poplar]
ref|XP_007142959.1|  hypothetical protein PHAVU_007G031800g             266   7e-80    Phaseolus vulgaris [French bean]
ref|XP_006378432.1|  hypothetical protein POPTR_0010s11510g             265   7e-80    
ref|XP_008220922.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    266   9e-80    Prunus mume [ume]
gb|KDP38139.1|  hypothetical protein JCGZ_04782                         265   2e-79    Jatropha curcas
ref|XP_010518663.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    265   2e-79    Tarenaya hassleriana [spider flower]
ref|XP_004228746.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    265   3e-79    Solanum lycopersicum
ref|XP_009778367.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    264   4e-79    Nicotiana sylvestris
ref|XP_006364054.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    264   6e-79    Solanum tuberosum [potatoes]
ref|XP_010650494.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    262   3e-78    Vitis vinifera
ref|XP_004503340.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    261   7e-78    Cicer arietinum [garbanzo]
ref|XP_011463160.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    259   2e-77    Fragaria vesca subsp. vesca
ref|XP_010043976.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    258   1e-76    Eucalyptus grandis [rose gum]
ref|XP_010242150.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    256   3e-76    
ref|XP_002312472.1|  hypothetical protein POPTR_0008s13590g             255   7e-76    
ref|XP_004293972.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    254   2e-75    Fragaria vesca subsp. vesca
ref|XP_011024382.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    253   3e-75    Populus euphratica
gb|AHL29280.1|  trehalose-phosphate synthase 6                          253   7e-75    Camellia sinensis [black tea]
ref|XP_008383601.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    251   2e-74    
ref|XP_010093315.1|  Alpha,alpha-trehalose-phosphate synthase [UD...    251   2e-74    Morus notabilis
gb|KDP21135.1|  hypothetical protein JCGZ_21606                         251   2e-74    Jatropha curcas
gb|KJB30628.1|  hypothetical protein B456_005G152400                    248   3e-74    Gossypium raimondii
ref|XP_007214619.1|  hypothetical protein PRUPE_ppa001324mg             251   3e-74    Prunus persica
gb|AAG52003.1|AC012563_13  putative trehalose-6-phosphate synthas...    250   4e-74    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006391193.1|  hypothetical protein EUTSA_v10018111mg             250   8e-74    Eutrema salsugineum [saltwater cress]
ref|XP_007045543.1|  UDP-Glycosyltransferase / trehalose-phosphat...    249   9e-74    
ref|XP_009351624.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    249   1e-73    Pyrus x bretschneideri [bai li]
ref|XP_010106616.1|  putative alpha,alpha-trehalose-phosphate syn...    249   1e-73    Morus notabilis
ref|XP_002522255.1|  trehalose-6-phosphate synthase, putative           249   1e-73    Ricinus communis
ref|XP_008371505.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    249   1e-73    
ref|NP_564918.1|  alpha,alpha-trehalose-phosphate synthase [UDP-f...    247   1e-73    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007045541.1|  UDP-Glycosyltransferase / trehalose-phosphat...    249   2e-73    
gb|KJB30627.1|  hypothetical protein B456_005G152400                    248   2e-73    Gossypium raimondii
ref|XP_010511784.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    248   3e-73    Camelina sativa [gold-of-pleasure]
ref|XP_010511780.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    248   3e-73    
gb|KDO60795.1|  hypothetical protein CISIN_1g044635mg                   248   3e-73    Citrus sinensis [apfelsine]
ref|XP_006448141.1|  hypothetical protein CICLE_v10014251mg             248   3e-73    Citrus clementina [clementine]
gb|KJB30625.1|  hypothetical protein B456_005G152400                    248   4e-73    Gossypium raimondii
ref|XP_003630977.1|  Alpha,alpha-trehalose-phosphate synthase           248   5e-73    Medicago truncatula
gb|KHG01703.1|  putative alpha,alpha-trehalose-phosphate synthase...    247   7e-73    Gossypium arboreum [tree cotton]
ref|XP_004233035.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    247   7e-73    Solanum lycopersicum
gb|AJO70168.1|  alpha,alpha-trehalose-phosphate synthase 7              247   8e-73    Camellia sinensis [black tea]
ref|XP_002268174.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    247   9e-73    Vitis vinifera
ref|XP_010671073.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    247   1e-72    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011039387.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    246   1e-72    Populus euphratica
ref|NP_974105.1|  alpha,alpha-trehalose-phosphate synthase [UDP-f...    246   1e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002317392.1|  hypothetical protein POPTR_0011s06910g             246   2e-72    Populus trichocarpa [western balsam poplar]
ref|XP_004171547.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    243   2e-72    
ref|XP_011070555.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    246   2e-72    Sesamum indicum [beniseed]
ref|XP_010415412.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    246   2e-72    Camelina sativa [gold-of-pleasure]
gb|KJB57382.1|  hypothetical protein B456_009G160400                    246   2e-72    Gossypium raimondii
ref|XP_006300724.1|  hypothetical protein CARUB_v10019781mg             246   3e-72    Capsella rubella
ref|XP_006358103.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    244   6e-72    Solanum tuberosum [potatoes]
ref|XP_003529226.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    244   6e-72    Glycine max [soybeans]
ref|XP_008439718.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    244   8e-72    Cucumis melo [Oriental melon]
ref|XP_008775883.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    244   9e-72    Phoenix dactylifera
emb|CDY04199.1|  BnaC06g26160D                                          244   1e-71    
gb|KFK41224.1|  hypothetical protein AALP_AA2G101500                    244   1e-71    Arabis alpina [alpine rockcress]
ref|XP_010052171.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    244   1e-71    Eucalyptus grandis [rose gum]
emb|CDY07404.1|  BnaA07g24830D                                          243   2e-71    Brassica napus [oilseed rape]
gb|KHG14143.1|  Alpha,alpha-trehalose-phosphate synthase [UDP-for...    243   2e-71    Gossypium arboreum [tree cotton]
ref|XP_010276900.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    243   3e-71    Nelumbo nucifera [Indian lotus]
ref|XP_002888643.1|  predicted protein                                  242   5e-71    Arabidopsis lyrata subsp. lyrata
ref|XP_009409100.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    242   5e-71    Musa acuminata subsp. malaccensis [pisang utan]
gb|ACD56638.1|  trehalose synthase-like protein                         242   6e-71    Gossypioides kirkii
gb|KHN15462.1|  Alpha,alpha-trehalose-phosphate synthase [UDP-for...    242   6e-71    Glycine soja [wild soybean]
gb|ACJ61506.1|  trehalose-6-phosphate synthase                          242   7e-71    Glycine max [soybeans]
ref|XP_004134569.1|  PREDICTED: LOW QUALITY PROTEIN: probable alp...    241   7e-71    
gb|KJB69686.1|  hypothetical protein B456_011G037000                    240   7e-71    Gossypium raimondii
gb|KGN49325.1|  Trehalose-6-phosphate synthase                          241   8e-71    Cucumis sativus [cucumbers]
ref|XP_009804181.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    240   1e-70    Nicotiana sylvestris
ref|XP_002305726.1|  hypothetical protein POPTR_0004s06000g             241   1e-70    Populus trichocarpa [western balsam poplar]
gb|KHG11600.1|  putative alpha,alpha-trehalose-phosphate synthase...    241   1e-70    Gossypium arboreum [tree cotton]
gb|KJB69685.1|  hypothetical protein B456_011G037000                    241   1e-70    Gossypium raimondii
ref|XP_009804180.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    239   2e-70    Nicotiana sylvestris
ref|XP_010999788.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    241   2e-70    Populus euphratica
emb|CBI26812.3|  unnamed protein product                                238   2e-70    Vitis vinifera
ref|XP_010556235.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    240   2e-70    
ref|XP_009804177.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    240   3e-70    Nicotiana sylvestris
ref|XP_008775639.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    239   9e-70    Phoenix dactylifera
gb|KEH40650.1|  trehalose-6-phosphate synthase domain protein           238   1e-69    Medicago truncatula
gb|KJB68366.1|  hypothetical protein B456_010G241200                    236   1e-69    Gossypium raimondii
emb|CDY01487.1|  BnaC07g34770D                                          237   3e-69    
ref|XP_006843713.1|  hypothetical protein AMTR_s00007p00214170          237   3e-69    Amborella trichopoda
gb|KJB68367.1|  hypothetical protein B456_010G241200                    235   3e-69    Gossypium raimondii
ref|XP_007025310.1|  Trehalose-phosphatase/synthase 7 isoform 4         236   3e-69    
ref|XP_007025309.1|  Trehalose-phosphatase/synthase 7 isoform 3         236   4e-69    
gb|AEQ54916.1|  trehalose-6-phosphate synthase                          237   4e-69    Salvia miltiorrhiza [Chinese salvia]
ref|XP_010916234.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    237   4e-69    Elaeis guineensis
ref|XP_007025308.1|  Trehalose-phosphatase/synthase 7 isoform 2         236   7e-69    Theobroma cacao [chocolate]
ref|XP_002281386.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    234   1e-68    Vitis vinifera
gb|KJB68365.1|  hypothetical protein B456_010G241200                    236   1e-68    Gossypium raimondii
ref|XP_009105068.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    235   2e-68    Brassica rapa
ref|XP_007025307.1|  Trehalose-phosphatase/synthase 7 isoform 1         236   2e-68    
ref|XP_008225229.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    235   2e-68    Prunus mume [ume]
ref|XP_010052868.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    234   3e-68    Eucalyptus grandis [rose gum]
ref|XP_009624608.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    233   3e-68    
ref|XP_010052859.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    234   4e-68    Eucalyptus grandis [rose gum]
ref|XP_009624607.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    233   4e-68    
gb|KDO77921.1|  hypothetical protein CISIN_1g003025mg                   233   6e-68    Citrus sinensis [apfelsine]
ref|XP_009624606.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    234   6e-68    Nicotiana tomentosiformis
emb|CAN67058.1|  hypothetical protein VITISV_036715                     234   6e-68    Vitis vinifera
ref|XP_010557135.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    233   7e-68    Tarenaya hassleriana [spider flower]
ref|XP_003633255.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    233   7e-68    Vitis vinifera
gb|EYU30144.1|  hypothetical protein MIMGU_mgv1a001255mg                233   8e-68    Erythranthe guttata [common monkey flower]
ref|XP_006449548.1|  hypothetical protein CICLE_v10014248mg             233   8e-68    
ref|XP_006467609.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    233   8e-68    Citrus sinensis [apfelsine]
ref|XP_011070304.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    232   1e-67    Sesamum indicum [beniseed]
ref|XP_010531642.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    233   1e-67    Tarenaya hassleriana [spider flower]
gb|KDO53157.1|  hypothetical protein CISIN_1g002958mg                   231   2e-67    Citrus sinensis [apfelsine]
ref|XP_010926098.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    231   4e-67    
ref|XP_008381189.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    231   5e-67    
gb|ACA62945.1|  trehalose-6-phosphate synthase                          230   1e-66    Zostera marina
ref|XP_011082978.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    230   1e-66    Sesamum indicum [beniseed]
ref|XP_006417924.1|  hypothetical protein EUTSA_v10006783mg             230   1e-66    Eutrema salsugineum [saltwater cress]
ref|XP_008455290.1|  PREDICTED: LOW QUALITY PROTEIN: probable alp...    230   1e-66    
ref|XP_010522084.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    229   2e-66    Tarenaya hassleriana [spider flower]
ref|XP_008228949.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    229   2e-66    Prunus mume [ume]
gb|EPS71188.1|  hypothetical protein M569_03569                         228   4e-66    Genlisea aurea
ref|XP_004136836.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    228   5e-66    
ref|XP_007153210.1|  hypothetical protein PHAVU_003G016300g             228   5e-66    Phaseolus vulgaris [French bean]
ref|XP_009365280.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    228   7e-66    
gb|EPS68578.1|  hypothetical protein M569_06190                         227   8e-66    Genlisea aurea
ref|XP_004498234.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    227   1e-65    Cicer arietinum [garbanzo]
gb|KGN43637.1|  hypothetical protein Csa_7G049190                       228   1e-65    
ref|XP_007214959.1|  hypothetical protein PRUPE_ppa001387mg             227   2e-65    Prunus persica
ref|XP_003540002.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    227   2e-65    Glycine max [soybeans]
ref|XP_010932535.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    226   2e-65    Elaeis guineensis
gb|KHG01704.1|  putative alpha,alpha-trehalose-phosphate synthase...    226   2e-65    Gossypium arboreum [tree cotton]
ref|XP_010916659.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    226   4e-65    Elaeis guineensis
gb|EYU37347.1|  hypothetical protein MIMGU_mgv1a001197mg                226   4e-65    Erythranthe guttata [common monkey flower]
ref|XP_004505467.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    226   5e-65    Cicer arietinum [garbanzo]
ref|XP_009416430.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    225   6e-65    Musa acuminata subsp. malaccensis [pisang utan]
gb|ACA62946.1|  trehalose-6-phosphate synthase                          225   8e-65    Zostera marina
ref|XP_003607607.1|  Trehalose synthase-like protein                    224   1e-64    Medicago truncatula
ref|XP_008789265.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    223   2e-64    
gb|ACD56625.1|  trehalose synthase/phosphatase-like protein             224   2e-64    Gossypium raimondii
ref|XP_009782523.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    224   2e-64    Nicotiana sylvestris
ref|XP_009628927.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    224   2e-64    Nicotiana tomentosiformis
ref|XP_008789260.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    224   2e-64    Phoenix dactylifera
ref|XP_009411218.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    224   3e-64    Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU30761.1|  hypothetical protein MIMGU_mgv1a001183mg                223   6e-64    Erythranthe guttata [common monkey flower]
ref|XP_008812813.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    223   6e-64    
gb|ADN34028.1|  trehalose-6-phosphate synthase                          222   8e-64    Cucumis melo subsp. melo
ref|XP_004248198.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    221   2e-63    Solanum lycopersicum
ref|XP_006364095.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    220   4e-63    Solanum tuberosum [potatoes]
ref|XP_007225259.1|  hypothetical protein PRUPE_ppa001556mg             219   1e-62    
ref|XP_007132825.1|  hypothetical protein PHAVU_011G127700g             219   1e-62    Phaseolus vulgaris [French bean]
ref|XP_010268366.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    218   2e-62    Nelumbo nucifera [Indian lotus]
ref|XP_009595385.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    218   3e-62    Nicotiana tomentosiformis
emb|CDY10196.1|  BnaC05g04390D                                          210   4e-62    Brassica napus [oilseed rape]
ref|XP_009768217.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    218   4e-62    Nicotiana sylvestris
ref|XP_003527335.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    217   8e-62    Glycine max [soybeans]
ref|XP_007153644.1|  hypothetical protein PHAVU_003G053000g             216   1e-61    Phaseolus vulgaris [French bean]
ref|NP_172129.1|  putative alpha,alpha-trehalose-phosphate syntha...    216   1e-61    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008348581.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    216   2e-61    
ref|XP_002889602.1|  hypothetical protein ARALYDRAFT_470660             215   2e-61    
ref|XP_004969834.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    215   3e-61    Setaria italica
gb|AAL91978.1|AF483209_1  putative trehalose synthase                   215   3e-61    Solanum tuberosum [potatoes]
ref|XP_010475368.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    215   4e-61    Camelina sativa [gold-of-pleasure]
ref|XP_010486072.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    214   4e-61    Camelina sativa [gold-of-pleasure]
ref|XP_004243268.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    214   4e-61    Solanum lycopersicum
ref|XP_006348895.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    214   4e-61    Solanum tuberosum [potatoes]
ref|XP_006306755.1|  hypothetical protein CARUB_v10008292mg             214   4e-61    Capsella rubella
ref|XP_009365279.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    214   7e-61    
gb|KHG20430.1|  putative alpha,alpha-trehalose-phosphate synthase...    214   8e-61    Gossypium arboreum [tree cotton]
ref|XP_010511782.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    213   1e-60    
ref|XP_010917511.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    213   2e-60    Elaeis guineensis
ref|XP_003532016.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    212   3e-60    Glycine max [soybeans]
ref|XP_004509840.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    212   3e-60    Cicer arietinum [garbanzo]
gb|KHN24134.1|  Putative alpha,alpha-trehalose-phosphate synthase...    212   3e-60    Glycine soja [wild soybean]
ref|XP_003552011.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    212   4e-60    Glycine max [soybeans]
gb|KHN10606.1|  Putative alpha,alpha-trehalose-phosphate synthase...    211   6e-60    Glycine soja [wild soybean]
ref|XP_002989114.1|  trehalose phosphate synthase                       211   6e-60    Selaginella moellendorffii
ref|XP_002983300.1|  trehalose phosphate synthase                       211   1e-59    Selaginella moellendorffii
gb|ACI62866.1|  trehalose 6-phosphate synthase                          209   2e-59    Gossypium arboreum [tree cotton]
gb|AEB53179.1|  trehalose-6-phosphate synthase 3                        209   4e-59    Oryza sativa Indica Group [Indian rice]
gb|EAZ13427.1|  hypothetical protein OsJ_03344                          209   4e-59    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001044141.1|  Os01g0730300                                       209   4e-59    
ref|XP_009415178.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    209   4e-59    Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB31282.1|  hypothetical protein B456_005G183800                    207   5e-59    Gossypium raimondii
ref|XP_008792314.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    208   7e-59    Phoenix dactylifera
ref|XP_002521023.1|  trehalose-6-phosphate synthase, putative           208   7e-59    Ricinus communis
gb|KJB31285.1|  hypothetical protein B456_005G183800                    207   8e-59    Gossypium raimondii
gb|KDP21328.1|  hypothetical protein JCGZ_21799                         208   1e-58    Jatropha curcas
gb|KJB31283.1|  hypothetical protein B456_005G183800                    207   2e-58    Gossypium raimondii
gb|KJB31284.1|  hypothetical protein B456_005G183800                    207   2e-58    Gossypium raimondii
gb|KDP31124.1|  hypothetical protein JCGZ_11500                         207   2e-58    Jatropha curcas
ref|XP_002322159.2|  glycosyl transferase family 20 family protein      207   2e-58    Populus trichocarpa [western balsam poplar]
gb|AIN39848.1|  hypothetical protein                                    207   2e-58    Zoysia matrella [Japanese carpet grass]
ref|XP_003578837.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    207   3e-58    Brachypodium distachyon [annual false brome]
ref|XP_004305452.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    206   4e-58    Fragaria vesca subsp. vesca
emb|CDY15577.1|  BnaA08g28610D                                          206   4e-58    Brassica napus [oilseed rape]
dbj|BAJ94864.1|  predicted protein                                      206   4e-58    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX86523.1|  BnaC08g01800D                                          206   4e-58    
ref|XP_009110992.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    206   4e-58    Brassica rapa
ref|XP_008446229.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    206   4e-58    Cucumis melo [Oriental melon]
ref|XP_010542724.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    206   4e-58    Tarenaya hassleriana [spider flower]
gb|EPS59044.1|  hypothetical protein M569_15766                         206   6e-58    Genlisea aurea
ref|XP_010682587.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    206   6e-58    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007044571.1|  Trehalose-phosphatase/synthase 9                   206   6e-58    
ref|XP_009391422.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    205   9e-58    Musa acuminata subsp. malaccensis [pisang utan]
gb|AAV65494.1|  trehalose 6-phosphate synthase                          205   1e-57    Gossypium hirsutum [American cotton]
emb|CDY06638.1|  BnaA10g04170D                                          197   1e-57    
ref|XP_008353109.1|  PREDICTED: LOW QUALITY PROTEIN: probable alp...    196   1e-57    
ref|XP_002456290.1|  hypothetical protein SORBIDRAFT_03g033590          204   2e-57    Sorghum bicolor [broomcorn]
ref|XP_002963442.1|  trehalose phosphate synthase                       204   2e-57    
gb|AJO70169.1|  alpha,alpha-trehalose-phosphate synthase 10             204   2e-57    
ref|XP_010251315.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    204   3e-57    
ref|XP_010924709.1|  PREDICTED: LOW QUALITY PROTEIN: probable alp...    204   3e-57    
ref|XP_002318643.1|  glycosyl transferase family 20 family protein      203   5e-57    
ref|XP_006340112.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    203   5e-57    
ref|XP_009785713.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    202   7e-57    
ref|XP_009605902.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    202   8e-57    
ref|XP_010268369.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    202   9e-57    
ref|XP_010278047.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    202   2e-56    
ref|XP_009417681.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    202   2e-56    
emb|CBI32507.3|  unnamed protein product                                199   2e-56    
emb|CAN78769.1|  hypothetical protein VITISV_024248                     201   2e-56    
ref|XP_002264873.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    201   2e-56    
ref|XP_004135234.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    201   3e-56    
ref|XP_011044324.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    201   3e-56    
ref|XP_002511428.1|  trehalose-6-phosphate synthase, putative           200   4e-56    
ref|XP_004237260.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    200   4e-56    
ref|XP_004297647.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    200   6e-56    
ref|XP_010100492.1|  putative alpha,alpha-trehalose-phosphate syn...    199   8e-56    
ref|XP_007036167.1|  Trehalose-phosphatase/synthase 9 isoform 2         199   1e-55    
gb|AAV65495.1|  trehalose 6-phosphate synthase                          199   1e-55    
ref|XP_007036166.1|  Trehalose-phosphatase/synthase 9 isoform 1         199   1e-55    
tpg|DAA44158.1|  TPA: putative trehalose phosphatase/synthase fam...    197   2e-55    
ref|XP_003578083.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    198   2e-55    
gb|EYU29720.1|  hypothetical protein MIMGU_mgv1a001271mg                197   5e-55    
ref|XP_011028589.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    197   5e-55    
ref|XP_004498235.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    197   5e-55    
gb|ADA67991.1|  trehalose-6-phosphate synthase                          197   5e-55    
emb|CDP00187.1|  unnamed protein product                                197   6e-55    
gb|KCW87490.1|  hypothetical protein EUGRSUZ_B03950                     197   6e-55    
ref|XP_010271971.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    197   7e-55    
tpg|DAA57653.1|  TPA: putative trehalose phosphatase/synthase fam...    197   7e-55    
ref|XP_010045326.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    197   8e-55    
ref|XP_004238680.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    197   9e-55    
ref|XP_006654654.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    196   1e-54    
ref|XP_006826657.1|  hypothetical protein AMTR_s00137p00018220          196   1e-54    
ref|XP_008340008.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    196   1e-54    
ref|XP_003568093.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    196   2e-54    
ref|XP_009604621.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    195   3e-54    
gb|EYU34289.1|  hypothetical protein MIMGU_mgv1a0016701mg               192   3e-54    
ref|XP_002458490.1|  hypothetical protein SORBIDRAFT_03g034640          196   3e-54    
ref|XP_009783894.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    195   4e-54    
ref|XP_002440081.1|  hypothetical protein SORBIDRAFT_09g025660          195   6e-54    
ref|NP_001061805.1|  Os08g0414700                                       194   1e-53    
ref|XP_010102124.1|  putative alpha,alpha-trehalose-phosphate syn...    194   1e-53    
ref|XP_004969951.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    194   2e-53    
ref|XP_006392184.1|  hypothetical protein EUTSA_v10023265mg             193   2e-53    
gb|EEE68684.1|  hypothetical protein OsJ_27312                          193   2e-53    
ref|XP_003519705.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    192   3e-53    
dbj|BAJ87235.1|  predicted protein                                      193   3e-53    
ref|XP_010547901.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    192   3e-53    
dbj|BAJ97342.1|  predicted protein                                      192   4e-53    
emb|CDY57320.1|  BnaA08g20280D                                          192   4e-53    
emb|CDP02920.1|  unnamed protein product                                192   4e-53    
ref|XP_011079327.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    192   4e-53    
ref|XP_009768810.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    192   5e-53    
gb|KEH19955.1|  trehalose-6-phosphate synthase domain protein           192   5e-53    
tpg|DAA61345.1|  TPA: putative trehalose phosphatase/synthase fam...    191   6e-53    
ref|XP_006306746.1|  hypothetical protein CARUB_v10008281mg             191   7e-53    
ref|XP_007154820.1|  hypothetical protein PHAVU_003G150400g             191   9e-53    
gb|KFK40813.1|  trehalose-phosphate synthase                            191   9e-53    
ref|XP_006416048.1|  hypothetical protein EUTSA_v10006773mg             191   1e-52    
gb|ACJ86290.1|  unknown                                                 178   1e-52    
ref|XP_009615328.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    189   2e-52    
tpg|DAA61344.1|  TPA: putative trehalose phosphatase/synthase fam...    191   2e-52    
ref|XP_006573047.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    190   2e-52    
gb|EEC83577.1|  hypothetical protein OsI_29236                          190   2e-52    
ref|XP_006659396.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    190   2e-52    
tpg|DAA57651.1|  TPA: putative trehalose phosphatase/synthase fam...    191   2e-52    
ref|XP_002283215.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    190   2e-52    
ref|XP_010028137.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    190   3e-52    
ref|XP_007157471.1|  hypothetical protein PHAVU_002G072400g             190   3e-52    
ref|XP_006300393.1|  hypothetical protein CARUB_v10019782mg             190   3e-52    
ref|XP_002460185.1|  hypothetical protein SORBIDRAFT_02g024140          189   3e-52    
ref|XP_009615327.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    189   4e-52    
gb|AEO13239.1|  trehalose-6-phosphate synthase                          189   4e-52    
ref|XP_002465620.1|  hypothetical protein SORBIDRAFT_01g042380          189   4e-52    
ref|NP_001288502.1|  uncharacterized protein LOC103636651               189   5e-52    
ref|XP_010913569.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    189   6e-52    
ref|XP_006355973.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    189   6e-52    
ref|NP_001056050.1|  Os05g0517200                                       189   6e-52    
dbj|BAF01061.1|  putative trehalose-6-phosphate synthase                189   7e-52    
ref|NP_176221.1|  putative alpha,alpha-trehalose-phosphate syntha...    189   7e-52    
ref|XP_008781991.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    189   8e-52    
ref|XP_010477691.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    188   9e-52    
ref|XP_002886635.1|  ATTPS10                                            188   1e-51    
emb|CDY62994.1|  BnaCnng41250D                                          187   2e-51    
emb|CDM84185.1|  unnamed protein product                                188   2e-51    
gb|KDO69720.1|  hypothetical protein CISIN_1g045882mg                   187   2e-51    
ref|XP_010417957.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    187   2e-51    
ref|XP_011069859.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    187   2e-51    
ref|XP_010473203.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    187   2e-51    
ref|XP_006476751.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    187   2e-51    
ref|XP_006439780.1|  hypothetical protein CICLE_v10018842mg             187   2e-51    
ref|NP_001063104.1|  Os09g0397300                                       187   2e-51    
ref|XP_009110077.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    187   4e-51    
dbj|BAJ94322.1|  predicted protein                                      187   5e-51    
ref|NP_173799.1|  putative alpha,alpha-trehalose-phosphate syntha...    186   5e-51    
ref|XP_002890598.1|  hypothetical protein ARALYDRAFT_889930             186   6e-51    
gb|EYU22478.1|  hypothetical protein MIMGU_mgv1a001235mg                186   6e-51    
ref|XP_009414014.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    186   7e-51    
ref|XP_002445486.1|  hypothetical protein SORBIDRAFT_07g020270          186   7e-51    
ref|XP_010460163.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    186   8e-51    
ref|XP_007225309.1|  hypothetical protein PRUPE_ppa001295mg             186   1e-50    
ref|XP_008678555.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    186   1e-50    
gb|KHN17551.1|  Putative alpha,alpha-trehalose-phosphate synthase...    185   1e-50    
ref|XP_003569812.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    186   1e-50    
ref|XP_009119065.1|  PREDICTED: LOW QUALITY PROTEIN: probable alp...    185   1e-50    
ref|XP_011086535.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    185   2e-50    
ref|XP_010510971.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    185   2e-50    
gb|EEC74792.1|  hypothetical protein OsI_10580                          185   2e-50    
gb|AAN52740.1|  Putative trehalose-6-phosphate synthase                 184   2e-50    
gb|EYU42464.1|  hypothetical protein MIMGU_mgv1a001200mg                184   2e-50    
ref|XP_008664697.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    184   3e-50    
ref|XP_010498895.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    183   8e-50    
ref|XP_008793857.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    183   9e-50    
ref|XP_008223545.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    182   1e-49    
gb|KJB08196.1|  hypothetical protein B456_001G070500                    182   1e-49    
gb|EMT15117.1|  Putative alpha,alpha-trehalose-phosphate synthase...    183   1e-49    
gb|KJB08195.1|  hypothetical protein B456_001G070500                    182   1e-49    
ref|XP_004973427.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    182   2e-49    
ref|XP_010471024.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    182   2e-49    
ref|XP_004973426.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    182   2e-49    
gb|EPS67351.1|  hypothetical protein M569_07419                         182   2e-49    
ref|XP_010415706.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    182   2e-49    
ref|NP_177186.2|  putative alpha,alpha-trehalose-phosphate syntha...    181   3e-49    
gb|EEC84539.1|  hypothetical protein OsI_31278                          181   3e-49    
ref|XP_009138560.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    181   3e-49    
gb|AEB53185.1|  trehalose-6-phosphate synthase 10                       181   3e-49    
gb|EEE64369.1|  hypothetical protein OsJ_19211                          182   3e-49    
ref|XP_008221778.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    181   4e-49    
ref|XP_004298929.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    181   4e-49    
ref|XP_004985151.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    181   4e-49    
emb|CDY31598.1|  BnaA03g54540D                                          181   4e-49    
ref|XP_008374461.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    181   4e-49    
ref|XP_009103647.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    181   5e-49    
ref|XP_006390900.1|  hypothetical protein EUTSA_v10018114mg             181   6e-49    
emb|CDY24516.1|  BnaA01g22200D                                          181   6e-49    
gb|KDO82521.1|  hypothetical protein CISIN_1g002979mg                   179   7e-49    
ref|XP_010928594.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    180   9e-49    
gb|AGD98700.1|  trehalose-6-phosphate synthase                          180   1e-48    
ref|XP_001766049.1|  predicted protein                                  179   1e-48    
gb|KDO82516.1|  hypothetical protein CISIN_1g002979mg                   179   1e-48    
gb|ABO61744.1|  trehalose-phosphate synthase 5                          179   1e-48    
ref|XP_010427800.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    179   1e-48    
ref|XP_006438435.1|  hypothetical protein CICLE_v10030691mg             179   2e-48    
ref|XP_007227009.1|  hypothetical protein PRUPE_ppa001301mg             179   3e-48    
gb|EEC71477.1|  hypothetical protein OsI_03737                          179   3e-48    
gb|AEB53178.1|  trehalose-6-phosphate synthase 2                        179   3e-48    
gb|EEC79533.1|  hypothetical protein OsI_20637                          179   4e-48    
ref|XP_009363520.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    178   4e-48    
emb|CDY54952.1|  BnaC01g43070D                                          178   6e-48    
ref|XP_008239739.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    177   7e-48    
ref|NP_001044248.1|  Os01g0749400                                       177   1e-47    
ref|XP_008389621.1|  PREDICTED: LOW QUALITY PROTEIN: probable alp...    177   2e-47    
ref|XP_011071074.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    176   2e-47    
ref|XP_010228946.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    174   3e-47    
ref|XP_006644707.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    176   3e-47    
gb|KHN34483.1|  Putative alpha,alpha-trehalose-phosphate synthase...    176   4e-47    
ref|XP_010107455.1|  putative alpha,alpha-trehalose-phosphate syn...    176   4e-47    
ref|XP_009391250.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    175   6e-47    
ref|XP_003574481.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    175   7e-47    
ref|XP_004166499.1|  PREDICTED: LOW QUALITY PROTEIN: probable alp...    175   8e-47    
ref|XP_004138116.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    175   8e-47    
ref|XP_006651181.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    174   8e-47    
ref|XP_003558453.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    175   8e-47    
ref|XP_010678736.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    175   9e-47    
ref|XP_001765959.1|  trehalose-6-phosphate synthase                     174   1e-46    
ref|XP_010457769.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    173   2e-46    
ref|XP_003527027.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    174   2e-46    
emb|CDX91726.1|  BnaC08g06450D                                          173   3e-46    
ref|XP_006844250.1|  hypothetical protein AMTR_s00006p00269110          173   3e-46    
ref|XP_002888764.1|  hypothetical protein ARALYDRAFT_894829             172   4e-46    
ref|XP_008453107.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    172   5e-46    
ref|XP_010533498.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    172   6e-46    
ref|XP_010913570.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    172   7e-46    
ref|XP_006578621.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    171   1e-45    
ref|NP_001288476.1|  uncharacterized protein LOC103651208               171   1e-45    
gb|EMT31860.1|  Alpha,alpha-trehalose-phosphate synthase (UDP-for...    170   5e-45    
ref|XP_008393046.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    169   8e-45    
ref|XP_006660589.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    169   1e-44    
ref|XP_003525494.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    169   1e-44    
ref|XP_006661198.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    168   2e-44    
ref|XP_009127784.1|  PREDICTED: LOW QUALITY PROTEIN: probable alp...    167   3e-44    
ref|XP_004309955.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    167   3e-44    
ref|XP_010913571.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    165   3e-43    
ref|XP_004501945.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    164   5e-43    
ref|NP_001063045.1|  Os09g0376800                                       161   6e-43    
emb|CBH32509.1|  trehalose synthase, putative, expressed                164   7e-43    
ref|XP_008781992.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    162   2e-42    
gb|EEC84489.1|  hypothetical protein OsI_31155                          161   3e-42    
gb|AEB53186.1|  trehalose-6-phosphate synthase 11                       161   6e-42    
ref|XP_010477693.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    161   7e-42    
ref|XP_007138100.1|  hypothetical protein PHAVU_009G180300g             160   1e-41    
ref|XP_006453464.1|  hypothetical protein CICLE_v10007428mg             159   2e-41    
ref|XP_006453465.1|  hypothetical protein CICLE_v10007428mg             159   3e-41    
ref|XP_007155406.1|  hypothetical protein PHAVU_003G198800g             159   4e-41    
emb|CAN71202.1|  hypothetical protein VITISV_006369                     157   6e-41    
ref|XP_006300612.1|  hypothetical protein CARUB_v10019802mg             158   6e-41    
emb|CDY03758.1|  BnaA02g14790D                                          158   6e-41    
ref|XP_011010033.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    158   7e-41    
gb|KDO62386.1|  hypothetical protein CISIN_1g003042mg                   157   7e-41    
ref|XP_009625114.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    158   7e-41    
gb|KDO62387.1|  hypothetical protein CISIN_1g003042mg                   157   8e-41    
gb|KDO62385.1|  hypothetical protein CISIN_1g003042mg                   157   1e-40    
gb|AAC18810.1|  Strong similarity to trehalose-6-phosphate syntha...    157   2e-40    
ref|XP_001772649.1|  trehalose-6-phosphate synthase                     157   2e-40    
ref|XP_002462305.1|  hypothetical protein SORBIDRAFT_02g023610          157   3e-40    
ref|XP_010047021.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    156   3e-40    
ref|XP_002308438.1|  glycosyl transferase family 20 family protein      156   5e-40    
ref|XP_004956710.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    156   5e-40    
ref|XP_004507802.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    155   7e-40    
emb|CDY43001.1|  BnaC02g19750D                                          155   7e-40    
ref|XP_006581930.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    155   7e-40    
ref|XP_010687711.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    154   2e-39    
ref|XP_004956711.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    154   2e-39    
ref|XP_002884153.1|  predicted protein                                  154   2e-39    
tpg|DAA61259.1|  TPA: putative trehalose phosphatase/synthase fam...    144   4e-39    
ref|XP_010489579.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    153   4e-39    
emb|CBI32125.3|  unnamed protein product                                150   7e-39    



>ref|XP_009788524.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Nicotiana sylvestris]
 ref|XP_009788525.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Nicotiana sylvestris]
 ref|XP_009788526.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Nicotiana sylvestris]
Length=862

 Score =   342 bits (878),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 165/181 (91%), Positives = 174/181 (96%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLLDL SG+S TFGR+G+KLSRVATVAGVLSELDDE+RSN  SD PSSISQER
Sbjct  1    MVSRSYSNLLDLTSGDSPTFGRSGRKLSRVATVAGVLSELDDENRSNA-SDAPSSISQER  59

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIVGNQLPLRA+RRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIY+GCLKEEI DP+E
Sbjct  60   MIIVGNQLPLRAYRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYIGCLKEEI-DPSE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDVAQTLLETFKCVPAF+PPELFSKFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR+LWQ
Sbjct  119  QDDVAQTLLETFKCVPAFIPPELFSKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRSLWQ  178

Query  617  A  619
            A
Sbjct  179  A  179



>ref|XP_009606207.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Nicotiana tomentosiformis]
 ref|XP_009606214.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Nicotiana tomentosiformis]
Length=862

 Score =   342 bits (876),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 166/181 (92%), Positives = 172/181 (95%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLLDL SG+S TFGR G+KLSRVATVAGVLSELDDE+RSN  SD PSSISQER
Sbjct  1    MVSRSYSNLLDLTSGDSPTFGRGGRKLSRVATVAGVLSELDDENRSNA-SDAPSSISQER  59

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEI DP+E
Sbjct  60   MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEI-DPSE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDVA TLLETFKCVPAF+PPELFSKFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR+LWQ
Sbjct  119  QDDVALTLLETFKCVPAFIPPELFSKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRSLWQ  178

Query  617  A  619
            A
Sbjct  179  A  179



>ref|XP_006352881.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X1 [Solanum tuberosum]
 ref|XP_006352882.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X2 [Solanum tuberosum]
Length=862

 Score =   337 bits (864),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 163/181 (90%), Positives = 171/181 (94%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLLDL SG+S TFGR G+KLSRVATVAGVLSELDDESRSN  SD PSS++QER
Sbjct  1    MVSRSYSNLLDLTSGDSPTFGRGGRKLSRVATVAGVLSELDDESRSNA-SDAPSSVTQER  59

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIVGNQLPLRAHRR DGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVG LKEEI DP++
Sbjct  60   MIIVGNQLPLRAHRRKDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGSLKEEI-DPSQ  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDVAQTLLETFKCVPAF+PPELFSKFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR+LWQ
Sbjct  119  QDDVAQTLLETFKCVPAFIPPELFSKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRSLWQ  178

Query  617  A  619
            A
Sbjct  179  A  179



>ref|XP_004245918.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Solanum lycopersicum]
 ref|XP_010325563.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Solanum lycopersicum]
Length=862

 Score =   334 bits (856),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 170/181 (94%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLLDL S +S TFGR G+KLSRVATVAGVLSELDDESRSN  SD PSS++QER
Sbjct  1    MVSRSYSNLLDLISDDSPTFGRGGRKLSRVATVAGVLSELDDESRSNA-SDAPSSVTQER  59

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIVGNQLPLRAHRR DGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVG LKEEI DP++
Sbjct  60   MIIVGNQLPLRAHRRQDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGSLKEEI-DPSQ  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDVAQTLLETFKCVPAF+PPELFSKFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR+LWQ
Sbjct  119  QDDVAQTLLETFKCVPAFIPPELFSKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRSLWQ  178

Query  617  A  619
            A
Sbjct  179  A  179



>ref|XP_011070302.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 isoform X1 [Sesamum indicum]
 ref|XP_011070303.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 isoform X1 [Sesamum indicum]
Length=864

 Score =   326 bits (836),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 169/182 (93%), Gaps = 2/182 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLLDL SG S TF R GKK  RVATVAGVLS+LDDE+RSNGGSD PSSISQER
Sbjct  1    MVSRSYSNLLDLTSGGSPTFSRGGKKFPRVATVAGVLSDLDDENRSNGGSDAPSSISQER  60

Query  257  MIIVGNQLPLRAHRR-TDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPN  433
            MIIVGNQLPLRAHRR +DG++GW+FSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEI D +
Sbjct  61   MIIVGNQLPLRAHRRESDGDKGWDFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEI-DVS  119

Query  434  EQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLW  613
            EQ+DVAQTLLETFKCVPAF+P ELFSKFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR+LW
Sbjct  120  EQEDVAQTLLETFKCVPAFIPSELFSKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRSLW  179

Query  614  QA  619
            QA
Sbjct  180  QA  181



>ref|XP_002277503.2| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Vitis vinifera]
 ref|XP_010663329.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Vitis vinifera]
 ref|XP_010663335.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Vitis vinifera]
Length=864

 Score =   323 bits (828),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 168/181 (93%), Gaps = 1/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLLDL SG+S TFGR GKK+SRVATVAGVLSELDDE+ ++  SD PSS+SQ+R
Sbjct  1    MVSRSYSNLLDLVSGDSPTFGRGGKKISRVATVAGVLSELDDETSNSVTSDAPSSVSQDR  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIVGNQLPLRAHR +DG   W FSWDEDSLLLQLKDGLGEDVEV+YVGCL+E+ IDP+E
Sbjct  61   MIIVGNQLPLRAHRSSDGSGEWCFSWDEDSLLLQLKDGLGEDVEVLYVGCLREQ-IDPSE  119

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDVAQTLLETFKCVPAF+PPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDR+LWQ
Sbjct  120  QDDVAQTLLETFKCVPAFIPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRSLWQ  179

Query  617  A  619
            A
Sbjct  180  A  180



>emb|CAN61971.1| hypothetical protein VITISV_016593 [Vitis vinifera]
Length=859

 Score =   322 bits (826),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 168/181 (93%), Gaps = 1/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLLDL SG+S TFGR GKK+SRVATVAGVLSELDDE+ ++  SD PSS+SQ+R
Sbjct  1    MVSRSYSNLLDLVSGDSPTFGRGGKKISRVATVAGVLSELDDETSNSVTSDAPSSVSQDR  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIVGNQLPLRAHR +DG   W FSWDEDSLLLQLKDGLGEDVEV+YVGCL+E+ IDP+E
Sbjct  61   MIIVGNQLPLRAHRSSDGSGEWCFSWDEDSLLLQLKDGLGEDVEVLYVGCLREQ-IDPSE  119

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDVAQTLLETFKCVPAF+PPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDR+LWQ
Sbjct  120  QDDVAQTLLETFKCVPAFIPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRSLWQ  179

Query  617  A  619
            A
Sbjct  180  A  180



>ref|XP_010245191.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like [Nelumbo nucifera]
 ref|XP_010245192.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like [Nelumbo nucifera]
 ref|XP_010245193.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like [Nelumbo nucifera]
 ref|XP_010245194.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like [Nelumbo nucifera]
Length=856

 Score =   321 bits (822),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 169/181 (93%), Gaps = 1/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLL+LASG+S TFG+ GK+L RV TVAG++SELDDE+ ++  SD PSS++QER
Sbjct  1    MVSRSYSNLLELASGDSPTFGKVGKRLPRVMTVAGIISELDDENSNSASSDAPSSVTQER  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            +IIVGNQLP+RAHRR+DG+ GWNFSWDEDSLLLQLKDGLGEDVEVIY+GCL+EE IDP+E
Sbjct  61   IIIVGNQLPIRAHRRSDGDGGWNFSWDEDSLLLQLKDGLGEDVEVIYIGCLREE-IDPSE  119

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDVAQTLLETFKCVP F+PP+LFSKFYHGFCKQQLWPLFHYMLPLSP LGGRFDR+LWQ
Sbjct  120  QDDVAQTLLETFKCVPTFIPPDLFSKFYHGFCKQQLWPLFHYMLPLSPYLGGRFDRSLWQ  179

Query  617  A  619
            A
Sbjct  180  A  180



>ref|XP_002527658.1| trehalose-6-phosphate synthase, putative [Ricinus communis]
 gb|EEF34729.1| trehalose-6-phosphate synthase, putative [Ricinus communis]
Length=814

 Score =   319 bits (818),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 155/181 (86%), Positives = 164/181 (91%), Gaps = 1/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLLDL SG   TFGR  K+L RVATVAGVLSELDDE+ ++ GSD PSS+SQER
Sbjct  1    MVSRSYSNLLDLTSGGIPTFGREKKRLPRVATVAGVLSELDDENSNSVGSDAPSSVSQER  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIVGNQLPLRAHR  DG E W FSWDEDSLLLQLKDGLGED+EVIYVGCLKEE IDP+E
Sbjct  61   MIIVGNQLPLRAHRSPDGSEEWCFSWDEDSLLLQLKDGLGEDLEVIYVGCLKEE-IDPSE  119

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDVAQTLLETFKCVPAF+PPELFSKFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR+LWQ
Sbjct  120  QDDVAQTLLETFKCVPAFIPPELFSKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRSLWQ  179

Query  617  A  619
            A
Sbjct  180  A  180



>ref|XP_007210367.1| hypothetical protein PRUPE_ppa001305mg [Prunus persica]
 gb|EMJ11566.1| hypothetical protein PRUPE_ppa001305mg [Prunus persica]
Length=858

 Score =   316 bits (810),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/181 (84%), Positives = 166/181 (92%), Gaps = 3/181 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLLDL SG+S TFGR  K+  RVATVAGVLSELDD++ ++ GSD PSSI+QER
Sbjct  1    MVSRSYSNLLDLTSGDSPTFGREKKRFPRVATVAGVLSELDDDNSNSVGSDAPSSIAQER  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIVGNQLP+RAHRR DGE  W FSWDEDSLLLQLKDGLGEDVEV+Y+GCLKEEI DP+E
Sbjct  61   MIIVGNQLPIRAHRRDDGE--WYFSWDEDSLLLQLKDGLGEDVEVVYIGCLKEEI-DPSE  117

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDVAQTLL+TFKCVPAF+PPELFSKFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR+LWQ
Sbjct  118  QDDVAQTLLDTFKCVPAFLPPELFSKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRSLWQ  177

Query  617  A  619
            A
Sbjct  178  A  178



>gb|AJO70167.1| alpha,alpha-trehalose-phosphate synthase 5 [Camellia sinensis]
Length=863

 Score =   314 bits (805),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 166/181 (92%), Gaps = 1/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLLDL SG S  FGR G+K SRVATVAGVLSELDD++ ++ GSD PSS+SQ+R
Sbjct  1    MVSRSYSNLLDLTSGGSPNFGRGGRKFSRVATVAGVLSELDDDNCNSVGSDAPSSVSQDR  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            +IIVGNQLPL+AH+ +D + GWNFSWDEDSLLLQLKDGLG+D+EVIYVG LKEE IDP+E
Sbjct  61   IIIVGNQLPLKAHKSSDNDGGWNFSWDEDSLLLQLKDGLGDDLEVIYVGSLKEE-IDPDE  119

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDVAQTLLETFKCVPAF+PPELFSKFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR+LWQ
Sbjct  120  QDDVAQTLLETFKCVPAFIPPELFSKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRSLWQ  179

Query  617  A  619
            A
Sbjct  180  A  180



>ref|XP_004300232.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Fragaria vesca subsp. vesca]
Length=861

 Score =   314 bits (805),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 166/182 (91%), Gaps = 4/182 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNG-GSDVPSSISQE  253
            MVSRSYSNLLDL SG+SLTFGR  K+  RVATVAGVLSELDD++ +N  GSD PSSISQ+
Sbjct  1    MVSRSYSNLLDLTSGDSLTFGREKKRFPRVATVAGVLSELDDDASNNSVGSDAPSSISQD  60

Query  254  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPN  433
            RMIIVGNQLPLRAHR  DGE  W FSWDEDSLLLQLKDGLGEDVEVIY+GCLKEEI DP+
Sbjct  61   RMIIVGNQLPLRAHRSDDGE--WCFSWDEDSLLLQLKDGLGEDVEVIYIGCLKEEI-DPS  117

Query  434  EQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLW  613
            EQDDVAQTLL+TFKCVPAF+PP+LFSKFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR+LW
Sbjct  118  EQDDVAQTLLDTFKCVPAFLPPDLFSKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRSLW  177

Query  614  QA  619
            QA
Sbjct  178  QA  179



>ref|XP_006432795.1| hypothetical protein CICLE_v10000247mg [Citrus clementina]
 gb|ESR46035.1| hypothetical protein CICLE_v10000247mg [Citrus clementina]
Length=757

 Score =   311 bits (798),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 164/181 (91%), Gaps = 1/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLLDLASG+   F R  K+L RVATVAGVLSE+DDE+ ++ GSD PSS+SQER
Sbjct  1    MVSRSYSNLLDLASGDFPNFSREKKRLPRVATVAGVLSEIDDENSNSVGSDAPSSVSQER  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIVGNQLPLRAHR +DG  GW FSWDEDSLLLQLKDGLGEDVEVIYVGC+KE+ ID +E
Sbjct  61   MIIVGNQLPLRAHRSSDGSGGWTFSWDEDSLLLQLKDGLGEDVEVIYVGCIKEQ-IDLSE  119

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QD+V+QTLLETFKCVPAF+PPELFSKFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR+LWQ
Sbjct  120  QDEVSQTLLETFKCVPAFIPPELFSKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRSLWQ  179

Query  617  A  619
            A
Sbjct  180  A  180



>ref|XP_008238210.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Prunus mume]
Length=858

 Score =   312 bits (799),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 165/181 (91%), Gaps = 3/181 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLLDL SG+S TFGR  K+  RVATVAGVLSELDD++ ++ GSD PSSI+QER
Sbjct  1    MVSRSYSNLLDLTSGDSPTFGREKKRFPRVATVAGVLSELDDDNSNSVGSDAPSSIAQER  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIVGNQLP+RAHRR DGE  W FSWDEDSLLLQLKDGLGEDVEV+Y+GCLKEEI D +E
Sbjct  61   MIIVGNQLPIRAHRRDDGE--WYFSWDEDSLLLQLKDGLGEDVEVVYIGCLKEEI-DLSE  117

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDVAQTLL+TFKCVPAF+PPELFSKFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR+LWQ
Sbjct  118  QDDVAQTLLDTFKCVPAFLPPELFSKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRSLWQ  177

Query  617  A  619
            A
Sbjct  178  A  178



>ref|XP_006432796.1| hypothetical protein CICLE_v10000247mg [Citrus clementina]
 ref|XP_006432797.1| hypothetical protein CICLE_v10000247mg [Citrus clementina]
 ref|XP_006432798.1| hypothetical protein CICLE_v10000247mg [Citrus clementina]
 ref|XP_006432799.1| hypothetical protein CICLE_v10000247mg [Citrus clementina]
 ref|XP_006471585.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X1 [Citrus sinensis]
 ref|XP_006471586.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X2 [Citrus sinensis]
 ref|XP_006471587.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X3 [Citrus sinensis]
 ref|XP_006471588.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X4 [Citrus sinensis]
 ref|XP_006471589.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X5 [Citrus sinensis]
 ref|XP_006471590.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X6 [Citrus sinensis]
 gb|ESR46036.1| hypothetical protein CICLE_v10000247mg [Citrus clementina]
 gb|ESR46037.1| hypothetical protein CICLE_v10000247mg [Citrus clementina]
 gb|ESR46038.1| hypothetical protein CICLE_v10000247mg [Citrus clementina]
 gb|ESR46039.1| hypothetical protein CICLE_v10000247mg [Citrus clementina]
 gb|KDO53149.1| hypothetical protein CISIN_1g002958mg [Citrus sinensis]
 gb|KDO53150.1| hypothetical protein CISIN_1g002958mg [Citrus sinensis]
 gb|KDO53151.1| hypothetical protein CISIN_1g002958mg [Citrus sinensis]
 gb|KDO53152.1| hypothetical protein CISIN_1g002958mg [Citrus sinensis]
 gb|KDO53153.1| hypothetical protein CISIN_1g002958mg [Citrus sinensis]
 gb|KDO53154.1| hypothetical protein CISIN_1g002958mg [Citrus sinensis]
 gb|KDO53155.1| hypothetical protein CISIN_1g002958mg [Citrus sinensis]
 gb|KDO53156.1| hypothetical protein CISIN_1g002958mg [Citrus sinensis]
Length=863

 Score =   312 bits (799),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 164/181 (91%), Gaps = 1/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLLDLASG+   F R  K+L RVATVAGVLSE+DDE+ ++ GSD PSS+SQER
Sbjct  1    MVSRSYSNLLDLASGDFPNFSREKKRLPRVATVAGVLSEIDDENSNSVGSDAPSSVSQER  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIVGNQLPLRAHR +DG  GW FSWDEDSLLLQLKDGLGEDVEVIYVGC+KE+ ID +E
Sbjct  61   MIIVGNQLPLRAHRSSDGSGGWTFSWDEDSLLLQLKDGLGEDVEVIYVGCIKEQ-IDLSE  119

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QD+V+QTLLETFKCVPAF+PPELFSKFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR+LWQ
Sbjct  120  QDEVSQTLLETFKCVPAFIPPELFSKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRSLWQ  179

Query  617  A  619
            A
Sbjct  180  A  180



>ref|XP_009371197.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Pyrus x bretschneideri]
 ref|XP_009371198.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Pyrus x bretschneideri]
 ref|XP_009371199.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Pyrus x bretschneideri]
Length=860

 Score =   311 bits (796),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 164/181 (91%), Gaps = 3/181 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYS+LLDL S +S TFGR  K+  RVATVAGVLSE DD++ ++ GSD PSSI+QER
Sbjct  1    MVSRSYSSLLDLTSSDSPTFGREKKRFPRVATVAGVLSEFDDDNSNSVGSDAPSSIAQER  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIVGNQLPLRAHRR DGE  W FSWDEDSLLLQLKDGLGEDVEV+Y+GCLKEEI DP+E
Sbjct  61   MIIVGNQLPLRAHRRDDGE--WYFSWDEDSLLLQLKDGLGEDVEVVYIGCLKEEI-DPSE  117

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDVAQTLL+TFKCVPAF+PP+LFSKFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR+LWQ
Sbjct  118  QDDVAQTLLDTFKCVPAFIPPDLFSKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRSLWQ  177

Query  617  A  619
            A
Sbjct  178  A  178



>gb|EYU33434.1| hypothetical protein MIMGU_mgv1a001209mg [Erythranthe guttata]
Length=866

 Score =   310 bits (793),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 153/184 (83%), Positives = 167/184 (91%), Gaps = 4/184 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGE-SLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQE  253
            MVSRSYSNLLDL SG  S TFGR GKK  RVATVAGVLSEL+DE+RSN GS+ PSSISQ+
Sbjct  1    MVSRSYSNLLDLTSGSGSPTFGREGKKFPRVATVAGVLSELEDENRSNLGSETPSSISQD  60

Query  254  RMIIVGNQLPLRAHR--RTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIID  427
            RMIIVGNQLPLRAHR   +DG++ W FSWDEDSLLLQLKDGLG+DV+VIYVGCLKEEI D
Sbjct  61   RMIIVGNQLPLRAHRTESSDGKKHWTFSWDEDSLLLQLKDGLGDDVDVIYVGCLKEEI-D  119

Query  428  PNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRN  607
             +EQ++VAQTLLETFKCVPAF+PPELFSKFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR+
Sbjct  120  LDEQEEVAQTLLETFKCVPAFIPPELFSKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRS  179

Query  608  LWQA  619
            LWQA
Sbjct  180  LWQA  183



>ref|XP_007040645.1| Trehalose phosphatase/synthase 5 isoform 3, partial [Theobroma 
cacao]
 gb|EOY25146.1| Trehalose phosphatase/synthase 5 isoform 3, partial [Theobroma 
cacao]
Length=761

 Score =   305 bits (782),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 163/181 (90%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLLDLASG+S TFGR  K+  RVATV G+LSE+DD++ ++ GSD PSS+SQER
Sbjct  1    MVSRSYSNLLDLASGDSPTFGREKKRFPRVATVPGLLSEVDDDNCNSVGSDAPSSVSQER  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIVGNQLPLR+HR  D  E W FSWDEDSLLLQLKDGLGEDV+VIYVGCLKEEI  PNE
Sbjct  61   MIIVGNQLPLRSHRNADDGE-WCFSWDEDSLLLQLKDGLGEDVDVIYVGCLKEEIA-PNE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDVAQTLLETFKCVPAF+PPELF+KFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR+LWQ
Sbjct  119  QDDVAQTLLETFKCVPAFLPPELFTKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRSLWQ  178

Query  617  A  619
            A
Sbjct  179  A  179



>ref|XP_007040643.1| Trehalose phosphatase/synthase 5 isoform 1 [Theobroma cacao]
 ref|XP_007040644.1| Trehalose phosphatase/synthase 5 isoform 1 [Theobroma cacao]
 gb|EOY25144.1| Trehalose phosphatase/synthase 5 isoform 1 [Theobroma cacao]
 gb|EOY25145.1| Trehalose phosphatase/synthase 5 isoform 1 [Theobroma cacao]
Length=862

 Score =   306 bits (785),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 163/181 (90%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLLDLASG+S TFGR  K+  RVATV G+LSE+DD++ ++ GSD PSS+SQER
Sbjct  1    MVSRSYSNLLDLASGDSPTFGREKKRFPRVATVPGLLSEVDDDNCNSVGSDAPSSVSQER  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIVGNQLPLR+HR  D  E W FSWDEDSLLLQLKDGLGEDV+VIYVGCLKEEI  PNE
Sbjct  61   MIIVGNQLPLRSHRNADDGE-WCFSWDEDSLLLQLKDGLGEDVDVIYVGCLKEEIA-PNE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDVAQTLLETFKCVPAF+PPELF+KFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR+LWQ
Sbjct  119  QDDVAQTLLETFKCVPAFLPPELFTKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRSLWQ  178

Query  617  A  619
            A
Sbjct  179  A  179



>ref|XP_002304347.1| glycosyl transferase family 20 family protein [Populus trichocarpa]
 gb|EEE79326.1| glycosyl transferase family 20 family protein [Populus trichocarpa]
Length=861

 Score =   306 bits (783),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 162/181 (90%), Gaps = 3/181 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLLDLASG++  FGR  K+L RVATVAG+L++LDDE+  +  SD PSS+SQER
Sbjct  1    MVSRSYSNLLDLASGDAPNFGRERKRLPRVATVAGILTDLDDENSVS--SDAPSSVSQER  58

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIVGNQLPLRAHR  DG  GW FSWDEDSLLLQLKDGLGEDVEVIYVG LKEEI  P+E
Sbjct  59   MIIVGNQLPLRAHRSPDGSGGWCFSWDEDSLLLQLKDGLGEDVEVIYVGSLKEEIA-PSE  117

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDVAQTLLETFKCVPAF+PP+LFSKFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR+LWQ
Sbjct  118  QDDVAQTLLETFKCVPAFIPPDLFSKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRSLWQ  177

Query  617  A  619
            A
Sbjct  178  A  178



>ref|XP_009401244.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Musa acuminata subsp. malaccensis]
 ref|XP_009401245.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Musa acuminata subsp. malaccensis]
 ref|XP_009401247.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Musa acuminata subsp. malaccensis]
 ref|XP_009401248.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Musa acuminata subsp. malaccensis]
Length=857

 Score =   305 bits (781),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 163/181 (90%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLLDLASGE   FGR GKKL RV TVAG++S+LD+E+ ++  SD PSS+SQ+R
Sbjct  1    MVSRSYSNLLDLASGEFPAFGRTGKKLPRVMTVAGIISDLDEENTNSMTSDGPSSVSQDR  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIVGNQLP+RAHRR DG+ GWNFSWDEDSLLLQLKDGLGEDVEV+Y+GCL+EEI DP E
Sbjct  61   MIIVGNQLPIRAHRRPDGK-GWNFSWDEDSLLLQLKDGLGEDVEVVYIGCLREEI-DPAE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDV+QTLLETF+CVP F+ P+LFSKFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR LWQ
Sbjct  119  QDDVSQTLLETFRCVPTFLAPDLFSKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRVLWQ  178

Query  617  A  619
            A
Sbjct  179  A  179



>gb|KDP26189.1| hypothetical protein JCGZ_22685 [Jatropha curcas]
Length=865

 Score =   303 bits (775),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 161/181 (89%), Gaps = 1/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLLDLASG+S T  R  K+L RVATVAGVLSELDDE+ ++  SD PSSISQER
Sbjct  1    MVSRSYSNLLDLASGQSPTLSRERKRLPRVATVAGVLSELDDENSNSVSSDAPSSISQER  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIVGNQLPLRA++  DG   W FSWDEDSLLLQLKDGLGEDVEVIYVGCLKEE ID +E
Sbjct  61   MIIVGNQLPLRAYKSPDGSGEWCFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEE-IDLSE  119

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDVAQ LLE+FKCVPA++PPELFSKFYHGFCKQ LWPLFHYMLPLSP+LGGRFDR+LWQ
Sbjct  120  QDDVAQILLESFKCVPAYIPPELFSKFYHGFCKQHLWPLFHYMLPLSPELGGRFDRSLWQ  179

Query  617  A  619
            A
Sbjct  180  A  180



>ref|XP_010096957.1| Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5 [Morus 
notabilis]
 gb|EXB66534.1| Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5 [Morus 
notabilis]
Length=857

 Score =   301 bits (771),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 163/181 (90%), Gaps = 3/181 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLLDLASG S TFGR  K+L RVATVAGVLSE+DD++ ++ GSD PSS+SQER
Sbjct  1    MVSRSYSNLLDLASGGSPTFGRERKRLPRVATVAGVLSEIDDDNTNSVGSDAPSSVSQER  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIVGNQLPL+  RR +G+  W+FSWDEDSLLLQLKDGLGED EVIY+GCLKEEI D +E
Sbjct  61   MIIVGNQLPLKVQRRENGD--WDFSWDEDSLLLQLKDGLGEDAEVIYIGCLKEEI-DLDE  117

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDVAQTLL+++KCVPAF+PPELFSKFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR+LW 
Sbjct  118  QDDVAQTLLDSYKCVPAFLPPELFSKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRSLWH  177

Query  617  A  619
            A
Sbjct  178  A  178



>gb|KHG14108.1| Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5 -like 
protein [Gossypium arboreum]
Length=756

 Score =   297 bits (761),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 161/181 (89%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLLDLASG+S +FG   K+  RVATV G+LSE+DDE+ ++ GS+ PSS+SQER
Sbjct  1    MVSRSYSNLLDLASGDSPSFGGERKRFPRVATVPGLLSEVDDETCNSVGSEAPSSVSQER  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIVGNQLPLRAHR  D  + W FSWDEDSLLLQLKDGLGEDVEVIYVGCLKE++   NE
Sbjct  61   MIIVGNQLPLRAHRNEDNGD-WCFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEQVA-LNE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDVAQTLLETFKCVPAF+PPELF+KFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR+LWQ
Sbjct  119  QDDVAQTLLETFKCVPAFIPPELFTKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRSLWQ  178

Query  617  A  619
            A
Sbjct  179  A  179



>ref|XP_011028148.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X2 [Populus euphratica]
Length=673

 Score =   295 bits (755),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 159/181 (88%), Gaps = 3/181 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLLDLASG++  FGR  K+L RVATVAG+L++LDDE+  +  SD PSS+SQER
Sbjct  1    MVSRSYSNLLDLASGDAPNFGRERKRLPRVATVAGILTDLDDENSVS--SDAPSSVSQER  58

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIVGNQLPLRA R   G  GW FSWDEDSLLLQLKDGLGEDVEVIYVG LKEEI  P+E
Sbjct  59   MIIVGNQLPLRARRSPGGSGGWCFSWDEDSLLLQLKDGLGEDVEVIYVGSLKEEIA-PSE  117

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            Q+DVAQTLLE FKCVPAF+PP+LF+KFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR+LWQ
Sbjct  118  QEDVAQTLLENFKCVPAFIPPDLFTKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRSLWQ  177

Query  617  A  619
            A
Sbjct  178  A  178



>ref|XP_011028149.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X3 [Populus euphratica]
Length=667

 Score =   295 bits (754),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 159/181 (88%), Gaps = 3/181 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLLDLASG++  FGR  K+L RVATVAG+L++LDDE+  +  SD PSS+SQER
Sbjct  1    MVSRSYSNLLDLASGDAPNFGRERKRLPRVATVAGILTDLDDENSVS--SDAPSSVSQER  58

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIVGNQLPLRA R   G  GW FSWDEDSLLLQLKDGLGEDVEVIYVG LKEEI  P+E
Sbjct  59   MIIVGNQLPLRARRSPGGSGGWCFSWDEDSLLLQLKDGLGEDVEVIYVGSLKEEIA-PSE  117

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            Q+DVAQTLLE FKCVPAF+PP+LF+KFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR+LWQ
Sbjct  118  QEDVAQTLLENFKCVPAFIPPDLFTKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRSLWQ  177

Query  617  A  619
            A
Sbjct  178  A  178



>ref|XP_006605933.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X1 [Glycine max]
 ref|XP_006605934.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X2 [Glycine max]
 ref|XP_006605935.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X3 [Glycine max]
 ref|XP_006605936.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X4 [Glycine max]
Length=852

 Score =   298 bits (763),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 160/181 (88%), Gaps = 3/181 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLLDL S  S TFGR  K+L RVATVAGVLSELDDE+ ++  SD PSS+SQER
Sbjct  1    MVSRSYSNLLDLTSCGSPTFGREKKRLPRVATVAGVLSELDDETSNSVCSDTPSSVSQER  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIVGNQLPL+AHR+ +G   W F+WDEDSLLLQLKDGLG+DVE IY+GCLKEEI +P+E
Sbjct  61   MIIVGNQLPLKAHRKDNGT--WEFTWDEDSLLLQLKDGLGDDVETIYIGCLKEEI-EPSE  117

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDVAQ LL+TFKCVP F+PPELFSKFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR+LWQ
Sbjct  118  QDDVAQYLLDTFKCVPTFLPPELFSKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRSLWQ  177

Query  617  A  619
            A
Sbjct  178  A  178



>gb|KHN42432.1| Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5 [Glycine 
soja]
Length=852

 Score =   298 bits (763),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 160/181 (88%), Gaps = 3/181 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLLDL S  S TFGR  K+L RVATVAGVLSELDDE+ ++  SD PSS+SQER
Sbjct  1    MVSRSYSNLLDLTSCGSPTFGREKKRLPRVATVAGVLSELDDETSNSVCSDTPSSVSQER  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIVGNQLPL+AHR+ +G   W F+WDEDSLLLQLKDGLG+DVE IY+GCLKEEI +P+E
Sbjct  61   MIIVGNQLPLKAHRKDNGT--WEFTWDEDSLLLQLKDGLGDDVETIYIGCLKEEI-EPSE  117

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDVAQ LL+TFKCVP F+PPELFSKFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR+LWQ
Sbjct  118  QDDVAQYLLDTFKCVPTFLPPELFSKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRSLWQ  177

Query  617  A  619
            A
Sbjct  178  A  178



>gb|KCW71761.1| hypothetical protein EUGRSUZ_E00259 [Eucalyptus grandis]
Length=686

 Score =   294 bits (752),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 163/181 (90%), Gaps = 3/181 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLLDL SGE+L FGR  ++ SRVATV+G LSELDD++ ++ GSD PSS+SQER
Sbjct  1    MVSRSYSNLLDLTSGEALGFGRERRRFSRVATVSGPLSELDDDNSNSVGSDAPSSLSQER  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIVGNQLP+R+H+R +GE  W FSWDEDSLL QLKDG+ +DVEVIYVG LKEEI D ++
Sbjct  61   MIIVGNQLPIRSHKRDNGE--WYFSWDEDSLLYQLKDGIAQDVEVIYVGSLKEEI-DMSD  117

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDD+AQTLL+TFKCVPAF+PP+LFSKFYHGFCKQQLWPLFHYMLPLSP+LGGRFDR+LWQ
Sbjct  118  QDDIAQTLLDTFKCVPAFIPPDLFSKFYHGFCKQQLWPLFHYMLPLSPELGGRFDRSLWQ  177

Query  617  A  619
            A
Sbjct  178  A  178



>gb|KCW71760.1| hypothetical protein EUGRSUZ_E00259 [Eucalyptus grandis]
Length=681

 Score =   293 bits (751),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 163/181 (90%), Gaps = 3/181 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLLDL SGE+L FGR  ++ SRVATV+G LSELDD++ ++ GSD PSS+SQER
Sbjct  1    MVSRSYSNLLDLTSGEALGFGRERRRFSRVATVSGPLSELDDDNSNSVGSDAPSSLSQER  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIVGNQLP+R+H+R +GE  W FSWDEDSLL QLKDG+ +DVEVIYVG LKEEI D ++
Sbjct  61   MIIVGNQLPIRSHKRDNGE--WYFSWDEDSLLYQLKDGIAQDVEVIYVGSLKEEI-DMSD  117

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDD+AQTLL+TFKCVPAF+PP+LFSKFYHGFCKQQLWPLFHYMLPLSP+LGGRFDR+LWQ
Sbjct  118  QDDIAQTLLDTFKCVPAFIPPDLFSKFYHGFCKQQLWPLFHYMLPLSPELGGRFDRSLWQ  177

Query  617  A  619
            A
Sbjct  178  A  178



>gb|KHG01348.1| Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5 -like 
protein [Gossypium arboreum]
Length=862

 Score =   298 bits (762),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 161/181 (89%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLLDLA G + T  +  K+  RVATV G+LSE++D++ ++  SD PSS+SQER
Sbjct  1    MVSRSYSNLLDLAYGGTPTLSQEKKRFPRVATVPGLLSEVEDDNCNSVSSDAPSSVSQER  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIVGNQLPLRAH+ TD +EGW FSWDEDSLLLQLKDGLGEDVEVIYVGCLKEE+  PNE
Sbjct  61   MIIVGNQLPLRAHQNTD-DEGWCFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEV-PPNE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDVAQTLLETFKCVPAF+PPELF+KFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR+LWQ
Sbjct  119  QDDVAQTLLETFKCVPAFLPPELFTKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRSLWQ  178

Query  617  A  619
            A
Sbjct  179  A  179



>gb|KJB25286.1| hypothetical protein B456_004G183400 [Gossypium raimondii]
Length=760

 Score =   295 bits (755),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 160/181 (88%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLLDLA G + T  +  K+  RVATV G+LSE++D++ ++  SD PSS+SQER
Sbjct  1    MVSRSYSNLLDLAYGGTPTLSQEKKRFPRVATVPGLLSEVEDDNCNSVSSDAPSSVSQER  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIVGNQLPLR H+ TD +EGW FSWDEDSLLLQLKDGLGEDVEVIYVGCLKEE+  PNE
Sbjct  61   MIIVGNQLPLRVHQNTD-DEGWCFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEV-PPNE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDVAQTLLETFKCVPAF+PPELF+KFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR+LWQ
Sbjct  119  QDDVAQTLLETFKCVPAFLPPELFTKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRSLWQ  178

Query  617  A  619
            A
Sbjct  179  A  179



>ref|XP_008800104.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Phoenix dactylifera]
 ref|XP_008800105.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Phoenix dactylifera]
 ref|XP_008800106.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Phoenix dactylifera]
 ref|XP_008800107.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Phoenix dactylifera]
 ref|XP_008800109.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Phoenix dactylifera]
 ref|XP_008800110.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Phoenix dactylifera]
 ref|XP_008800111.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Phoenix dactylifera]
Length=859

 Score =   297 bits (760),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 162/181 (90%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLLDL +G S T+GR GK+L RV TVAG++ +LD+E+ ++ GS+  SS+SQER
Sbjct  1    MVSRSYSNLLDLVTGGSPTYGRLGKRLPRVMTVAGIICDLDEENSNSVGSEALSSVSQER  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            +IIVGNQLPLRAHRR D + GWNFSWDEDSLLLQLKDGLGEDVEVIY+GCL+EEI +P E
Sbjct  61   VIIVGNQLPLRAHRRPD-DSGWNFSWDEDSLLLQLKDGLGEDVEVIYIGCLREEI-EPGE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDV+ TLLETFKCVP F+PP+LFSKFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR+LWQ
Sbjct  119  QDDVSLTLLETFKCVPTFLPPDLFSKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRSLWQ  178

Query  617  A  619
            A
Sbjct  179  A  179



>gb|KJB25285.1| hypothetical protein B456_004G183400 [Gossypium raimondii]
 gb|KJB25287.1| hypothetical protein B456_004G183400 [Gossypium raimondii]
Length=862

 Score =   296 bits (757),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 160/181 (88%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLLDLA G + T  +  K+  RVATV G+LSE++D++ ++  SD PSS+SQER
Sbjct  1    MVSRSYSNLLDLAYGGTPTLSQEKKRFPRVATVPGLLSEVEDDNCNSVSSDAPSSVSQER  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIVGNQLPLR H+ TD +EGW FSWDEDSLLLQLKDGLGEDVEVIYVGCLKEE+  PNE
Sbjct  61   MIIVGNQLPLRVHQNTD-DEGWCFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEV-PPNE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDVAQTLLETFKCVPAF+PPELF+KFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR+LWQ
Sbjct  119  QDDVAQTLLETFKCVPAFLPPELFTKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRSLWQ  178

Query  617  A  619
            A
Sbjct  179  A  179



>ref|XP_010908489.1| PREDICTED: LOW QUALITY PROTEIN: alpha,alpha-trehalose-phosphate 
synthase [UDP-forming] 5-like [Elaeis guineensis]
Length=857

 Score =   295 bits (756),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 162/181 (90%), Gaps = 4/181 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLLDL SG+S TFGR GK+L RV TVAG++S+LD+E+  + GS+  SS+ QER
Sbjct  1    MVSRSYSNLLDLVSGDSPTFGRVGKRLPRVMTVAGIISDLDEEN--SVGSEALSSVCQER  58

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            +IIVGNQLPLRAHRR D + GWNFSWDEDSLLLQLKDGLGEDVEVIY+GCL+EEI +P E
Sbjct  59   VIIVGNQLPLRAHRRPD-DSGWNFSWDEDSLLLQLKDGLGEDVEVIYIGCLREEI-EPGE  116

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDV+QTLLETFKCVP F+ P+LFSKFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR+LWQ
Sbjct  117  QDDVSQTLLETFKCVPTFLSPDLFSKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRSLWQ  176

Query  617  A  619
            A
Sbjct  177  A  177



>ref|XP_011028143.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X1 [Populus euphratica]
 ref|XP_011028145.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X1 [Populus euphratica]
 ref|XP_011028146.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X1 [Populus euphratica]
 ref|XP_011028147.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X1 [Populus euphratica]
Length=861

 Score =   295 bits (756),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 159/181 (88%), Gaps = 3/181 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLLDLASG++  FGR  K+L RVATVAG+L++LDDE+  +  SD PSS+SQER
Sbjct  1    MVSRSYSNLLDLASGDAPNFGRERKRLPRVATVAGILTDLDDENSVS--SDAPSSVSQER  58

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIVGNQLPLRA R   G  GW FSWDEDSLLLQLKDGLGEDVEVIYVG LKEEI  P+E
Sbjct  59   MIIVGNQLPLRARRSPGGSGGWCFSWDEDSLLLQLKDGLGEDVEVIYVGSLKEEIA-PSE  117

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            Q+DVAQTLLE FKCVPAF+PP+LF+KFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR+LWQ
Sbjct  118  QEDVAQTLLENFKCVPAFIPPDLFTKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRSLWQ  177

Query  617  A  619
            A
Sbjct  178  A  178



>ref|XP_010055292.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Eucalyptus grandis]
 ref|XP_010055293.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Eucalyptus grandis]
 gb|KCW71759.1| hypothetical protein EUGRSUZ_E00259 [Eucalyptus grandis]
Length=864

 Score =   293 bits (751),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 163/181 (90%), Gaps = 3/181 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLLDL SGE+L FGR  ++ SRVATV+G LSELDD++ ++ GSD PSS+SQER
Sbjct  1    MVSRSYSNLLDLTSGEALGFGRERRRFSRVATVSGPLSELDDDNSNSVGSDAPSSLSQER  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIVGNQLP+R+H+R +GE  W FSWDEDSLL QLKDG+ +DVEVIYVG LKEEI D ++
Sbjct  61   MIIVGNQLPIRSHKRDNGE--WYFSWDEDSLLYQLKDGIAQDVEVIYVGSLKEEI-DMSD  117

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDD+AQTLL+TFKCVPAF+PP+LFSKFYHGFCKQQLWPLFHYMLPLSP+LGGRFDR+LWQ
Sbjct  118  QDDIAQTLLDTFKCVPAFIPPDLFSKFYHGFCKQQLWPLFHYMLPLSPELGGRFDRSLWQ  177

Query  617  A  619
            A
Sbjct  178  A  178



>ref|XP_006589670.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X1 [Glycine max]
 ref|XP_006589671.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X2 [Glycine max]
 ref|XP_006589672.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X3 [Glycine max]
 ref|XP_006589673.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X4 [Glycine max]
 ref|XP_006589674.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X5 [Glycine max]
 ref|XP_006589675.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X6 [Glycine max]
Length=853

 Score =   293 bits (750),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 158/181 (87%), Gaps = 3/181 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLLDL S  S TF R  K+L RVATVAGVLSELDDE+ ++  SD PSS+SQER
Sbjct  1    MVSRSYSNLLDLTSCGSPTFSREKKRLPRVATVAGVLSELDDETSNSVCSDTPSSVSQER  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIVGNQLPL+AHR+ +G   W F+WDEDSLLLQLKDGLG+DVE IY+GCLKEEI +P+E
Sbjct  61   MIIVGNQLPLKAHRKDNGT--WEFTWDEDSLLLQLKDGLGDDVETIYIGCLKEEI-EPSE  117

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDVA  LL+TFKCVP F+PPELFSKFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR+LWQ
Sbjct  118  QDDVALYLLDTFKCVPTFLPPELFSKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRSLWQ  177

Query  617  A  619
            A
Sbjct  178  A  178



>gb|KJB39837.1| hypothetical protein B456_007G033200 [Gossypium raimondii]
 gb|KJB39838.1| hypothetical protein B456_007G033200 [Gossypium raimondii]
 gb|KJB39839.1| hypothetical protein B456_007G033200 [Gossypium raimondii]
Length=864

 Score =   293 bits (750),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 160/181 (88%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLLDLASG+S +FG   K+  RVATV G+LSE+DDE+ ++ GS+ PSS+SQER
Sbjct  1    MVSRSYSNLLDLASGDSPSFGGERKRFPRVATVPGLLSEVDDETCNSVGSEAPSSVSQER  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIVGNQLPLRAHR  D  E W FSWDEDSLLLQLKDGLGED+EVIYVGCLKE++   NE
Sbjct  61   MIIVGNQLPLRAHRNEDNGE-WCFSWDEDSLLLQLKDGLGEDLEVIYVGCLKEQVA-LNE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDVAQTLLETFKCVPAF+P ELF+KFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR+LWQ
Sbjct  119  QDDVAQTLLETFKCVPAFIPLELFTKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRSLWQ  178

Query  617  A  619
            A
Sbjct  179  A  179



>gb|KHN06692.1| Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5 [Glycine 
soja]
Length=853

 Score =   293 bits (749),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 158/181 (87%), Gaps = 3/181 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLLDL S  S TF R  K+L RVATVAGVLSELDDE+ ++  SD PSS+SQER
Sbjct  1    MVSRSYSNLLDLTSCGSPTFSREKKRLPRVATVAGVLSELDDETSNSVCSDTPSSVSQER  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIVGNQLPL+AHR+ +G   W F+WDEDSLLLQLKDGLG+DVE IY+GCLKEEI +P+E
Sbjct  61   MIIVGNQLPLKAHRKDNGT--WEFTWDEDSLLLQLKDGLGDDVETIYIGCLKEEI-EPSE  117

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDVA  LL+TFKCVP F+PPELFSKFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR+LWQ
Sbjct  118  QDDVALYLLDTFKCVPTFLPPELFSKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRSLWQ  177

Query  617  A  619
            A
Sbjct  178  A  178



>ref|XP_006368376.1| hypothetical protein POPTR_0001s02190g [Populus trichocarpa]
 gb|ERP64945.1| hypothetical protein POPTR_0001s02190g [Populus trichocarpa]
Length=862

 Score =   292 bits (748),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 160/183 (87%), Gaps = 5/183 (3%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESL--TFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  250
            MVSRSYSNLLDLASG++   +FGR  K+  RVATVAG+L++LDDE+  N GSD PSS+S 
Sbjct  1    MVSRSYSNLLDLASGDAPIPSFGRERKRFPRVATVAGILTDLDDEN--NVGSDSPSSVSL  58

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  430
             RMIIVGNQLPLRAHR  D   GW FSWDEDSLLLQLKDGLGE VEVIYVG LKEEI +P
Sbjct  59   GRMIIVGNQLPLRAHRSPDSSGGWCFSWDEDSLLLQLKDGLGEGVEVIYVGSLKEEI-EP  117

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
            +EQDDVAQTLLETFKCVPAF+PP+LF+KFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR+L
Sbjct  118  SEQDDVAQTLLETFKCVPAFIPPDLFTKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRSL  177

Query  611  WQA  619
            WQA
Sbjct  178  WQA  180



>gb|KEH44193.1| trehalose-6-phosphate synthase domain protein [Medicago truncatula]
Length=855

 Score =   292 bits (748),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 157/181 (87%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M SRSYSNLLDL S  S +FGR  K+L RVATVAGVLSELDDE+ ++ GSD PSSISQER
Sbjct  1    MASRSYSNLLDLTSCGSPSFGREKKRLPRVATVAGVLSELDDETNNSVGSDAPSSISQER  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIVGNQLPL+A R+ +  + W F+WDEDSLLLQLKDGLG+DVE IY+GCLKEEI DP E
Sbjct  61   MIIVGNQLPLKAQRKEENGK-WEFTWDEDSLLLQLKDGLGDDVETIYIGCLKEEI-DPIE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDVAQ LL+ FKCVP F+PPELF+KFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR+LWQ
Sbjct  119  QDDVAQYLLDNFKCVPTFLPPELFTKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRSLWQ  178

Query  617  A  619
            A
Sbjct  179  A  179



>ref|XP_004497053.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X4 [Cicer arietinum]
Length=841

 Score =   291 bits (744),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 156/181 (86%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLLDL S  S  F R  K+L RVATVAGVLSELDDE+ ++ GSD PSSISQER
Sbjct  1    MVSRSYSNLLDLTSCGSPCFSREKKRLPRVATVAGVLSELDDETSNSVGSDAPSSISQER  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIVGNQLPL+A R+ +    W F+WDEDSLLLQLKDGLG+DVE IY+GCLKEEI DP+E
Sbjct  61   MIIVGNQLPLKAQRK-ENNGMWEFTWDEDSLLLQLKDGLGDDVETIYIGCLKEEI-DPSE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDVAQ LL+ FKCVP F+PPELF+KFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR+LWQ
Sbjct  119  QDDVAQYLLDNFKCVPTFLPPELFTKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRSLWQ  178

Query  617  A  619
            A
Sbjct  179  A  179



>ref|XP_004497050.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X1 [Cicer arietinum]
 ref|XP_004497051.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X2 [Cicer arietinum]
 ref|XP_004497052.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X3 [Cicer arietinum]
Length=855

 Score =   291 bits (744),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 156/181 (86%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLLDL S  S  F R  K+L RVATVAGVLSELDDE+ ++ GSD PSSISQER
Sbjct  1    MVSRSYSNLLDLTSCGSPCFSREKKRLPRVATVAGVLSELDDETSNSVGSDAPSSISQER  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIVGNQLPL+A R+ +    W F+WDEDSLLLQLKDGLG+DVE IY+GCLKEEI DP+E
Sbjct  61   MIIVGNQLPLKAQRK-ENNGMWEFTWDEDSLLLQLKDGLGDDVETIYIGCLKEEI-DPSE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDVAQ LL+ FKCVP F+PPELF+KFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR+LWQ
Sbjct  119  QDDVAQYLLDNFKCVPTFLPPELFTKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRSLWQ  178

Query  617  A  619
            A
Sbjct  179  A  179



>ref|XP_010276860.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like [Nelumbo nucifera]
 ref|XP_010276862.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like [Nelumbo nucifera]
 ref|XP_010276863.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like [Nelumbo nucifera]
 ref|XP_010276864.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like [Nelumbo nucifera]
 ref|XP_010276865.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like [Nelumbo nucifera]
Length=860

 Score =   289 bits (740),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 150/185 (81%), Positives = 168/185 (91%), Gaps = 5/185 (3%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLLDL SG+S +FGR GK+L RV TVAG++SELDD++ ++  SDVPSS+SQER
Sbjct  1    MVSRSYSNLLDLVSGDSPSFGRVGKRLPRVMTVAGIMSELDDDNSNSVSSDVPSSVSQER  60

Query  257  MIIVGNQLPLRAHRRTDGEEG----WNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEII  424
            MIIVGNQLPLR HRR+DG+       NFSWDEDSLLLQLKDGLGEDVEVIY+GCL+EEI 
Sbjct  61   MIIVGNQLPLRVHRRSDGDGDGDGGLNFSWDEDSLLLQLKDGLGEDVEVIYIGCLREEI-  119

Query  425  DPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDR  604
            DP+EQDDVAQTLLETFKCVPAF+PP+LFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDR
Sbjct  120  DPSEQDDVAQTLLETFKCVPAFIPPDLFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDR  179

Query  605  NLWQA  619
            +LWQA
Sbjct  180  SLWQA  184



>ref|XP_004148747.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like [Cucumis sativus]
 ref|XP_004165051.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like [Cucumis sativus]
 gb|KGN55736.1| hypothetical protein Csa_3G009420 [Cucumis sativus]
Length=864

 Score =   288 bits (736),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 160/184 (87%), Gaps = 6/184 (3%)
 Frame = +2

Query  77   MVSRSYSNLLDLASG---ESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSIS  247
            MVSRSYSNLL+LASG    +   GR  K+L RVATVAGVLSELDD+S ++ GSD PSS+S
Sbjct  1    MVSRSYSNLLELASGGCSPTFGLGRERKRLPRVATVAGVLSELDDDSCNSTGSDAPSSVS  60

Query  248  QERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIID  427
            Q+RMIIVGNQLP+RA+R  +G+  W FS DEDSLLLQLKDGLGEDVEVIY+GCL+EE+ D
Sbjct  61   QDRMIIVGNQLPIRANRDENGD--WEFSMDEDSLLLQLKDGLGEDVEVIYIGCLREEV-D  117

Query  428  PNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRN  607
            P EQDDVAQTLL+ FKCVP F+PPELFSKFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR+
Sbjct  118  PREQDDVAQTLLDRFKCVPTFLPPELFSKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRS  177

Query  608  LWQA  619
            LWQA
Sbjct  178  LWQA  181



>ref|XP_008448661.1| PREDICTED: LOW QUALITY PROTEIN: alpha,alpha-trehalose-phosphate 
synthase [UDP-forming] 5-like [Cucumis melo]
Length=864

 Score =   287 bits (735),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/184 (77%), Positives = 160/184 (87%), Gaps = 6/184 (3%)
 Frame = +2

Query  77   MVSRSYSNLLDLASG---ESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSIS  247
            MVSRSYSNLL+LASG    +   GR  K+L RVATVAGVLSELDD+S ++ GSD PSS++
Sbjct  1    MVSRSYSNLLELASGGCSPTFGLGRERKRLPRVATVAGVLSELDDDSCNSTGSDAPSSVA  60

Query  248  QERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIID  427
            Q+RMIIVGNQLP+RA+R  +G+  W FS DEDSLLLQLKDGLGEDVEVIY+GCL+EE+ D
Sbjct  61   QDRMIIVGNQLPIRANRNENGD--WEFSMDEDSLLLQLKDGLGEDVEVIYIGCLREEV-D  117

Query  428  PNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRN  607
            P EQDDVAQTLL+ FKCVP F+PPELFSKFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR+
Sbjct  118  PREQDDVAQTLLDRFKCVPTFLPPELFSKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRS  177

Query  608  LWQA  619
            LWQA
Sbjct  178  LWQA  181



>ref|XP_011018523.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Populus euphratica]
 ref|XP_011018524.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Populus euphratica]
Length=863

 Score =   287 bits (734),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 160/184 (87%), Gaps = 6/184 (3%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESL--TFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSIS-  247
            MVS+SYSNLLDLASG++   +FGR  K+  RVATVAG+L++LDDE+  N GSD PSS+S 
Sbjct  1    MVSKSYSNLLDLASGDAPIPSFGRERKRFPRVATVAGILTDLDDEN--NVGSDAPSSVSL  58

Query  248  QERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIID  427
              RMIIVGNQLPLRAHR  D   GW F+WDEDSLLLQLKDGLGEDVEVIYVG LKEEI +
Sbjct  59   GRRMIIVGNQLPLRAHRSPDSSGGWCFNWDEDSLLLQLKDGLGEDVEVIYVGSLKEEI-E  117

Query  428  PNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRN  607
            P+EQDDVA TLLETFKCVPAF+PP+LF+KFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR+
Sbjct  118  PSEQDDVALTLLETFKCVPAFIPPDLFTKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRS  177

Query  608  LWQA  619
            LWQA
Sbjct  178  LWQA  181



>ref|XP_006854042.1| hypothetical protein AMTR_s00048p00069850 [Amborella trichopoda]
 gb|ERN15509.1| hypothetical protein AMTR_s00048p00069850 [Amborella trichopoda]
Length=852

 Score =   285 bits (729),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 157/181 (87%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M SRSYSNLLDL SG S +F R GK+L RV TVAG+LSE+DDE  ++ GS+ PSSI QER
Sbjct  1    MASRSYSNLLDLTSGNSPSFNRVGKRLPRVMTVAGLLSEIDDEGSNSVGSEGPSSICQER  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            +IIVGNQLPLRAHRR + +  W+FSWDEDSLLLQL+DGLGE+ E +Y+GCLKEEI DP+E
Sbjct  61   IIIVGNQLPLRAHRRPN-QSSWDFSWDEDSLLLQLRDGLGEEKEFMYIGCLKEEI-DPSE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QD+V+Q LLE FKCVP F+ PELF+KFYHGFCKQQLWPLFHYMLPLSPDLGGRFDR+LWQ
Sbjct  119  QDEVSQILLERFKCVPTFLSPELFTKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRSLWQ  178

Query  617  A  619
            A
Sbjct  179  A  179



>ref|XP_010677331.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Beta vulgaris subsp. vulgaris]
 ref|XP_010677332.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Beta vulgaris subsp. vulgaris]
Length=866

 Score =   283 bits (723),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 155/182 (85%), Gaps = 2/182 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLLDLASG+  +  R  ++  RV TVAGVLSELDDE+ ++  SD PSSI+QER
Sbjct  1    MVSRSYSNLLDLASGQFPSICRGERRFPRVKTVAGVLSELDDETSNSVSSDAPSSITQER  60

Query  257  MIIVGNQLPLRAHRRTDGEE-GWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPN  433
            +IIVGNQLPLR H ++D E+ G  FSWDEDSLLLQLKDGL EDVE++Y+GCL+E+I DP+
Sbjct  61   VIIVGNQLPLRVHHKSDDEKVGRYFSWDEDSLLLQLKDGLAEDVEIVYIGCLREQI-DPS  119

Query  434  EQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLW  613
            EQD VA TL E FKCVP F+PPELF+KFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR+LW
Sbjct  120  EQDSVAHTLFENFKCVPTFLPPELFTKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRSLW  179

Query  614  QA  619
            QA
Sbjct  180  QA  181



>ref|XP_006849789.1| hypothetical protein AMTR_s00176p00032980 [Amborella trichopoda]
 gb|ERN11370.1| hypothetical protein AMTR_s00176p00032980 [Amborella trichopoda]
Length=859

 Score =   281 bits (719),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 158/183 (86%), Gaps = 4/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESL-TFGRAGKKLSRVATVAGVLSELDD-ESRSNGGSDVPSSISQ  250
            MVSRSYSNLLDL SG +  +FGR G++L RV TV G++S+ DD  S  + GSD PSS++Q
Sbjct  1    MVSRSYSNLLDLVSGGTPPSFGRMGRRLPRVMTVPGIISDFDDGASVHSTGSDPPSSVTQ  60

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  430
            +R IIV NQLP+RAHRR DG+ GW FSWDED+LLLQLKDGLGEDVEVIYVGCLKEE+  P
Sbjct  61   DRTIIVANQLPIRAHRRDDGK-GWLFSWDEDALLLQLKDGLGEDVEVIYVGCLKEEV-PP  118

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
            +EQD+V+Q LLETFKCVP F+PP+LFS+FYHGFCKQQLWPLFHYMLPLSPDLGGRFDR L
Sbjct  119  SEQDEVSQILLETFKCVPTFLPPDLFSRFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRAL  178

Query  611  WQA  619
            WQA
Sbjct  179  WQA  181



>emb|CBI33857.3| unnamed protein product [Vitis vinifera]
Length=223

 Score =   263 bits (672),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 144/181 (80%), Gaps = 28/181 (15%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLLDL                           LDDE+ ++  SD PSS+SQ+R
Sbjct  1    MVSRSYSNLLDL---------------------------LDDETSNSVTSDAPSSVSQDR  33

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIVGNQLPLRAHR +DG   W FSWDEDSLLLQLKDGLGEDVEV+YVGCL+E+I DP+E
Sbjct  34   MIIVGNQLPLRAHRSSDGSGEWCFSWDEDSLLLQLKDGLGEDVEVLYVGCLREQI-DPSE  92

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDVAQTLLETFKCVPAF+PPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDR+LWQ
Sbjct  93   QDDVAQTLLETFKCVPAFIPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRSLWQ  152

Query  617  A  619
            A
Sbjct  153  A  153



>gb|AAX16014.1| trehalose-6-phosphate synthase [Ginkgo biloba]
 gb|AAX16015.1| trehalose-6-phosphate synthase [Ginkgo biloba]
Length=868

 Score =   280 bits (715),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 153/181 (85%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M+SRSY+NL+DLA+G    FGRA K+L RV TV G++SELDD++ ++  SDVPSSI QER
Sbjct  1    MMSRSYTNLMDLATGNFPAFGRATKRLPRVMTVPGIISELDDDNSNSVSSDVPSSICQER  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIV NQLPLRA RR D   GW FSWDEDSLLLQLKDGL ED+EV+YVG LK E+ D +E
Sbjct  61   MIIVANQLPLRAQRRPDNR-GWAFSWDEDSLLLQLKDGLAEDMEVVYVGSLKVEV-DLSE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDVAQ LLE FKCVPAF+PPEL +KFYHGFCKQQLWPLFHYMLPLSPD GGRFDR+LWQ
Sbjct  119  QDDVAQILLENFKCVPAFLPPELLTKFYHGFCKQQLWPLFHYMLPLSPDHGGRFDRSLWQ  178

Query  617  A  619
            A
Sbjct  179  A  179



>emb|CDX90449.1| BnaA03g43320D [Brassica napus]
Length=857

 Score =   275 bits (703),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 156/182 (86%), Gaps = 4/182 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNG-GSDVPSSISQE  253
            MVSRSYSNLLDLASG   +F R  K+  RVATV GVLSELDD++ SN   SD PSS++Q+
Sbjct  1    MVSRSYSNLLDLASGNFHSFSREKKRFPRVATVTGVLSELDDDTNSNSVCSDAPSSVAQD  60

Query  254  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPN  433
            R+IIVGNQLP+++HR + G+    F+WD DSLLLQLKDG+ ED+EV+Y+GCLK+++ DP+
Sbjct  61   RIIIVGNQLPIKSHRTSSGK--LTFTWDNDSLLLQLKDGMREDMEVVYIGCLKDQV-DPS  117

Query  434  EQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLW  613
            EQDDVAQ LLE FKCVPA++PPE+F+K+YHGFCKQ LWPLFHYMLPL+PDLGGRFDR+LW
Sbjct  118  EQDDVAQRLLENFKCVPAYIPPEIFTKYYHGFCKQHLWPLFHYMLPLNPDLGGRFDRSLW  177

Query  614  QA  619
            QA
Sbjct  178  QA  179



>emb|CAB10557.1| trehalose-6-phosphate synthase like protein [Arabidopsis thaliana]
 emb|CAB78780.1| trehalose-6-phosphate synthase like protein [Arabidopsis thaliana]
Length=865

 Score =   273 bits (698),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 133/196 (68%), Positives = 160/196 (82%), Gaps = 9/196 (5%)
 Frame = +2

Query  44   FERCIY---CGESTMVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRS  214
               CIY   C +  MVSRSYSNLLDLASG   +F R  K+  RVATV GVLSELDD++ S
Sbjct  6    LRHCIYFTCCRD--MVSRSYSNLLDLASGNFHSFSREKKRFPRVATVTGVLSELDDDNNS  63

Query  215  NG-GSDVPSSISQERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEV  391
            N   SD PSS++Q+R+IIVGNQLP+++HR + G+   +FSWD DSLLLQLKDG+ ED+EV
Sbjct  64   NSVCSDAPSSVTQDRIIIVGNQLPIKSHRNSAGK--LSFSWDNDSLLLQLKDGMREDMEV  121

Query  392  IYVGCLKEEIIDPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLP  571
            +Y+GCLKE+I D  EQDDV+Q LLE FKCVPA++PPELF+K+YHGFCKQ LWPLFHYMLP
Sbjct  122  VYIGCLKEQI-DTVEQDDVSQRLLENFKCVPAYIPPELFTKYYHGFCKQHLWPLFHYMLP  180

Query  572  LSPDLGGRFDRNLWQA  619
            L+PDLGGRFDR+LWQA
Sbjct  181  LTPDLGGRFDRSLWQA  196



>gb|ABD65165.1| trehalose-6-phosphate synthase, putative [Brassica oleracea]
Length=857

 Score =   273 bits (697),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 155/182 (85%), Gaps = 4/182 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNG-GSDVPSSISQE  253
            MVSRSYSNLLDLASG   +F R  K+  RVATV GVLSELDD++ SN   SD PSSI+Q+
Sbjct  1    MVSRSYSNLLDLASGNFHSFSREKKRFPRVATVTGVLSELDDDANSNSVCSDAPSSIAQD  60

Query  254  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPN  433
            R+IIVGNQLP+++HR   G+    F+WD DSLLLQLKDG+ ED+EV+Y+GCLK+++ DP+
Sbjct  61   RIIIVGNQLPIKSHRNPSGK--LTFTWDNDSLLLQLKDGMREDMEVVYIGCLKDQV-DPS  117

Query  434  EQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLW  613
            EQDDV+Q LLE FKCVPA++PPE+F+K+YHGFCKQ LWPLFHYMLPL+PDLGGRFDR+LW
Sbjct  118  EQDDVSQRLLENFKCVPAYIPPEIFTKYYHGFCKQHLWPLFHYMLPLNPDLGGRFDRSLW  177

Query  614  QA  619
            QA
Sbjct  178  QA  179



>ref|XP_009136870.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Brassica rapa]
 ref|XP_009136871.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Brassica rapa]
Length=857

 Score =   272 bits (696),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 155/182 (85%), Gaps = 4/182 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNG-GSDVPSSISQE  253
            MVSRSYSNLLDLASG   +F R  K+  RVAT  GVLSELDD++ SN   SD PSS++Q+
Sbjct  1    MVSRSYSNLLDLASGNFHSFSREKKRFPRVATFTGVLSELDDDTNSNSVCSDAPSSVAQD  60

Query  254  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPN  433
            R+IIVGNQLP+++HR + G+    F+WD DSLLLQLKDG+ ED+EV+Y+GCLK+++ DP+
Sbjct  61   RIIIVGNQLPIKSHRTSSGK--LTFTWDNDSLLLQLKDGMREDMEVVYIGCLKDQV-DPS  117

Query  434  EQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLW  613
            EQDDVAQ LLE FKCVPA++PPE+F+K+YHGFCKQ LWPLFHYMLPL+PDLGGRFDR+LW
Sbjct  118  EQDDVAQRLLENFKCVPAYIPPEIFTKYYHGFCKQHLWPLFHYMLPLNPDLGGRFDRSLW  177

Query  614  QA  619
            QA
Sbjct  178  QA  179



>ref|NP_567538.1| putative trehalose phosphatase/synthase 5 [Arabidopsis thaliana]
 sp|O23617.2|TPS5_ARATH RecName: Full=Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5; AltName: Full=Trehalose-6-phosphate synthase 5; Short=AtTPS5 
[Arabidopsis thaliana]
 dbj|BAC43297.1| putative trehalose-6-phosphate synthase [Arabidopsis thaliana]
 gb|AAO64902.1| At4g17770 [Arabidopsis thaliana]
 gb|AEE83948.1| putative trehalose phosphatase/synthase 5 [Arabidopsis thaliana]
 gb|AHL38687.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=862

 Score =   272 bits (696),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 155/182 (85%), Gaps = 4/182 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNG-GSDVPSSISQE  253
            MVSRSYSNLLDLASG   +F R  K+  RVATV GVLSELDD++ SN   SD PSS++Q+
Sbjct  1    MVSRSYSNLLDLASGNFHSFSREKKRFPRVATVTGVLSELDDDNNSNSVCSDAPSSVTQD  60

Query  254  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPN  433
            R+IIVGNQLP+++HR + G+   +FSWD DSLLLQLKDG+ ED+EV+Y+GCLKE+I D  
Sbjct  61   RIIIVGNQLPIKSHRNSAGK--LSFSWDNDSLLLQLKDGMREDMEVVYIGCLKEQI-DTV  117

Query  434  EQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLW  613
            EQDDV+Q LLE FKCVPA++PPELF+K+YHGFCKQ LWPLFHYMLPL+PDLGGRFDR+LW
Sbjct  118  EQDDVSQRLLENFKCVPAYIPPELFTKYYHGFCKQHLWPLFHYMLPLTPDLGGRFDRSLW  177

Query  614  QA  619
            QA
Sbjct  178  QA  179



>ref|XP_010449561.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X2 [Camelina sativa]
Length=858

 Score =   271 bits (694),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 155/182 (85%), Gaps = 4/182 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNG-GSDVPSSISQE  253
            MVSRSYSNLLDLASG   +F R  K+  RVATV GVLSELDD++ SN   SD PSS++Q+
Sbjct  1    MVSRSYSNLLDLASGNFHSFSREKKRFPRVATVTGVLSELDDDNNSNSVCSDAPSSVTQD  60

Query  254  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPN  433
            R+I+VGNQLP+++HR + G+   +FSWD DSLLLQLKDG+ ED+EV+Y+GCLKE+I D  
Sbjct  61   RIIVVGNQLPIKSHRNSAGK--LSFSWDNDSLLLQLKDGMREDMEVVYIGCLKEQI-DTV  117

Query  434  EQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLW  613
            EQDDV+Q LLE FKCVPA++PPELF+K+YHGFCKQ LWPLFHYMLPL+PDLGGRFDR+LW
Sbjct  118  EQDDVSQRLLENFKCVPAYIPPELFTKYYHGFCKQHLWPLFHYMLPLTPDLGGRFDRSLW  177

Query  614  QA  619
            QA
Sbjct  178  QA  179



>ref|XP_010434619.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like [Camelina sativa]
 ref|XP_010434620.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like [Camelina sativa]
Length=862

 Score =   271 bits (694),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 155/182 (85%), Gaps = 4/182 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNG-GSDVPSSISQE  253
            MVSRSYSNLLDLASG   +F R  K+  RVATV GVLSELDD++ SN   SD PSS++Q+
Sbjct  1    MVSRSYSNLLDLASGNFHSFSREKKRFPRVATVTGVLSELDDDNNSNSVCSDAPSSVTQD  60

Query  254  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPN  433
            R+I+VGNQLP+++HR + G+   +FSWD DSLLLQLKDG+ ED+EV+Y+GCLKE+I D  
Sbjct  61   RIIVVGNQLPIKSHRNSAGK--LSFSWDNDSLLLQLKDGMREDMEVVYIGCLKEQI-DTV  117

Query  434  EQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLW  613
            EQDDV+Q LLE FKCVPA++PPELF+K+YHGFCKQ LWPLFHYMLPL+PDLGGRFDR+LW
Sbjct  118  EQDDVSQRLLENFKCVPAYIPPELFTKYYHGFCKQHLWPLFHYMLPLTPDLGGRFDRSLW  177

Query  614  QA  619
            QA
Sbjct  178  QA  179



>ref|XP_010449562.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X3 [Camelina sativa]
Length=844

 Score =   271 bits (693),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 155/182 (85%), Gaps = 4/182 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNG-GSDVPSSISQE  253
            MVSRSYSNLLDLASG   +F R  K+  RVATV GVLSELDD++ SN   SD PSS++Q+
Sbjct  1    MVSRSYSNLLDLASGNFHSFSREKKRFPRVATVTGVLSELDDDNNSNSVCSDAPSSVTQD  60

Query  254  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPN  433
            R+I+VGNQLP+++HR + G+   +FSWD DSLLLQLKDG+ ED+EV+Y+GCLKE+I D  
Sbjct  61   RIIVVGNQLPIKSHRNSAGK--LSFSWDNDSLLLQLKDGMREDMEVVYIGCLKEQI-DTV  117

Query  434  EQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLW  613
            EQDDV+Q LLE FKCVPA++PPELF+K+YHGFCKQ LWPLFHYMLPL+PDLGGRFDR+LW
Sbjct  118  EQDDVSQRLLENFKCVPAYIPPELFTKYYHGFCKQHLWPLFHYMLPLTPDLGGRFDRSLW  177

Query  614  QA  619
            QA
Sbjct  178  QA  179



>ref|XP_002527520.1| trehalose-6-phosphate synthase, putative [Ricinus communis]
 gb|EEF34829.1| trehalose-6-phosphate synthase, putative [Ricinus communis]
Length=753

 Score =   269 bits (688),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 159/184 (86%), Gaps = 4/184 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPS-SISQE  253
            MVSRSYSNLL+LASGES +FGR  +++ R+ TVAG++S+LDD+   +  SD  S SI ++
Sbjct  1    MVSRSYSNLLELASGESPSFGRMNRRIPRIMTVAGIISDLDDDPSESVCSDPSSASIQKD  60

Query  254  RMIIVGNQLPLRAHRRTDG-EEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEIID  427
            R+IIV NQLP+RA R++DG  + W F+WDE+SLLLQLKDGLG+D +EVIYVGCL+EEI  
Sbjct  61   RIIIVANQLPIRAQRKSDGSNKSWIFTWDENSLLLQLKDGLGDDEIEVIYVGCLREEI-H  119

Query  428  PNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRN  607
            PNEQD+V+Q LLETFKCVP F+PP+LFS++YHGFCKQQLWPLFHYMLPLSPDLGGRF+R+
Sbjct  120  PNEQDEVSQILLETFKCVPTFIPPDLFSRYYHGFCKQQLWPLFHYMLPLSPDLGGRFNRS  179

Query  608  LWQA  619
            LWQA
Sbjct  180  LWQA  183



>ref|XP_010449559.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X1 [Camelina sativa]
 ref|XP_010449560.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X1 [Camelina sativa]
Length=859

 Score =   271 bits (693),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 155/182 (85%), Gaps = 4/182 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNG-GSDVPSSISQE  253
            MVSRSYSNLLDLASG   +F R  K+  RVATV GVLSELDD++ SN   SD PSS++Q+
Sbjct  1    MVSRSYSNLLDLASGNFHSFSREKKRFPRVATVTGVLSELDDDNNSNSVCSDAPSSVTQD  60

Query  254  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPN  433
            R+I+VGNQLP+++HR + G+   +FSWD DSLLLQLKDG+ ED+EV+Y+GCLKE+I D  
Sbjct  61   RIIVVGNQLPIKSHRNSAGK--LSFSWDNDSLLLQLKDGMREDMEVVYIGCLKEQI-DTV  117

Query  434  EQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLW  613
            EQDDV+Q LLE FKCVPA++PPELF+K+YHGFCKQ LWPLFHYMLPL+PDLGGRFDR+LW
Sbjct  118  EQDDVSQRLLENFKCVPAYIPPELFTKYYHGFCKQHLWPLFHYMLPLTPDLGGRFDRSLW  177

Query  614  QA  619
            QA
Sbjct  178  QA  179



>ref|XP_002870086.1| ATTPS5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46345.1| ATTPS5 [Arabidopsis lyrata subsp. lyrata]
Length=862

 Score =   271 bits (692),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 155/182 (85%), Gaps = 4/182 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNG-GSDVPSSISQE  253
            MVSRSYSNLLDLASG   +F R  K+  RVATV GVLSELDD++ SN   SD PSS++Q+
Sbjct  1    MVSRSYSNLLDLASGNFHSFSREKKRFPRVATVTGVLSELDDDNNSNSVCSDAPSSVTQD  60

Query  254  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPN  433
            R+IIVGNQLP+++HR + G+   +FSWD DSLLLQLKDG+ ED+EV+Y+GCLKE+I D  
Sbjct  61   RIIIVGNQLPIKSHRNSAGK--LSFSWDNDSLLLQLKDGMREDMEVVYIGCLKEQI-DIV  117

Query  434  EQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLW  613
            EQDDV+Q LLE FKCVPA++PPELF+K+YHGFCKQ LWPLFHYMLPL+PDLGGRFDR+LW
Sbjct  118  EQDDVSQRLLENFKCVPAYLPPELFTKYYHGFCKQHLWPLFHYMLPLTPDLGGRFDRSLW  177

Query  614  QA  619
            QA
Sbjct  178  QA  179



>ref|XP_006283097.1| hypothetical protein CARUB_v10004115mg [Capsella rubella]
 gb|EOA15995.1| hypothetical protein CARUB_v10004115mg [Capsella rubella]
Length=862

 Score =   270 bits (691),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 155/182 (85%), Gaps = 4/182 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNG-GSDVPSSISQE  253
            MVSRSYSNLLDLASG   +F R  K+  RVATV GVLSELDD++ SN   SD PSS++Q+
Sbjct  1    MVSRSYSNLLDLASGNFHSFSREKKRFPRVATVTGVLSELDDDNNSNSVCSDAPSSVTQD  60

Query  254  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPN  433
            R+IIVGNQLP++++R + G+   +FSWD DSLLLQLKDG+ ED+EV+Y+GCLKE+I D  
Sbjct  61   RIIIVGNQLPIKSYRNSAGK--LSFSWDNDSLLLQLKDGMREDMEVVYIGCLKEQI-DTA  117

Query  434  EQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLW  613
            EQDDV+Q LLE FKCVPA++PPELF+K+YHGFCKQ LWPLFHYMLPL+PDLGGRFDR+LW
Sbjct  118  EQDDVSQRLLENFKCVPAYIPPELFTKYYHGFCKQHLWPLFHYMLPLTPDLGGRFDRSLW  177

Query  614  QA  619
            QA
Sbjct  178  QA  179



>ref|XP_010439943.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Camelina sativa]
 ref|XP_010439944.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Camelina sativa]
Length=862

 Score =   269 bits (688),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 154/182 (85%), Gaps = 4/182 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNG-GSDVPSSISQE  253
            MVSRSYSNLLDLASG   +F R  K+  RVATV GVLSELDD++ SN   SD PSS++Q+
Sbjct  1    MVSRSYSNLLDLASGNFHSFSREKKRFPRVATVTGVLSELDDDNNSNSVCSDAPSSVTQD  60

Query  254  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPN  433
            R+IIVGNQLP+++HR + G+   +FSWD DSLLLQLKDG+ ED+EV+Y+GCLKE+I D  
Sbjct  61   RIIIVGNQLPIKSHRNSAGK--LSFSWDNDSLLLQLKDGMREDMEVVYIGCLKEQI-DTV  117

Query  434  EQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLW  613
            EQDDV+Q LLE FKCVPA++ PELF+K+YHGFCKQ LWPLFHYMLPL+PDLGGRFDR+LW
Sbjct  118  EQDDVSQRLLENFKCVPAYISPELFTKYYHGFCKQHLWPLFHYMLPLTPDLGGRFDRSLW  177

Query  614  QA  619
            QA
Sbjct  178  QA  179



>ref|XP_008381762.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Malus domestica]
 ref|XP_008381764.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Malus domestica]
 ref|XP_008381765.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Malus domestica]
Length=848

 Score =   268 bits (686),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 154/182 (85%), Gaps = 7/182 (4%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVS+SYSNLL+LASGE  +FGR G+++ RV  VAGV+S++DDE     G    SS  ++R
Sbjct  1    MVSKSYSNLLELASGEGDSFGRIGRRIPRVMNVAGVMSDVDDE-----GYTSSSSSQRDR  55

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEIIDPN  433
            +IIV NQLP+RA R+ D  +GW FSWDE+SLLLQLKDGLG+D +EVIYVGCLKEEI  PN
Sbjct  56   IIIVANQLPIRAQRKADDSKGWIFSWDENSLLLQLKDGLGDDEIEVIYVGCLKEEI-HPN  114

Query  434  EQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLW  613
            EQD+V+Q LLETFKCVP F+PP+LFS++YHGFCKQQLWPLFHYMLPLSPDLGGRF+R+LW
Sbjct  115  EQDEVSQILLETFKCVPTFLPPDLFSRYYHGFCKQQLWPLFHYMLPLSPDLGGRFNRSLW  174

Query  614  QA  619
            QA
Sbjct  175  QA  176



>ref|XP_009595830.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Nicotiana tomentosiformis]
Length=856

 Score =   268 bits (685),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 160/185 (86%), Gaps = 5/185 (3%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGE--SLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  250
            MVSRSYSNLL+LASGE  S +FGR  +++ R+ TVAG++S+LDD+   +  SD  SS +Q
Sbjct  1    MVSRSYSNLLELASGEAPSPSFGRMSRRIPRIMTVAGIMSDLDDDGSESVCSDPSSSSAQ  60

Query  251  -ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEII  424
             +R+IIVGNQLP+R  R+TDG +GW FSWDE+SLLLQLKDGLG+D +EVIYVGCLKEEI 
Sbjct  61   KDRIIIVGNQLPIRVQRKTDGSKGWLFSWDENSLLLQLKDGLGDDELEVIYVGCLKEEI-  119

Query  425  DPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDR  604
             PNEQD+V+Q LLETFKCVP FVPP+LF+KFYHGFCKQQLWPLFHYMLPLSPDLGGRF+R
Sbjct  120  HPNEQDEVSQILLETFKCVPTFVPPDLFTKFYHGFCKQQLWPLFHYMLPLSPDLGGRFNR  179

Query  605  NLWQA  619
            +LWQA
Sbjct  180  SLWQA  184



>ref|XP_009351564.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Pyrus x bretschneideri]
 ref|XP_009351565.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Pyrus x bretschneideri]
Length=848

 Score =   268 bits (684),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 155/182 (85%), Gaps = 7/182 (4%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVS+SYSNLL+LASGE  +FGR G+++ RV  VAGV+S++DDE     G    SS  ++R
Sbjct  1    MVSKSYSNLLELASGEGDSFGRIGRRIPRVMNVAGVMSDVDDE-----GYTSSSSSQRDR  55

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEIIDPN  433
            +IIV NQLP++A R+TD  +GW FSWDE+SLLLQLKDGLG+D +EVIYVGCLKEEI  PN
Sbjct  56   IIIVANQLPIKAQRKTDDSKGWIFSWDENSLLLQLKDGLGDDEIEVIYVGCLKEEI-HPN  114

Query  434  EQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLW  613
            EQD+V+Q LLETFKCVP F+PP+LFS++YHGFCKQQLWPLFHYMLPLSPDLGGRF+R+LW
Sbjct  115  EQDEVSQFLLETFKCVPTFLPPDLFSRYYHGFCKQQLWPLFHYMLPLSPDLGGRFNRSLW  174

Query  614  QA  619
            QA
Sbjct  175  QA  176



>ref|XP_011021750.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 isoform X1 [Populus euphratica]
Length=854

 Score =   267 bits (683),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 128/183 (70%), Positives = 157/183 (86%), Gaps = 3/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSISQE  253
            MVSRSYSNLL+LASGES +FGR  +++ R+ TVAG++S++DD+ S S       SSI ++
Sbjct  1    MVSRSYSNLLELASGESPSFGRMSRRIPRIMTVAGIMSDIDDDPSESVCSDPSSSSIPKD  60

Query  254  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEIIDP  430
            R+IIV NQLP+RA R++DG + W FSWDE+SLLLQLKDGLG+D +EVIYVGCLKEE+  P
Sbjct  61   RIIIVANQLPIRAQRKSDGSKSWIFSWDENSLLLQLKDGLGDDEIEVIYVGCLKEEV-HP  119

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
            NEQD+V Q LLETFKCVP F+PP+LFS++YHGFCKQQLWPLFHYMLPLSPDLGGRF+R+L
Sbjct  120  NEQDEVYQILLETFKCVPTFLPPDLFSRYYHGFCKQQLWPLFHYMLPLSPDLGGRFNRSL  179

Query  611  WQA  619
            WQA
Sbjct  180  WQA  182



>ref|XP_006414189.1| hypothetical protein EUTSA_v10024381mg [Eutrema salsugineum]
 gb|ESQ55642.1| hypothetical protein EUTSA_v10024381mg [Eutrema salsugineum]
Length=862

 Score =   266 bits (681),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 153/182 (84%), Gaps = 4/182 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNG-GSDVPSSISQE  253
            MVSRSYSNLLDLASG   +F R  K+  RV+TV GVLSELDD++ SN   SD PSS++Q+
Sbjct  1    MVSRSYSNLLDLASGNFHSFSREKKRFPRVSTVTGVLSELDDDNNSNSVCSDAPSSVTQD  60

Query  254  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPN  433
            R+IIVGNQLP+++HR + G+    FSWD DSLLLQLKDG+ ED+EV+Y+GCLKE+I D  
Sbjct  61   RIIIVGNQLPIKSHRNSAGK--LIFSWDNDSLLLQLKDGMREDMEVVYIGCLKEQI-DVV  117

Query  434  EQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLW  613
            EQDDV+Q LLE FKCVPA++ PELFSK+YHGFCKQ LWPLFHYMLPL+PDLGGRFDR+LW
Sbjct  118  EQDDVSQRLLENFKCVPAYISPELFSKYYHGFCKQHLWPLFHYMLPLTPDLGGRFDRSLW  177

Query  614  QA  619
            QA
Sbjct  178  QA  179



>ref|XP_011021751.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 isoform X2 [Populus euphratica]
Length=832

 Score =   266 bits (680),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 128/183 (70%), Positives = 157/183 (86%), Gaps = 3/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSISQE  253
            MVSRSYSNLL+LASGES +FGR  +++ R+ TVAG++S++DD+ S S       SSI ++
Sbjct  1    MVSRSYSNLLELASGESPSFGRMSRRIPRIMTVAGIMSDIDDDPSESVCSDPSSSSIPKD  60

Query  254  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEIIDP  430
            R+IIV NQLP+RA R++DG + W FSWDE+SLLLQLKDGLG+D +EVIYVGCLKEE+  P
Sbjct  61   RIIIVANQLPIRAQRKSDGSKSWIFSWDENSLLLQLKDGLGDDEIEVIYVGCLKEEV-HP  119

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
            NEQD+V Q LLETFKCVP F+PP+LFS++YHGFCKQQLWPLFHYMLPLSPDLGGRF+R+L
Sbjct  120  NEQDEVYQILLETFKCVPTFLPPDLFSRYYHGFCKQQLWPLFHYMLPLSPDLGGRFNRSL  179

Query  611  WQA  619
            WQA
Sbjct  180  WQA  182



>ref|XP_010271238.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Nelumbo nucifera]
 ref|XP_010271239.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Nelumbo nucifera]
Length=853

 Score =   266 bits (681),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 157/182 (86%), Gaps = 3/182 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLL+LASGES +FGR  +++ R+ TVAG++S+LDD+   +  SD  SS  +ER
Sbjct  1    MVSRSYSNLLELASGESPSFGRMSRRIPRIMTVAGIISDLDDDPADSVSSDPSSSAPRER  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLG-EDVEVIYVGCLKEEIIDPN  433
            +IIV NQLP+RAH++ D + GW FSWD+DSLLLQLKDGLG EDVEVIYVGCLKEEI  P+
Sbjct  61   IIIVANQLPIRAHKKPDNK-GWTFSWDDDSLLLQLKDGLGDEDVEVIYVGCLKEEI-HPS  118

Query  434  EQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLW  613
            EQ+DV+Q LLETFKCVP F+PP+LFS++YH FCKQQLWPLFHYMLPLSPDLGGRFDR+LW
Sbjct  119  EQEDVSQILLETFKCVPTFLPPDLFSRYYHRFCKQQLWPLFHYMLPLSPDLGGRFDRSLW  178

Query  614  QA  619
            QA
Sbjct  179  QA  180



>ref|XP_002314777.2| hypothetical protein POPTR_0010s11510g [Populus trichocarpa]
 gb|EEF00948.2| hypothetical protein POPTR_0010s11510g [Populus trichocarpa]
Length=854

 Score =   266 bits (681),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 127/183 (69%), Positives = 157/183 (86%), Gaps = 3/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSISQE  253
            MVSRSYSNLL+LASGES +FGR  +++ R+ TVAG++S++DD+ S S       SS  ++
Sbjct  1    MVSRSYSNLLELASGESPSFGRMSRRIPRIMTVAGIMSDIDDDPSESVCSDPSSSSTPKD  60

Query  254  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEIIDP  430
            R+IIV NQLP+RA R++DG + W FSWDE+SLLLQLKDGLG+D +EVIYVGCLKEE+  P
Sbjct  61   RIIIVANQLPIRAQRKSDGSKSWIFSWDENSLLLQLKDGLGDDEIEVIYVGCLKEEV-HP  119

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
            NEQD+V+Q LLETFKCVP F+PP+LFS++YHGFCKQQLWPLFHYMLPLSPDLGGRF+R+L
Sbjct  120  NEQDEVSQILLETFKCVPTFLPPDLFSRYYHGFCKQQLWPLFHYMLPLSPDLGGRFNRSL  179

Query  611  WQA  619
            WQA
Sbjct  180  WQA  182



>ref|XP_007142959.1| hypothetical protein PHAVU_007G031800g [Phaseolus vulgaris]
 ref|XP_007142960.1| hypothetical protein PHAVU_007G031800g [Phaseolus vulgaris]
 gb|ESW14953.1| hypothetical protein PHAVU_007G031800g [Phaseolus vulgaris]
 gb|ESW14954.1| hypothetical protein PHAVU_007G031800g [Phaseolus vulgaris]
Length=853

 Score =   266 bits (680),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 158/181 (87%), Gaps = 3/181 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M SRSYSNLLDL S  S +FGR  K+L RVATVAGVLSELDDES ++ GSD PSS+SQER
Sbjct  1    MASRSYSNLLDLTSCGSPSFGREKKRLPRVATVAGVLSELDDESSNSVGSDTPSSVSQER  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIVGNQLPL+A R+ +G   W F+WDEDSLLLQL+D LG+DVE IY+GCLKEEI +P+E
Sbjct  61   MIIVGNQLPLKARRKDNG--SWEFTWDEDSLLLQLQDDLGDDVETIYIGCLKEEI-EPSE  117

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDVAQ LL+TFKCVP F+PPELFSKFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR+LWQ
Sbjct  118  QDDVAQYLLDTFKCVPTFLPPELFSKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRSLWQ  177

Query  617  A  619
            A
Sbjct  178  A  178



>ref|XP_006378432.1| hypothetical protein POPTR_0010s11510g [Populus trichocarpa]
 gb|ERP56229.1| hypothetical protein POPTR_0010s11510g [Populus trichocarpa]
Length=815

 Score =   265 bits (678),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 127/183 (69%), Positives = 157/183 (86%), Gaps = 3/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSISQE  253
            MVSRSYSNLL+LASGES +FGR  +++ R+ TVAG++S++DD+ S S       SS  ++
Sbjct  1    MVSRSYSNLLELASGESPSFGRMSRRIPRIMTVAGIMSDIDDDPSESVCSDPSSSSTPKD  60

Query  254  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEIIDP  430
            R+IIV NQLP+RA R++DG + W FSWDE+SLLLQLKDGLG+D +EVIYVGCLKEE+  P
Sbjct  61   RIIIVANQLPIRAQRKSDGSKSWIFSWDENSLLLQLKDGLGDDEIEVIYVGCLKEEV-HP  119

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
            NEQD+V+Q LLETFKCVP F+PP+LFS++YHGFCKQQLWPLFHYMLPLSPDLGGRF+R+L
Sbjct  120  NEQDEVSQILLETFKCVPTFLPPDLFSRYYHGFCKQQLWPLFHYMLPLSPDLGGRFNRSL  179

Query  611  WQA  619
            WQA
Sbjct  180  WQA  182



>ref|XP_008220922.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Prunus mume]
Length=855

 Score =   266 bits (680),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 158/184 (86%), Gaps = 4/184 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSD--VPSSISQ  250
            MVS+SYSNLL+L SGE+ +FGR G+++ R+ TVA ++S++DD+   +  S+    SS+ +
Sbjct  1    MVSKSYSNLLELTSGEAPSFGRIGRRIPRIMTVASLISDVDDDPSESACSEDMSSSSVQR  60

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEIID  427
            +R+IIV NQLP+RA R++D  +GW F+WDE+SLLLQLKDGLG+D +EVIYVGCLKEEI  
Sbjct  61   DRIIIVANQLPIRAQRKSDTSKGWIFNWDENSLLLQLKDGLGDDEIEVIYVGCLKEEI-H  119

Query  428  PNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRN  607
            PNEQD+V+Q LLETFKCVP F+PP+LFS++YHGFCKQQLWPLFHYMLPLSPDLGGRF+R+
Sbjct  120  PNEQDEVSQILLETFKCVPTFLPPDLFSRYYHGFCKQQLWPLFHYMLPLSPDLGGRFNRS  179

Query  608  LWQA  619
            LWQA
Sbjct  180  LWQA  183



>gb|KDP38139.1| hypothetical protein JCGZ_04782 [Jatropha curcas]
Length=855

 Score =   265 bits (677),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 158/183 (86%), Gaps = 3/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSISQE  253
            MVSRSYSNLL+LASGES +FGR  +++ R+ TVAG++S+LDD+ S S       SS+ ++
Sbjct  1    MVSRSYSNLLELASGESPSFGRMSRRIPRIMTVAGIISDLDDDPSESVCSDPSSSSVQKD  60

Query  254  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEIIDP  430
            R+IIV NQLP+RA R++DG + W F+WDE+SLLLQLKDGLG+D +EVIYVGCL+EEI  P
Sbjct  61   RIIIVANQLPIRAQRKSDGSKSWIFTWDENSLLLQLKDGLGDDEIEVIYVGCLREEI-HP  119

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
            +EQD+V+Q LLETFKCVP F+PP+LFS++YHGFCKQQLWPLFHYMLPLSPDLGGRF+R+L
Sbjct  120  SEQDEVSQILLETFKCVPTFLPPDLFSRYYHGFCKQQLWPLFHYMLPLSPDLGGRFNRSL  179

Query  611  WQA  619
            WQA
Sbjct  180  WQA  182



>ref|XP_010518663.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Tarenaya hassleriana]
 ref|XP_010518664.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Tarenaya hassleriana]
Length=848

 Score =   265 bits (676),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 149/181 (82%), Gaps = 3/181 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M SRSYSNLLDLASG S T  R  K+  RVATV GVLSELD+E  +   SD PSS+ QER
Sbjct  1    MASRSYSNLLDLASGGSPTISREKKRFPRVATVPGVLSELDNEIGNGADSDAPSSVLQER  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            +IIVGNQLP++A + +DG+  WNFSWD +SLL+QLKDG+ EDVEVIY+GCLK EI +P +
Sbjct  61   LIIVGNQLPIKAQQNSDGK--WNFSWDNNSLLVQLKDGVREDVEVIYIGCLKAEI-EPID  117

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDVAQ LLE FKCVPA+VPP+LF+K+YHGFCKQ LWPLFHYMLP+ PD G +FDR+LWQ
Sbjct  118  QDDVAQRLLENFKCVPAYVPPDLFAKYYHGFCKQSLWPLFHYMLPIVPDYGIKFDRSLWQ  177

Query  617  A  619
            A
Sbjct  178  A  178



>ref|XP_004228746.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Solanum lycopersicum]
 ref|XP_010316481.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Solanum lycopersicum]
Length=857

 Score =   265 bits (676),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 158/185 (85%), Gaps = 5/185 (3%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGE--SLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  250
            MVSRSYSNLL+LASGE  S +FGR  +++ RV TVAG++S+LDD+   +  SD  SS +Q
Sbjct  1    MVSRSYSNLLELASGEAPSPSFGRMSRRIPRVMTVAGIMSDLDDDGSESVCSDPSSSSAQ  60

Query  251  -ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEII  424
             +R+I+V NQLP+R  R+TDG +GW FSWDE+SLLLQLKDGLG+D +EVIYVGCLKEEI 
Sbjct  61   KDRIIVVANQLPIRVQRKTDGSKGWLFSWDENSLLLQLKDGLGDDEIEVIYVGCLKEEI-  119

Query  425  DPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDR  604
             PNEQD+V+Q LLETFKCVP FVPP+LF+K+YHGFCKQQLWPLFHYMLPLSPDLGGRF+R
Sbjct  120  HPNEQDEVSQILLETFKCVPTFVPPDLFTKYYHGFCKQQLWPLFHYMLPLSPDLGGRFNR  179

Query  605  NLWQA  619
             LWQA
Sbjct  180  LLWQA  184



>ref|XP_009778367.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Nicotiana sylvestris]
Length=856

 Score =   264 bits (675),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 158/185 (85%), Gaps = 5/185 (3%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGE--SLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  250
            MVSRSYSNLL+LASGE  S +FGR  +++ R+ TVAG++S+LDD+   +  SD  SS +Q
Sbjct  1    MVSRSYSNLLELASGEAPSPSFGRMSRRIPRIMTVAGIMSDLDDDGSESVCSDPSSSSAQ  60

Query  251  -ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEII  424
             +R+IIV NQLP+R  R+ DG +GW FSWDE+SLLLQLKDGLG+D +EVIYVGCLKEEI 
Sbjct  61   KDRIIIVANQLPIRVQRKNDGSKGWLFSWDENSLLLQLKDGLGDDELEVIYVGCLKEEI-  119

Query  425  DPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDR  604
             PNEQD+V+Q LLETFKCVP FVPP+LF+KFYHGFCKQQLWPLFHYMLPLSPDLGGRF+R
Sbjct  120  HPNEQDEVSQILLETFKCVPTFVPPDLFTKFYHGFCKQQLWPLFHYMLPLSPDLGGRFNR  179

Query  605  NLWQA  619
            +LWQA
Sbjct  180  SLWQA  184



>ref|XP_006364054.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Solanum tuberosum]
Length=857

 Score =   264 bits (674),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 158/185 (85%), Gaps = 5/185 (3%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGE--SLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  250
            MVSRSYSNLL+LASGE  S +FGR  +++ R+ TVAG++S+LDD+   +  SD  SS +Q
Sbjct  1    MVSRSYSNLLELASGEAPSPSFGRMSQRIPRIMTVAGIMSDLDDDGSESVCSDPSSSSAQ  60

Query  251  -ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEII  424
             +R+I+V NQLP+R  R+TDG +GW FSWDE+SLLLQLKDGLG+D +EVIYVGCLKEEI 
Sbjct  61   KDRIIVVANQLPIRVQRKTDGSKGWLFSWDENSLLLQLKDGLGDDEIEVIYVGCLKEEI-  119

Query  425  DPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDR  604
             PNEQD+V+Q LLETFKCVP FVPP+LF+K+YHGFCKQQLWPLFHYMLPLSPDLGGRF+R
Sbjct  120  HPNEQDEVSQILLETFKCVPTFVPPDLFTKYYHGFCKQQLWPLFHYMLPLSPDLGGRFNR  179

Query  605  NLWQA  619
             LWQA
Sbjct  180  LLWQA  184



>ref|XP_010650494.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Vitis vinifera]
 emb|CAN76185.1| hypothetical protein VITISV_023086 [Vitis vinifera]
Length=854

 Score =   262 bits (669),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 156/183 (85%), Gaps = 3/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSISQE  253
            MVSRSYSNLL+LASGES +FGR  +++ R+ TVAG++S+LDD+ S S       SS+ ++
Sbjct  1    MVSRSYSNLLELASGESPSFGRMSRRIPRIMTVAGIISDLDDDPSESVCSDPSSSSVQRD  60

Query  254  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEIIDP  430
            R+IIV NQLP+RA R+++   GW FSWDE+SLLLQLKDGLG+D +EVIYVGCLKEEI  P
Sbjct  61   RLIIVANQLPIRAQRKSENNNGWIFSWDENSLLLQLKDGLGDDEIEVIYVGCLKEEI-HP  119

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
             EQD+V+Q LLETFKCVP F+PP+LF+++YHGFCKQQLWPLFHYMLPLSPDLGGRF+R+L
Sbjct  120  CEQDEVSQILLETFKCVPTFLPPDLFTRYYHGFCKQQLWPLFHYMLPLSPDLGGRFNRSL  179

Query  611  WQA  619
            WQA
Sbjct  180  WQA  182



>ref|XP_004503340.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Cicer arietinum]
Length=854

 Score =   261 bits (666),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 155/184 (84%), Gaps = 4/184 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDES--RSNGGSDVPSSISQ  250
            MVSRSYSNLL+LASGES +F    +++ R+ TVAG++S++DD+    S       SS+ +
Sbjct  1    MVSRSYSNLLELASGESPSFEHMNRRIPRIMTVAGLISDVDDDDPLESICSDPSSSSVQR  60

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEIID  427
            ER+IIV NQLP++AHR+ DG + W FSWDE+SLLLQLKDGLG+D VEVIYVGCLKE++  
Sbjct  61   ERIIIVANQLPIKAHRKQDGNKNWFFSWDENSLLLQLKDGLGDDDVEVIYVGCLKEDV-H  119

Query  428  PNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRN  607
            PNEQD+V+Q LLETFKCVP F+PPELF+++YHGFCKQQLWPLFHYMLPLSPDLGGRF+R+
Sbjct  120  PNEQDEVSQILLETFKCVPTFLPPELFTRYYHGFCKQQLWPLFHYMLPLSPDLGGRFNRS  179

Query  608  LWQA  619
            LWQA
Sbjct  180  LWQA  183



>ref|XP_011463160.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Fragaria vesca subsp. vesca]
Length=855

 Score =   259 bits (663),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 159/184 (86%), Gaps = 4/184 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESL-TFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ-  250
            MVS+SYSNLL+LASGES  TFGR G+++ R+ TVAG++S++DD+   +  S+V SS  Q 
Sbjct  1    MVSKSYSNLLELASGESSPTFGRIGRRMPRIMTVAGLISDVDDDKPESVCSEVSSSSVQR  60

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEIID  427
            +R+IIV NQLP+RA R++D  +GW FSWDE+SLLLQLKDGLG+D +EVIYVGCLKEEI  
Sbjct  61   DRIIIVANQLPIRAQRKSDTSKGWIFSWDENSLLLQLKDGLGDDEIEVIYVGCLKEEI-H  119

Query  428  PNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRN  607
            PNEQ++V+Q LLETFKCVP F+PPELFS++YHGFCKQQLWPLFHYMLPLSPD GGRF+R+
Sbjct  120  PNEQEEVSQILLETFKCVPTFLPPELFSRYYHGFCKQQLWPLFHYMLPLSPDHGGRFNRS  179

Query  608  LWQA  619
            LWQA
Sbjct  180  LWQA  183



>ref|XP_010043976.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Eucalyptus grandis]
 gb|KCW85984.1| hypothetical protein EUGRSUZ_B02686 [Eucalyptus grandis]
Length=856

 Score =   258 bits (658),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 156/185 (84%), Gaps = 5/185 (3%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSS--ISQ  250
            MVSRSYSNLL+LASGES +F R  +++ R+ TV G++S++DD++RS G    PSS    +
Sbjct  1    MVSRSYSNLLELASGESPSFSRMSRRIPRIMTVPGIISDVDDDNRSEGSCSDPSSSTTQR  60

Query  251  ERMIIVGNQLPLRAHRRTDGE-EGWNFSWDEDSLLLQLKDGLGE-DVEVIYVGCLKEEII  424
            +R+IIV NQLP+RA R++DG  +GW F+WDE+SLLLQLKDGLG+ D E IYVGCLK++I 
Sbjct  61   DRIIIVANQLPIRAQRKSDGNGKGWIFNWDENSLLLQLKDGLGDNDTEFIYVGCLKDDI-  119

Query  425  DPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDR  604
             P+EQD+V+Q LLETF+CVP F+P +LF+++YHGFCKQQLWPLFHYMLPLSPDLGGRF+R
Sbjct  120  HPSEQDEVSQILLETFRCVPTFLPSDLFTRYYHGFCKQQLWPLFHYMLPLSPDLGGRFNR  179

Query  605  NLWQA  619
            +LWQA
Sbjct  180  SLWQA  184



>ref|XP_010242150.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Nelumbo nucifera]
 ref|XP_010242151.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Nelumbo nucifera]
Length=848

 Score =   256 bits (655),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 148/181 (82%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M+SRSY+NLLDLASG     GR  K+L RV TV G++SELDD+  ++  SDVPSSI Q+R
Sbjct  1    MLSRSYTNLLDLASGNFPALGREKKRLPRVMTVPGIVSELDDDQANSVSSDVPSSIIQDR  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            +IIV NQLP++A RR D   GW+FSWDEDSLLLQLKDGL ED+EV+YVG L+ ++ D NE
Sbjct  61   IIIVANQLPVKAKRRPDNN-GWSFSWDEDSLLLQLKDGLPEDMEVLYVGSLRADV-DVNE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDV+Q LLE FKCVPAF+PP++ SK+YHGFCKQ LWPLFHYMLP S + GGRFDR+LW+
Sbjct  119  QDDVSQILLERFKCVPAFLPPDVLSKYYHGFCKQHLWPLFHYMLPFSSEHGGRFDRSLWE  178

Query  617  A  619
            A
Sbjct  179  A  179



>ref|XP_002312472.1| hypothetical protein POPTR_0008s13590g [Populus trichocarpa]
 gb|EEE89839.1| hypothetical protein POPTR_0008s13590g [Populus trichocarpa]
Length=851

 Score =   255 bits (652),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 155/183 (85%), Gaps = 3/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSISQE  253
            MVSRSYSNLL+LASGES +F R  +++ R+ TVAG++S++DD+ S S       SS+   
Sbjct  1    MVSRSYSNLLELASGESPSFERMNRRIPRIMTVAGIMSDIDDDPSESVCSDPSSSSVQMC  60

Query  254  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEIIDP  430
            R+IIV NQLP+RA R++DG + W F+WDE+SLLLQLKDGLG+D +EVIYVGCLKEE+   
Sbjct  61   RIIIVANQLPIRAQRKSDGSKSWIFNWDENSLLLQLKDGLGDDEIEVIYVGCLKEEV-HL  119

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
            +EQ++V+QTLLETFKCVP F+PP+LFS++YHGFCKQQLWPLFHYMLPLSPDLGGRF+R+L
Sbjct  120  SEQEEVSQTLLETFKCVPTFLPPDLFSRYYHGFCKQQLWPLFHYMLPLSPDLGGRFNRSL  179

Query  611  WQA  619
            WQA
Sbjct  180  WQA  182



>ref|XP_004293972.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Fragaria vesca subsp. vesca]
Length=856

 Score =   254 bits (648),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 148/181 (82%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M+S+SY+NLLDLASG     GR  K+L RV TVAGV+SELDD++ ++  SDVPSSI Q+R
Sbjct  1    MMSKSYTNLLDLASGNFPIMGRERKRLPRVMTVAGVISELDDDNANSVSSDVPSSIVQDR  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            +IIV NQLP++A RR D + GW+FSWDEDSLLLQLKDGL ED+EV+YVG L  E+ D NE
Sbjct  61   IIIVANQLPVKAKRRPDNK-GWSFSWDEDSLLLQLKDGLPEDMEVLYVGSLNVEV-DSNE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDV+Q LL+ FKCVPAF+P ++ +KFYHGFCKQ LWPLFHYMLP S + GGRFDR LW+
Sbjct  119  QDDVSQLLLDRFKCVPAFLPADILAKFYHGFCKQHLWPLFHYMLPFSANHGGRFDRTLWE  178

Query  617  A  619
            A
Sbjct  179  A  179



>ref|XP_011024382.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Populus euphratica]
 ref|XP_011024390.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Populus euphratica]
 ref|XP_011024395.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Populus euphratica]
Length=854

 Score =   253 bits (647),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 124/183 (68%), Positives = 155/183 (85%), Gaps = 3/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQE-  253
            MVSRSYSNLL+LASGES +F R  +++ R+ TVAG++S++DD+   +  SD  SS  Q  
Sbjct  1    MVSRSYSNLLELASGESPSFERMNRRIPRIMTVAGIMSDIDDDPSESVCSDPSSSSGQMY  60

Query  254  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEIIDP  430
            R+IIV NQLP+RA R++DG + W FSWDE+SLLLQLKDGLG+D +EVIYVGCLKEE+   
Sbjct  61   RIIIVANQLPIRAQRKSDGSKSWIFSWDENSLLLQLKDGLGDDEIEVIYVGCLKEEV-HL  119

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
            +EQ++V+Q LLETFKCVP F+PP+LFS++YHGFCKQQLWPLFHYMLPLSPDLGGRF+R+L
Sbjct  120  SEQEEVSQILLETFKCVPTFLPPDLFSRYYHGFCKQQLWPLFHYMLPLSPDLGGRFNRSL  179

Query  611  WQA  619
            WQA
Sbjct  180  WQA  182



>gb|AHL29280.1| trehalose-phosphate synthase 6 [Camellia sinensis]
Length=856

 Score =   253 bits (645),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 123/185 (66%), Positives = 156/185 (84%), Gaps = 5/185 (3%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESL--TFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSIS  247
            MVSRSYSNLL+LASGES   +F R G+++ R+ TVAG++S+LDD+ S S       SS+ 
Sbjct  1    MVSRSYSNLLELASGESPVPSFSRMGRRIPRIMTVAGIMSDLDDDPSESVCSDRSSSSVH  60

Query  248  QERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEII  424
            ++R+IIV NQLP+R  R+T+  +GW F+WDE+SLLLQLKDGLG+D ++VIYVGCLKEEI 
Sbjct  61   RDRIIIVANQLPIRVQRKTENGKGWIFTWDENSLLLQLKDGLGDDEIDVIYVGCLKEEI-  119

Query  425  DPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDR  604
             PNEQD+V+Q LLETFKCVP F+P +LF+++YHGFCKQQLWPLFHYMLPLSP+LGGRF+R
Sbjct  120  HPNEQDEVSQILLETFKCVPTFLPSDLFTRYYHGFCKQQLWPLFHYMLPLSPELGGRFNR  179

Query  605  NLWQA  619
            +LWQA
Sbjct  180  SLWQA  184



>ref|XP_008383601.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Malus domestica]
Length=854

 Score =   251 bits (642),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 146/181 (81%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M+S+SY+NLLDLASG     GR  ++L RV TVAGV+SELDD+   +  SDVPSSI Q+R
Sbjct  1    MMSKSYTNLLDLASGNFPVMGRERRRLPRVMTVAGVISELDDDQAGSVSSDVPSSIIQDR  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            +IIV NQLP++A RR D + GW+FSWDEDSL+LQLKDGL ED+EV+YVG L  E+ D NE
Sbjct  61   IIIVANQLPVKAKRRPDNK-GWSFSWDEDSLVLQLKDGLPEDMEVLYVGSLSVEV-DSNE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDV+  LL+ FKCVPAF+PP++ SKFYHGFCKQ LWPLFHYMLP S   GGRFDR+LW+
Sbjct  119  QDDVSALLLDRFKCVPAFLPPDILSKFYHGFCKQHLWPLFHYMLPFSATHGGRFDRSLWE  178

Query  617  A  619
            A
Sbjct  179  A  179



>ref|XP_010093315.1| Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Morus 
notabilis]
 gb|EXB53854.1| Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Morus 
notabilis]
Length=855

 Score =   251 bits (642),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 153/183 (84%), Gaps = 3/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELD-DESRSNGGSDVPSSISQE  253
            MVS+SYSNLL+LASGE  +FGR   ++ R+ TV+G++SE+D D S S       SSI ++
Sbjct  1    MVSKSYSNLLELASGEPPSFGRISGRIPRLMTVSGLISEIDEDPSESVCSDWSSSSIHRD  60

Query  254  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEIIDP  430
            R+I+V NQLP+RA RR D  +GW F+WD+ SLLLQ+KDGLG+D VEVIYVGCLKEEI  P
Sbjct  61   RIIMVANQLPIRAQRRLDCSKGWLFNWDDTSLLLQMKDGLGDDEVEVIYVGCLKEEI-HP  119

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
            +EQD+V+Q LLE+F+CVP FVPP+LFS++YHGFCKQQLWPLFHYMLPLSPDLGGRF+R+L
Sbjct  120  SEQDEVSQILLESFRCVPTFVPPDLFSRYYHGFCKQQLWPLFHYMLPLSPDLGGRFNRSL  179

Query  611  WQA  619
            WQA
Sbjct  180  WQA  182



>gb|KDP21135.1| hypothetical protein JCGZ_21606 [Jatropha curcas]
Length=857

 Score =   251 bits (642),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 149/183 (81%), Gaps = 4/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  250
            M+SRSY+NLLDLASG     G  R  K+L RV TV GV+SELDD+  ++  SDVPSS+ Q
Sbjct  1    MMSRSYTNLLDLASGNFPAMGQPREKKRLPRVMTVPGVISELDDDQANSVASDVPSSVVQ  60

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  430
            +R+IIV NQLP++A RR D + GW+FSWDED+LLLQLKDGL ED+EVIYVG LK E+ D 
Sbjct  61   DRIIIVANQLPVKAKRRPDNK-GWSFSWDEDALLLQLKDGLPEDMEVIYVGSLKVEV-DL  118

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
            +EQDDV+Q LL+ FKCVPAF+PP++ SKFYHGFCKQ LWPLFHYMLP S + GGRFDR+L
Sbjct  119  SEQDDVSQLLLDRFKCVPAFLPPDILSKFYHGFCKQHLWPLFHYMLPFSANHGGRFDRSL  178

Query  611  WQA  619
            W+A
Sbjct  179  WEA  181



>gb|KJB30628.1| hypothetical protein B456_005G152400 [Gossypium raimondii]
Length=681

 Score =   248 bits (634),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 121/196 (62%), Positives = 155/196 (79%), Gaps = 16/196 (8%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSISQE  253
            MVSRSYSNLL+LASGE+ + GR  +++ R+ TV G++S++DD+ S S       SS  ++
Sbjct  1    MVSRSYSNLLELASGEAPSLGRISRRIPRIMTVPGIISDIDDDPSESVCSDPSSSSSQKD  60

Query  254  RMIIVGNQLPLRAHRRTDGEEG-------------WNFSWDEDSLLLQLKDGLGED-VEV  391
            R+I+V NQLP+RAHR++D  +              W FSWD++SLLLQ++DGLG+D VEV
Sbjct  61   RIIMVANQLPIRAHRKSDNNKNGSSSCSTTTTSNNWIFSWDDNSLLLQMRDGLGDDDVEV  120

Query  392  IYVGCLKEEIIDPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLP  571
            IY+GCLKEEI  PNEQD+V+Q LLETFKCVP F+PP+LFS++YHGFCKQQLWPLFHYMLP
Sbjct  121  IYIGCLKEEI-HPNEQDEVSQILLETFKCVPTFLPPDLFSRYYHGFCKQQLWPLFHYMLP  179

Query  572  LSPDLGGRFDRNLWQA  619
            LSPDLGGRF+R+LWQA
Sbjct  180  LSPDLGGRFNRSLWQA  195



>ref|XP_007214619.1| hypothetical protein PRUPE_ppa001324mg [Prunus persica]
 gb|EMJ15818.1| hypothetical protein PRUPE_ppa001324mg [Prunus persica]
Length=854

 Score =   251 bits (641),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 148/181 (82%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M+S+SY+NLLDLASG     GR  ++L RV TVAGV+SELDD+  ++  SDVPSSI Q+R
Sbjct  1    MMSKSYTNLLDLASGNFPIMGRERRRLPRVMTVAGVISELDDDQANSVSSDVPSSIMQDR  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            +IIV NQLP++A RR D + GW+FSWDEDSLLLQLKDGL E++EV+YVG L  E+ D NE
Sbjct  61   IIIVANQLPVKAKRRPDNK-GWSFSWDEDSLLLQLKDGLPEEMEVLYVGSLNVEV-DSNE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDV+Q LL+ FKCVPAF+P ++ SKFYHGFCKQ LWPLFHYMLP S + GGRFDR+LW+
Sbjct  119  QDDVSQLLLDRFKCVPAFLPHDILSKFYHGFCKQHLWPLFHYMLPFSANHGGRFDRSLWE  178

Query  617  A  619
            A
Sbjct  179  A  179



>gb|AAG52003.1|AC012563_13 putative trehalose-6-phosphate synthase; 46897-44149 [Arabidopsis 
thaliana]
Length=847

 Score =   250 bits (639),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 149/182 (82%), Gaps = 9/182 (5%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLL+LASG+S TFGR  +++ R+  VAG++S +D++S+    S       ++R
Sbjct  1    MVSRSYSNLLELASGDSPTFGRMNRQIPRIMAVAGIMSNIDNDSKDTDLS------PKDR  54

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLG-EDVEVIYVGCLKEEIIDPN  433
            +IIV N+LP+RA RR DG  GWNFSWDE+SLLLQLKDGLG E +EVIYVGCLKEEI   N
Sbjct  55   IIIVANELPIRAQRRVDGN-GWNFSWDENSLLLQLKDGLGDEAIEVIYVGCLKEEI-PLN  112

Query  434  EQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLW  613
            EQ++V Q LLE+FKCVP F+P +L++++YHGFCKQQLWPLFHYMLPLSPDLGGRFDR LW
Sbjct  113  EQEEVYQILLESFKCVPTFLPLDLYTRYYHGFCKQQLWPLFHYMLPLSPDLGGRFDRTLW  172

Query  614  QA  619
            QA
Sbjct  173  QA  174



>ref|XP_006391193.1| hypothetical protein EUTSA_v10018111mg [Eutrema salsugineum]
 gb|ESQ28479.1| hypothetical protein EUTSA_v10018111mg [Eutrema salsugineum]
Length=863

 Score =   250 bits (638),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 122/195 (63%), Positives = 155/195 (79%), Gaps = 19/195 (10%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSIS-QE  253
            MVSRSYSNLL+LASG+S TFGR  +++ R+  VAG++S +D++S+ +    VPS +S ++
Sbjct  1    MVSRSYSNLLELASGDSPTFGRMNRQIPRIMAVAGIMSNIDNDSKES----VPSDLSPKD  56

Query  254  RMIIVGNQLPLRAHRRTDGE------------EGWNFSWDEDSLLLQLKDGLG-EDVEVI  394
            R+IIV N+LP+RA R+ +              +GWNFSWDE+SLLLQLKDGLG E +EVI
Sbjct  57   RIIIVANELPIRAQRKLESNIGSTSTSSSCCSKGWNFSWDENSLLLQLKDGLGDEAIEVI  116

Query  395  YVGCLKEEIIDPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPL  574
            YVGCLKEEI  PNEQ++V Q LLE+FKCVP F+P +L++++YHGFCKQQLWPLFHYMLPL
Sbjct  117  YVGCLKEEI-HPNEQEEVYQILLESFKCVPTFLPLDLYTRYYHGFCKQQLWPLFHYMLPL  175

Query  575  SPDLGGRFDRNLWQA  619
            SPDLGGRFDR LWQA
Sbjct  176  SPDLGGRFDRTLWQA  190



>ref|XP_007045543.1| UDP-Glycosyltransferase / trehalose-phosphatase family protein 
isoform 3 [Theobroma cacao]
 gb|EOY01375.1| UDP-Glycosyltransferase / trehalose-phosphatase family protein 
isoform 3 [Theobroma cacao]
Length=777

 Score =   249 bits (635),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 157/191 (82%), Gaps = 11/191 (6%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSISQE  253
            MVSRSYSNLL+LASGE+ +FGR  +++ R+ TV G++S++DD+ S S       SS+ ++
Sbjct  1    MVSRSYSNLLELASGEAPSFGRMSRRIPRIMTVPGIISDIDDDPSESVCSDPSSSSVQRD  60

Query  254  RMIIVGNQLPLRAHRRTDGE--------EGWNFSWDEDSLLLQLKDGLGED-VEVIYVGC  406
            R+I+V NQLP+RA R++D          +GW FSWDE+SLLLQ+KDGLG+D +EVIYVGC
Sbjct  61   RIIMVANQLPIRAQRKSDSTNNGSSSSSKGWIFSWDENSLLLQMKDGLGDDDIEVIYVGC  120

Query  407  LKEEIIDPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDL  586
            LKEEI  PNEQD+V+Q LL+TF+CVP F+PP+LFS++YHGFCKQQLWPLFHYMLPLSPDL
Sbjct  121  LKEEI-HPNEQDEVSQILLDTFRCVPTFLPPDLFSRYYHGFCKQQLWPLFHYMLPLSPDL  179

Query  587  GGRFDRNLWQA  619
            GGRF+R+LWQA
Sbjct  180  GGRFNRSLWQA  190



>ref|XP_009351624.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Pyrus x bretschneideri]
Length=854

 Score =   249 bits (637),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 145/181 (80%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M+S+SY+NLLDLASG     GR  ++L RV TVAGV+SELDD+   +  SDVPSSI Q+R
Sbjct  1    MMSKSYTNLLDLASGNFPVMGRERRRLPRVMTVAGVISELDDDQAGSVSSDVPSSIVQDR  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            +IIV NQLP++A RR D + GW+FSWDEDSLLLQLKDGL ED+EV+YVG L  E+ D NE
Sbjct  61   IIIVANQLPVKAKRRPDNK-GWSFSWDEDSLLLQLKDGLPEDMEVLYVGSLSVEV-DSNE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDV+  LL+ FK VPAF+PP++ SKFYHGFCKQ LWPLFHYMLP S   GGRFDR+LW+
Sbjct  119  QDDVSALLLDKFKSVPAFLPPDILSKFYHGFCKQHLWPLFHYMLPFSATHGGRFDRSLWE  178

Query  617  A  619
            A
Sbjct  179  A  179



>ref|XP_010106616.1| putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
7 [Morus notabilis]
 gb|EXC10946.1| putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
7 [Morus notabilis]
Length=856

 Score =   249 bits (637),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 148/181 (82%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M+SRSY+NLLDLASG      R  K+L RV TV G++SELDD+  ++  SDVPSSI Q+R
Sbjct  1    MMSRSYTNLLDLASGNFPIMIREKKRLPRVMTVPGIISELDDDQANSVSSDVPSSIIQDR  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            +IIVGNQLP++A RR D + GW+FSWDEDSLLLQLK GL +D+EV+YVG L+ ++ D NE
Sbjct  61   IIIVGNQLPVKAKRRPDNK-GWSFSWDEDSLLLQLKSGLPDDMEVLYVGSLRVDV-DLNE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDV+Q LL+ FKCVPAF+PP++ SKFYHGFCKQ LWPLFHYMLP S + GGRFDR+LW+
Sbjct  119  QDDVSQLLLDRFKCVPAFLPPDILSKFYHGFCKQHLWPLFHYMLPYSANHGGRFDRSLWE  178

Query  617  A  619
            A
Sbjct  179  A  179



>ref|XP_002522255.1| trehalose-6-phosphate synthase, putative [Ricinus communis]
 gb|EEF40113.1| trehalose-6-phosphate synthase, putative [Ricinus communis]
Length=853

 Score =   249 bits (636),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 149/183 (81%), Gaps = 4/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  250
            M+SRSY+NLLDLASG     G  R  K+L RV TV GV+SELDD+  ++  SDVPSS+ Q
Sbjct  1    MMSRSYTNLLDLASGNFPVMGQPREKKRLPRVMTVPGVISELDDDQANSVASDVPSSLVQ  60

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  430
            +R+IIV NQLP++A RR D + GW+FSWD+DSLLLQLKDGL ED+EVIYVG L+ E+ D 
Sbjct  61   DRIIIVANQLPVKAKRRPDNK-GWSFSWDDDSLLLQLKDGLPEDMEVIYVGSLRVEV-DM  118

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
            +EQDDV+Q LL+ FKCVPAF+PP++ SKFYHGFCKQ LWPLFHYMLP S + GGRFDR+L
Sbjct  119  SEQDDVSQLLLDRFKCVPAFLPPDILSKFYHGFCKQHLWPLFHYMLPFSANHGGRFDRSL  178

Query  611  WQA  619
            W+A
Sbjct  179  WEA  181



>ref|XP_008371505.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Malus domestica]
Length=854

 Score =   249 bits (636),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 145/181 (80%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M+S+SY+NLLDLASG     GR  ++L RV TVAGV+SELDD+   +  SDVPSSI Q+R
Sbjct  1    MMSKSYTNLLDLASGNFPVMGRERRRLPRVMTVAGVISELDDDQAGSVSSDVPSSIVQDR  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            +IIV NQLP++A RR D + GW+FSWDEDSLLLQLKDGL ED+EV+YVG L  E+ D NE
Sbjct  61   IIIVANQLPVKAKRRPDNK-GWSFSWDEDSLLLQLKDGLPEDMEVLYVGSLSVEV-DSNE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDV+  LL+ FK VPAF+PP++ SKFYHGFCKQ LWPLFHYMLP S   GGRFDR+LW+
Sbjct  119  QDDVSALLLDRFKSVPAFLPPDILSKFYHGFCKQHLWPLFHYMLPFSATHGGRFDRSLWE  178

Query  617  A  619
            A
Sbjct  179  A  179



>ref|NP_564918.1| alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Arabidopsis 
thaliana]
 gb|AAK76702.1| putative trehalose-6-phosphate synthase [Arabidopsis thaliana]
 gb|AEE34737.1| alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Arabidopsis 
thaliana]
 gb|AHL38889.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=700

 Score =   247 bits (630),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 150/194 (77%), Gaps = 20/194 (10%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLL+LASG+S TFGR  +++ R+  VAG++S +D++S+    S       ++R
Sbjct  1    MVSRSYSNLLELASGDSPTFGRMNRQIPRIMAVAGIMSNIDNDSKDTDLS------PKDR  54

Query  257  MIIVGNQLPLRAHRRTDGE------------EGWNFSWDEDSLLLQLKDGLG-EDVEVIY  397
            +IIV N+LP+RA RR DG             +GWNFSWDE+SLLLQLKDGLG E +EVIY
Sbjct  55   IIIVANELPIRAQRRVDGNGSGSSSSSTCCSKGWNFSWDENSLLLQLKDGLGDEAIEVIY  114

Query  398  VGCLKEEIIDPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLS  577
            VGCLKEEI   NEQ++V Q LLE+FKCVP F+P +L++++YHGFCKQQLWPLFHYMLPLS
Sbjct  115  VGCLKEEI-PLNEQEEVYQILLESFKCVPTFLPLDLYTRYYHGFCKQQLWPLFHYMLPLS  173

Query  578  PDLGGRFDRNLWQA  619
            PDLGGRFDR LWQA
Sbjct  174  PDLGGRFDRTLWQA  187



>ref|XP_007045541.1| UDP-Glycosyltransferase / trehalose-phosphatase family protein 
isoform 1 [Theobroma cacao]
 ref|XP_007045542.1| UDP-Glycosyltransferase / trehalose-phosphatase family protein 
isoform 1 [Theobroma cacao]
 gb|EOY01373.1| UDP-Glycosyltransferase / trehalose-phosphatase family protein 
isoform 1 [Theobroma cacao]
 gb|EOY01374.1| UDP-Glycosyltransferase / trehalose-phosphatase family protein 
isoform 1 [Theobroma cacao]
Length=862

 Score =   249 bits (636),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 157/191 (82%), Gaps = 11/191 (6%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSISQE  253
            MVSRSYSNLL+LASGE+ +FGR  +++ R+ TV G++S++DD+ S S       SS+ ++
Sbjct  1    MVSRSYSNLLELASGEAPSFGRMSRRIPRIMTVPGIISDIDDDPSESVCSDPSSSSVQRD  60

Query  254  RMIIVGNQLPLRAHRRTDGE--------EGWNFSWDEDSLLLQLKDGLGED-VEVIYVGC  406
            R+I+V NQLP+RA R++D          +GW FSWDE+SLLLQ+KDGLG+D +EVIYVGC
Sbjct  61   RIIMVANQLPIRAQRKSDSTNNGSSSSSKGWIFSWDENSLLLQMKDGLGDDDIEVIYVGC  120

Query  407  LKEEIIDPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDL  586
            LKEEI  PNEQD+V+Q LL+TF+CVP F+PP+LFS++YHGFCKQQLWPLFHYMLPLSPDL
Sbjct  121  LKEEI-HPNEQDEVSQILLDTFRCVPTFLPPDLFSRYYHGFCKQQLWPLFHYMLPLSPDL  179

Query  587  GGRFDRNLWQA  619
            GGRF+R+LWQA
Sbjct  180  GGRFNRSLWQA  190



>gb|KJB30627.1| hypothetical protein B456_005G152400 [Gossypium raimondii]
Length=800

 Score =   248 bits (633),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/196 (62%), Positives = 155/196 (79%), Gaps = 16/196 (8%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSISQE  253
            MVSRSYSNLL+LASGE+ + GR  +++ R+ TV G++S++DD+ S S       SS  ++
Sbjct  1    MVSRSYSNLLELASGEAPSLGRISRRIPRIMTVPGIISDIDDDPSESVCSDPSSSSSQKD  60

Query  254  RMIIVGNQLPLRAHRRTDGEEG-------------WNFSWDEDSLLLQLKDGLGED-VEV  391
            R+I+V NQLP+RAHR++D  +              W FSWD++SLLLQ++DGLG+D VEV
Sbjct  61   RIIMVANQLPIRAHRKSDNNKNGSSSCSTTTTSNNWIFSWDDNSLLLQMRDGLGDDDVEV  120

Query  392  IYVGCLKEEIIDPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLP  571
            IY+GCLKEEI  PNEQD+V+Q LLETFKCVP F+PP+LFS++YHGFCKQQLWPLFHYMLP
Sbjct  121  IYIGCLKEEI-HPNEQDEVSQILLETFKCVPTFLPPDLFSRYYHGFCKQQLWPLFHYMLP  179

Query  572  LSPDLGGRFDRNLWQA  619
            LSPDLGGRF+R+LWQA
Sbjct  180  LSPDLGGRFNRSLWQA  195



>ref|XP_010511784.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like isoform X5 [Camelina sativa]
Length=863

 Score =   248 bits (634),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 151/195 (77%), Gaps = 21/195 (11%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLL+LASG+S TFGR  +++ R+  VAG++S +D+E++    S       ++R
Sbjct  1    MVSRSYSNLLELASGDSPTFGRMNRQIPRIMAVAGIMSNIDNETKETDLS------PKDR  54

Query  257  MIIVGNQLPLRAHRRTDGE-------------EGWNFSWDEDSLLLQLKDGLGED-VEVI  394
            +IIV N+LP+RA RR DG              +GWNFSWD++SLLLQLKDGLG+  +EVI
Sbjct  55   IIIVANELPIRAQRRVDGNGSSSSSTSSICCSKGWNFSWDKNSLLLQLKDGLGDGAIEVI  114

Query  395  YVGCLKEEIIDPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPL  574
            YVGCLKEEI  PNEQ++V Q LLE+FKCVP F+P +L++++YHGFCKQQLWPLFHYMLPL
Sbjct  115  YVGCLKEEI-HPNEQEEVYQVLLESFKCVPTFLPLDLYTRYYHGFCKQQLWPLFHYMLPL  173

Query  575  SPDLGGRFDRNLWQA  619
            SPDLGGRFDR LWQA
Sbjct  174  SPDLGGRFDRTLWQA  188



>ref|XP_010511780.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like isoform X1 [Camelina sativa]
 ref|XP_010511781.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like isoform X2 [Camelina sativa]
 ref|XP_010511783.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like isoform X4 [Camelina sativa]
Length=862

 Score =   248 bits (634),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 151/195 (77%), Gaps = 21/195 (11%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLL+LASG+S TFGR  +++ R+  VAG++S +D+E++    S       ++R
Sbjct  1    MVSRSYSNLLELASGDSPTFGRMNRQIPRIMAVAGIMSNIDNETKETDLS------PKDR  54

Query  257  MIIVGNQLPLRAHRRTDGE-------------EGWNFSWDEDSLLLQLKDGLGED-VEVI  394
            +IIV N+LP+RA RR DG              +GWNFSWD++SLLLQLKDGLG+  +EVI
Sbjct  55   IIIVANELPIRAQRRVDGNGSSSSSTSSICCSKGWNFSWDKNSLLLQLKDGLGDGAIEVI  114

Query  395  YVGCLKEEIIDPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPL  574
            YVGCLKEEI  PNEQ++V Q LLE+FKCVP F+P +L++++YHGFCKQQLWPLFHYMLPL
Sbjct  115  YVGCLKEEI-HPNEQEEVYQVLLESFKCVPTFLPLDLYTRYYHGFCKQQLWPLFHYMLPL  173

Query  575  SPDLGGRFDRNLWQA  619
            SPDLGGRFDR LWQA
Sbjct  174  SPDLGGRFDRTLWQA  188



>gb|KDO60795.1| hypothetical protein CISIN_1g044635mg [Citrus sinensis]
Length=831

 Score =   248 bits (633),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 157/183 (86%), Gaps = 3/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ-E  253
            MVS+SYSNLL+LASGE+ +FGR  +++ R+ TVAG++S+LDD+   +  SD  SS  Q +
Sbjct  1    MVSKSYSNLLELASGEAPSFGRMRRRIPRIMTVAGIISDLDDDPADSVCSDPSSSSVQRD  60

Query  254  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEIIDP  430
            R+IIV NQLP+RA R++D  +GW FSWDE+SLLLQLKDGLG+D +EVIYVGCLKEEI   
Sbjct  61   RIIIVANQLPIRAQRKSDNSKGWIFSWDENSLLLQLKDGLGDDDIEVIYVGCLKEEI-HV  119

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
            NEQD+V+Q LL+TFKCVP F+PP+LFS++YHGFCKQQLWPLFHYMLPLSPDLGGRF+R+L
Sbjct  120  NEQDEVSQILLDTFKCVPTFLPPDLFSRYYHGFCKQQLWPLFHYMLPLSPDLGGRFNRSL  179

Query  611  WQA  619
            WQA
Sbjct  180  WQA  182



>ref|XP_006448141.1| hypothetical protein CICLE_v10014251mg [Citrus clementina]
 ref|XP_006448142.1| hypothetical protein CICLE_v10014251mg [Citrus clementina]
 ref|XP_006469268.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Citrus sinensis]
 gb|ESR61381.1| hypothetical protein CICLE_v10014251mg [Citrus clementina]
 gb|ESR61382.1| hypothetical protein CICLE_v10014251mg [Citrus clementina]
Length=854

 Score =   248 bits (633),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 157/183 (86%), Gaps = 3/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ-E  253
            MVS+SYSNLL+LASGE+ +FGR  +++ R+ TVAG++S+LDD+   +  SD  SS  Q +
Sbjct  1    MVSKSYSNLLELASGEAPSFGRMRRRIPRIMTVAGIISDLDDDPADSVCSDPSSSSVQRD  60

Query  254  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEIIDP  430
            R+IIV NQLP+RA R++D  +GW FSWDE+SLLLQLKDGLG+D +EVIYVGCLKEEI   
Sbjct  61   RIIIVANQLPIRAQRKSDNSKGWIFSWDENSLLLQLKDGLGDDDIEVIYVGCLKEEI-HV  119

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
            NEQD+V+Q LL+TFKCVP F+PP+LFS++YHGFCKQQLWPLFHYMLPLSPDLGGRF+R+L
Sbjct  120  NEQDEVSQILLDTFKCVPTFLPPDLFSRYYHGFCKQQLWPLFHYMLPLSPDLGGRFNRSL  179

Query  611  WQA  619
            WQA
Sbjct  180  WQA  182



>gb|KJB30625.1| hypothetical protein B456_005G152400 [Gossypium raimondii]
 gb|KJB30626.1| hypothetical protein B456_005G152400 [Gossypium raimondii]
Length=869

 Score =   248 bits (633),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 121/196 (62%), Positives = 155/196 (79%), Gaps = 16/196 (8%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSISQE  253
            MVSRSYSNLL+LASGE+ + GR  +++ R+ TV G++S++DD+ S S       SS  ++
Sbjct  1    MVSRSYSNLLELASGEAPSLGRISRRIPRIMTVPGIISDIDDDPSESVCSDPSSSSSQKD  60

Query  254  RMIIVGNQLPLRAHRRTDGEEG-------------WNFSWDEDSLLLQLKDGLGED-VEV  391
            R+I+V NQLP+RAHR++D  +              W FSWD++SLLLQ++DGLG+D VEV
Sbjct  61   RIIMVANQLPIRAHRKSDNNKNGSSSCSTTTTSNNWIFSWDDNSLLLQMRDGLGDDDVEV  120

Query  392  IYVGCLKEEIIDPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLP  571
            IY+GCLKEEI  PNEQD+V+Q LLETFKCVP F+PP+LFS++YHGFCKQQLWPLFHYMLP
Sbjct  121  IYIGCLKEEI-HPNEQDEVSQILLETFKCVPTFLPPDLFSRYYHGFCKQQLWPLFHYMLP  179

Query  572  LSPDLGGRFDRNLWQA  619
            LSPDLGGRF+R+LWQA
Sbjct  180  LSPDLGGRFNRSLWQA  195



>ref|XP_003630977.1| Alpha,alpha-trehalose-phosphate synthase [Medicago truncatula]
 gb|AET05453.1| trehalose-6-phosphate synthase domain protein [Medicago truncatula]
Length=853

 Score =   248 bits (632),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 119/185 (64%), Positives = 151/185 (82%), Gaps = 5/185 (3%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSD-VPSSISQE  253
            MVSRSYSNLL+L SG+S TF    +++ R+ TVAG++S++DD+    G S+   SS+ +E
Sbjct  1    MVSRSYSNLLELVSGDSPTFENINRRIPRIMTVAGLISDVDDDPLETGCSEPSSSSVQRE  60

Query  254  RMIIVGNQLPLRAHRRTDGEE--GWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEII  424
            R+IIV NQLP++A R+ DG     W FSWDE+SLLLQLKDGLG+D  +VIYVGCLKE++ 
Sbjct  61   RIIIVANQLPIKAQRKQDGNNMNKWFFSWDENSLLLQLKDGLGDDDTDVIYVGCLKEDV-  119

Query  425  DPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDR  604
             PNEQD+V+Q LLETFKCVP F+P +LF+++YHGFCKQQLWPLFHYMLPLSP LGGRF+R
Sbjct  120  HPNEQDEVSQILLETFKCVPTFLPGDLFTRYYHGFCKQQLWPLFHYMLPLSPGLGGRFNR  179

Query  605  NLWQA  619
            +LWQA
Sbjct  180  SLWQA  184



>gb|KHG01703.1| putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
7 [Gossypium arboreum]
Length=857

 Score =   247 bits (631),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 149/183 (81%), Gaps = 4/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  250
            M+SRSY+NLLDLASG     G  R  K+L RV TV GV+SELDD+  ++  SDVPSSI Q
Sbjct  1    MMSRSYTNLLDLASGNFPVMGQPREKKRLPRVMTVPGVISELDDDQANSVASDVPSSIIQ  60

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  430
            +R+IIV NQLP++A RR D + GW+FSWD+DSLLLQLKDGL E++EV+YVG LK ++ DP
Sbjct  61   DRIIIVANQLPVKAKRRPDNK-GWSFSWDDDSLLLQLKDGLPEEMEVLYVGSLKVDV-DP  118

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
            +EQDDV+Q LL+ FKCVPAF+PP++ +KFYHGFCKQ LWPLFHYMLP S + GGRF R+L
Sbjct  119  SEQDDVSQLLLDRFKCVPAFLPPDILTKFYHGFCKQHLWPLFHYMLPFSANHGGRFYRSL  178

Query  611  WQA  619
            W+A
Sbjct  179  WEA  181



>ref|XP_004233035.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Solanum lycopersicum]
 ref|XP_010316843.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Solanum lycopersicum]
Length=851

 Score =   247 bits (631),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 146/181 (81%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M+S+SY+NLLDLASG     GR  K+L RV TVAGV+SELDD+  ++  SDVPSSI  +R
Sbjct  1    MMSKSYTNLLDLASGNFPVMGREKKRLPRVMTVAGVISELDDDQANSVTSDVPSSIIVDR  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            +IIV NQLP++A RR+D + GWNFSWDEDSLLL +KDGL +D+EV+YVG LK E+ D +E
Sbjct  61   IIIVANQLPVKAKRRSDNK-GWNFSWDEDSLLLHIKDGLPDDMEVLYVGSLKVEV-DSSE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDV+Q LL+ FKCVPAF+PP++ SK+YHGFCKQ LWPLFHYMLP S   G RFDR+ W+
Sbjct  119  QDDVSQLLLDRFKCVPAFLPPDILSKYYHGFCKQHLWPLFHYMLPYSASHGSRFDRSWWE  178

Query  617  A  619
            A
Sbjct  179  A  179



>gb|AJO70168.1| alpha,alpha-trehalose-phosphate synthase 7 [Camellia sinensis]
Length=855

 Score =   247 bits (631),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 146/181 (81%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M+SRSY+NLLDLASG     GR  K+L RV TV GV+SELDD+  ++  SDV SS+  +R
Sbjct  1    MMSRSYTNLLDLASGNFPVMGREKKRLPRVMTVPGVISELDDDQANSVTSDVQSSLVVDR  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            +IIV NQLP++A RR D + GW+FSWDEDSLLL +KDGL +D+EVIYVG L+ E+ DPNE
Sbjct  61   VIIVANQLPVKAKRRPDNK-GWSFSWDEDSLLLHIKDGLPDDMEVIYVGSLRVEV-DPNE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDV+Q LL+ FKCVPAF+PP++ +++YHGFCKQ LWPLFHYMLP S   GGRFDR+LW+
Sbjct  119  QDDVSQLLLDRFKCVPAFLPPDILARYYHGFCKQHLWPLFHYMLPFSASHGGRFDRSLWE  178

Query  617  A  619
            A
Sbjct  179  A  179



>ref|XP_002268174.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Vitis vinifera]
Length=853

 Score =   247 bits (630),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 149/181 (82%), Gaps = 3/181 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M+SRSY+NLLDLASG     G+  K+L RV TV GV+SELDD+  ++  SDVPSSI Q+R
Sbjct  1    MMSRSYTNLLDLASGNFPLMGQR-KRLPRVMTVPGVISELDDDQANSVTSDVPSSIVQDR  59

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            +IIV NQLP++A RR D + GW+FSWDEDSLLLQLKDGL +D+EV+YVG L+ ++ D NE
Sbjct  60   VIIVANQLPVKAKRRPDNK-GWSFSWDEDSLLLQLKDGLPDDMEVLYVGSLRVDV-DSNE  117

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDV+Q LL+ FKCVPAF+P ++ SKFYHGFCKQQLWPLFHYMLP S + GGRFDR+LW+
Sbjct  118  QDDVSQVLLDRFKCVPAFLPQDILSKFYHGFCKQQLWPLFHYMLPFSANHGGRFDRSLWE  177

Query  617  A  619
            A
Sbjct  178  A  178



>ref|XP_010671073.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Beta vulgaris subsp. vulgaris]
 ref|XP_010671074.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Beta vulgaris subsp. vulgaris]
Length=857

 Score =   247 bits (630),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 147/183 (80%), Gaps = 4/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGE--SLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  250
            M+SRSY+NLLDLASG   ++  GR  ++L RV TVAGV+SE+DD+  ++  SDVPSSI Q
Sbjct  1    MMSRSYTNLLDLASGNFPAMEMGREKRRLPRVMTVAGVISEMDDDQANSVSSDVPSSIVQ  60

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  430
            +R+IIV NQLP+RA RR D + GW+FSWDEDSLLL LK GL ED+EV+YVG LK E+ D 
Sbjct  61   DRIIIVANQLPVRAKRRPDNK-GWSFSWDEDSLLLHLKHGLPEDMEVLYVGSLKVEV-DV  118

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
            +EQDDV+Q LLE FKCVPAF+P ++ +KFYHGFCK  LWPLFHYMLP S   GGRFDR+L
Sbjct  119  DEQDDVSQILLEKFKCVPAFLPQDIHTKFYHGFCKHHLWPLFHYMLPFSASHGGRFDRSL  178

Query  611  WQA  619
            W+A
Sbjct  179  WEA  181



>ref|XP_011039387.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Populus euphratica]
 ref|XP_011039388.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Populus euphratica]
Length=853

 Score =   246 bits (629),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 151/183 (83%), Gaps = 4/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  250
            M+SRSY+NLLDLASG     G  R  K+L RV TV GV+SELDD+  ++  SDVPSS+ Q
Sbjct  1    MMSRSYTNLLDLASGNFPAMGQPRERKRLPRVMTVPGVISELDDDVANSVTSDVPSSVVQ  60

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  430
            +R+IIVGNQLP++A RR D + GW+FSWDEDSLLLQLKDGL E++EV+YVG L+ +I D 
Sbjct  61   DRIIIVGNQLPVKAKRRPDNK-GWSFSWDEDSLLLQLKDGLPEEMEVLYVGSLRADI-DL  118

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
            +EQ+DV+Q LL+ FKCVPAF+PP++ SKFYHGFCKQ LWPLFHYMLP+S + GGRFDR+L
Sbjct  119  SEQEDVSQVLLDRFKCVPAFLPPDILSKFYHGFCKQYLWPLFHYMLPISGNHGGRFDRSL  178

Query  611  WQA  619
            W+A
Sbjct  179  WEA  181



>ref|NP_974105.1| alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Arabidopsis 
thaliana]
 sp|Q94AH8.2|TPS6_ARATH RecName: Full=Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6; AltName: Full=Trehalose-6-phosphate synthase 6; Short=AtTPS6 
[Arabidopsis thaliana]
 gb|AEE34738.1| alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Arabidopsis 
thaliana]
Length=860

 Score =   246 bits (629),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 150/194 (77%), Gaps = 20/194 (10%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLL+LASG+S TFGR  +++ R+  VAG++S +D++S+    S       ++R
Sbjct  1    MVSRSYSNLLELASGDSPTFGRMNRQIPRIMAVAGIMSNIDNDSKDTDLS------PKDR  54

Query  257  MIIVGNQLPLRAHRRTDGE------------EGWNFSWDEDSLLLQLKDGLG-EDVEVIY  397
            +IIV N+LP+RA RR DG             +GWNFSWDE+SLLLQLKDGLG E +EVIY
Sbjct  55   IIIVANELPIRAQRRVDGNGSGSSSSSTCCSKGWNFSWDENSLLLQLKDGLGDEAIEVIY  114

Query  398  VGCLKEEIIDPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLS  577
            VGCLKEEI   NEQ++V Q LLE+FKCVP F+P +L++++YHGFCKQQLWPLFHYMLPLS
Sbjct  115  VGCLKEEI-PLNEQEEVYQILLESFKCVPTFLPLDLYTRYYHGFCKQQLWPLFHYMLPLS  173

Query  578  PDLGGRFDRNLWQA  619
            PDLGGRFDR LWQA
Sbjct  174  PDLGGRFDRTLWQA  187



>ref|XP_002317392.1| hypothetical protein POPTR_0011s06910g [Populus trichocarpa]
 ref|XP_006377536.1| glycosyl transferase family 20 family protein [Populus trichocarpa]
 ref|XP_006377537.1| hypothetical protein POPTR_0011s06910g [Populus trichocarpa]
 gb|EEE98004.1| hypothetical protein POPTR_0011s06910g [Populus trichocarpa]
 gb|ERP55333.1| glycosyl transferase family 20 family protein [Populus trichocarpa]
 gb|ERP55334.1| hypothetical protein POPTR_0011s06910g [Populus trichocarpa]
Length=853

 Score =   246 bits (628),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 151/183 (83%), Gaps = 4/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  250
            M+SRSY+NLLDLASG     G  R  K+L RV TV GV+SELDD+  ++  SDVPSS+ Q
Sbjct  1    MMSRSYTNLLDLASGNFPAMGQPRERKRLPRVMTVPGVISELDDDVANSVTSDVPSSVVQ  60

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  430
            +R+IIVGNQLP++A RR D + GW+FSWDEDSLLLQLKDGL E++EV+YVG L+ +I D 
Sbjct  61   DRIIIVGNQLPVKAKRRPDNK-GWSFSWDEDSLLLQLKDGLPEEMEVLYVGSLRADI-DL  118

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
            +EQ+DV+Q LL+ FKCVPAF+PP++ SKFYHGFCKQ LWPLFHYMLP+S + GGRFDR+L
Sbjct  119  SEQEDVSQILLDRFKCVPAFLPPDILSKFYHGFCKQYLWPLFHYMLPISGNHGGRFDRSL  178

Query  611  WQA  619
            W+A
Sbjct  179  WEA  181



>ref|XP_004171547.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7-like, partial [Cucumis sativus]
Length=654

 Score =   243 bits (620),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 147/181 (81%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M+S+SY+NLLDLASG     GR  K+L RV TVAGV+SELDD+  ++  S+ PSS+ Q+R
Sbjct  1    MMSKSYTNLLDLASGNFPIMGREKKRLPRVMTVAGVISELDDDQANSVTSEGPSSVVQDR  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            +IIV NQLP++A RR D + GW+FSWDEDSLL QLKDGL ED+EV+YVG L+ ++ D +E
Sbjct  61   IIIVANQLPIKAKRRPDNK-GWSFSWDEDSLLWQLKDGLPEDMEVLYVGSLRVDV-DFSE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            Q+DV+Q LLE FKCVPAF+P ++ SKFYHGFCKQQLWPLFHYMLP S   GGRFDR+LW+
Sbjct  119  QEDVSQLLLERFKCVPAFLPHDILSKFYHGFCKQQLWPLFHYMLPFSATHGGRFDRSLWE  178

Query  617  A  619
            A
Sbjct  179  A  179



>ref|XP_011070555.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Sesamum indicum]
Length=856

 Score =   246 bits (628),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 156/185 (84%), Gaps = 5/185 (3%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGE--SLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  250
            MVSRSYSNLL+LASGE  S +F R  ++L R+ TVAG++S++DD+   +  SD  SS +Q
Sbjct  1    MVSRSYSNLLELASGEAPSPSFSRMRRRLPRIMTVAGIMSDIDDDGSDSVSSDPSSSTAQ  60

Query  251  -ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEII  424
             +R+IIV NQLP++ HR+TD   GW FSWDE+SLLLQLKDGLG+D +E IYVGCLKE+I 
Sbjct  61   RDRIIIVANQLPIKVHRKTDESRGWTFSWDENSLLLQLKDGLGDDEMEFIYVGCLKEDI-  119

Query  425  DPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDR  604
             PN+QD+V+Q LLETFKCVP F+PP+LFS++YHGFCKQQLWPLFHYMLPLSPDLGGRF+R
Sbjct  120  HPNDQDEVSQILLETFKCVPTFLPPDLFSRYYHGFCKQQLWPLFHYMLPLSPDLGGRFNR  179

Query  605  NLWQA  619
            +LWQA
Sbjct  180  SLWQA  184



>ref|XP_010415412.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Camelina sativa]
Length=859

 Score =   246 bits (628),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/193 (62%), Positives = 151/193 (78%), Gaps = 19/193 (10%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLL+LASG+S TFGR  +++ R+  VAG++S +D+E++    S       ++R
Sbjct  1    MVSRSYSNLLELASGDSPTFGRMNRQIPRIMAVAGIMSNIDNETKETDLS------PKDR  54

Query  257  MIIVGNQLPLRAHRRTDGE-----------EGWNFSWDEDSLLLQLKDGLGED-VEVIYV  400
            +IIV N+LP+RA RR DG            +GWNFSWD++SLLLQLKDGLG+  +EVIYV
Sbjct  55   IIIVANELPIRAQRRVDGSTSGSTSSTCCSKGWNFSWDKNSLLLQLKDGLGDGAIEVIYV  114

Query  401  GCLKEEIIDPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSP  580
            GCLKEEI  PNEQ++V Q LLE+FKCVP F+P +L++++YHGFCKQQLWPLFHYMLPLSP
Sbjct  115  GCLKEEI-HPNEQEEVYQVLLESFKCVPTFLPLDLYTRYYHGFCKQQLWPLFHYMLPLSP  173

Query  581  DLGGRFDRNLWQA  619
            DLGGRFDR LWQA
Sbjct  174  DLGGRFDRTLWQA  186



>gb|KJB57382.1| hypothetical protein B456_009G160400 [Gossypium raimondii]
Length=857

 Score =   246 bits (627),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 149/183 (81%), Gaps = 4/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  250
            M+S+SY+NLLDLASG     G  R  K+L RV TV GV+SELDD+  ++  SDVPSSI Q
Sbjct  1    MMSKSYTNLLDLASGNFPVMGQPREKKRLPRVMTVPGVISELDDDQANSVASDVPSSIIQ  60

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  430
            +R+IIV NQLP++A RR D + GW+FSWD+DSLLLQLKDGL E++EV+YVG LK ++ DP
Sbjct  61   DRIIIVANQLPVKAKRRPDNK-GWSFSWDDDSLLLQLKDGLPEEMEVLYVGSLKVDV-DP  118

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
            +EQDDV+Q LL+ FKCVPAF+PP++ +KFYHGFCKQ LWPLFHYMLP S + GGRF R+L
Sbjct  119  SEQDDVSQLLLDRFKCVPAFLPPDILTKFYHGFCKQHLWPLFHYMLPFSANHGGRFYRSL  178

Query  611  WQA  619
            W+A
Sbjct  179  WEA  181



>ref|XP_006300724.1| hypothetical protein CARUB_v10019781mg [Capsella rubella]
 gb|EOA33622.1| hypothetical protein CARUB_v10019781mg [Capsella rubella]
Length=863

 Score =   246 bits (627),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 121/196 (62%), Positives = 151/196 (77%), Gaps = 22/196 (11%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLL+LASG+S TFGR  +++ R+  VAG++S +D++S+    S       ++R
Sbjct  1    MVSRSYSNLLELASGDSPTFGRMNRQIPRIMAVAGIMSNIDNDSKETDLS------PKDR  54

Query  257  MIIVGNQLPLRAHRRTDGE--------------EGWNFSWDEDSLLLQLKDGLG-EDVEV  391
            +IIV N+LP+RA RR DG               +GWNFSWD++SLLLQLKDGLG E +EV
Sbjct  55   IIIVANELPIRAQRRVDGSSGSTSGGSTSTCCSKGWNFSWDKNSLLLQLKDGLGDEAIEV  114

Query  392  IYVGCLKEEIIDPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLP  571
            IYVGCLKEEI  PNEQ++V Q LLE+FKCVP F+P +L++++YHGFCKQQLWPLFHYMLP
Sbjct  115  IYVGCLKEEI-HPNEQEEVYQVLLESFKCVPTFLPLDLYTRYYHGFCKQQLWPLFHYMLP  173

Query  572  LSPDLGGRFDRNLWQA  619
            LSPDLGGRFDR LWQA
Sbjct  174  LSPDLGGRFDRTLWQA  189



>ref|XP_006358103.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7-like [Solanum tuberosum]
Length=850

 Score =   244 bits (624),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 146/181 (81%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M+S+SY+NLLDLASG     GR  K+L RV TVAGV+SELDD+  ++  SDVPSSI  +R
Sbjct  1    MMSKSYTNLLDLASGNFPVMGREKKRLPRVMTVAGVISELDDDQANSVTSDVPSSIIVDR  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            +IIV NQLP++A RR+D + GW+FSWDEDSLLL +KDGL +D+EV+YVG LK E+ D +E
Sbjct  61   IIIVANQLPVKAKRRSDNK-GWSFSWDEDSLLLHIKDGLPDDMEVLYVGSLKVEV-DSSE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDV+Q LL+ FKCVPAF+PP++ SK+YHGFCKQ LWPLFHYMLP S   G RFDR+ W+
Sbjct  119  QDDVSQLLLDRFKCVPAFLPPDILSKYYHGFCKQHLWPLFHYMLPYSASHGSRFDRSWWE  178

Query  617  A  619
            A
Sbjct  179  A  179



>ref|XP_003529226.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Glycine max]
 gb|KHN19098.1| Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Glycine 
soja]
Length=853

 Score =   244 bits (624),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 154/184 (84%), Gaps = 5/184 (3%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSIS-QE  253
            MVS+SYSNLL+LASGE+ +FG   +++ R+ TVAG++S++DD+   +  SD  SS + ++
Sbjct  1    MVSKSYSNLLELASGEAPSFGYMNRRIPRIMTVAGLISDVDDDPVESVCSDPSSSTAHRD  60

Query  254  RMIIVGNQLPLRAHRRTDGEEG-WNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEIID  427
            R+I+V NQLP+RA RR DG    W+F WDE++LL QLKDGLG+D +EVIYVGCLKEE+  
Sbjct  61   RIIMVANQLPIRAQRRPDGNRSCWSFEWDENALL-QLKDGLGDDDIEVIYVGCLKEEV-H  118

Query  428  PNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRN  607
            P+EQD+V+QTLLETFKC+P F+P + F+K+YHGFCKQQLWPLFHYMLPLSP+LGGRF+R+
Sbjct  119  PSEQDEVSQTLLETFKCIPTFLPADQFTKYYHGFCKQQLWPLFHYMLPLSPELGGRFNRS  178

Query  608  LWQA  619
            LWQA
Sbjct  179  LWQA  182



>ref|XP_008439718.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Cucumis melo]
 ref|XP_008439720.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Cucumis melo]
Length=850

 Score =   244 bits (623),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 147/181 (81%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M+S+SY+NLLDLASG     GR  K+L RV TVAGV+SELDD+  ++  S+ PSS+ Q+R
Sbjct  1    MMSKSYTNLLDLASGNFPIMGREKKRLPRVMTVAGVISELDDDQANSVTSEGPSSVVQDR  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            +IIV NQLP++A RR D + GW+FSWDEDSLL QLKDGL ED+EV+YVG L+ ++ D +E
Sbjct  61   IIIVANQLPIKAKRRPDNK-GWSFSWDEDSLLWQLKDGLPEDMEVLYVGSLRVDV-DSSE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            Q+DV+Q LLE FKCVPAF+P ++ SKFYHGFCKQQLWPLFHYMLP S   GGRFDR+LW+
Sbjct  119  QEDVSQLLLERFKCVPAFLPHDILSKFYHGFCKQQLWPLFHYMLPFSATHGGRFDRSLWE  178

Query  617  A  619
            A
Sbjct  179  A  179



>ref|XP_008775883.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Phoenix dactylifera]
 ref|XP_008775884.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Phoenix dactylifera]
Length=864

 Score =   244 bits (623),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 151/187 (81%), Gaps = 8/187 (4%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGE--SLTFGRAG---KKLSRVATVAGVLSELDDESRSNG-GSDVPS  238
            M+SRSY+NLLDLASG   +L+ G  G   +++ RV T+ G L+ELD+E R+    SDVPS
Sbjct  1    MMSRSYTNLLDLASGNFAALSVGSQGASRRRMPRVMTMPGALAELDEEDRAGSVSSDVPS  60

Query  239  SISQERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEE  418
            SI+Q+R+IIV NQLP+RA RR DG  GW+FSWDEDSLLLQLKDGL +D+EV+YVG L+ +
Sbjct  61   SIAQDRIIIVANQLPVRAKRRPDGR-GWSFSWDEDSLLLQLKDGLPDDMEVLYVGSLRVD  119

Query  419  IIDPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRF  598
            + + +EQDD+AQ LLE FKCVPAF+P +L  KFYHGFCKQQLWPLFHYMLP S D GGRF
Sbjct  120  V-EVHEQDDIAQALLERFKCVPAFLPADLLEKFYHGFCKQQLWPLFHYMLPFSADHGGRF  178

Query  599  DRNLWQA  619
            DR+LW++
Sbjct  179  DRSLWES  185



>emb|CDY04199.1| BnaC06g26160D [Brassica napus]
Length=851

 Score =   244 bits (622),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/184 (63%), Positives = 148/184 (80%), Gaps = 7/184 (4%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLL+LASG+S TFGR  +++ R+  VAG++S +D++S+ +  SD+     ++R
Sbjct  1    MVSRSYSNLLELASGDSPTFGRMNRQIPRIMAVAGIMSNIDNDSKESLSSDLSP---KDR  57

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED---VEVIYVGCLKEEIID  427
            +IIV N+LP+RA R+ +    W FS DE+SLLLQLKDGLG +    EVIYVGCLKE+I  
Sbjct  58   IIIVANELPIRAQRKLESSTSWTFSLDENSLLLQLKDGLGSEEATTEVIYVGCLKEDI-H  116

Query  428  PNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRN  607
            PNEQ++V Q LLE FKCVP F+P +L++++YHGFCKQQLWPLFHYMLPLSPDLGGRFDR+
Sbjct  117  PNEQEEVYQLLLENFKCVPTFLPLDLYTRYYHGFCKQQLWPLFHYMLPLSPDLGGRFDRS  176

Query  608  LWQA  619
            LWQA
Sbjct  177  LWQA  180



>gb|KFK41224.1| hypothetical protein AALP_AA2G101500 [Arabis alpina]
Length=857

 Score =   244 bits (623),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/191 (62%), Positives = 149/191 (78%), Gaps = 18/191 (9%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLL+LASG+S TFGR  +++ R+  VAG++S +D++S+            ++R
Sbjct  1    MVSRSYSNLLELASGDSPTFGRMNRQIPRIMAVAGIMSNIDNDSKETLSP-------KDR  53

Query  257  MIIVGNQLPLRAHRRTDGE---------EGWNFSWDEDSLLLQLKDGLG-EDVEVIYVGC  406
            +IIV N+LP+RA R+ +           +GWNFSWDE+SLLLQLKDGLG E +EVIYVGC
Sbjct  54   IIIVANELPIRAQRKLETNIGTSSSSTSKGWNFSWDENSLLLQLKDGLGDEAIEVIYVGC  113

Query  407  LKEEIIDPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDL  586
            LKEEI  PNEQ++V Q LLE FKCVP F+P +L++++YHGFCKQQLWPLFHYMLPLSPDL
Sbjct  114  LKEEI-HPNEQEEVYQLLLENFKCVPTFLPLDLYTRYYHGFCKQQLWPLFHYMLPLSPDL  172

Query  587  GGRFDRNLWQA  619
            GGRFDR+LWQA
Sbjct  173  GGRFDRSLWQA  183



>ref|XP_010052171.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Eucalyptus grandis]
 gb|KCW76087.1| hypothetical protein EUGRSUZ_D00465 [Eucalyptus grandis]
Length=864

 Score =   244 bits (622),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 146/181 (81%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M+S+SY+NLLDLASG     GR  K+L RV TV   +SELDD+  ++  SDVPSSI Q+R
Sbjct  1    MLSKSYTNLLDLASGNFPVMGREKKRLPRVMTVPVDISELDDDQANSVSSDVPSSIIQDR  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            +IIV NQLP++A RR D + GW  SWD+DSLLLQLKDGL +D+EV+YVG L+ ++ DP+E
Sbjct  61   IIIVANQLPVKAKRRPDNK-GWALSWDDDSLLLQLKDGLPDDMEVLYVGSLRVDV-DPSE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDV+Q LLE FKCVPAF+PP++ SK+YHGFCKQ LWPLFHYMLP + + GGRFDR+LW+
Sbjct  119  QDDVSQLLLEKFKCVPAFLPPDILSKYYHGFCKQHLWPLFHYMLPFAANHGGRFDRSLWE  178

Query  617  A  619
            A
Sbjct  179  A  179



>emb|CDY07404.1| BnaA07g24830D [Brassica napus]
Length=852

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 149/185 (81%), Gaps = 8/185 (4%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLL+LASG+S TFGR  +++ R+  VAG++S +D++S+ +  SD+P    ++R
Sbjct  1    MVSRSYSNLLELASGDSPTFGRMNRQIPRIMAVAGIMSNIDNDSKESPSSDLPP---KDR  57

Query  257  MIIVGNQLPLRAHRRTD-GEEGWNFSWDEDSLLLQLKDGLGED---VEVIYVGCLKEEII  424
            +IIV N+LP+RA R+ +     W FS DE+SLLLQLKDGLG +    EVIYVGCLKE+I 
Sbjct  58   IIIVANELPIRAQRKLETSSTSWTFSLDENSLLLQLKDGLGSEATTTEVIYVGCLKEDI-  116

Query  425  DPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDR  604
             PNEQ++V Q LLE FKCVP F+P +L++++YHGFCKQQLWPLFHYMLPLSPDLGGRFDR
Sbjct  117  HPNEQEEVYQLLLENFKCVPTFLPLDLYTRYYHGFCKQQLWPLFHYMLPLSPDLGGRFDR  176

Query  605  NLWQA  619
            +LWQA
Sbjct  177  SLWQA  181



>gb|KHG14143.1| Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 -like 
protein [Gossypium arboreum]
Length=869

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/196 (63%), Positives = 157/196 (80%), Gaps = 16/196 (8%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ-E  253
            MVSRSYSNLL+LASGE+ + GR  +++ R+ TV G++S++DD+   +  SD  SS +Q +
Sbjct  1    MVSRSYSNLLELASGEAPSLGRISRRIPRIMTVPGIISDIDDDPSESVCSDPSSSSTQKD  60

Query  254  RMIIVGNQLPLRAHRRTDGEEG-------------WNFSWDEDSLLLQLKDGLGED-VEV  391
            R+I+V NQLP+RAHR++D  +              W FSWD++SLLLQ++DGLG+D VEV
Sbjct  61   RIIMVANQLPIRAHRKSDNNKNGSSSSSTTTTSNNWIFSWDDNSLLLQMRDGLGDDDVEV  120

Query  392  IYVGCLKEEIIDPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLP  571
            IYVGCLKEEI  PNEQD+V+Q LLETFKCVP F+PP+LFS++YHGFCKQQLWPLFHYMLP
Sbjct  121  IYVGCLKEEI-HPNEQDEVSQILLETFKCVPTFLPPDLFSRYYHGFCKQQLWPLFHYMLP  179

Query  572  LSPDLGGRFDRNLWQA  619
            LSPDLGGRF+R+LWQA
Sbjct  180  LSPDLGGRFNRSLWQA  195



>ref|XP_010276900.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like isoform X1 [Nelumbo nucifera]
 ref|XP_010276976.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like isoform X1 [Nelumbo nucifera]
Length=853

 Score =   243 bits (619),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 151/182 (83%), Gaps = 3/182 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSR YSNLL+LASGES +FGR  +++ R+ TVAG++S+LDD+   +  SD  S   +ER
Sbjct  1    MVSRPYSNLLELASGESPSFGRMSRRIPRIMTVAGIISDLDDDPDDSVSSDPSSPAPRER  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEIIDPN  433
             IIV NQLP+R HR+ D + GW FSW+EDSLLLQLKD LG+D VEVIYVGCL+EEI  P+
Sbjct  61   TIIVANQLPIRVHRKPDNK-GWTFSWEEDSLLLQLKDRLGDDEVEVIYVGCLREEI-HPS  118

Query  434  EQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLW  613
            EQD+V+Q LL+TFKCVP F+P +LFS++YH FCKQQLWPLFHYMLPLSPDLGGRFDR+LW
Sbjct  119  EQDEVSQILLDTFKCVPTFLPSDLFSRYYHRFCKQQLWPLFHYMLPLSPDLGGRFDRSLW  178

Query  614  QA  619
            QA
Sbjct  179  QA  180



>ref|XP_002888643.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64902.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=857

 Score =   242 bits (618),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 150/191 (79%), Gaps = 17/191 (9%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLL+LASG+S TFGR  +++ R+  VAG++S +D++S+    S       ++R
Sbjct  1    MVSRSYSNLLELASGDSPTFGRMNRQIPRIMAVAGIMSNIDNDSKETDLS------PKDR  54

Query  257  MIIVGNQLPLRAHRRTDGE---------EGWNFSWDEDSLLLQLKDGLG-EDVEVIYVGC  406
            +IIV N+LP+RA RR +G          +GWNFSWDE+SLLLQLKDGLG E +EVIYVGC
Sbjct  55   IIIVANELPIRAQRRLEGSGSSTSTCCSKGWNFSWDENSLLLQLKDGLGDEAIEVIYVGC  114

Query  407  LKEEIIDPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDL  586
            LKEEI   NEQ++V Q LLE+FKCVP F+P +L++++YHGFCKQQLWPLFHYMLPLSPDL
Sbjct  115  LKEEI-PLNEQEEVYQVLLESFKCVPTFLPLDLYTRYYHGFCKQQLWPLFHYMLPLSPDL  173

Query  587  GGRFDRNLWQA  619
            GGRFDR LWQA
Sbjct  174  GGRFDRALWQA  184



>ref|XP_009409100.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Musa acuminata subsp. malaccensis]
Length=862

 Score =   242 bits (618),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 152/184 (83%), Gaps = 5/184 (3%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLL+LASGE  +  +  +++ RV TVAG++S+LD +S S+G +  PSS +++R
Sbjct  1    MVSRSYSNLLELASGEPPSISQIRRRIPRVMTVAGIISDLDSDSDSDGSATGPSSTTRDR  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGE---DVEVIYVGCLKEEIID  427
             I+V NQLP+RA RR DG  GW+FSWDEDSLLLQLKD +G+   D+E  YVGCL++EI  
Sbjct  61   TIVVANQLPIRARRRPDGR-GWDFSWDEDSLLLQLKDAIGDRGADMEFFYVGCLRDEI-P  118

Query  428  PNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRN  607
            P +QDDV Q LLE+FKCVPAF+PP+L +++YHGFCKQQLWPLFHYMLP+SPDLGGRFDR+
Sbjct  119  PADQDDVGQVLLESFKCVPAFLPPDLLARYYHGFCKQQLWPLFHYMLPMSPDLGGRFDRS  178

Query  608  LWQA  619
            LWQA
Sbjct  179  LWQA  182



>gb|ACD56638.1| trehalose synthase-like protein [Gossypioides kirkii]
Length=857

 Score =   242 bits (617),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 145/183 (79%), Gaps = 4/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  250
            M+SRSY+NLLDLASG     G  R  K+L RV TV GV+SELDD+  ++  SD PSS  Q
Sbjct  1    MMSRSYTNLLDLASGNFPAMGQPREKKRLPRVMTVPGVISELDDDQANSVTSDAPSSAIQ  60

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  430
            +R+IIV NQLP++A RR D + GW+FSWD+DSLLLQLKDGL E++EV+YVG L  ++ DP
Sbjct  61   DRIIIVANQLPVKAKRRPDNK-GWSFSWDDDSLLLQLKDGLPEEMEVLYVGSLTVDV-DP  118

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
             EQDDV+Q LL+ FKCVPAF+PP++ +KFYHGFCKQ LWPLFHYMLP S   GGRFDR+L
Sbjct  119  VEQDDVSQLLLDKFKCVPAFLPPDILTKFYHGFCKQHLWPLFHYMLPFSASHGGRFDRSL  178

Query  611  WQA  619
            W+A
Sbjct  179  WEA  181



>gb|KHN15462.1| Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Glycine 
soja]
Length=870

 Score =   242 bits (618),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 154/185 (83%), Gaps = 6/185 (3%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSIS-QE  253
            MVS+SYSNLL+LASGE+ +FG   +++ R+ TVAG++S++DD+   +  SD  SS + ++
Sbjct  1    MVSKSYSNLLELASGEAPSFGYMNRRIPRIMTVAGLISDVDDDPVESVCSDPSSSTAHRD  60

Query  254  RMIIVGNQLPLRAHRRTDGEEG--WNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEII  424
            R+I+V NQLP+RA RR +G     W+F WDE++LL QLKDGLG+D +EVIYVGCLKEE+ 
Sbjct  61   RIIMVANQLPIRAQRRPNGNNRSCWSFEWDENALL-QLKDGLGDDDIEVIYVGCLKEEV-  118

Query  425  DPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDR  604
             P+EQD+V+QTLLETFKC+P F+P + F+K+YHGFCKQQLWPLFHYMLPLSP+LGGRF+R
Sbjct  119  HPSEQDEVSQTLLETFKCIPTFLPADQFTKYYHGFCKQQLWPLFHYMLPLSPELGGRFNR  178

Query  605  NLWQA  619
            +LWQA
Sbjct  179  SLWQA  183



>gb|ACJ61506.1| trehalose-6-phosphate synthase [Glycine max]
Length=842

 Score =   242 bits (617),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 154/185 (83%), Gaps = 6/185 (3%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSIS-QE  253
            MVS+SYSNLL+LASGE+ +FG   +++ R+ TVAG++S++DD+   +  SD  SS + ++
Sbjct  1    MVSKSYSNLLELASGEAPSFGYMNRRIPRIMTVAGLISDVDDDPVESVCSDPSSSTAHRD  60

Query  254  RMIIVGNQLPLRAHRRTDGEEG--WNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEII  424
            R+I+V NQLP+RA RR +G     W+F WDE++LL QLKDGLG+D +EVIYVGCLKEE+ 
Sbjct  61   RIIMVANQLPIRAQRRPNGNNRSCWSFEWDENALL-QLKDGLGDDDIEVIYVGCLKEEV-  118

Query  425  DPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDR  604
             P+EQD+V+QTLLETFKC+P F+P + F+K+YHGFCKQQLWPLFHYMLPLSP+LGGRF+R
Sbjct  119  HPSEQDEVSQTLLETFKCIPTFLPADQFTKYYHGFCKQQLWPLFHYMLPLSPELGGRFNR  178

Query  605  NLWQA  619
            +LWQA
Sbjct  179  SLWQA  183



>ref|XP_004134569.1| PREDICTED: LOW QUALITY PROTEIN: probable alpha,alpha-trehalose-phosphate 
synthase [UDP-forming] 7-like [Cucumis sativus]
Length=838

 Score =   241 bits (616),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 146/181 (81%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M+S+SY+NLLDLASG     GR  K+L RV TVAGV+SELDD+  ++  S+ PSS+ Q+R
Sbjct  1    MMSKSYTNLLDLASGNFPIMGREKKRLPRVMTVAGVISELDDDQANSVTSEGPSSVVQDR  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            +IIV NQLP++A RR D + GW+FSWDEDSLL QLKDGL ED+EV+YVG L+ ++ D  E
Sbjct  61   IIIVANQLPIKAKRRPDNK-GWSFSWDEDSLLWQLKDGLPEDMEVLYVGSLRVDV-DFCE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            Q+DV+Q LLE FKCVPAF+P ++ SKFYHGFCKQQLWPLFHYMLP S   GGRFDR+LW+
Sbjct  119  QEDVSQLLLERFKCVPAFLPHDILSKFYHGFCKQQLWPLFHYMLPFSATHGGRFDRSLWE  178

Query  617  A  619
            A
Sbjct  179  A  179



>gb|KJB69686.1| hypothetical protein B456_011G037000 [Gossypium raimondii]
Length=758

 Score =   240 bits (613),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 145/183 (79%), Gaps = 4/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  250
            M+SRSY+NLLDLASG     G  R  K+L RV TV GV+SELDD+  ++  SD PSS  Q
Sbjct  1    MMSRSYTNLLDLASGNFPAMGQPREKKRLPRVMTVPGVISELDDDQANSVTSDAPSSAIQ  60

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  430
            +R+IIV NQLP++A RR D + GW+FSWD+DSLLLQLKDGL E++EV+YVG LK ++ DP
Sbjct  61   DRIIIVANQLPVKAKRRPDNK-GWSFSWDDDSLLLQLKDGLPEEMEVLYVGSLKVDV-DP  118

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
             EQDDV+Q LL+ FKCVPAF+P ++ +KFYHGFCKQ LWPLFHYMLP S   GGRFDR+L
Sbjct  119  VEQDDVSQLLLDKFKCVPAFLPSDILTKFYHGFCKQHLWPLFHYMLPFSASHGGRFDRSL  178

Query  611  WQA  619
            W+A
Sbjct  179  WEA  181



>gb|KGN49325.1| Trehalose-6-phosphate synthase [Cucumis sativus]
Length=850

 Score =   241 bits (616),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 146/181 (81%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M+S+SY+NLLDLASG     GR  K+L RV TVAGV+SELDD+  ++  S+ PSS+ Q+R
Sbjct  1    MMSKSYTNLLDLASGNFPIMGREKKRLPRVMTVAGVISELDDDQANSVTSEGPSSVVQDR  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            +IIV NQLP++A RR D + GW+FSWDEDSLL QLKDGL ED+EV+YVG L+ ++ D  E
Sbjct  61   IIIVANQLPIKAKRRPDNK-GWSFSWDEDSLLWQLKDGLPEDMEVLYVGSLRVDV-DFCE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            Q+DV+Q LLE FKCVPAF+P ++ SKFYHGFCKQQLWPLFHYMLP S   GGRFDR+LW+
Sbjct  119  QEDVSQLLLERFKCVPAFLPHDILSKFYHGFCKQQLWPLFHYMLPFSATHGGRFDRSLWE  178

Query  617  A  619
            A
Sbjct  179  A  179



>ref|XP_009804181.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X3 [Nicotiana sylvestris]
Length=757

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 145/181 (80%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M+S+SY+NLLDLASG     GR  ++L RV TVAGV+SELDD+  ++  SDVPSSI  +R
Sbjct  1    MLSKSYTNLLDLASGNFPVMGREKRRLPRVMTVAGVISELDDDQANSVTSDVPSSIIVDR  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            +IIV NQLP++A RR D + GW+FSWD+DSLLL +KDGL +D+EV+YVGCL+ E+ D +E
Sbjct  61   IIIVANQLPVKAKRRPDNK-GWSFSWDDDSLLLHIKDGLPDDMEVLYVGCLRVEV-DSSE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDV+Q LL+ FK VPAF+PP++ SK+YHGFCKQ LWPLFHYMLP S   G RFDR+ W+
Sbjct  119  QDDVSQLLLDRFKSVPAFLPPDILSKYYHGFCKQHLWPLFHYMLPYSASHGSRFDRSWWE  178

Query  617  A  619
            A
Sbjct  179  A  179



>ref|XP_002305726.1| hypothetical protein POPTR_0004s06000g [Populus trichocarpa]
 gb|EEE86237.1| hypothetical protein POPTR_0004s06000g [Populus trichocarpa]
Length=849

 Score =   241 bits (615),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 145/183 (79%), Gaps = 8/183 (4%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  250
            MVSRSY+NLLDLASG     G  R  K+L RV TV GV+SELDD++     SDVPSS+ Q
Sbjct  1    MVSRSYTNLLDLASGNFPAMGQPRERKQLPRVMTVPGVISELDDDA----ASDVPSSVVQ  56

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  430
            +RMIIV NQLP++A R  D + GW+FSWDEDSLLL LKDGL ED+EV+YVG L+ ++ D 
Sbjct  57   DRMIIVANQLPVKAKRMPDNK-GWSFSWDEDSLLLHLKDGLPEDMEVLYVGSLRADV-DL  114

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
            +EQDDV+Q LL+ F CVPAF+PP++ SKFYHGFCKQ LWPLFHYMLP S + GGRFDR+L
Sbjct  115  SEQDDVSQVLLDRFNCVPAFLPPDILSKFYHGFCKQHLWPLFHYMLPFSGNHGGRFDRSL  174

Query  611  WQA  619
            W+A
Sbjct  175  WEA  177



>gb|KHG11600.1| putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
7 -like protein [Gossypium arboreum]
Length=857

 Score =   241 bits (615),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 145/183 (79%), Gaps = 4/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  250
            M+SRSY+NLLDLASG     G  R  K+L RV TV GV+SELDD+  ++  SD PSS  Q
Sbjct  1    MMSRSYTNLLDLASGNFPAMGQPREKKRLPRVMTVPGVISELDDDQANSVTSDAPSSAIQ  60

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  430
            +R+IIV NQLP++A RR D + GW+FSWD+DSLLLQLKDGL E++EV+YVG LK ++ DP
Sbjct  61   DRIIIVANQLPVKAKRRPDNK-GWSFSWDDDSLLLQLKDGLPEEMEVLYVGSLKVDV-DP  118

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
             EQDDV+Q LL+ FKCVPAF+P ++ +KFYHGFCKQ LWPLFHYMLP S   GGRFDR+L
Sbjct  119  VEQDDVSQLLLDKFKCVPAFLPSDILTKFYHGFCKQHLWPLFHYMLPFSASHGGRFDRSL  178

Query  611  WQA  619
            W+A
Sbjct  179  WEA  181



>gb|KJB69685.1| hypothetical protein B456_011G037000 [Gossypium raimondii]
Length=857

 Score =   241 bits (614),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 145/183 (79%), Gaps = 4/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  250
            M+SRSY+NLLDLASG     G  R  K+L RV TV GV+SELDD+  ++  SD PSS  Q
Sbjct  1    MMSRSYTNLLDLASGNFPAMGQPREKKRLPRVMTVPGVISELDDDQANSVTSDAPSSAIQ  60

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  430
            +R+IIV NQLP++A RR D + GW+FSWD+DSLLLQLKDGL E++EV+YVG LK ++ DP
Sbjct  61   DRIIIVANQLPVKAKRRPDNK-GWSFSWDDDSLLLQLKDGLPEEMEVLYVGSLKVDV-DP  118

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
             EQDDV+Q LL+ FKCVPAF+P ++ +KFYHGFCKQ LWPLFHYMLP S   GGRFDR+L
Sbjct  119  VEQDDVSQLLLDKFKCVPAFLPSDILTKFYHGFCKQHLWPLFHYMLPFSASHGGRFDRSL  178

Query  611  WQA  619
            W+A
Sbjct  179  WEA  181



>ref|XP_009804180.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X2 [Nicotiana sylvestris]
Length=758

 Score =   239 bits (611),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 145/181 (80%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M+S+SY+NLLDLASG     GR  ++L RV TVAGV+SELDD+  ++  SDVPSSI  +R
Sbjct  1    MLSKSYTNLLDLASGNFPVMGREKRRLPRVMTVAGVISELDDDQANSVTSDVPSSIIVDR  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            +IIV NQLP++A RR D + GW+FSWD+DSLLL +KDGL +D+EV+YVGCL+ E+ D +E
Sbjct  61   IIIVANQLPVKAKRRPDNK-GWSFSWDDDSLLLHIKDGLPDDMEVLYVGCLRVEV-DSSE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDV+Q LL+ FK VPAF+PP++ SK+YHGFCKQ LWPLFHYMLP S   G RFDR+ W+
Sbjct  119  QDDVSQLLLDRFKSVPAFLPPDILSKYYHGFCKQHLWPLFHYMLPYSASHGSRFDRSWWE  178

Query  617  A  619
            A
Sbjct  179  A  179



>ref|XP_010999788.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Populus euphratica]
Length=849

 Score =   241 bits (614),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 146/183 (80%), Gaps = 8/183 (4%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  250
            MVSRSY+NLLDLASG     G  R  K+L RV TV GV+SELDD++     SDVPSS+ Q
Sbjct  1    MVSRSYTNLLDLASGNFPAMGQPRERKQLPRVMTVPGVISELDDDA----ASDVPSSVVQ  56

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  430
            +RMIIV NQLP++A RR D + GW+FSWD+DSLLL LKDGL E++EV+YVG L+ ++ D 
Sbjct  57   DRMIIVANQLPVKAKRRPDNK-GWSFSWDDDSLLLHLKDGLPEEMEVLYVGSLRADV-DL  114

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
            +EQDDV+Q LL+ F CVPAF+PP++ SKFYHGFCKQ LWPLFHYMLP S + GGRFDR+L
Sbjct  115  SEQDDVSQVLLDRFNCVPAFLPPDILSKFYHGFCKQHLWPLFHYMLPFSGNHGGRFDRSL  174

Query  611  WQA  619
            W+A
Sbjct  175  WEA  177



>emb|CBI26812.3| unnamed protein product [Vitis vinifera]
Length=702

 Score =   238 bits (608),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 140/182 (77%), Gaps = 27/182 (15%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLL+LASGES +FGR  +++ R+ T                         ++R
Sbjct  1    MVSRSYSNLLELASGESPSFGRMSRRIPRIMT-------------------------RDR  35

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEIIDPN  433
            +IIV NQLP+RA R+++   GW FSWDE+SLLLQLKDGLG+D +EVIYVGCLKEEI  P 
Sbjct  36   LIIVANQLPIRAQRKSENNNGWIFSWDENSLLLQLKDGLGDDEIEVIYVGCLKEEI-HPC  94

Query  434  EQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLW  613
            EQD+V+Q LLETFKCVP F+PP+LF+++YHGFCKQQLWPLFHYMLPLSPDLGGRF+R+LW
Sbjct  95   EQDEVSQILLETFKCVPTFLPPDLFTRYYHGFCKQQLWPLFHYMLPLSPDLGGRFNRSLW  154

Query  614  QA  619
            QA
Sbjct  155  QA  156



>ref|XP_010556235.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Tarenaya hassleriana]
 ref|XP_010556236.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Tarenaya hassleriana]
 ref|XP_010556237.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Tarenaya hassleriana]
Length=866

 Score =   240 bits (613),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 152/195 (78%), Gaps = 15/195 (8%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSISQE  253
            MVSRSYSNLLDLASG+S +FGR  +++ R+ TVAG +S +DD+ + S       S+  ++
Sbjct  1    MVSRSYSNLLDLASGDSPSFGRMSRQIPRIMTVAGFMSNIDDDPAESVSSDPSSSTARKD  60

Query  254  RMIIVGNQLPLRAHRRTD-----------GEEGWNFSWDEDSLLLQLKDGLG--EDVEVI  394
            R+IIV NQLP+R  +R++           G + W F+WD++SLLLQLKDGLG  E+ EVI
Sbjct  61   RLIIVANQLPIRVQKRSENSSTSTSSSNIGYKNWIFTWDDNSLLLQLKDGLGDEEETEVI  120

Query  395  YVGCLKEEIIDPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPL  574
            YVGCLK+EI  PN+Q++V+Q LLETFKCVP F+PP+L+S++YHGFCKQ LWPLFHYMLPL
Sbjct  121  YVGCLKDEI-HPNDQEEVSQILLETFKCVPTFLPPDLYSRYYHGFCKQHLWPLFHYMLPL  179

Query  575  SPDLGGRFDRNLWQA  619
            SPDLGGRF+RNLWQA
Sbjct  180  SPDLGGRFNRNLWQA  194



>ref|XP_009804177.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X1 [Nicotiana sylvestris]
 ref|XP_009804178.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X1 [Nicotiana sylvestris]
 ref|XP_009804179.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X1 [Nicotiana sylvestris]
Length=849

 Score =   240 bits (612),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 145/181 (80%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M+S+SY+NLLDLASG     GR  ++L RV TVAGV+SELDD+  ++  SDVPSSI  +R
Sbjct  1    MLSKSYTNLLDLASGNFPVMGREKRRLPRVMTVAGVISELDDDQANSVTSDVPSSIIVDR  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            +IIV NQLP++A RR D + GW+FSWD+DSLLL +KDGL +D+EV+YVGCL+ E+ D +E
Sbjct  61   IIIVANQLPVKAKRRPDNK-GWSFSWDDDSLLLHIKDGLPDDMEVLYVGCLRVEV-DSSE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDV+Q LL+ FK VPAF+PP++ SK+YHGFCKQ LWPLFHYMLP S   G RFDR+ W+
Sbjct  119  QDDVSQLLLDRFKSVPAFLPPDILSKYYHGFCKQHLWPLFHYMLPYSASHGSRFDRSWWE  178

Query  617  A  619
            A
Sbjct  179  A  179



>ref|XP_008775639.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Phoenix dactylifera]
 ref|XP_008775645.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Phoenix dactylifera]
Length=856

 Score =   239 bits (609),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 149/183 (81%), Gaps = 5/183 (3%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLL+L SGE  + GR  +++ RV TVAG++S+LDD+S S+  +  PSS   +R
Sbjct  1    MVSRSYSNLLELTSGEPPSVGRIRRRIPRVMTVAGIISDLDDDSDSDTSAG-PSSSPGDR  59

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGE--DVEVIYVGCLKEEIIDP  430
             I+V N LP+RAHRR DG  GW FSWD+DSLLLQLKD +G+  D+E  YVGCL++EI  P
Sbjct  60   TIVVANHLPIRAHRRPDGR-GWTFSWDKDSLLLQLKDAIGDRCDMEFFYVGCLRDEI-PP  117

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
             EQD+V Q LLETFKCVPAF+PP+L ++FYHGFCKQQLWPLFHYMLPLSP+LGGRFDR+L
Sbjct  118  AEQDEVGQILLETFKCVPAFLPPDLLARFYHGFCKQQLWPLFHYMLPLSPELGGRFDRSL  177

Query  611  WQA  619
            WQA
Sbjct  178  WQA  180



>gb|KEH40650.1| trehalose-6-phosphate synthase domain protein [Medicago truncatula]
Length=855

 Score =   238 bits (608),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 151/186 (81%), Gaps = 7/186 (4%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSEL---DDESRSNGGSDVPSSIS  247
            MVSRSYSNL++LASGE+ +FG   +++ R+ TVAG++SE+   DD+  S       SS+ 
Sbjct  1    MVSRSYSNLVELASGETPSFGLMNRRIPRIMTVAGLISEVNIDDDQVESVASDLSSSSVH  60

Query  248  QERMIIVGNQLPLRAHRRTDGEEG-WNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEI  421
            ++R+IIV NQLP++A +  DG    W+F WDE+SLL QLKDG+G+D +EVIYVGCLKE++
Sbjct  61   RDRIIIVANQLPIKAQKNHDGNRSYWSFDWDENSLL-QLKDGIGDDDIEVIYVGCLKEDV  119

Query  422  IDPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFD  601
              PNEQD+V+ TLLE FKCVP F+PPE+F+K+YHGFCKQQLWPLFHYMLPLSP+LGGRF+
Sbjct  120  -HPNEQDEVSMTLLENFKCVPTFLPPEMFTKYYHGFCKQQLWPLFHYMLPLSPELGGRFN  178

Query  602  RNLWQA  619
            R+LWQA
Sbjct  179  RSLWQA  184



>gb|KJB68366.1| hypothetical protein B456_010G241200 [Gossypium raimondii]
Length=690

 Score =   236 bits (602),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 147/183 (80%), Gaps = 4/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  250
            M+SRSY+NLLDLASG     G  R  K+L+RV TV GV+SELDD+  ++  SDV SS++Q
Sbjct  1    MMSRSYTNLLDLASGNFPVMGPVRERKRLTRVMTVPGVVSELDDDQANSVNSDVHSSVNQ  60

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  430
            +R+IIV NQLP++A R  D + GW+F+WD+ SLLLQLKDGL E++EV+YVG LK ++ D 
Sbjct  61   DRIIIVANQLPVKAKRGPDNK-GWSFNWDDYSLLLQLKDGLPEEMEVLYVGSLKIDV-DI  118

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
            NEQD+V+  LLE FKCVPAF+PPE+F+KFYHGFCKQ LW LFHYMLP S + GGRFDR+L
Sbjct  119  NEQDEVSSVLLEKFKCVPAFLPPEIFNKFYHGFCKQHLWSLFHYMLPYSANHGGRFDRSL  178

Query  611  WQA  619
            W+A
Sbjct  179  WEA  181



>emb|CDY01487.1| BnaC07g34770D [Brassica napus]
Length=837

 Score =   237 bits (605),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 140/182 (77%), Gaps = 24/182 (13%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNG-GSDVPSSISQE  253
            MVSRSYSNLLDLASG   +F R                    E +SN   SD PSSI+Q+
Sbjct  1    MVSRSYSNLLDLASGNFHSFSR--------------------EKKSNSVCSDAPSSIAQD  40

Query  254  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPN  433
            R+IIVGNQLP+++HR   G+    F+WD DSLLLQLKDG+ ED+EV+Y+GCLK+++ DP+
Sbjct  41   RIIIVGNQLPIKSHRNPSGK--LTFTWDNDSLLLQLKDGMREDMEVVYIGCLKDQV-DPS  97

Query  434  EQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLW  613
            EQDDV+Q LLE FKCVPA++PPE+F+K+YHGFCKQ LWPLFHYMLPL+PDLGGRFDR+LW
Sbjct  98   EQDDVSQRLLENFKCVPAYIPPEIFTKYYHGFCKQHLWPLFHYMLPLNPDLGGRFDRSLW  157

Query  614  QA  619
            QA
Sbjct  158  QA  159



>ref|XP_006843713.1| hypothetical protein AMTR_s00007p00214170 [Amborella trichopoda]
 gb|ERN05388.1| hypothetical protein AMTR_s00007p00214170 [Amborella trichopoda]
Length=846

 Score =   237 bits (605),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 147/181 (81%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M SRSY+NLLDLA+G      R+GK+L RV TV GV+SELDD++ ++  SDVPSS+SQER
Sbjct  1    MTSRSYTNLLDLATGNFPAPTRSGKRLPRVMTVPGVISELDDDNANSVSSDVPSSVSQER  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            +IIV NQLPLRA RR D   GW FSWD+DSLLLQLKDGL ++++VIY+G LK E+ D NE
Sbjct  61   IIIVANQLPLRARRRPDNR-GWIFSWDDDSLLLQLKDGLPDELDVIYIGSLKVEV-DLNE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            Q++VAQ LLE FKCVPAF+ PEL  KFYHGFCKQ LWPLFHYMLPLSP  G RFDR+LWQ
Sbjct  119  QEEVAQILLEKFKCVPAFLSPELLIKFYHGFCKQHLWPLFHYMLPLSPHHGNRFDRSLWQ  178

Query  617  A  619
            A
Sbjct  179  A  179



>gb|KJB68367.1| hypothetical protein B456_010G241200 [Gossypium raimondii]
Length=710

 Score =   235 bits (600),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 147/183 (80%), Gaps = 4/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  250
            M+SRSY+NLLDLASG     G  R  K+L+RV TV GV+SELDD+  ++  SDV SS++Q
Sbjct  1    MMSRSYTNLLDLASGNFPVMGPVRERKRLTRVMTVPGVVSELDDDQANSVNSDVHSSVNQ  60

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  430
            +R+IIV NQLP++A R  D + GW+F+WD+ SLLLQLKDGL E++EV+YVG LK ++ D 
Sbjct  61   DRIIIVANQLPVKAKRGPDNK-GWSFNWDDYSLLLQLKDGLPEEMEVLYVGSLKIDV-DI  118

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
            NEQD+V+  LLE FKCVPAF+PPE+F+KFYHGFCKQ LW LFHYMLP S + GGRFDR+L
Sbjct  119  NEQDEVSSVLLEKFKCVPAFLPPEIFNKFYHGFCKQHLWSLFHYMLPYSANHGGRFDRSL  178

Query  611  WQA  619
            W+A
Sbjct  179  WEA  181



>ref|XP_007025310.1| Trehalose-phosphatase/synthase 7 isoform 4 [Theobroma cacao]
 gb|EOY27932.1| Trehalose-phosphatase/synthase 7 isoform 4 [Theobroma cacao]
Length=754

 Score =   236 bits (601),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 151/183 (83%), Gaps = 4/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRA--GKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  250
            M+SRSY+NLLDLASG     G+A   K+L RV TV GV+SELDD+  ++  SDVPSS+ Q
Sbjct  1    MMSRSYTNLLDLASGNFPVMGQAREKKRLPRVMTVPGVISELDDDQANSVSSDVPSSVIQ  60

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  430
            +R+IIV NQLP++A RR D + GW+FSWD+DSLLLQLKDGL E++EV+YVG LK ++ DP
Sbjct  61   DRIIIVANQLPVKAKRRPDNK-GWSFSWDDDSLLLQLKDGLPEEMEVLYVGSLKVDV-DP  118

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
            NEQDDV+Q LL+ FKCVPAF+PP++ +KFYHGFCKQ LWPLFHYMLP S + GGRFDR+L
Sbjct  119  NEQDDVSQLLLDRFKCVPAFLPPDILTKFYHGFCKQHLWPLFHYMLPFSANHGGRFDRSL  178

Query  611  WQA  619
            W+A
Sbjct  179  WEA  181



>ref|XP_007025309.1| Trehalose-phosphatase/synthase 7 isoform 3 [Theobroma cacao]
 gb|EOY27931.1| Trehalose-phosphatase/synthase 7 isoform 3 [Theobroma cacao]
Length=764

 Score =   236 bits (601),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 151/183 (83%), Gaps = 4/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRA--GKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  250
            M+SRSY+NLLDLASG     G+A   K+L RV TV GV+SELDD+  ++  SDVPSS+ Q
Sbjct  1    MMSRSYTNLLDLASGNFPVMGQAREKKRLPRVMTVPGVISELDDDQANSVSSDVPSSVIQ  60

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  430
            +R+IIV NQLP++A RR D + GW+FSWD+DSLLLQLKDGL E++EV+YVG LK ++ DP
Sbjct  61   DRIIIVANQLPVKAKRRPDNK-GWSFSWDDDSLLLQLKDGLPEEMEVLYVGSLKVDV-DP  118

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
            NEQDDV+Q LL+ FKCVPAF+PP++ +KFYHGFCKQ LWPLFHYMLP S + GGRFDR+L
Sbjct  119  NEQDDVSQLLLDRFKCVPAFLPPDILTKFYHGFCKQHLWPLFHYMLPFSANHGGRFDRSL  178

Query  611  WQA  619
            W+A
Sbjct  179  WEA  181



>gb|AEQ54916.1| trehalose-6-phosphate synthase [Salvia miltiorrhiza]
Length=857

 Score =   237 bits (604),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 153/185 (83%), Gaps = 5/185 (3%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGE--SLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  250
            MVSRSYSNLL+LASGE  S +F R  +++ R+ TVAG++S++DD+   +  SD  SS SQ
Sbjct  1    MVSRSYSNLLELASGEAPSPSFSRMSRRIPRIMTVAGIMSDIDDDGSDSVSSDPSSSSSQ  60

Query  251  -ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLG-EDVEVIYVGCLKEEII  424
             +R+IIV NQLP++ H++TD  +GW FSWD++SL LQLKD LG ED E IYVGCLKEEI 
Sbjct  61   KDRIIIVANQLPIKVHKKTDNSKGWTFSWDDNSLYLQLKDCLGDEDTEFIYVGCLKEEI-  119

Query  425  DPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDR  604
             PN+QD+V+Q LLETFKC+P F+PP+L+S++YHGFCKQQLWPLFHYMLPLSPDLGGRF+R
Sbjct  120  HPNDQDEVSQILLETFKCIPTFLPPDLYSRYYHGFCKQQLWPLFHYMLPLSPDLGGRFNR  179

Query  605  NLWQA  619
            + WQA
Sbjct  180  SSWQA  184



>ref|XP_010916234.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Elaeis guineensis]
Length=856

 Score =   237 bits (604),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 148/183 (81%), Gaps = 5/183 (3%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLL+L SGE  + GR  +++ RV TVAG++S+LD++S S+  +   SS   +R
Sbjct  1    MVSRSYSNLLELTSGEPPSVGRIRRRIPRVMTVAGLISDLDEDSDSDTSAGTSSS-PHDR  59

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGE--DVEVIYVGCLKEEIIDP  430
             I+V N LP+RAHRR DG  GW FSWDEDSLLLQLKD +G+  D+E IYVGCL++EI  P
Sbjct  60   TIVVANHLPVRAHRRPDGR-GWTFSWDEDSLLLQLKDAIGDHCDMEFIYVGCLRDEI-PP  117

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
             +QD+V Q LLETFKCVPAF+PP+L ++FYHGFCKQ LWPLFHYMLPLSP+LGGRFDR+L
Sbjct  118  ADQDEVGQILLETFKCVPAFLPPDLLARFYHGFCKQHLWPLFHYMLPLSPELGGRFDRSL  177

Query  611  WQA  619
            WQA
Sbjct  178  WQA  180



>ref|XP_007025308.1| Trehalose-phosphatase/synthase 7 isoform 2 [Theobroma cacao]
 gb|EOY27930.1| Trehalose-phosphatase/synthase 7 isoform 2 [Theobroma cacao]
Length=857

 Score =   236 bits (602),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 151/183 (83%), Gaps = 4/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRA--GKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  250
            M+SRSY+NLLDLASG     G+A   K+L RV TV GV+SELDD+  ++  SDVPSS+ Q
Sbjct  1    MMSRSYTNLLDLASGNFPVMGQAREKKRLPRVMTVPGVISELDDDQANSVSSDVPSSVIQ  60

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  430
            +R+IIV NQLP++A RR D + GW+FSWD+DSLLLQLKDGL E++EV+YVG LK ++ DP
Sbjct  61   DRIIIVANQLPVKAKRRPDNK-GWSFSWDDDSLLLQLKDGLPEEMEVLYVGSLKVDV-DP  118

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
            NEQDDV+Q LL+ FKCVPAF+PP++ +KFYHGFCKQ LWPLFHYMLP S + GGRFDR+L
Sbjct  119  NEQDDVSQLLLDRFKCVPAFLPPDILTKFYHGFCKQHLWPLFHYMLPFSANHGGRFDRSL  178

Query  611  WQA  619
            W+A
Sbjct  179  WEA  181



>ref|XP_002281386.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Vitis vinifera]
Length=705

 Score =   234 bits (596),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 144/181 (80%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M+SRSY+NLLDLA+G     GR  K+L RV TV G + ELDD+  ++  SD PSS++Q+R
Sbjct  1    MMSRSYTNLLDLATGNFPAIGRERKRLPRVMTVPGNVYELDDDQANSVSSDNPSSVAQDR  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            +IIV NQLP++A+RR D + GW FSW+EDSLLLQLK+GL ED+EV+YVG L+ ++ D  E
Sbjct  61   LIIVANQLPVKANRRAD-DRGWVFSWNEDSLLLQLKEGLPEDMEVLYVGSLRVDV-DLTE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            Q++V+Q LLETFKCVP F+P ++  KFYHGFCK+ LWPLFHYMLP S D GGRFDR++W+
Sbjct  119  QEEVSQILLETFKCVPTFLPHDVLEKFYHGFCKKLLWPLFHYMLPFSADHGGRFDRSMWE  178

Query  617  A  619
            A
Sbjct  179  A  179



>gb|KJB68365.1| hypothetical protein B456_010G241200 [Gossypium raimondii]
Length=857

 Score =   236 bits (601),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 147/183 (80%), Gaps = 4/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  250
            M+SRSY+NLLDLASG     G  R  K+L+RV TV GV+SELDD+  ++  SDV SS++Q
Sbjct  1    MMSRSYTNLLDLASGNFPVMGPVRERKRLTRVMTVPGVVSELDDDQANSVNSDVHSSVNQ  60

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  430
            +R+IIV NQLP++A R  D + GW+F+WD+ SLLLQLKDGL E++EV+YVG LK ++ D 
Sbjct  61   DRIIIVANQLPVKAKRGPDNK-GWSFNWDDYSLLLQLKDGLPEEMEVLYVGSLKIDV-DI  118

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
            NEQD+V+  LLE FKCVPAF+PPE+F+KFYHGFCKQ LW LFHYMLP S + GGRFDR+L
Sbjct  119  NEQDEVSSVLLEKFKCVPAFLPPEIFNKFYHGFCKQHLWSLFHYMLPYSANHGGRFDRSL  178

Query  611  WQA  619
            W+A
Sbjct  179  WEA  181



>ref|XP_009105068.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Brassica rapa]
Length=863

 Score =   235 bits (600),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 149/195 (76%), Gaps = 17/195 (9%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLL+LASG+S TFGR  +++ R+  VAG++S +D++S+ +  S   S   ++R
Sbjct  1    MVSRSYSNLLELASGDSPTFGRMNRQIPRIMAVAGIMSNIDNDSKESSPSSDLSP--KDR  58

Query  257  MIIVGNQLPLRAHRRTDGE-----------EGWNFSWDEDSLLLQLKDGLGED---VEVI  394
            +IIV N+LP+RA R+ +             +GW FS DE+SLLLQLKDGLG +    EVI
Sbjct  59   IIIVANELPIRAQRKLETSSTSTSTTHCSSKGWTFSLDENSLLLQLKDGLGSEATTTEVI  118

Query  395  YVGCLKEEIIDPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPL  574
            YVGCLKE+I  PNEQ++V Q LLE FKCVP F+P +L++++YHGFCKQQLWPLFHYMLPL
Sbjct  119  YVGCLKEDI-HPNEQEEVYQLLLENFKCVPTFLPLDLYTRYYHGFCKQQLWPLFHYMLPL  177

Query  575  SPDLGGRFDRNLWQA  619
            SPDLGGRFDR+LWQA
Sbjct  178  SPDLGGRFDRSLWQA  192



>ref|XP_007025307.1| Trehalose-phosphatase/synthase 7 isoform 1 [Theobroma cacao]
 gb|EOY27929.1| Trehalose-phosphatase/synthase 7 isoform 1 [Theobroma cacao]
Length=888

 Score =   236 bits (601),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 151/183 (83%), Gaps = 4/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRA--GKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  250
            M+SRSY+NLLDLASG     G+A   K+L RV TV GV+SELDD+  ++  SDVPSS+ Q
Sbjct  1    MMSRSYTNLLDLASGNFPVMGQAREKKRLPRVMTVPGVISELDDDQANSVSSDVPSSVIQ  60

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  430
            +R+IIV NQLP++A RR D + GW+FSWD+DSLLLQLKDGL E++EV+YVG LK ++ DP
Sbjct  61   DRIIIVANQLPVKAKRRPDNK-GWSFSWDDDSLLLQLKDGLPEEMEVLYVGSLKVDV-DP  118

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
            NEQDDV+Q LL+ FKCVPAF+PP++ +KFYHGFCKQ LWPLFHYMLP S + GGRFDR+L
Sbjct  119  NEQDDVSQLLLDRFKCVPAFLPPDILTKFYHGFCKQHLWPLFHYMLPFSANHGGRFDRSL  178

Query  611  WQA  619
            W+A
Sbjct  179  WEA  181



>ref|XP_008225229.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Prunus mume]
Length=854

 Score =   235 bits (599),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 148/181 (82%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M+S+SY+NLLDLASG     GR  ++L RV TVAGV+SELDD+  ++  SDVPSS+ Q+R
Sbjct  1    MMSKSYTNLLDLASGNFPIMGRERRRLPRVMTVAGVISELDDDQANSVSSDVPSSVMQDR  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            +IIV NQLP++A RR D + GW+FSWDEDSLLLQLKDGL E++EV+YVG L  E+ D NE
Sbjct  61   IIIVANQLPVKAKRRPDNK-GWSFSWDEDSLLLQLKDGLPEEMEVLYVGSLNVEV-DSNE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDV+Q LL+ FKCVPAF+P ++ SKFYHGFCKQ LWPLFHYMLP S + GGRFDR+LW+
Sbjct  119  QDDVSQLLLDRFKCVPAFLPHDILSKFYHGFCKQHLWPLFHYMLPFSANHGGRFDRSLWE  178

Query  617  A  619
            A
Sbjct  179  A  179



>ref|XP_010052868.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X2 [Eucalyptus grandis]
 gb|KCW89661.1| hypothetical protein EUGRSUZ_A01931 [Eucalyptus grandis]
Length=862

 Score =   234 bits (598),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 140/181 (77%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M+SRSY+NL+DLA+G     GR  K+  R  TV G ++ELDD+   +  S+ PSS++ +R
Sbjct  1    MMSRSYTNLVDLATGNFPAMGREKKRFPRTMTVPGNIAELDDDQAYSVTSENPSSVTSDR  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIVGNQLPL+A RR D + GW+FSW+EDSLLLQLKDG  +D+EV YVG LK  + DP+E
Sbjct  61   MIIVGNQLPLKATRRPD-DTGWSFSWNEDSLLLQLKDGFADDMEVFYVGLLKVSV-DPSE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDV+QTLLE FKCVP F+P ++ SKFY GFCK+QLWPLFHYMLP S + GG FDR+ W+
Sbjct  119  QDDVSQTLLEKFKCVPTFLPSDILSKFYDGFCKRQLWPLFHYMLPFSAERGGHFDRSSWE  178

Query  617  A  619
            A
Sbjct  179  A  179



>ref|XP_009624608.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X3 [Nicotiana tomentosiformis]
Length=754

 Score =   233 bits (595),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 144/181 (80%), Gaps = 5/181 (3%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M+S+SY+NLLDLASG    F    ++L RV TVAGV+SELDD+  ++  SDVPSSI  +R
Sbjct  1    MLSKSYTNLLDLASG---NFPVMKRRLPRVMTVAGVISELDDDQANSVTSDVPSSIIVDR  57

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            +IIV NQLP++A RR D + GW+FSWD+DSLLL +KDGL +D+EV+YVGCL+ E+ D +E
Sbjct  58   IIIVANQLPVKAKRRPDNK-GWSFSWDDDSLLLHIKDGLPDDMEVLYVGCLRVEV-DSSE  115

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDV+Q LL+ FKCVPAF+P ++ SK+YHGFCKQ LWPLFHYMLP S   G RFDR+ W+
Sbjct  116  QDDVSQLLLDRFKCVPAFLPADILSKYYHGFCKQNLWPLFHYMLPYSASHGSRFDRSWWE  175

Query  617  A  619
            A
Sbjct  176  A  176



>ref|XP_010052859.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X1 [Eucalyptus grandis]
Length=876

 Score =   234 bits (598),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 140/181 (77%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M+SRSY+NL+DLA+G     GR  K+  R  TV G ++ELDD+   +  S+ PSS++ +R
Sbjct  15   MMSRSYTNLVDLATGNFPAMGREKKRFPRTMTVPGNIAELDDDQAYSVTSENPSSVTSDR  74

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIVGNQLPL+A RR D + GW+FSW+EDSLLLQLKDG  +D+EV YVG LK  + DP+E
Sbjct  75   MIIVGNQLPLKATRRPD-DTGWSFSWNEDSLLLQLKDGFADDMEVFYVGLLKVSV-DPSE  132

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDV+QTLLE FKCVP F+P ++ SKFY GFCK+QLWPLFHYMLP S + GG FDR+ W+
Sbjct  133  QDDVSQTLLEKFKCVPTFLPSDILSKFYDGFCKRQLWPLFHYMLPFSAERGGHFDRSSWE  192

Query  617  A  619
            A
Sbjct  193  A  193



>ref|XP_009624607.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X2 [Nicotiana tomentosiformis]
Length=755

 Score =   233 bits (594),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 144/181 (80%), Gaps = 5/181 (3%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M+S+SY+NLLDLASG    F    ++L RV TVAGV+SELDD+  ++  SDVPSSI  +R
Sbjct  1    MLSKSYTNLLDLASG---NFPVMKRRLPRVMTVAGVISELDDDQANSVTSDVPSSIIVDR  57

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            +IIV NQLP++A RR D + GW+FSWD+DSLLL +KDGL +D+EV+YVGCL+ E+ D +E
Sbjct  58   IIIVANQLPVKAKRRPDNK-GWSFSWDDDSLLLHIKDGLPDDMEVLYVGCLRVEV-DSSE  115

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDV+Q LL+ FKCVPAF+P ++ SK+YHGFCKQ LWPLFHYMLP S   G RFDR+ W+
Sbjct  116  QDDVSQLLLDRFKCVPAFLPADILSKYYHGFCKQNLWPLFHYMLPYSASHGSRFDRSWWE  175

Query  617  A  619
            A
Sbjct  176  A  176



>gb|KDO77921.1| hypothetical protein CISIN_1g003025mg [Citrus sinensis]
Length=761

 Score =   233 bits (593),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 149/183 (81%), Gaps = 4/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  250
            M+S+SY+NLLDLASG     G  R  K+L RV TV GV+SELDD+  ++  SDVPSS++Q
Sbjct  1    MMSKSYTNLLDLASGNFPAMGPSREKKRLPRVMTVPGVISELDDDQANSVSSDVPSSVAQ  60

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  430
            +R+IIV NQLP++A RR D + GW+FSWDEDSLLLQLKDGL ED+EVIYVG LK ++ D 
Sbjct  61   DRVIIVANQLPVKAKRRPDNK-GWSFSWDEDSLLLQLKDGLPEDMEVIYVGSLKVDV-DL  118

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
            +EQDDV+Q LL+ FKCVPAF+PP++ +KFYHGFCKQ LWPLFHYMLP S   GGRFDR+L
Sbjct  119  SEQDDVSQLLLDRFKCVPAFLPPDILTKFYHGFCKQHLWPLFHYMLPFSATHGGRFDRSL  178

Query  611  WQA  619
            W+A
Sbjct  179  WEA  181



>ref|XP_009624606.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X1 [Nicotiana tomentosiformis]
Length=851

 Score =   234 bits (596),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 144/181 (80%), Gaps = 5/181 (3%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M+S+SY+NLLDLASG    F    ++L RV TVAGV+SELDD+  ++  SDVPSSI  +R
Sbjct  1    MLSKSYTNLLDLASG---NFPVMKRRLPRVMTVAGVISELDDDQANSVTSDVPSSIIVDR  57

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            +IIV NQLP++A RR D + GW+FSWD+DSLLL +KDGL +D+EV+YVGCL+ E+ D +E
Sbjct  58   IIIVANQLPVKAKRRPDNK-GWSFSWDDDSLLLHIKDGLPDDMEVLYVGCLRVEV-DSSE  115

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDV+Q LL+ FKCVPAF+P ++ SK+YHGFCKQ LWPLFHYMLP S   G RFDR+ W+
Sbjct  116  QDDVSQLLLDRFKCVPAFLPADILSKYYHGFCKQNLWPLFHYMLPYSASHGSRFDRSWWE  175

Query  617  A  619
            A
Sbjct  176  A  176



>emb|CAN67058.1| hypothetical protein VITISV_036715 [Vitis vinifera]
Length=886

 Score =   234 bits (596),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 144/181 (80%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M+SRSY+NLLDLA+G     GR  K+L RV TV G + ELDD+  ++  SD PSS++Q+R
Sbjct  1    MMSRSYTNLLDLATGNFPAIGRERKRLPRVMTVPGNVYELDDDQANSVSSDNPSSVAQDR  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            +IIV NQLP++A+RR D + GW FSW+EDSLLLQLK+GL ED+EV+YVG L+ ++ D  E
Sbjct  61   LIIVANQLPVKANRRAD-DRGWVFSWNEDSLLLQLKEGLPEDMEVLYVGSLRVDV-DLEE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            Q++V+Q LLETFKCVP F+P ++  KFYHGFCK+ LWPLFHYMLP S D GGRFDR++W+
Sbjct  119  QEEVSQILLETFKCVPTFLPHDVLEKFYHGFCKKLLWPLFHYMLPFSADHGGRFDRSMWE  178

Query  617  A  619
            A
Sbjct  179  A  179



>ref|XP_010557135.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X1 [Tarenaya hassleriana]
 ref|XP_010557136.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X2 [Tarenaya hassleriana]
Length=851

 Score =   233 bits (595),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 139/181 (77%), Gaps = 4/181 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M+SRSY+NLLDLASG     GR  ++L RV TV G +SE D++   +  SD PSSIS +R
Sbjct  1    MISRSYTNLLDLASGNFPVMGRERRRLPRVMTVPGNVSEFDEDQAYSVSSDNPSSISTDR  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIV N+LPL+A RR      WNFSW++DSL LQLKDGL ED+EV+YVG L  ++ DP E
Sbjct  61   MIIVANRLPLKAERRNGS---WNFSWNQDSLYLQLKDGLPEDMEVLYVGSLDVDV-DPYE  116

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDVAQ LL+ FKCVP F+PP+L SKFY GFCK+QLWPLFHYMLP S D GGRF+R+LW+
Sbjct  117  QDDVAQILLDGFKCVPTFLPPDLQSKFYDGFCKRQLWPLFHYMLPFSADHGGRFERSLWE  176

Query  617  A  619
            A
Sbjct  177  A  177



>ref|XP_003633255.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Vitis vinifera]
Length=855

 Score =   233 bits (595),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 144/181 (80%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M+SRSY+NLLDLA+G     GR  K+L RV TV G + ELDD+  ++  SD PSS++Q+R
Sbjct  1    MMSRSYTNLLDLATGNFPAIGRERKRLPRVMTVPGNVYELDDDQANSVSSDNPSSVAQDR  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            +IIV NQLP++A+RR D + GW FSW+EDSLLLQLK+GL ED+EV+YVG L+ ++ D  E
Sbjct  61   LIIVANQLPVKANRRAD-DRGWVFSWNEDSLLLQLKEGLPEDMEVLYVGSLRVDV-DLEE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            Q++V+Q LLETFKCVP F+P ++  KFYHGFCK+ LWPLFHYMLP S D GGRFDR++W+
Sbjct  119  QEEVSQILLETFKCVPTFLPHDVLEKFYHGFCKKLLWPLFHYMLPFSADHGGRFDRSMWE  178

Query  617  A  619
            A
Sbjct  179  A  179



>gb|EYU30144.1| hypothetical protein MIMGU_mgv1a001255mg [Erythranthe guttata]
Length=852

 Score =   233 bits (595),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 152/188 (81%), Gaps = 12/188 (6%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGE--SLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  250
            MVSRSYSNL+DLASGE  S +F R  +++ R+ TVAG++S+ DD   S+  S    +  +
Sbjct  1    MVSRSYSNLMDLASGEAQSPSFTRLSRRIPRIMTVAGIISDSDDGYSSSSSS----AAQR  56

Query  251  ERMIIVGNQLPLRAHRRTDGEEG----WNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKE  415
            +R+IIV NQLP++AHR+TDG  G    W F+WDEDS+LLQLKDGL  D ++ IYVGCLKE
Sbjct  57   DRIIIVANQLPIKAHRKTDGGGGGGGGWTFTWDEDSILLQLKDGLAPDEIDFIYVGCLKE  116

Query  416  EIIDPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGR  595
            +I  PN+QD+V+Q LLE+FKCVP F+PP+LFS++YHGFCKQQLWPLFHYMLPLSPDLGGR
Sbjct  117  DI-HPNDQDEVSQILLESFKCVPTFLPPDLFSRYYHGFCKQQLWPLFHYMLPLSPDLGGR  175

Query  596  FDRNLWQA  619
            F+R+LWQA
Sbjct  176  FNRSLWQA  183



>ref|XP_006449548.1| hypothetical protein CICLE_v10014248mg [Citrus clementina]
 ref|XP_006449549.1| hypothetical protein CICLE_v10014248mg [Citrus clementina]
 gb|ESR62788.1| hypothetical protein CICLE_v10014248mg [Citrus clementina]
 gb|ESR62789.1| hypothetical protein CICLE_v10014248mg [Citrus clementina]
Length=856

 Score =   233 bits (595),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 149/183 (81%), Gaps = 4/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  250
            M+S+SY+NLLDLASG     G  R  K+L RV TV GV+SELDD+  ++  SDVPSS++Q
Sbjct  1    MMSKSYTNLLDLASGNFPAMGPSREKKRLPRVMTVPGVISELDDDQANSVSSDVPSSVAQ  60

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  430
            +R+IIV NQLP++A RR D + GW+FSWDEDSLLLQLKDGL ED+EVIYVG LK ++ D 
Sbjct  61   DRVIIVANQLPVKAKRRPDNK-GWSFSWDEDSLLLQLKDGLPEDMEVIYVGSLKVDV-DL  118

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
            +EQDDV+Q LL+ FKCVPAF+PP++ +KFYHGFCKQ LWPLFHYMLP S   GGRFDR+L
Sbjct  119  SEQDDVSQLLLDRFKCVPAFLPPDILTKFYHGFCKQHLWPLFHYMLPFSATHGGRFDRSL  178

Query  611  WQA  619
            W+A
Sbjct  179  WEA  181



>ref|XP_006467609.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7-like [Citrus sinensis]
 gb|KDO77917.1| hypothetical protein CISIN_1g003025mg [Citrus sinensis]
 gb|KDO77918.1| hypothetical protein CISIN_1g003025mg [Citrus sinensis]
 gb|KDO77919.1| hypothetical protein CISIN_1g003025mg [Citrus sinensis]
 gb|KDO77920.1| hypothetical protein CISIN_1g003025mg [Citrus sinensis]
Length=856

 Score =   233 bits (595),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 149/183 (81%), Gaps = 4/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  250
            M+S+SY+NLLDLASG     G  R  K+L RV TV GV+SELDD+  ++  SDVPSS++Q
Sbjct  1    MMSKSYTNLLDLASGNFPAMGPSREKKRLPRVMTVPGVISELDDDQANSVSSDVPSSVAQ  60

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  430
            +R+IIV NQLP++A RR D + GW+FSWDEDSLLLQLKDGL ED+EVIYVG LK ++ D 
Sbjct  61   DRVIIVANQLPVKAKRRPDNK-GWSFSWDEDSLLLQLKDGLPEDMEVIYVGSLKVDV-DL  118

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
            +EQDDV+Q LL+ FKCVPAF+PP++ +KFYHGFCKQ LWPLFHYMLP S   GGRFDR+L
Sbjct  119  SEQDDVSQLLLDRFKCVPAFLPPDILTKFYHGFCKQHLWPLFHYMLPFSATHGGRFDRSL  178

Query  611  WQA  619
            W+A
Sbjct  179  WEA  181



>ref|XP_011070304.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 isoform X2 [Sesamum indicum]
 ref|XP_011070305.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 isoform X2 [Sesamum indicum]
Length=804

 Score =   232 bits (592),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/122 (89%), Positives = 117/122 (96%), Gaps = 2/122 (2%)
 Frame = +2

Query  257  MIIVGNQLPLRAHRR-TDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPN  433
            MIIVGNQLPLRAHRR +DG++GW+FSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEI D +
Sbjct  1    MIIVGNQLPLRAHRRESDGDKGWDFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEI-DVS  59

Query  434  EQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLW  613
            EQ+DVAQTLLETFKCVPAF+P ELFSKFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR+LW
Sbjct  60   EQEDVAQTLLETFKCVPAFIPSELFSKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRSLW  119

Query  614  QA  619
            QA
Sbjct  120  QA  121



>ref|XP_010531642.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Tarenaya hassleriana]
Length=865

 Score =   233 bits (593),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 147/194 (76%), Gaps = 14/194 (7%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSISQE  253
            MVSRSYSNLLDLASG+S +FGR  + + R+ TVAG +S +DD+ + S       S+  ++
Sbjct  1    MVSRSYSNLLDLASGDSPSFGRMSRGIPRIMTVAGFMSNIDDDPAESASSDPSSSTAHKD  60

Query  254  RMIIVGNQLPLRAHRRTDGE-----------EGWNFSWDEDSLLLQLKDGLG-EDVEVIY  397
            R+IIV NQLP+RA +R+D               W F+WDE+SLLLQLKD LG ED++V+Y
Sbjct  61   RLIIVANQLPIRAQKRSDKSSTSSSNNGGGCRNWIFNWDENSLLLQLKDALGKEDIDVLY  120

Query  398  VGCLKEEIIDPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLS  577
            VGCLK+EI  PN+Q++V+Q L+ETFKCVP F+P +L+S++YHGFCKQ LWPLFHYMLPLS
Sbjct  121  VGCLKDEI-HPNDQEEVSQILVETFKCVPTFLPTDLYSRYYHGFCKQHLWPLFHYMLPLS  179

Query  578  PDLGGRFDRNLWQA  619
            PDL GRF+RN WQA
Sbjct  180  PDLSGRFNRNQWQA  193



>gb|KDO53157.1| hypothetical protein CISIN_1g002958mg [Citrus sinensis]
Length=803

 Score =   231 bits (590),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 114/121 (94%), Gaps = 1/121 (1%)
 Frame = +2

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIVGNQLPLRAHR +DG  GW FSWDEDSLLLQLKDGLGEDVEVIYVGC+KE+I D +E
Sbjct  1    MIIVGNQLPLRAHRSSDGSGGWTFSWDEDSLLLQLKDGLGEDVEVIYVGCIKEQI-DLSE  59

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QD+V+QTLLETFKCVPAF+PPELFSKFYHGFCKQ LWPLFHYMLPLSPDLGGRFDR+LWQ
Sbjct  60   QDEVSQTLLETFKCVPAFIPPELFSKFYHGFCKQHLWPLFHYMLPLSPDLGGRFDRSLWQ  119

Query  617  A  619
            A
Sbjct  120  A  120



>ref|XP_010926098.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Elaeis guineensis]
Length=856

 Score =   231 bits (589),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 153/183 (84%), Gaps = 5/183 (3%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLL+LASGE  + GR  +++ RV TVAG++S+LDD+S S+  +  PSS  ++R
Sbjct  1    MVSRSYSNLLELASGEPPSIGRIRRRIPRVMTVAGIISDLDDDSDSDNSAG-PSSSPRDR  59

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGE--DVEVIYVGCLKEEIIDP  430
             I+V N LP+RAHRR DG  GW FSWDEDSLLLQLKD +G+  D+E IYVGCL++EI  P
Sbjct  60   TIVVANHLPIRAHRRPDGR-GWTFSWDEDSLLLQLKDAIGDHCDMEFIYVGCLRDEI-PP  117

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
             +QD+V+Q LL+TFKCVPAF+PP+L ++FYHGFCKQQLWPLFHYMLPLSP+LGGRFDR+L
Sbjct  118  ADQDEVSQILLDTFKCVPAFLPPDLLARFYHGFCKQQLWPLFHYMLPLSPELGGRFDRSL  177

Query  611  WQA  619
            WQA
Sbjct  178  WQA  180



>ref|XP_008381189.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Malus domestica]
Length=854

 Score =   231 bits (589),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 137/180 (76%), Gaps = 2/180 (1%)
 Frame = +2

Query  80   VSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQERM  259
            +S+SY NLLDLASG   T     ++  RV T  G LS+LDD+   +  SD PSSI+ +R+
Sbjct  1    MSQSYINLLDLASGNFPTMEGKRRRFPRVNTAPGNLSDLDDDQARSVSSDQPSSIASDRV  60

Query  260  IIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNEQ  439
            IIV NQLP++A RR D + GW FSW+EDSLLLQLKDGL ED+EV+YVG LK  + DP EQ
Sbjct  61   IIVANQLPVKAKRREDNK-GWTFSWNEDSLLLQLKDGLPEDMEVLYVGSLKVSV-DPKEQ  118

Query  440  DDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQA  619
            DDV+Q LLE FKCVP F+PP++ SKFY GFCK+ LWPLFHYMLP S D GGRFDR+LW+A
Sbjct  119  DDVSQVLLERFKCVPTFLPPDILSKFYDGFCKRHLWPLFHYMLPFSADQGGRFDRSLWEA  178



>gb|ACA62945.1| trehalose-6-phosphate synthase [Zostera marina]
Length=870

 Score =   230 bits (587),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 144/189 (76%), Gaps = 10/189 (5%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGE--------SLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDV  232
            M+SRSY+NLLDLASG                 +++ RV TV   ++EL+DE  S+  SDV
Sbjct  1    MMSRSYTNLLDLASGNFPVISGGGRDGRSGGMRRMPRVMTVPSNIAELEDEQASSVASDV  60

Query  233  PSSISQERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLK  412
             SSI Q+R+IIVGNQLP+ A RR+D   GW+FSWD++SLLLQLKDGL +D+EV+YVGCL+
Sbjct  61   QSSIIQDRLIIVGNQLPVVAKRRSDNA-GWDFSWDDESLLLQLKDGLPDDMEVLYVGCLR  119

Query  413  EEIIDPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGG  592
              I+DP EQDDV+QTLLE FKCVPAF+  E+  K+YHGFCK+ LWPLFHYMLPL+ D GG
Sbjct  120  V-IVDPEEQDDVSQTLLEKFKCVPAFLTEEILEKYYHGFCKKLLWPLFHYMLPLTKDHGG  178

Query  593  RFDRNLWQA  619
            RFDR+LW+A
Sbjct  179  RFDRSLWEA  187



>ref|XP_011082978.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Sesamum indicum]
 ref|XP_011082980.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Sesamum indicum]
Length=867

 Score =   230 bits (586),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 141/183 (77%), Gaps = 4/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAG--KKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  250
            M+SRSY+NLL+LASG     GR    K+  RV TV G + ELDDE  ++  S+ PSS++ 
Sbjct  1    MMSRSYTNLLELASGNFPVMGREKERKRFPRVMTVPGNIVELDDEQANSVTSENPSSVAG  60

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  430
            +RMIIV N LPL+A RR D + GW+FSW+EDSL+L++KDG  ED+EV+YVG L  ++ DP
Sbjct  61   DRMIIVSNLLPLKAKRRPDNK-GWSFSWNEDSLILRVKDGFPEDMEVLYVGSLPVDV-DP  118

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
             EQDDVA  LLE FKCVPAF+PP L +K+YHGFCK+QLWPLFHYMLP S D GGRFDR++
Sbjct  119  IEQDDVANYLLEKFKCVPAFLPPNLLAKYYHGFCKKQLWPLFHYMLPFSADHGGRFDRSM  178

Query  611  WQA  619
            W+A
Sbjct  179  WEA  181



>ref|XP_006417924.1| hypothetical protein EUTSA_v10006783mg [Eutrema salsugineum]
 ref|XP_006417925.1| hypothetical protein EUTSA_v10006783mg [Eutrema salsugineum]
 ref|XP_006417926.1| hypothetical protein EUTSA_v10006783mg [Eutrema salsugineum]
 gb|ESQ36277.1| hypothetical protein EUTSA_v10006783mg [Eutrema salsugineum]
 gb|ESQ36278.1| hypothetical protein EUTSA_v10006783mg [Eutrema salsugineum]
 gb|ESQ36279.1| hypothetical protein EUTSA_v10006783mg [Eutrema salsugineum]
Length=851

 Score =   230 bits (586),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 138/181 (76%), Gaps = 4/181 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M+SRSY+NLLDLASG     GR  ++L RV TV G +SE D++   +  SD PSS+S +R
Sbjct  1    MISRSYTNLLDLASGNFPVMGRERRRLPRVMTVPGNVSEFDEDQAYSVSSDNPSSVSCDR  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIV N+LPL+A RR      W+FSWD+D+L LQLKDGL ED+EV+YVG L  +I D +E
Sbjct  61   MIIVANRLPLKAERRNGC---WSFSWDQDALYLQLKDGLPEDMEVLYVGSLSVDI-DSHE  116

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDVAQ LL+ FKCVP F PP+L SKFY GFCK+QLWPLFHYMLP S D GGRFDR+LW+
Sbjct  117  QDDVAQILLDKFKCVPTFFPPDLQSKFYDGFCKRQLWPLFHYMLPFSADHGGRFDRSLWE  176

Query  617  A  619
            A
Sbjct  177  A  177



>ref|XP_008455290.1| PREDICTED: LOW QUALITY PROTEIN: probable alpha,alpha-trehalose-phosphate 
synthase [UDP-forming] 7 [Cucumis melo]
Length=856

 Score =   230 bits (586),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 137/181 (76%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M+SRSY+NLLDLASG         K+  RV TV G ++ELDD+   +  S+ PSSIS +R
Sbjct  1    MISRSYTNLLDLASGNFPAMEVKKKRFPRVMTVPGNVAELDDDQAYSVTSENPSSISSDR  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIV NQLPLRA RR D +  W+FSW+EDSLLLQLKDGL ED+E++YVG LK +I  P E
Sbjct  61   MIIVANQLPLRAKRRED-DNSWSFSWNEDSLLLQLKDGLPEDMEILYVGSLKVDI-QPEE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QD+V+Q LLE F+C+PAF+PP +  KFY GFCK+ LWPLFHYMLP S D  GRFDR++W+
Sbjct  119  QDEVSQILLERFRCIPAFLPPHILEKFYDGFCKRHLWPLFHYMLPYSADQKGRFDRSMWE  178

Query  617  A  619
            A
Sbjct  179  A  179



>ref|XP_010522084.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Tarenaya hassleriana]
Length=845

 Score =   229 bits (585),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 138/181 (76%), Gaps = 4/181 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M+SRSY+NLLDLASG     GR  ++L RV TV   + ELD++   +  SD PSSI  +R
Sbjct  1    MISRSYTNLLDLASGNFPVMGRERRRLPRVMTVPSNVCELDEDQAYSVSSDNPSSIPTDR  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIV N+LPL+A RR      W+FSW++DSL LQLKDGL ED+E++YVG L  ++ DPNE
Sbjct  61   MIIVANRLPLKAERRNGS---WSFSWNQDSLYLQLKDGLPEDMEILYVGSLGVDV-DPNE  116

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDVAQ LL+ FKCVP F+PP+L SKFY GFCK+QLWPLFHYMLP S D GGRF+R+LW+
Sbjct  117  QDDVAQILLDRFKCVPTFLPPDLQSKFYDGFCKRQLWPLFHYMLPFSADHGGRFERSLWE  176

Query  617  A  619
            A
Sbjct  177  A  177



>ref|XP_008228949.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Prunus mume]
Length=856

 Score =   229 bits (585),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 137/180 (76%), Gaps = 2/180 (1%)
 Frame = +2

Query  80   VSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQERM  259
            +S+SY NLLDLASG   T     ++  RV T  G LS+LDD+   +  SD PSSI+ +RM
Sbjct  1    MSKSYVNLLDLASGNFPTMEGKRRRFPRVNTAPGNLSDLDDDQARSVSSDQPSSIASDRM  60

Query  260  IIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNEQ  439
            IIV NQLP++A RR D + GW+FSW+ED+LLL LKDGL ED+EV+YVG LK  + DP EQ
Sbjct  61   IIVANQLPVKAKRREDNK-GWSFSWNEDALLLHLKDGLPEDMEVLYVGSLKVSV-DPKEQ  118

Query  440  DDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQA  619
            DDV+Q LL+ F+CVP F+PP++ SKFY GFCK+ LWPLFHYMLP S D GGRFDR+LW+A
Sbjct  119  DDVSQVLLDKFRCVPTFLPPDILSKFYDGFCKRHLWPLFHYMLPFSADQGGRFDRSLWEA  178



>gb|EPS71188.1| hypothetical protein M569_03569, partial [Genlisea aurea]
Length=861

 Score =   228 bits (582),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 141/183 (77%), Gaps = 4/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  250
            M+SRSY+NLLDLASG     G  +  K+  RV TV G + ELDDE  S+  S+ PSS++ 
Sbjct  8    MLSRSYTNLLDLASGNFPVMGTEKEKKRFPRVMTVPGNIVELDDEQASSVTSENPSSVAG  67

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  430
            +RMIIV N LPL+A RR D + GW+FSW+EDSLLL++KDGL E++EV+YVG L  ++ DP
Sbjct  68   DRMIIVSNLLPLKAKRRPDNK-GWSFSWNEDSLLLRVKDGLPEEMEVLYVGSLTVDV-DP  125

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
             EQ+DVA  LL+ FKCVPAF+PP L SK+YHGFCK+ LWPLFHYMLP SPD G RFDR++
Sbjct  126  IEQEDVANYLLDKFKCVPAFLPPSLLSKYYHGFCKKHLWPLFHYMLPFSPDHGCRFDRSM  185

Query  611  WQA  619
            W+A
Sbjct  186  WEA  188



>ref|XP_004136836.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7-like [Cucumis sativus]
 ref|XP_004170435.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7-like [Cucumis sativus]
Length=856

 Score =   228 bits (582),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 136/181 (75%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M+SRSY+NLLDLASG         K+  RV TV G ++ELDD+   +  S+ PSSIS +R
Sbjct  1    MISRSYTNLLDLASGNFPAMEVKKKRFPRVMTVPGNVAELDDDQAYSVTSENPSSISSDR  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIV NQLPLRA RR D +  W+FSW+EDSLLLQLKDGL ED+E++YVG LK +I  P E
Sbjct  61   MIIVANQLPLRAKRRED-DNSWSFSWNEDSLLLQLKDGLPEDMEILYVGSLKVDI-QPEE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QD+V+Q LLE F+C+PAF+PP +   FY GFCK+ LWPLFHYMLP S D  GRFDR++W+
Sbjct  119  QDEVSQILLEKFRCIPAFLPPHILENFYDGFCKRHLWPLFHYMLPYSADQKGRFDRSMWE  178

Query  617  A  619
            A
Sbjct  179  A  179



>ref|XP_007153210.1| hypothetical protein PHAVU_003G016300g [Phaseolus vulgaris]
 gb|ESW25204.1| hypothetical protein PHAVU_003G016300g [Phaseolus vulgaris]
Length=861

 Score =   228 bits (582),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 153/184 (83%), Gaps = 5/184 (3%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSIS-QE  253
            MVS+SYSNLL+LASGE+ +FG   +++ R+ TVAG++S++DD+   +  SD  SS + ++
Sbjct  1    MVSKSYSNLLELASGEAPSFGYMNRRIPRIMTVAGLISDVDDDPVDSVCSDPSSSSAHRD  60

Query  254  RMIIVGNQLPLRAHRRTDGEEG-WNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEIID  427
            R+I+V NQLP+RA RR DG    W F WDE++LL QLKDGLG+D +EVIYVGCLKEE+  
Sbjct  61   RIIMVANQLPIRAQRRPDGNRSCWCFEWDENALL-QLKDGLGDDDIEVIYVGCLKEEV-H  118

Query  428  PNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRN  607
            P+EQD+V+QTLLETFKCVP F+P + F+KFYHGFCKQQLWPLFHYMLPLSP+LGGRF+R+
Sbjct  119  PSEQDEVSQTLLETFKCVPTFLPADQFTKFYHGFCKQQLWPLFHYMLPLSPELGGRFNRS  178

Query  608  LWQA  619
            LWQA
Sbjct  179  LWQA  182



>ref|XP_009365280.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X2 [Pyrus x bretschneideri]
Length=856

 Score =   228 bits (581),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 137/182 (75%), Gaps = 4/182 (2%)
 Frame = +2

Query  80   VSRSYSNLLDLASGESLTFGRAGKK--LSRVATVAGVLSELDDESRSNGGSDVPSSISQE  253
            +S+SY NLLDLASG        GK+    RV T  G LS+LDD+   +  SD PSSI+ +
Sbjct  1    MSQSYINLLDLASGNFPXXXMEGKRRRFPRVNTAPGNLSDLDDDQARSVSSDQPSSIASD  60

Query  254  RMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPN  433
            R+IIV NQLP++A RR D + GW FSW+EDSLLLQLKDGL ED+EV+YVG LK  + DP 
Sbjct  61   RVIIVANQLPVKAKRREDNK-GWTFSWNEDSLLLQLKDGLPEDMEVLYVGSLKVSV-DPK  118

Query  434  EQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLW  613
            EQDDV+Q LLE FKCVP F+PP++ SKFY GFCK+ LWPLFHYMLP S D GGRFDR+LW
Sbjct  119  EQDDVSQVLLERFKCVPTFLPPDILSKFYDGFCKRHLWPLFHYMLPFSADQGGRFDRSLW  178

Query  614  QA  619
            +A
Sbjct  179  EA  180



>gb|EPS68578.1| hypothetical protein M569_06190 [Genlisea aurea]
Length=762

 Score =   227 bits (578),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 138/183 (75%), Gaps = 4/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGR--AGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  250
            M+SRSY+NLLDLASG     GR    K+  RV TV G + ELDDE  S+  SD PSS++ 
Sbjct  1    MLSRSYTNLLDLASGNFPVMGRDKERKRFPRVNTVPGNIGELDDEQTSSFASDNPSSVAG  60

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  430
            +R+IIV N LPL+  RR D +  W+FSW+EDSLLL++KDG  ED++V+YVG L  ++ DP
Sbjct  61   DRIIIVSNLLPLKVKRRPDNK-SWSFSWNEDSLLLRVKDGFPEDMDVLYVGSLPVDV-DP  118

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
             EQDDV+  LLE FKCVPAF+PP L SK+YHGFCK+ LWPLFHYM+P SPD GG FDR+L
Sbjct  119  VEQDDVSNYLLEKFKCVPAFLPPSLMSKYYHGFCKKHLWPLFHYMMPFSPDHGGSFDRSL  178

Query  611  WQA  619
            W+A
Sbjct  179  WEA  181



>ref|XP_004498234.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like isoform X1 [Cicer arietinum]
Length=856

 Score =   227 bits (579),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 150/187 (80%), Gaps = 8/187 (4%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDD----ESRSNGGSDVPSSI  244
            MVSRSYSNL++LASGE+ +FG   +++ R+ TVAG++S++      +  S       SS+
Sbjct  1    MVSRSYSNLVELASGEAPSFGLMNRRIPRIMTVAGLISDVVVVDDDQVESVSSDFSSSSV  60

Query  245  SQERMIIVGNQLPLRAHRRTDGEEG-WNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEE  418
             ++R+IIV NQLP++A +  DG    W+F WDE+SLL QLKDGLG+D +EVIYVGCLKE+
Sbjct  61   HRDRIIIVANQLPIKAQKNQDGNRNCWSFCWDENSLL-QLKDGLGDDDIEVIYVGCLKED  119

Query  419  IIDPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRF  598
            + +PNEQD+V+Q LLE FKCVP F+PP++F+++YHGFCKQQLWPLFHYMLPLSP+LGGRF
Sbjct  120  V-NPNEQDEVSQILLENFKCVPVFLPPDMFTRYYHGFCKQQLWPLFHYMLPLSPELGGRF  178

Query  599  DRNLWQA  619
            +R+LWQA
Sbjct  179  NRSLWQA  185



>gb|KGN43637.1| hypothetical protein Csa_7G049190 [Cucumis sativus]
Length=971

 Score =   228 bits (580),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 137/184 (74%), Gaps = 2/184 (1%)
 Frame = +2

Query  68   ESTMVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSIS  247
            +  M+SRSY+NLLDLASG         K+  RV TV G ++ELDD+   +  S+ PSSIS
Sbjct  113  KRNMISRSYTNLLDLASGNFPAMEVKKKRFPRVMTVPGNVAELDDDQAYSVTSENPSSIS  172

Query  248  QERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIID  427
             +RMIIV NQLPLRA RR D +  W+FSW+EDSLLLQLKDGL ED+E++YVG LK +I  
Sbjct  173  SDRMIIVANQLPLRAKRRED-DNSWSFSWNEDSLLLQLKDGLPEDMEILYVGSLKVDI-Q  230

Query  428  PNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRN  607
            P EQD+V+Q LLE F+C+PAF+PP +   FY GFCK+ LWPLFHYMLP S D  GRFDR+
Sbjct  231  PEEQDEVSQILLEKFRCIPAFLPPHILENFYDGFCKRHLWPLFHYMLPYSADQKGRFDRS  290

Query  608  LWQA  619
            +W+A
Sbjct  291  MWEA  294



>ref|XP_007214959.1| hypothetical protein PRUPE_ppa001387mg [Prunus persica]
 gb|EMJ16158.1| hypothetical protein PRUPE_ppa001387mg [Prunus persica]
Length=840

 Score =   227 bits (578),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 136/180 (76%), Gaps = 2/180 (1%)
 Frame = +2

Query  80   VSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQERM  259
            +S+SY NLLDLASG   T     ++  RV T  G LS++DD+   +  SD PSSI+ +RM
Sbjct  1    MSKSYVNLLDLASGNFPTMEGKRRRFPRVNTAPGNLSDVDDDQARSVSSDQPSSIASDRM  60

Query  260  IIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNEQ  439
            IIV NQLP++A RR D + GW FSW+ED+LLL LKDGL ED+EV+YVG LK  + DP EQ
Sbjct  61   IIVANQLPVKAKRREDNK-GWIFSWNEDALLLHLKDGLPEDMEVLYVGSLKVSV-DPREQ  118

Query  440  DDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQA  619
            DDV+Q LL+ F+CVP F+PP++ SKFY GFCK+ LWPLFHYMLP S D GGRFDR+LW+A
Sbjct  119  DDVSQVLLDKFRCVPTFLPPDILSKFYDGFCKRHLWPLFHYMLPFSADQGGRFDRSLWEA  178



>ref|XP_003540002.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7-like [Glycine max]
 gb|KHN34247.1| Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
7 [Glycine soja]
Length=862

 Score =   227 bits (578),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/185 (59%), Positives = 142/185 (77%), Gaps = 6/185 (3%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFG----RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSI  244
            M+SRSY+NLLDLASG     G    R  K++ RV +V G L+E+DD+   +  SD PS++
Sbjct  1    MMSRSYTNLLDLASGNFPAMGGRETRERKRMPRVMSVPGFLTEVDDDQAVSVSSDNPSTV  60

Query  245  SQERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEII  424
            + +RMIIV NQLPL+A R+ D + GW+FSW+EDSLLLQLKDGL +D+EV+YVG L+ +I 
Sbjct  61   TTDRMIIVANQLPLKAKRKEDNK-GWSFSWNEDSLLLQLKDGLPDDMEVLYVGSLRVDI-  118

Query  425  DPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDR  604
            DP EQDDV+Q LL+ FKCVP F+P ++ +KFY GFCK+QLWPLFHYMLP S D   RFDR
Sbjct  119  DPAEQDDVSQYLLDKFKCVPTFLPADVLAKFYDGFCKRQLWPLFHYMLPFSTDKSHRFDR  178

Query  605  NLWQA  619
            +LW+A
Sbjct  179  SLWEA  183



>ref|XP_010932535.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Elaeis guineensis]
 ref|XP_010932536.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Elaeis guineensis]
 ref|XP_010932537.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Elaeis guineensis]
 ref|XP_010932538.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Elaeis guineensis]
 ref|XP_010932539.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Elaeis guineensis]
Length=859

 Score =   226 bits (577),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 145/185 (78%), Gaps = 6/185 (3%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGS--DVPSSISQ  250
            MVS+SYSNLL+LASGES + GR G+++ RV T  G++ +LD+   +   S  ++ S   +
Sbjct  1    MVSKSYSNLLELASGESQSLGRIGRRIPRVVTAPGIVPDLDESDDAASNSSSELASPSPR  60

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGE--DVEVIYVGCLKEEII  424
            +R IIV NQLP+RA R+  G  GW+FSWD+DSLL Q+KD +G+  D+E IY+G L+EEI 
Sbjct  61   DRTIIVANQLPIRAARQP-GVGGWSFSWDQDSLLHQVKDSIGDHKDMEFIYIGSLREEI-  118

Query  425  DPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDR  604
              +EQD+VA+ LLETF CVPAF+P +L S+FYHGFCKQQLWPLFHYMLPLSPDLGGRFDR
Sbjct  119  PVSEQDEVAKILLETFNCVPAFLPADLLSRFYHGFCKQQLWPLFHYMLPLSPDLGGRFDR  178

Query  605  NLWQA  619
            +LWQA
Sbjct  179  SLWQA  183



>gb|KHG01704.1| putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
7 [Gossypium arboreum]
Length=838

 Score =   226 bits (577),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 133/160 (83%), Gaps = 2/160 (1%)
 Frame = +2

Query  140  RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQERMIIVGNQLPLRAHRRTDGEEG  319
            R  K+L RV TV GV+SELDD+  ++  SDVPSSI Q+R+IIV NQLP++A RR D + G
Sbjct  5    REKKRLPRVMTVPGVISELDDDQANSVASDVPSSIIQDRIIIVANQLPVKAKRRPDNK-G  63

Query  320  WNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNEQDDVAQTLLETFKCVPAFVPP  499
            W+FSWD+DSLLLQLKDGL E++EV+YVG LK ++ DP+EQDDV+Q LL+ FKCVPAF+PP
Sbjct  64   WSFSWDDDSLLLQLKDGLPEEMEVLYVGSLKVDV-DPSEQDDVSQLLLDRFKCVPAFLPP  122

Query  500  ELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQA  619
            ++ +KFYHGFCKQ LWPLFHYMLP S + GGRF R+LW+A
Sbjct  123  DILTKFYHGFCKQHLWPLFHYMLPFSANHGGRFYRSLWEA  162



>ref|XP_010916659.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Elaeis guineensis]
Length=871

 Score =   226 bits (576),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 145/187 (78%), Gaps = 8/187 (4%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGE--SLTFGRAG---KKLSRVATVAGVLSELDDESRSNGGSDVPSS  241
            M+SRSY+NLLDLA+G   +L+ G  G   +++ RV T+ G L+ELDDE R+   S    S
Sbjct  1    MMSRSYTNLLDLATGNFAALSVGGPGGSRRRMPRVMTMPGTLTELDDEDRAGSVSSDVPS  60

Query  242  I-SQERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEE  418
              +Q+R+IIV NQLP+RA RR DG  GW FSWDEDSLLLQLKDGL +D+EV+YVG L+ +
Sbjct  61   SVAQDRIIIVANQLPVRAKRRPDGR-GWCFSWDEDSLLLQLKDGLPDDMEVLYVGSLRVD  119

Query  419  IIDPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRF  598
            + + +EQDDVAQ LLE FKCVPAF+P ++  KFYHGFCKQQLWPLFHYMLP S D GGRF
Sbjct  120  V-EGHEQDDVAQALLERFKCVPAFLPSDILEKFYHGFCKQQLWPLFHYMLPFSADHGGRF  178

Query  599  DRNLWQA  619
            DR+LW++
Sbjct  179  DRSLWES  185



>gb|EYU37347.1| hypothetical protein MIMGU_mgv1a001197mg [Erythranthe guttata]
Length=868

 Score =   226 bits (575),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 113/183 (62%), Positives = 139/183 (76%), Gaps = 4/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAG--KKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  250
            M+SRSY+NLL+LASG     GR    K+  RV TV G + E+DDE  ++  S+ PSSI+ 
Sbjct  1    MMSRSYTNLLELASGNFPVMGREKERKRFPRVMTVPGNIVEMDDEQDNSVTSENPSSIAG  60

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  430
            +RMIIV N LPL+A RR D + GW FSW+EDSLLL +K GL ED+EV+YVG L  ++ DP
Sbjct  61   DRMIIVANLLPLKAKRRPDNK-GWVFSWNEDSLLLWVKVGLPEDMEVLYVGSLPVDV-DP  118

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
             EQDDVA  LLE FKCVPAF+PP L +K+YHGFCK+QLWPLFHYMLP S D GGRFDR++
Sbjct  119  IEQDDVANHLLEKFKCVPAFLPPNLLAKYYHGFCKKQLWPLFHYMLPFSADHGGRFDRSM  178

Query  611  WQA  619
            W+A
Sbjct  179  WEA  181



>ref|XP_004505467.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7-like [Cicer arietinum]
Length=860

 Score =   226 bits (575),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 143/186 (77%), Gaps = 7/186 (4%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFG-----RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSS  241
            M+SRSY+NLLDLASG     G     +  ++L RV +V G++SELDD+   +  SD PS+
Sbjct  1    MMSRSYTNLLDLASGNFPAMGSGREFKERRRLPRVMSVPGIVSELDDDQAVSVSSDNPST  60

Query  242  ISQERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEI  421
            IS +R+IIV NQLPL+A RR D ++GW+FSW+ED+LLLQLKDG  E++EV+YVG L+ +I
Sbjct  61   ISTDRIIIVANQLPLKAKRRED-DKGWSFSWNEDALLLQLKDGFPEEMEVLYVGSLRIDI  119

Query  422  IDPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFD  601
             DP EQDDV+Q LL+ FKCVP F+PP++ +KFY GFCK+QLWPLFHY LP S D   RFD
Sbjct  120  -DPAEQDDVSQYLLDKFKCVPTFLPPDVLAKFYDGFCKRQLWPLFHYKLPFSTDKSHRFD  178

Query  602  RNLWQA  619
            R+LW+A
Sbjct  179  RSLWEA  184



>ref|XP_009416430.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Musa acuminata subsp. malaccensis]
 ref|XP_009416432.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Musa acuminata subsp. malaccensis]
Length=874

 Score =   225 bits (574),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 147/190 (77%), Gaps = 11/190 (6%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGE----SLTFGRAGKKLSRVATVAGVLSEL-DDESRSNG-GSDVPS  238
            M+SRSY+NLLDLASG     SL  GRA ++L RV TV G L++L ++E R+N   SDV S
Sbjct  1    MMSRSYTNLLDLASGNFSALSLGGGRAPRRLPRVMTVPGTLADLQEEEERANSVASDVQS  60

Query  239  SISQERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEE  418
            S +Q+R+IIV NQLP+RA RR D + GW F+WD+DSL+LQLKDGL +D+EV+YVG L+ +
Sbjct  61   SQAQDRIIIVANQLPVRARRRPD-DRGWTFAWDDDSLILQLKDGLPDDMEVLYVGSLRVD  119

Query  419  IIDPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGG--  592
            + + +EQDDVAQ LLE F+CVP F+PP+L  +FYHGFCK  LWPLFHYMLP S D GG  
Sbjct  120  V-EAHEQDDVAQALLERFQCVPTFLPPDLHERFYHGFCKNNLWPLFHYMLPFSADHGGSG  178

Query  593  -RFDRNLWQA  619
             RFDR+LW++
Sbjct  179  SRFDRSLWES  188



>gb|ACA62946.1| trehalose-6-phosphate synthase [Zostera marina]
Length=870

 Score =   225 bits (573),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 143/189 (76%), Gaps = 10/189 (5%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGE--------SLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDV  232
            M+SRSY+NLLDLASG                 +++ RV TV   ++EL+DE  S+  SDV
Sbjct  1    MMSRSYTNLLDLASGNFPVISGGGRDGRSGGMRRMPRVMTVPSNIAELEDEQASSVASDV  60

Query  233  PSSISQERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLK  412
             SSI Q+R+IIVGNQLP+ A RR+D   G +FSWD++SLLLQLKDGL +D+EV+YVGCL+
Sbjct  61   QSSIIQDRLIIVGNQLPVVAKRRSDNA-GRDFSWDDESLLLQLKDGLPDDMEVLYVGCLR  119

Query  413  EEIIDPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGG  592
              I+DP EQDDV+QTLLE FKCVPAF+  E+  K+YHGFCK+ LWPLFHYMLPL+ D GG
Sbjct  120  V-IVDPEEQDDVSQTLLEKFKCVPAFLTEEILEKYYHGFCKKLLWPLFHYMLPLTKDHGG  178

Query  593  RFDRNLWQA  619
            RFDR+LW+A
Sbjct  179  RFDRSLWEA  187



>ref|XP_003607607.1| Trehalose synthase-like protein [Medicago truncatula]
 gb|AES89804.1| trehalose-6-phosphate synthase domain protein [Medicago truncatula]
Length=861

 Score =   224 bits (571),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/188 (57%), Positives = 142/188 (76%), Gaps = 9/188 (5%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFG-------RAGKKLSRVATVAGVLSELDDESRSNGGSDVP  235
            M+SRSY+NLLDLASG     G       +  +++ RV +V G++SE+DD+   +  SD P
Sbjct  1    MMSRSYTNLLDLASGNFPAMGSGSGREFKERRRMPRVMSVPGIVSEVDDDQAVSVSSDNP  60

Query  236  SSISQERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKE  415
            S+I+ +R+IIV NQLPL+A++R D + GWNFSW+EDSLLLQLKDG  E++EV+YVG L+ 
Sbjct  61   STITTDRIIIVANQLPLKANKREDNK-GWNFSWNEDSLLLQLKDGFPEEMEVLYVGSLRV  119

Query  416  EIIDPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGR  595
            +I DP EQDDV+Q LLE FKCVP F+PP++ + FY GFCK+QLWPLFHY LP S D   R
Sbjct  120  DI-DPAEQDDVSQYLLEKFKCVPTFLPPDVLANFYDGFCKRQLWPLFHYKLPFSTDKSHR  178

Query  596  FDRNLWQA  619
            FDR+LW+A
Sbjct  179  FDRHLWEA  186



>ref|XP_008789265.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like isoform X2 [Phoenix dactylifera]
Length=766

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 146/185 (79%), Gaps = 6/185 (3%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGS--DVPSSISQ  250
            MVS+SY+NLL++ASGES + GR G+++ RV T  G++ +LD+   +   S  ++ S   +
Sbjct  1    MVSKSYTNLLEVASGESPSLGRIGRRIPRVVTAPGIVPDLDESDDAASNSSSELASPSPR  60

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGE--DVEVIYVGCLKEEII  424
            +R IIV NQLP+RA R+ +G  GW+F+WD+DS+L Q+KD +G+  D+E IY+G L+EEI 
Sbjct  61   DRTIIVANQLPIRAARQPEGG-GWSFTWDQDSILHQVKDSIGDHNDMEFIYIGSLREEI-  118

Query  425  DPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDR  604
              +EQD+VA+ LLETF CVPAF+P +L S+FYHGFCKQQLWPLFHYMLPLSPDLGGRFDR
Sbjct  119  PLSEQDEVAKILLETFNCVPAFLPADLLSRFYHGFCKQQLWPLFHYMLPLSPDLGGRFDR  178

Query  605  NLWQA  619
            +LWQA
Sbjct  179  SLWQA  183



>gb|ACD56625.1| trehalose synthase/phosphatase-like protein [Gossypium raimondii]
Length=1000

 Score =   224 bits (572),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/185 (62%), Positives = 140/185 (76%), Gaps = 5/185 (3%)
 Frame = +2

Query  71   STMVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSI  244
            S M+S    N  DLASG     G  R  K+L RV TV GV+SELDD+  ++  SD PSS 
Sbjct  143  SHMISLLKPNA-DLASGNFPAMGQPREKKRLPRVMTVPGVISELDDDQANSVTSDAPSSA  201

Query  245  SQERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEII  424
             Q+R+IIV NQLP++A RR D + GW+FSWD+DSLLLQLKDGL E++EV+YVG LK ++ 
Sbjct  202  IQDRIIIVANQLPVKAKRRPDNK-GWSFSWDDDSLLLQLKDGLPEEMEVLYVGSLKVDV-  259

Query  425  DPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDR  604
            DP EQDDV+Q LL+ FKCVPAF+P ++ +KFYHGFCKQ LWPLFHYMLP S   GGRFDR
Sbjct  260  DPVEQDDVSQLLLDKFKCVPAFLPSDILTKFYHGFCKQHLWPLFHYMLPFSASHGGRFDR  319

Query  605  NLWQA  619
            +LW+A
Sbjct  320  SLWEA  324



>ref|XP_009782523.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Nicotiana sylvestris]
Length=857

 Score =   224 bits (570),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/183 (60%), Positives = 142/183 (78%), Gaps = 4/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKK--LSRVATVAGVLSELDDESRSNGGSDVPSSISQ  250
            M+SRSY+NLLDLASG   T GR  ++  + RV TV G + ELDD+  ++  S+ PSS++ 
Sbjct  1    MISRSYTNLLDLASGNFPTMGRERERRRMPRVMTVPGSICELDDDQANSVSSENPSSLAG  60

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  430
            +RMIIV N LPL+A RR D + GW+FSW+EDSLLL+LKDGL ED+EV+YVG L  ++ DP
Sbjct  61   DRMIIVANLLPLKAKRRPDNK-GWSFSWNEDSLLLRLKDGLPEDMEVLYVGSLCVDV-DP  118

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
             EQDDV+  LL+ F+CVPAF+PP +  K+Y GFCK+ LWPLFHYMLP SPD GGRFDR++
Sbjct  119  IEQDDVSNYLLDKFRCVPAFLPPNIVEKYYEGFCKRHLWPLFHYMLPFSPDHGGRFDRSM  178

Query  611  WQA  619
            W+A
Sbjct  179  WEA  181



>ref|XP_009628927.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Nicotiana tomentosiformis]
Length=857

 Score =   224 bits (570),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/183 (60%), Positives = 142/183 (78%), Gaps = 4/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKK--LSRVATVAGVLSELDDESRSNGGSDVPSSISQ  250
            M+SRSY+NLLDLASG   T GR  ++  + RV TV G + ELDD+  ++  S+ PSS++ 
Sbjct  1    MISRSYTNLLDLASGNFPTMGRERERRRMPRVMTVPGSICELDDDQANSVSSENPSSLAG  60

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  430
            +RMIIV N LPL+A RR D + GW+FSW+EDSLLL+LKDGL ED+EV+YVG L  ++ DP
Sbjct  61   DRMIIVANLLPLKAKRRPDNK-GWSFSWNEDSLLLRLKDGLPEDMEVLYVGSLCVDV-DP  118

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
             EQDDV+  LL+ F+CVPAF+PP +  K+Y GFCK+ LWPLFHYMLP SPD GGRFDR++
Sbjct  119  IEQDDVSNYLLDKFRCVPAFLPPNIVEKYYEGFCKRHLWPLFHYMLPFSPDHGGRFDRSM  178

Query  611  WQA  619
            W+A
Sbjct  179  WEA  181



>ref|XP_008789260.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like isoform X1 [Phoenix dactylifera]
 ref|XP_008789262.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like isoform X1 [Phoenix dactylifera]
 ref|XP_008789263.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like isoform X1 [Phoenix dactylifera]
 ref|XP_008789264.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like isoform X1 [Phoenix dactylifera]
Length=859

 Score =   224 bits (570),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 146/185 (79%), Gaps = 6/185 (3%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGS--DVPSSISQ  250
            MVS+SY+NLL++ASGES + GR G+++ RV T  G++ +LD+   +   S  ++ S   +
Sbjct  1    MVSKSYTNLLEVASGESPSLGRIGRRIPRVVTAPGIVPDLDESDDAASNSSSELASPSPR  60

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGE--DVEVIYVGCLKEEII  424
            +R IIV NQLP+RA R+ +G  GW+F+WD+DS+L Q+KD +G+  D+E IY+G L+EEI 
Sbjct  61   DRTIIVANQLPIRAARQPEGG-GWSFTWDQDSILHQVKDSIGDHNDMEFIYIGSLREEI-  118

Query  425  DPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDR  604
              +EQD+VA+ LLETF CVPAF+P +L S+FYHGFCKQQLWPLFHYMLPLSPDLGGRFDR
Sbjct  119  PLSEQDEVAKILLETFNCVPAFLPADLLSRFYHGFCKQQLWPLFHYMLPLSPDLGGRFDR  178

Query  605  NLWQA  619
            +LWQA
Sbjct  179  SLWQA  183



>ref|XP_009411218.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Musa acuminata subsp. malaccensis]
Length=873

 Score =   224 bits (570),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 143/188 (76%), Gaps = 9/188 (5%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGE--SLTFGRAGKKLSRVATVAGVLSELD--DESRSNGGSDVPSSI  244
            M+SRSY+NLLDLASG   +L+ G   +++SR  TV G LS LD  D+   +  SDVPSSI
Sbjct  1    MMSRSYTNLLDLASGNFSALSLGGRSRRMSRTMTVPGSLSGLDEDDDRAISVSSDVPSSI  60

Query  245  SQERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEII  424
            +Q+R+IIV NQLP+RA RR DG  GW+F+WD+DSLLLQLK GL +D+EV+YVG L+  + 
Sbjct  61   AQDRVIIVANQLPVRARRRPDGH-GWSFAWDDDSLLLQLKGGLPDDMEVLYVGSLRVHV-  118

Query  425  DPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPD---LGGR  595
            DP EQD+VAQ LLE F+CVPAF+P ++  +FYHG+CKQ LWPLFHYMLP S      GGR
Sbjct  119  DPREQDEVAQALLERFRCVPAFLPADVNERFYHGYCKQALWPLFHYMLPFSSSEHRAGGR  178

Query  596  FDRNLWQA  619
            FDR LW++
Sbjct  179  FDRALWES  186



>gb|EYU30761.1| hypothetical protein MIMGU_mgv1a001183mg [Erythranthe guttata]
Length=871

 Score =   223 bits (567),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 138/183 (75%), Gaps = 4/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAG--KKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  250
            M+SRSY+NLLDLASG     GR    K+  RV TV G + ELDDE  S+  S+ PS+++ 
Sbjct  1    MMSRSYTNLLDLASGNFPLTGREKERKRFPRVMTVPGNILELDDEQASSVTSENPSTVAG  60

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  430
            +R+I+V N LPL+A RR D + GW FSW+EDSLLL++KDG  E++EV+YVG L  ++ DP
Sbjct  61   DRIIVVANLLPLKAKRRPDNK-GWTFSWNEDSLLLRIKDGFPEEMEVLYVGSLPVDV-DP  118

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
             EQDDVA  LLE FKCV AF+PP +  K+YHGFCK+QLWPLFHYMLP S D GGRFDR++
Sbjct  119  IEQDDVASFLLEKFKCVAAFLPPNILEKYYHGFCKKQLWPLFHYMLPFSADHGGRFDRSM  178

Query  611  WQA  619
            W+A
Sbjct  179  WEA  181



>ref|XP_008812813.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Phoenix dactylifera]
Length=856

 Score =   223 bits (567),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 149/183 (81%), Gaps = 5/183 (3%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            MVSRSYSNLL+LASGE  + GR  +++ RV TVAG++S+LD++S S+  +  PSS  ++R
Sbjct  1    MVSRSYSNLLELASGEPPSIGRIRRRIPRVMTVAGIISDLDEDSDSDNSAG-PSSPPRDR  59

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGE--DVEVIYVGCLKEEIIDP  430
             I+V N LP+RAHRR D   GW FSWDEDSLL QLKD +G+  D+E +YVGCL++EI   
Sbjct  60   TIVVSNHLPIRAHRRPDNR-GWTFSWDEDSLLHQLKDAIGDHCDMEFVYVGCLRDEI-PL  117

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
             +QD+V Q LLETFKCVPAF+PP+L ++FYHGFCKQQLWPLFHYMLPLSP+LGGRFDR+L
Sbjct  118  ADQDEVGQILLETFKCVPAFLPPDLLARFYHGFCKQQLWPLFHYMLPLSPELGGRFDRSL  177

Query  611  WQA  619
            WQA
Sbjct  178  WQA  180



>gb|ADN34028.1| trehalose-6-phosphate synthase [Cucumis melo subsp. melo]
Length=831

 Score =   222 bits (566),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 132/162 (81%), Gaps = 2/162 (1%)
 Frame = +2

Query  134  FGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQERMIIVGNQLPLRAHRRTDGE  313
             GR  K+L RV TVAGV+SELDD+  ++  S+ PSS+ Q+R+IIV NQLP++A RR D +
Sbjct  1    MGREKKRLPRVMTVAGVISELDDDQANSVTSEGPSSVVQDRIIIVANQLPIKAKRRPDNK  60

Query  314  EGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNEQDDVAQTLLETFKCVPAFV  493
             GW+FSWDEDSLL QLKDGL ED+EV+YVG L+ ++ D +EQ+DV+Q LLE FKCVPAF+
Sbjct  61   -GWSFSWDEDSLLWQLKDGLPEDMEVLYVGSLRVDV-DSSEQEDVSQLLLERFKCVPAFL  118

Query  494  PPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQA  619
            P ++ SKFYHGFCKQQLWPLFHYMLP S   GGRFDR+LW+A
Sbjct  119  PHDILSKFYHGFCKQQLWPLFHYMLPFSATHGGRFDRSLWEA  160



>ref|XP_004248198.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Solanum lycopersicum]
Length=857

 Score =   221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 140/183 (77%), Gaps = 4/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKK--LSRVATVAGVLSELDDESRSNGGSDVPSSISQ  250
            M+SRSY+NLLDLASG   T GR   +  + RV T+ G + E+DD+   +  S+ PSS++ 
Sbjct  1    MISRSYTNLLDLASGNFPTMGRDRDRRRMPRVMTLPGSICEMDDDQAHSVSSENPSSLAG  60

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  430
            +RMI+V N LPL+A RR D + GW+F+W+EDSLLL+L+DGL ED+EVIYVG L  +I DP
Sbjct  61   DRMIVVANLLPLKAKRRPDNK-GWSFNWNEDSLLLRLRDGLPEDMEVIYVGSLCVDI-DP  118

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
             EQDDV+  LLE F+CVPAF+PP +  K+Y GFCK+ LWPLFHYMLP SPD GGRFDR++
Sbjct  119  IEQDDVSSYLLEKFRCVPAFLPPNIVEKYYEGFCKRHLWPLFHYMLPFSPDHGGRFDRSM  178

Query  611  WQA  619
            W+A
Sbjct  179  WEA  181



>ref|XP_006364095.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7-like isoform X1 [Solanum tuberosum]
Length=857

 Score =   220 bits (561),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 140/183 (77%), Gaps = 4/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKK--LSRVATVAGVLSELDDESRSNGGSDVPSSISQ  250
            M+SRSY+NLLDLASG   T GR   +  + RV T+ G + E+DD+   +  S+ PSS++ 
Sbjct  1    MISRSYTNLLDLASGNFPTMGRDRDRRRMPRVMTLPGSICEMDDDQAHSVSSENPSSLAG  60

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  430
            +RMI+V N LPL+A RR D + GW+F+W+EDSLLL+L+DGL ED+EV+YVG L  +I DP
Sbjct  61   DRMIVVANLLPLKAKRRPDNK-GWSFNWNEDSLLLRLRDGLPEDMEVVYVGSLCVDI-DP  118

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
             EQDDV+  LLE F+CVPAF+PP +  K+Y GFCK+ LWPLFHYMLP SPD GGRFDR++
Sbjct  119  IEQDDVSSYLLEKFRCVPAFLPPNIVEKYYEGFCKRHLWPLFHYMLPFSPDHGGRFDRSM  178

Query  611  WQA  619
            W+A
Sbjct  179  WEA  181



>ref|XP_007225259.1| hypothetical protein PRUPE_ppa001556mg [Prunus persica]
 gb|EMJ26458.1| hypothetical protein PRUPE_ppa001556mg [Prunus persica]
Length=803

 Score =   219 bits (557),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 118/129 (91%), Gaps = 2/129 (2%)
 Frame = +2

Query  236  SSISQERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLK  412
            SS+ ++R+IIV NQLP+RA R++D  +GW F+WDE+SLLLQLKDGLG+D +EVIYVGCLK
Sbjct  4    SSVQRDRIIIVANQLPIRAQRKSDTSKGWIFNWDENSLLLQLKDGLGDDEIEVIYVGCLK  63

Query  413  EEIIDPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGG  592
            EEI  PNEQD+V+Q LLETFKCVP F+PP+LFS++YHGFCKQQLWPLFHYMLPLSPDLGG
Sbjct  64   EEI-HPNEQDEVSQILLETFKCVPTFLPPDLFSRYYHGFCKQQLWPLFHYMLPLSPDLGG  122

Query  593  RFDRNLWQA  619
            RF+R+LWQA
Sbjct  123  RFNRSLWQA  131



>ref|XP_007132825.1| hypothetical protein PHAVU_011G127700g [Phaseolus vulgaris]
 ref|XP_007132826.1| hypothetical protein PHAVU_011G127700g [Phaseolus vulgaris]
 gb|ESW04819.1| hypothetical protein PHAVU_011G127700g [Phaseolus vulgaris]
 gb|ESW04820.1| hypothetical protein PHAVU_011G127700g [Phaseolus vulgaris]
Length=862

 Score =   219 bits (557),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 141/185 (76%), Gaps = 6/185 (3%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFG----RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSI  244
            M+SRSY+NLLDLASG     G    R  +++ RV +V G L+E+DD+   +  SD PS++
Sbjct  1    MMSRSYTNLLDLASGNFPAMGGRESRERRRMPRVMSVPGFLTEVDDDQAVSVSSDNPSTV  60

Query  245  SQERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEII  424
            + +RMIIV NQLPL+A RR D + GW+FSW+EDSLLLQLKDGL +D+EV+YVG L+ +I 
Sbjct  61   TTDRMIIVANQLPLKAKRREDNK-GWSFSWNEDSLLLQLKDGLPDDMEVLYVGSLRVDI-  118

Query  425  DPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDR  604
            DP EQDDV+Q LL+ FKCVP F+P ++ +KFY GFCK+QLWPLFHYMLP S D   RFDR
Sbjct  119  DPAEQDDVSQNLLDKFKCVPTFLPADVLAKFYDGFCKRQLWPLFHYMLPFSTDKSHRFDR  178

Query  605  NLWQA  619
             +W+A
Sbjct  179  TMWEA  183



>ref|XP_010268366.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 9 isoform X1 [Nelumbo nucifera]
 ref|XP_010268367.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 9 isoform X1 [Nelumbo nucifera]
Length=867

 Score =   218 bits (556),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 139/189 (74%), Gaps = 12/189 (6%)
 Frame = +2

Query  77   MVSRSYSNLLDLAS----GESLTFGRAGKKLSRVATVAGVLSELD---DESRSN-GGSDV  232
            M+SRS +NLL+L S    G+    GR   +L RV TV G++S+ D   DE RS  GGSD 
Sbjct  1    MLSRSCANLLNLVSSGAVGDLPKIGRT--RLPRVMTVPGIISDFDGDEDEGRSECGGSDA  58

Query  233  PSSISQERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLK  412
             SS  QER IIV NQLPL+A R  + ++ W F WD+D+L+LQLKDG   DVEV+YVGCLK
Sbjct  59   VSSTVQERRIIVANQLPLQAQRDPESKK-WCFEWDKDALVLQLKDGFSPDVEVVYVGCLK  117

Query  413  EEIIDPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGG  592
             EI DP+EQD+VAQ LLE ++CVP F+P E+ +KFYHGFCKQ LWPLFHYMLP+SP+ G 
Sbjct  118  AEI-DPSEQDEVAQFLLEKYRCVPTFLPVEIQNKFYHGFCKQHLWPLFHYMLPISPNHGA  176

Query  593  RFDRNLWQA  619
            RFDR LWQA
Sbjct  177  RFDRALWQA  185



>ref|XP_009595385.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Nicotiana tomentosiformis]
Length=858

 Score =   218 bits (555),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 138/184 (75%), Gaps = 5/184 (3%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKK---LSRVATVAGVLSELDDESRSNGGSDVPSSIS  247
            M+SRSY+NLLDLASG     GR  ++   + RV TV G + ELDD+   +  SD  SS++
Sbjct  1    MMSRSYTNLLDLASGNFPVMGRERERPRMMPRVMTVPGSICELDDDLAHSVSSDNLSSLA  60

Query  248  QERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIID  427
             +RMIIV N LPL+A RR D + GW+FSW+EDSLLL+LKDGL ED+EV++VG L  ++ D
Sbjct  61   GDRMIIVANLLPLKAKRRPDNK-GWSFSWNEDSLLLRLKDGLPEDMEVLFVGSLSIDV-D  118

Query  428  PNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRN  607
            P EQDDV+  LL+ F+CVP F+PP +  K+Y GFCK+ LWPLFHYMLP SPD GGRFDR+
Sbjct  119  PIEQDDVSSYLLDKFRCVPTFLPPNILEKYYEGFCKRHLWPLFHYMLPFSPDHGGRFDRS  178

Query  608  LWQA  619
            +W+A
Sbjct  179  MWEA  182



>emb|CDY10196.1| BnaC05g04390D [Brassica napus]
Length=400

 Score =   210 bits (534),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 138/183 (75%), Gaps = 7/183 (4%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKK--LSRVATVAGVLSELDDESRSNGGSDVPSSISQ  250
            M+SRSY+NLLDLASG     GR   +  L RV TV G +SE DD+ +++  SD PSS+S 
Sbjct  1    MISRSYTNLLDLASGNFPVMGRERSRRLLPRVMTVPGNVSEFDDDDQAS--SDNPSSVSS  58

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  430
            +RMIIV N+LPL+A R       W+F+WD+DSL LQLKDG  ED+EV+YVG L  +++  
Sbjct  59   DRMIIVANRLPLKAERLNGT---WSFAWDQDSLYLQLKDGFPEDMEVLYVGSLSVDVVGS  115

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
            +EQ+ VAQ LLE FKCVPAF PP+L SKFYHGFCK+QLWPLFHYMLP SP  GGRFDR++
Sbjct  116  HEQEHVAQILLEKFKCVPAFFPPDLQSKFYHGFCKRQLWPLFHYMLPFSPANGGRFDRSM  175

Query  611  WQA  619
            W+A
Sbjct  176  WEA  178



>ref|XP_009768217.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Nicotiana sylvestris]
Length=858

 Score =   218 bits (554),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 138/184 (75%), Gaps = 5/184 (3%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKK---LSRVATVAGVLSELDDESRSNGGSDVPSSIS  247
            M+SRSY+NLLDLASG     GR  ++   + RV TV G + ELDD+   +  SD  SS++
Sbjct  1    MMSRSYTNLLDLASGNFPVMGRERERPRMMPRVMTVPGSICELDDDLAHSVSSDNLSSLA  60

Query  248  QERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIID  427
             +RMIIV N LPL+A RR D + GW+FSW+EDSLLL+LKDGL ED+EV++VG L  ++ D
Sbjct  61   GDRMIIVANLLPLKAKRRPDNK-GWSFSWNEDSLLLRLKDGLPEDMEVLFVGSLSIDV-D  118

Query  428  PNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRN  607
            P EQDD++  LL+ F+CVP F+PP +  K+Y GFCK+ LWPLFHYMLP SPD GGRFDR+
Sbjct  119  PIEQDDISSYLLDKFRCVPTFLPPNILEKYYEGFCKRHLWPLFHYMLPFSPDHGGRFDRS  178

Query  608  LWQA  619
            +W+A
Sbjct  179  MWEA  182



>ref|XP_003527335.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7-like [Glycine max]
 gb|KHN33938.1| Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
7 [Glycine soja]
Length=862

 Score =   217 bits (552),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 142/185 (77%), Gaps = 6/185 (3%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFG----RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSI  244
            M+SRSY+NLLDLASG     G    R  ++L RV +V G ++E+DD+   +  SD PS++
Sbjct  1    MMSRSYTNLLDLASGNFPAMGGRETRERRRLPRVMSVPGFITEVDDDQAVSVSSDNPSTV  60

Query  245  SQERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEII  424
            + +RMIIV NQLPL+A R+ D + GW+FSW+EDSLLLQLKDGL +D+EV+YVG L+ +I 
Sbjct  61   TTDRMIIVANQLPLKAKRKEDNK-GWSFSWNEDSLLLQLKDGLPDDMEVLYVGSLRVDI-  118

Query  425  DPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDR  604
            DP EQDDV+Q LL+ FKCVP F+P ++ +KFY GFCK+QLWPLFHYMLP S D   RFDR
Sbjct  119  DPAEQDDVSQYLLDKFKCVPTFLPADVLAKFYDGFCKRQLWPLFHYMLPFSTDKSHRFDR  178

Query  605  NLWQA  619
            +LW+A
Sbjct  179  SLWEA  183



>ref|XP_007153644.1| hypothetical protein PHAVU_003G053000g [Phaseolus vulgaris]
 gb|ESW25638.1| hypothetical protein PHAVU_003G053000g [Phaseolus vulgaris]
Length=857

 Score =   216 bits (550),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 130/181 (72%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M SRSY+NLLDLASG+ L   R  + L RV T+ G++S+LD    ++G SDV SS  +ER
Sbjct  1    MASRSYANLLDLASGDLLDIPRTPRALPRVMTIPGIISDLDGYGCNDGDSDVSSSGYRER  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
             IIV N LPL+A R  +  + W FSWDEDS+LLQLKDG   D EVIYVG LK EI D  E
Sbjct  61   KIIVANMLPLQAKRDIETAK-WVFSWDEDSILLQLKDGFSSDTEVIYVGSLKIEI-DLCE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QD VAQ LL+ F CVP F+P +L  KFY GFCKQQLWPLFHYMLP+ PD G RFDR LWQ
Sbjct  119  QDAVAQRLLDEFNCVPTFLPHDLQKKFYLGFCKQQLWPLFHYMLPICPDHGDRFDRTLWQ  178

Query  617  A  619
            A
Sbjct  179  A  179



>ref|NP_172129.1| putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
7 [Arabidopsis thaliana]
 sp|Q9LMI0.1|TPS7_ARATH RecName: Full=Probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7; AltName: Full=Trehalose-6-phosphate synthase 
7; Short=AtTPS7 [Arabidopsis thaliana]
 gb|AAF82169.1|AC068143_11 Contains similarity to a trehalose-6-phosphate synthase mRNA 
from Arabidopsis thaliana gb|Y08568 and contains a trehalose-6-phosphate 
synthase PF|00982 domain. ESTs gb|T76758, gb|T21695, 
gb|R30506, gb|T42298, gb|T42288 come from this gene [Arabidopsis 
thaliana]
 gb|AEE27983.1| putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
7 [Arabidopsis thaliana]
Length=851

 Score =   216 bits (550),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 138/181 (76%), Gaps = 4/181 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M+SRSY+NLLDLASG     GR  ++L RV TV G +SE D++   +  SD PSS+S +R
Sbjct  1    MISRSYTNLLDLASGNFPVMGRERRRLPRVMTVPGNVSEFDEDQAYSVSSDNPSSVSSDR  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIV N+LPL+A +R      W+FSWD+DSL LQLKDGL ED+E++YVG L  ++ D NE
Sbjct  61   MIIVANRLPLKAEKRNGS---WSFSWDQDSLYLQLKDGLPEDMEILYVGSLSVDV-DSNE  116

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDVAQ LL+ FKCVP F PP+L SKFY GFCK+Q+WPLFHYMLP S D GGRFDR+LW+
Sbjct  117  QDDVAQILLDKFKCVPTFFPPDLQSKFYDGFCKRQIWPLFHYMLPFSADHGGRFDRSLWE  176

Query  617  A  619
            A
Sbjct  177  A  177



>ref|XP_008348581.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Malus domestica]
Length=851

 Score =   216 bits (549),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/160 (64%), Positives = 124/160 (78%), Gaps = 2/160 (1%)
 Frame = +2

Query  140  RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQERMIIVGNQLPLRAHRRTDGEEG  319
            R  K + RV T  G LS+LDD+   +  SD PSSI+ +R+IIV NQLP++A RR D + G
Sbjct  18   RGKKTVPRVNTAPGNLSDLDDDQARSVSSDQPSSIASDRVIIVANQLPVKAKRREDNK-G  76

Query  320  WNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNEQDDVAQTLLETFKCVPAFVPP  499
            W FSW+EDSLLLQLKDGL ED+EV+YVG LK  + DP EQDDV+Q LLE FKCVP F+PP
Sbjct  77   WTFSWNEDSLLLQLKDGLPEDMEVLYVGSLKVSV-DPKEQDDVSQVLLERFKCVPTFLPP  135

Query  500  ELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQA  619
            ++ SKFY GFCK+ LWPLFHYMLP S D GGRFDR+LW+A
Sbjct  136  DILSKFYDGFCKRHLWPLFHYMLPFSADQGGRFDRSLWEA  175



>ref|XP_002889602.1| hypothetical protein ARALYDRAFT_470660 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65861.1| hypothetical protein ARALYDRAFT_470660 [Arabidopsis lyrata subsp. 
lyrata]
Length=851

 Score =   215 bits (548),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 138/181 (76%), Gaps = 4/181 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M+SRSY+NLLDLASG     GR  ++L RV TV G +SE D++   +  SD PSS+S +R
Sbjct  1    MISRSYTNLLDLASGNFPVMGRERRRLPRVMTVPGNVSEFDEDQAYSVSSDNPSSVSSDR  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIV N+LPL+A RR      W+FSWD+DSL LQLKDGL ED+E++YVG L  ++ D +E
Sbjct  61   MIIVANRLPLKAERRNGS---WSFSWDQDSLYLQLKDGLPEDMEILYVGSLSVDV-DSHE  116

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDVAQ LL+ FKCVP F PP+L SKFY GFCK+Q+WPLFHYMLP S D GGRFDR+LW+
Sbjct  117  QDDVAQILLDKFKCVPTFFPPDLQSKFYDGFCKRQIWPLFHYMLPFSADHGGRFDRSLWE  176

Query  617  A  619
            A
Sbjct  177  A  177



>ref|XP_004969834.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7-like [Setaria italica]
Length=878

 Score =   215 bits (547),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 136/196 (69%), Gaps = 17/196 (9%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGE--SLTFGRA-------------GKKLSRVATVAGVLSELDDESR  211
            M SRSY+NLLDLA+G   +L +G                +++ R  T  G L ELD+E  
Sbjct  1    MFSRSYTNLLDLANGNLSALDYGGGGGGGGGGGGRPPRARRMQRTMTTPGTLVELDEERA  60

Query  212  SNGGSDVPSSISQERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEV  391
             +  SDV SS++ +R+I+V N LP+R  RR DG  GW FSWDEDSLL  L+DGL +D+EV
Sbjct  61   GSVASDVQSSLAGDRLIVVANTLPVRGERRPDGR-GWTFSWDEDSLLFHLRDGLPDDMEV  119

Query  392  IYVGCLKEEIIDPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLP  571
            +YVG L+ ++  P EQDDVAQ LLE F+CVPAF+P ++  +FYHGFCKQ LWPLFHYMLP
Sbjct  120  LYVGSLRADV-PPAEQDDVAQALLERFRCVPAFLPKDICDRFYHGFCKQMLWPLFHYMLP  178

Query  572  LSPDLGGRFDRNLWQA  619
             SPD GGRFDR+ W+A
Sbjct  179  FSPDHGGRFDRSQWEA  194



>gb|AAL91978.1|AF483209_1 putative trehalose synthase [Solanum tuberosum]
Length=857

 Score =   215 bits (547),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 136/183 (74%), Gaps = 4/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSR--VATVAGVLSELDDESRSNGGSDVPSSISQ  250
            M+SRSY+NLLDLASG     GR   +     V TV G + ELDD+   +  SD  SS++ 
Sbjct  1    MMSRSYTNLLDLASGNFPVMGRERDRRRMSRVMTVPGSICELDDDQAVSVSSDNQSSLAG  60

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  430
            +RMI+V NQLPL+A RR D + GW+FSW+EDSLLL+LKDGL ED+EV++VG L  ++ DP
Sbjct  61   DRMIVVANQLPLKAKRRPDNK-GWSFSWNEDSLLLRLKDGLPEDMEVLFVGSLSVDV-DP  118

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
             EQDDV+  LL+ F+CVP F+PP +  K+Y GFCK+ LWPLFHYMLP SPD GGRFDR++
Sbjct  119  IEQDDVSSYLLDKFRCVPTFLPPNIVEKYYEGFCKRHLWPLFHYMLPFSPDHGGRFDRSM  178

Query  611  WQA  619
            W+A
Sbjct  179  WEA  181



>ref|XP_010475368.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X1 [Camelina sativa]
 ref|XP_010475369.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X2 [Camelina sativa]
 ref|XP_010475370.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X1 [Camelina sativa]
 ref|XP_010475371.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X3 [Camelina sativa]
 ref|XP_010475372.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X3 [Camelina sativa]
Length=851

 Score =   215 bits (547),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 138/181 (76%), Gaps = 4/181 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M+SRSY+NLLDLASG     GR  ++L RV TV G +SE D++   +  SD PSS+S +R
Sbjct  1    MISRSYTNLLDLASGNFPVMGRERRRLPRVMTVPGNVSEFDEDQAYSVSSDNPSSVSSDR  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIV N+LPL+A +R      W+FSWD+DSL LQLKDGL ED+E++YVG L  ++ D +E
Sbjct  61   MIIVANRLPLKAEKRNGS---WSFSWDQDSLYLQLKDGLPEDMEILYVGSLSVDV-DSHE  116

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDVAQ LL+ FKCVP F PP+L SKFY GFCK+QLWPLFHYMLP S D GGRFDR+LW+
Sbjct  117  QDDVAQILLDKFKCVPTFFPPDLQSKFYDGFCKRQLWPLFHYMLPFSADHGGRFDRSLWE  176

Query  617  A  619
            A
Sbjct  177  A  177



>ref|XP_010486072.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Camelina sativa]
Length=851

 Score =   214 bits (546),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 137/181 (76%), Gaps = 4/181 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M+SRSY+NLLDLASG     GR  ++L RV TV G +SE D++   +  SD PSS+S +R
Sbjct  1    MISRSYTNLLDLASGNFPVMGRERRRLPRVMTVPGNVSEFDEDQAYSVSSDNPSSVSSDR  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIV N+LPL+A +R      W+FSWD+DSL LQLKDGL ED+E++YVG L  ++ D  E
Sbjct  61   MIIVANRLPLKAEKRNGS---WSFSWDQDSLYLQLKDGLPEDMEILYVGSLSVDV-DSQE  116

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDVAQ LL+ FKCVP F PP+L SKFY GFCK+QLWPLFHYMLP S D GGRFDR+LW+
Sbjct  117  QDDVAQILLDKFKCVPTFFPPDLQSKFYDGFCKRQLWPLFHYMLPFSADHGGRFDRSLWE  176

Query  617  A  619
            A
Sbjct  177  A  177



>ref|XP_004243268.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Solanum lycopersicum]
Length=858

 Score =   214 bits (546),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 136/183 (74%), Gaps = 4/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSR--VATVAGVLSELDDESRSNGGSDVPSSISQ  250
            M+SRSY+NLLDLASG     GR   +     V TV G + ELDD+   +  SD  SS++ 
Sbjct  1    MMSRSYTNLLDLASGNFPVMGRERDRRRMSRVMTVPGSICELDDDQAVSVSSDNQSSLAG  60

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  430
            +RMI+V NQLPL+A RR D + GW+FSW+EDSLLL+LKDGL ED+EV++VG L  ++ DP
Sbjct  61   DRMIVVANQLPLKAKRRPDNK-GWSFSWNEDSLLLRLKDGLPEDMEVLFVGSLSVDV-DP  118

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
             EQDDV+  LL+ F+CVP F+PP +  K+Y GFCK+ LWPLFHYMLP SPD GGRFDR++
Sbjct  119  IEQDDVSSYLLDKFRCVPTFLPPNIVEKYYEGFCKRHLWPLFHYMLPFSPDHGGRFDRSM  178

Query  611  WQA  619
            W+A
Sbjct  179  WEA  181



>ref|XP_006348895.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7-like [Solanum tuberosum]
Length=857

 Score =   214 bits (546),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 136/183 (74%), Gaps = 4/183 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSR--VATVAGVLSELDDESRSNGGSDVPSSISQ  250
            M+SRSY+NLLDLASG     GR   +     V TV G + ELDD+   +  SD  SS++ 
Sbjct  1    MMSRSYTNLLDLASGNFPVMGRERDRRRMSRVMTVPGSICELDDDQAVSVSSDNQSSLAG  60

Query  251  ERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDP  430
            +RMI+V NQLPL+A RR D + GW+FSW+EDSLLL+LKDGL ED+EV++VG L  ++ DP
Sbjct  61   DRMIVVANQLPLKAKRRPDNK-GWSFSWNEDSLLLRLKDGLPEDMEVLFVGSLSVDV-DP  118

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
             EQDDV+  LL+ F+CVP F+PP +  K+Y GFCK+ LWPLFHYMLP SPD GGRFDR++
Sbjct  119  IEQDDVSSYLLDKFRCVPTFLPPNIVEKYYEGFCKRHLWPLFHYMLPFSPDHGGRFDRSM  178

Query  611  WQA  619
            W+A
Sbjct  179  WEA  181



>ref|XP_006306755.1| hypothetical protein CARUB_v10008292mg [Capsella rubella]
 ref|XP_006306756.1| hypothetical protein CARUB_v10008292mg [Capsella rubella]
 gb|EOA39653.1| hypothetical protein CARUB_v10008292mg [Capsella rubella]
 gb|EOA39654.1| hypothetical protein CARUB_v10008292mg [Capsella rubella]
Length=851

 Score =   214 bits (546),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 138/181 (76%), Gaps = 4/181 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M+SRSY+NLLDLASG     GR  ++L RV TV G +SE D++   +  SD PSS+S +R
Sbjct  1    MISRSYTNLLDLASGNFPVMGRERRRLPRVMTVPGNVSEFDEDQAYSVSSDNPSSVSSDR  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
            MIIV N+LPL+A +R      W+FSWD+DSL LQLKDGL ED+E++YVG L  ++ D +E
Sbjct  61   MIIVANRLPLKAEKRNGS---WSFSWDQDSLYLQLKDGLPEDMEILYVGSLSVDV-DSHE  116

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QDDVAQ LL+ FKCVP F PP+L SKFY GFCK+QLWPLFHYMLP S D GGRFDR+LW+
Sbjct  117  QDDVAQILLDKFKCVPTFFPPDLQSKFYDGFCKRQLWPLFHYMLPFSADHGGRFDRSLWE  176

Query  617  A  619
            A
Sbjct  177  A  177



>ref|XP_009365279.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X1 [Pyrus x bretschneideri]
Length=836

 Score =   214 bits (544),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 123/157 (78%), Gaps = 2/157 (1%)
 Frame = +2

Query  149  KKLSRVATVAGVLSELDDESRSNGGSDVPSSISQERMIIVGNQLPLRAHRRTDGEEGWNF  328
            ++  RV T  G LS+LDD+   +  SD PSSI+ +R+IIV NQLP++A RR D + GW F
Sbjct  6    RRFPRVNTAPGNLSDLDDDQARSVSSDQPSSIASDRVIIVANQLPVKAKRREDNK-GWTF  64

Query  329  SWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNEQDDVAQTLLETFKCVPAFVPPELF  508
            SW+EDSLLLQLKDGL ED+EV+YVG LK  + DP EQDDV+Q LLE FKCVP F+PP++ 
Sbjct  65   SWNEDSLLLQLKDGLPEDMEVLYVGSLKVSV-DPKEQDDVSQVLLERFKCVPTFLPPDIL  123

Query  509  SKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQA  619
            SKFY GFCK+ LWPLFHYMLP S D GGRFDR+LW+A
Sbjct  124  SKFYDGFCKRHLWPLFHYMLPFSADQGGRFDRSLWEA  160



>gb|KHG20430.1| putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
7 -like protein [Gossypium arboreum]
Length=838

 Score =   214 bits (544),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 130/160 (81%), Gaps = 2/160 (1%)
 Frame = +2

Query  140  RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQERMIIVGNQLPLRAHRRTDGEEG  319
            R  K+L+RV TV GV+SELDD+  ++  SDV SS++Q+R+IIV NQLP++  RR D + G
Sbjct  5    RERKRLTRVMTVPGVVSELDDDQANSVNSDVHSSVNQDRIIIVANQLPVKVKRRPDNK-G  63

Query  320  WNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNEQDDVAQTLLETFKCVPAFVPP  499
            W+F+WD+ SLLLQLKDGL E++EV+YVG LK ++ D NEQD+V+  LLE FKCVPAF+PP
Sbjct  64   WSFNWDDYSLLLQLKDGLPEEMEVLYVGSLKIDV-DINEQDEVSSVLLEKFKCVPAFLPP  122

Query  500  ELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQA  619
            E+F+KFYHGFCKQ LW LFHYMLP S + GGRF R+LW+A
Sbjct  123  EIFNKFYHGFCKQHLWSLFHYMLPYSANHGGRFHRSLWEA  162



>ref|XP_010511782.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like isoform X3 [Camelina sativa]
Length=840

 Score =   213 bits (542),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 130/172 (76%), Gaps = 21/172 (12%)
 Frame = +2

Query  146  GKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQERMIIVGNQLPLRAHRRTDGE----  313
             +++ R+  VAG++S +D+E++    S       ++R+IIV N+LP+RA RR DG     
Sbjct  2    NRQIPRIMAVAGIMSNIDNETKETDLS------PKDRIIIVANELPIRAQRRVDGNGSSS  55

Query  314  ---------EGWNFSWDEDSLLLQLKDGLGED-VEVIYVGCLKEEIIDPNEQDDVAQTLL  463
                     +GWNFSWD++SLLLQLKDGLG+  +EVIYVGCLKEEI  PNEQ++V Q LL
Sbjct  56   SSTSSICCSKGWNFSWDKNSLLLQLKDGLGDGAIEVIYVGCLKEEI-HPNEQEEVYQVLL  114

Query  464  ETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQA  619
            E+FKCVP F+P +L++++YHGFCKQQLWPLFHYMLPLSPDLGGRFDR LWQA
Sbjct  115  ESFKCVPTFLPLDLYTRYYHGFCKQQLWPLFHYMLPLSPDLGGRFDRTLWQA  166



>ref|XP_010917511.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Elaeis guineensis]
Length=854

 Score =   213 bits (541),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 137/183 (75%), Gaps = 8/183 (4%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M S+SYSNLL+LASGES T G    ++ RV T  G++ +LD+    +  SD+ S     R
Sbjct  1    MGSKSYSNLLELASGESPTLGGMSHRIPRVVTAPGIVPDLDESD--DTASDLSSP--PNR  56

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGE--DVEVIYVGCLKEEIIDP  430
             IIV NQLP+R+ R  +   GW+F+WD+DSLL Q+KD +G+  D+E IY+G L+EEI   
Sbjct  57   TIIVANQLPIRSARHPEAG-GWSFTWDQDSLLHQVKDSIGDRNDMEFIYIGSLREEI-PL  114

Query  431  NEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNL  610
            ++QD+VAQ LLETF CVPAF+P +L S+FYHGFCKQQLWPLFHYMLPLS DLGGRFDR+L
Sbjct  115  SDQDEVAQILLETFNCVPAFLPADLLSRFYHGFCKQQLWPLFHYMLPLSSDLGGRFDRSL  174

Query  611  WQA  619
            WQA
Sbjct  175  WQA  177



>ref|XP_003532016.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 10-like isoform X1 [Glycine max]
 ref|XP_006585958.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 10-like isoform X2 [Glycine max]
Length=861

 Score =   212 bits (540),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 129/181 (71%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M SRSY+NL DLASG+ L F    + L RV TV G++S+LD    ++G SDV SS  +ER
Sbjct  1    MASRSYANLFDLASGDFLDFPCPPRALPRVMTVPGIISDLDGYGCNDGDSDVSSSGCRER  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
             IIV N LP++A R  +  + W FSWDEDS+LLQLKDG   D EVIYVG LK EI D  E
Sbjct  61   KIIVANMLPVQAKRDIETAK-WVFSWDEDSILLQLKDGFSADTEVIYVGSLKVEI-DACE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QD VAQ LL+ F CVP F+P +L  +FY GFCKQQLWPLFHYMLP+ PD G RFDR LWQ
Sbjct  119  QDAVAQRLLDEFNCVPTFLPHDLQKRFYLGFCKQQLWPLFHYMLPICPDHGDRFDRILWQ  178

Query  617  A  619
            A
Sbjct  179  A  179



>ref|XP_004509840.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 9-like [Cicer arietinum]
Length=860

 Score =   212 bits (540),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 130/181 (72%), Gaps = 4/181 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M SRSY+NLLDLA G+        + L RV TV G++S+LD    ++G SDV SS  +ER
Sbjct  1    MTSRSYANLLDLAGGDLFDIPHTPRTLPRVMTVPGIISDLD--GCNDGDSDVSSSGCRER  58

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
             IIV N LPL+A R  D  + W FSWDEDS+LLQLKDG   D+EVIYVG LK EI D +E
Sbjct  59   KIIVANMLPLQAKRDIDTAK-WCFSWDEDSILLQLKDGFSSDIEVIYVGSLKVEI-DASE  116

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QD+VAQ LL+ F CVP F+P +L  KFY GFCKQQLWPLFHYMLP+  D G RFDR+LWQ
Sbjct  117  QDEVAQRLLDDFNCVPTFLPHDLQKKFYLGFCKQQLWPLFHYMLPICSDHGDRFDRSLWQ  176

Query  617  A  619
            A
Sbjct  177  A  177



>gb|KHN24134.1| Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
10 [Glycine soja]
Length=861

 Score =   212 bits (540),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 129/181 (71%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M SRSY+NL DLASG+ L F    + L RV TV G++S+LD    ++G SDV SS  +ER
Sbjct  1    MASRSYANLFDLASGDFLDFPCTPRALPRVMTVPGIISDLDGYGCNDGDSDVSSSGCRER  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
             IIV N LP++A R  +  + W FSWDEDS+LLQLKDG   D EVIYVG LK EI D  E
Sbjct  61   KIIVANMLPVQAKRDIETAK-WVFSWDEDSILLQLKDGFSADSEVIYVGSLKVEI-DACE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QD VAQ LL+ F CVP F+P +L  +FY GFCKQQLWPLFHYMLP+ PD G RFDR LWQ
Sbjct  119  QDAVAQRLLDEFNCVPTFLPHDLQKRFYLGFCKQQLWPLFHYMLPICPDHGDRFDRILWQ  178

Query  617  A  619
            A
Sbjct  179  A  179



>ref|XP_003552011.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 9-like isoform X1 [Glycine max]
 ref|XP_006602379.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 9-like isoform X2 [Glycine max]
Length=861

 Score =   212 bits (539),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 129/181 (71%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M SRSY+NL DLASG+ L F    + L RV TV G++S+LD    ++G SDV SS  +ER
Sbjct  1    MASRSYANLFDLASGDFLDFPCTPRALPRVMTVPGIISDLDGYGCNDGDSDVSSSGCRER  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
             IIV N LP++A R  +  + W FSWDEDS+LLQLKDG   D EVIYVG LK EI D  E
Sbjct  61   KIIVANMLPVQAKRDIETAK-WVFSWDEDSILLQLKDGFSADSEVIYVGSLKVEI-DACE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QD VAQ LL+ F CVP F+P +L  +FY GFCKQQLWPLFHYMLP+ PD G RFDR LWQ
Sbjct  119  QDAVAQRLLDEFNCVPTFLPHDLQKRFYLGFCKQQLWPLFHYMLPICPDHGDRFDRILWQ  178

Query  617  A  619
            A
Sbjct  179  A  179



>gb|KHN10606.1| Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
10 [Glycine soja]
Length=857

 Score =   211 bits (538),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 129/181 (71%), Gaps = 2/181 (1%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M SRSY+NL DLASG+ L F    + L RV TV G++S+LD    ++G SDV SS  +ER
Sbjct  1    MASRSYANLFDLASGDFLDFPCPPRALPRVMTVPGIISDLDGYGCNDGDSDVSSSGCRER  60

Query  257  MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPNE  436
             IIV N LP++A R  +  + W FSWDEDS+LLQLKDG   D EVIYVG LK EI D  E
Sbjct  61   KIIVANMLPVQAKRDIETAK-WVFSWDEDSILLQLKDGFCADTEVIYVGSLKVEI-DACE  118

Query  437  QDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLWQ  616
            QD VAQ LL+ F CVP F+P +L  +FY GFCKQQLWPLFHYMLP+ PD G RFDR LWQ
Sbjct  119  QDAVAQRLLDEFNCVPTFLPHDLQKRFYLGFCKQQLWPLFHYMLPICPDHGDRFDRILWQ  178

Query  617  A  619
            A
Sbjct  179  A  179



>ref|XP_002989114.1| trehalose phosphate synthase [Selaginella moellendorffii]
 gb|EFJ09908.1| trehalose phosphate synthase [Selaginella moellendorffii]
Length=890

 Score =   211 bits (538),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 134/184 (73%), Gaps = 9/184 (5%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSE---LDDESRSNGGSDVPSSIS  247
            MVSRSYSNLLDL+S    T    G++L RV TVAG+ S+   ++D+S S   S   SS  
Sbjct  1    MVSRSYSNLLDLSSPAEGTASPRGRRLPRVMTVAGLCSDSRIIEDDSASEAASISHSS--  58

Query  248  QERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIID  427
              R+IIV +QLPL   RR D    WNF WD+DSLLLQLKDGL E++EV+YVGCL+ ++  
Sbjct  59   --RVIIVAHQLPLHGERRPDNLL-WNFRWDDDSLLLQLKDGLPEELEVVYVGCLRVDV-P  114

Query  428  PNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRN  607
             +EQD+VA  LL  F CVPAF+PP+L  +FYHGFCKQQLWPLFHYMLPL+ D GGRFDR 
Sbjct  115  MSEQDEVAAILLRDFNCVPAFLPPDLHGRFYHGFCKQQLWPLFHYMLPLTTDPGGRFDRL  174

Query  608  LWQA  619
            LWQA
Sbjct  175  LWQA  178



>ref|XP_002983300.1| trehalose phosphate synthase [Selaginella moellendorffii]
 gb|EFJ15642.1| trehalose phosphate synthase [Selaginella moellendorffii]
Length=867

 Score =   211 bits (536),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 110/188 (59%), Positives = 138/188 (73%), Gaps = 11/188 (6%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSEL----DDESRSNGGSDVP---  235
            M+S+SYSNLL+LA+G+   F R   ++ RV TVAG  +EL    DD + ++G S +P   
Sbjct  1    MLSKSYSNLLELAAGDLPPFVRG--RMPRVMTVAGFPAELQQHEDDNNGNSGSSLIPDWN  58

Query  236  SSISQERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKE  415
            S  +Q+R IIV N LPL A  R      W+FSWDE+SLLL+LKDGL ED+EV+Y+GCL  
Sbjct  59   SCTAQDRTIIVANMLPLNA-ERNPSSLCWDFSWDEESLLLRLKDGLPEDMEVLYIGCLNV  117

Query  416  EIIDPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGR  595
            E+ +  EQD+VA +LL+ F CVPAF+P  L S+FYHGFCKQ LWPLFHYMLPLSPD GGR
Sbjct  118  EV-EAQEQDEVAASLLDRFNCVPAFLPSHLRSRFYHGFCKQHLWPLFHYMLPLSPDNGGR  176

Query  596  FDRNLWQA  619
            FDR+LWQA
Sbjct  177  FDRSLWQA  184



>gb|ACI62866.1| trehalose 6-phosphate synthase [Gossypium arboreum]
 gb|KHG27950.1| putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
9 -like protein [Gossypium arboreum]
Length=861

 Score =   209 bits (533),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 128/182 (70%), Gaps = 4/182 (2%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  256
            M SRS +N L LASG  L   +  + L RV TV G++S++D  S ++G SDV SS  +ER
Sbjct  1    MASRSCANFLHLASGNLLDIPQTPRGLPRVMTVPGIISDMDSCSSNDGDSDVASSGCRER  60

Query  257  MIIVGNQLPLRAHRRTDGEEG-WNFSWDEDSLLLQLKDGLGEDVEVIYVGCLKEEIIDPN  433
             IIV N LPL A R  DGE   W FSWDEDSLLL LKDG   ++EV+YVG LK +I D N
Sbjct  61   KIIVANMLPLHAKR--DGETSKWRFSWDEDSLLLHLKDGFSPEMEVVYVGSLKVDI-DVN  117

Query  434  EQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHYMLPLSPDLGGRFDRNLW  613
            EQ++VAQ LLE F CVP FVP +L  KFY GFCKQ LWPLFHYMLP+ PD G RFDR LW
Sbjct  118  EQEEVAQKLLEDFNCVPTFVPHDLQKKFYLGFCKQHLWPLFHYMLPMCPDHGDRFDRILW  177

Query  614  QA  619
            QA
Sbjct  178  QA  179



>gb|AEB53179.1| trehalose-6-phosphate synthase 3 [Oryza sativa Indica Group]
Length=878

 Score =   209 bits (532),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 137/199 (69%), Gaps = 20/199 (10%)
 Frame = +2

Query  77   MVSRSYSNLLDLASGE--SLTFGRA----------------GKKLSRVATVAGVLSELDD  202
            M SRSY+NL+DLA+G   +L +G                   +++ R  T  G L+ELD+
Sbjct  1    MFSRSYTNLVDLANGNLSALDYGGGGGGGGGGNGAGGRPPRARRMQRTMTTPGTLAELDE  60

Query  203  ESRSNGGSDVPSSISQERMIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGED  382
            E   +  SDVPSS++ +R+I+V N LP+R  RR DG  GW+F WDEDSLLL L+DGL +D
Sbjct  61   ERAGSVTSDVPSSLASDRLIVVANTLPVRCERRPDGR-GWSFCWDEDSLLLHLRDGLPDD  119

Query  383  VEVIYVGCLKEEIIDPNEQDDVAQTLLETFKCVPAFVPPELFSKFYHGFCKQQLWPLFHY  562
            +EV+YVG L+ ++    EQDDVAQ LL+ F+CVPAF+P ++  +FYHGFCKQ LWPLFHY
Sbjct  120  MEVLYVGSLRADVPSA-EQDDVAQALLDRFRCVPAFLPKDVLDRFYHGFCKQTLWPLFHY  178

Query  563  MLPLSPDLGGRFDRNLWQA  619
            MLP + D GGRFDR+ W+A
Sbjct  179  MLPFTSDHGGRFDRSQWEA  197



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520