BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS063H12

Length=609
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001274713.1|  leucine-rich repeat receptor-like serine/thr...    285   6e-86   Solanum lycopersicum
dbj|BAK52389.1|  leucine rich repeat receptor protein kinase CLAV...    284   7e-86   Solanum pennellii
ref|XP_006357743.1|  PREDICTED: leucine-rich repeat receptor-like...    283   3e-85   Solanum tuberosum [potatoes]
dbj|BAK52390.1|  leucine rich repeat receptor protein kinase CLAV...    281   8e-85   Solanum peruvianum [Peruvian tomato]
emb|CDP02660.1|  unnamed protein product                                281   1e-84   Coffea canephora [robusta coffee]
ref|XP_011073654.1|  PREDICTED: leucine-rich repeat receptor-like...    280   2e-84   Sesamum indicum [beniseed]
ref|XP_009613990.1|  PREDICTED: leucine-rich repeat receptor-like...    279   7e-84   Nicotiana tomentosiformis
ref|XP_009786199.1|  PREDICTED: leucine-rich repeat receptor-like...    279   8e-84   Nicotiana sylvestris
ref|XP_009375880.1|  PREDICTED: leucine-rich repeat receptor-like...    279   8e-84   Pyrus x bretschneideri [bai li]
ref|XP_006364007.1|  PREDICTED: leucine-rich repeat receptor-like...    278   1e-83   Solanum tuberosum [potatoes]
ref|XP_009771232.1|  PREDICTED: leucine-rich repeat receptor-like...    278   1e-83   Nicotiana sylvestris
ref|XP_009605676.1|  PREDICTED: leucine-rich repeat receptor-like...    278   1e-83   Nicotiana tomentosiformis
ref|XP_007208421.1|  hypothetical protein PRUPE_ppa000739mg             277   3e-83   Prunus persica
ref|XP_011099433.1|  PREDICTED: leucine-rich repeat receptor-like...    277   3e-83   Sesamum indicum [beniseed]
ref|XP_008344369.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    276   7e-83   
ref|XP_008354741.1|  PREDICTED: leucine-rich repeat receptor-like...    276   1e-82   
ref|XP_009354585.1|  PREDICTED: leucine-rich repeat receptor-like...    275   2e-82   Pyrus x bretschneideri [bai li]
ref|XP_008393812.1|  PREDICTED: leucine-rich repeat receptor-like...    275   3e-82   
ref|XP_004234641.1|  PREDICTED: leucine-rich repeat receptor-like...    272   2e-81   Solanum lycopersicum
ref|XP_004288299.1|  PREDICTED: leucine-rich repeat receptor-like...    271   8e-81   Fragaria vesca subsp. vesca
ref|XP_010268646.1|  PREDICTED: leucine-rich repeat receptor-like...    267   2e-79   Nelumbo nucifera [Indian lotus]
gb|AIT56194.1|  leucine-rich repeat receptor-like serine/threonin...    266   3e-79   Dimocarpus longan [longan]
gb|EYU41357.1|  hypothetical protein MIMGU_mgv1a000718mg                266   4e-79   Erythranthe guttata [common monkey flower]
ref|XP_010271550.1|  PREDICTED: leucine-rich repeat receptor-like...    266   4e-79   Nelumbo nucifera [Indian lotus]
ref|XP_010028033.1|  PREDICTED: leucine-rich repeat receptor-like...    265   1e-78   Eucalyptus grandis [rose gum]
ref|NP_001235080.1|  receptor-like protein kinase 3 precursor           264   2e-78   
ref|XP_006466390.1|  PREDICTED: leucine-rich repeat receptor-like...    261   2e-77   Citrus sinensis [apfelsine]
gb|KDO78771.1|  hypothetical protein CISIN_1g001816mg                   261   2e-77   Citrus sinensis [apfelsine]
ref|XP_006426178.1|  hypothetical protein CICLE_v10024796mg             261   2e-77   Citrus clementina [clementine]
emb|CBI35733.3|  unnamed protein product                                260   3e-77   Vitis vinifera
ref|XP_010105101.1|  Leucine-rich repeat receptor-like serine/thr...    261   3e-77   Morus notabilis
ref|XP_003635561.1|  PREDICTED: leucine-rich repeat receptor-like...    260   5e-77   Vitis vinifera
ref|XP_006404116.1|  hypothetical protein EUTSA_v10010092mg             259   6e-77   
ref|NP_190536.1|  CLAVATA1-related receptor kinase-like protein         259   7e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010547579.1|  PREDICTED: leucine-rich repeat receptor-like...    259   1e-76   Tarenaya hassleriana [spider flower]
ref|NP_001237715.1|  receptor-like protein kinase 2 precursor           259   1e-76   Glycine max [soybeans]
ref|XP_002875982.1|  hypothetical protein ARALYDRAFT_906265             258   2e-76   Arabidopsis lyrata subsp. lyrata
gb|KFK34238.1|  hypothetical protein AALP_AA5G119100                    258   2e-76   Arabis alpina [alpine rockcress]
ref|XP_004509039.1|  PREDICTED: leucine-rich repeat receptor-like...    258   3e-76   Cicer arietinum [garbanzo]
ref|XP_004511796.1|  PREDICTED: leucine-rich repeat receptor-like...    257   4e-76   
ref|XP_010484412.1|  PREDICTED: leucine-rich repeat receptor-like...    257   5e-76   Camelina sativa [gold-of-pleasure]
ref|XP_010444585.1|  PREDICTED: leucine-rich repeat receptor-like...    257   5e-76   Camelina sativa [gold-of-pleasure]
ref|XP_002864974.1|  hypothetical protein ARALYDRAFT_496807             256   9e-76   
ref|XP_008237309.1|  PREDICTED: leucine-rich repeat receptor-like...    255   2e-75   
ref|XP_010463501.1|  PREDICTED: leucine-rich repeat receptor-like...    255   2e-75   Camelina sativa [gold-of-pleasure]
gb|ADB85326.1|  putative receptor protein kinase                        239   2e-75   Phyllostachys edulis [kikko-chiku]
ref|NP_201371.1|  leucine-rich repeat receptor-like serine/threon...    255   3e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006279943.1|  hypothetical protein CARUB_v10025808mg             255   3e-75   Capsella rubella
ref|XP_006393995.1|  hypothetical protein EUTSA_v10003584mg             254   4e-75   
ref|XP_009136515.1|  PREDICTED: leucine-rich repeat receptor-like...    254   6e-75   Brassica rapa
ref|XP_010515326.1|  PREDICTED: leucine-rich repeat receptor-like...    254   6e-75   Camelina sativa [gold-of-pleasure]
gb|KJB18115.1|  hypothetical protein B456_003G034500                    253   1e-74   Gossypium raimondii
ref|XP_009150662.1|  PREDICTED: leucine-rich repeat receptor-like...    253   1e-74   Brassica rapa
gb|KHG04200.1|  Leucine-rich repeat receptor-like serine/threonin...    253   1e-74   Gossypium arboreum [tree cotton]
ref|XP_010426489.1|  PREDICTED: leucine-rich repeat receptor-like...    253   2e-74   Camelina sativa [gold-of-pleasure]
gb|EPS74129.1|  hypothetical protein M569_00625                         252   3e-74   Genlisea aurea
ref|XP_006290548.1|  hypothetical protein CARUB_v10016631mg             252   3e-74   Capsella rubella
ref|XP_002310320.2|  hypothetical protein POPTR_0007s14500g             251   4e-74   Populus trichocarpa [western balsam poplar]
ref|XP_007155783.1|  hypothetical protein PHAVU_003G231400g             251   1e-73   Phaseolus vulgaris [French bean]
ref|XP_011021820.1|  PREDICTED: leucine-rich repeat receptor-like...    250   1e-73   Populus euphratica
gb|KJB48795.1|  hypothetical protein B456_008G087500                    250   2e-73   Gossypium raimondii
gb|KJB18113.1|  hypothetical protein B456_003G034400                    250   2e-73   Gossypium raimondii
ref|XP_010518800.1|  PREDICTED: leucine-rich repeat receptor-like...    250   2e-73   Tarenaya hassleriana [spider flower]
gb|KHG03710.1|  Leucine-rich repeat receptor-like serine/threonin...    248   7e-73   Gossypium arboreum [tree cotton]
ref|XP_008441113.1|  PREDICTED: leucine-rich repeat receptor-like...    248   1e-72   Cucumis melo [Oriental melon]
ref|XP_002531999.1|  Receptor protein kinase CLAVATA1 precursor, ...    247   2e-72   Ricinus communis
gb|KDP32143.1|  hypothetical protein JCGZ_12604                         247   2e-72   Jatropha curcas
ref|XP_004143422.1|  PREDICTED: leucine-rich repeat receptor-like...    247   2e-72   Cucumis sativus [cucumbers]
ref|XP_010503631.1|  PREDICTED: leucine-rich repeat receptor-like...    246   2e-72   Camelina sativa [gold-of-pleasure]
gb|KFK28239.1|  hypothetical protein AALP_AA8G490400                    246   3e-72   Arabis alpina [alpine rockcress]
ref|XP_007047661.1|  Leucine-rich receptor-like protein kinase fa...    246   4e-72   
ref|NP_001235065.1|  receptor-like protein kinase 1 precursor           246   5e-72   Glycine max [soybeans]
ref|XP_010939309.1|  PREDICTED: leucine-rich repeat receptor-like...    243   3e-71   Elaeis guineensis
ref|XP_010683073.1|  PREDICTED: leucine-rich repeat receptor-like...    243   4e-71   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001237688.1|  receptor-like protein kinase precursor             243   5e-71   Glycine max [soybeans]
ref|XP_009397330.1|  PREDICTED: leucine-rich repeat receptor-like...    241   4e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008790445.1|  PREDICTED: leucine-rich repeat receptor-like...    240   5e-70   Phoenix dactylifera
ref|XP_008787359.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    237   5e-69   
gb|AES94465.2|  LRR receptor-like kinase family protein                 237   6e-69   Medicago truncatula
ref|XP_003611507.1|  Receptor-like protein kinase                       237   9e-69   
ref|XP_007156674.1|  hypothetical protein PHAVU_002G007600g             235   3e-68   Phaseolus vulgaris [French bean]
ref|XP_009394785.1|  PREDICTED: leucine-rich repeat receptor-like...    234   5e-68   
ref|XP_009395647.1|  PREDICTED: leucine-rich repeat receptor-like...    234   1e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006852730.1|  hypothetical protein AMTR_s00033p00083200          233   1e-67   
ref|XP_009408581.1|  PREDICTED: leucine-rich repeat receptor-like...    233   2e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010936307.1|  PREDICTED: leucine-rich repeat receptor-like...    232   3e-67   
ref|XP_006650665.1|  PREDICTED: leucine-rich repeat receptor-like...    232   4e-67   Oryza brachyantha
emb|CDY08759.1|  BnaA06g24650D                                          231   6e-67   Brassica napus [oilseed rape]
dbj|BAJ84911.1|  predicted protein                                      231   6e-67   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010941985.1|  PREDICTED: leucine-rich repeat receptor-like...    231   8e-67   Elaeis guineensis
ref|XP_009394620.1|  PREDICTED: leucine-rich repeat receptor-like...    231   8e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002466378.1|  hypothetical protein SORBIDRAFT_01g006690          230   2e-66   Sorghum bicolor [broomcorn]
ref|XP_008665503.1|  PREDICTED: leucine-rich repeat receptor-like...    229   4e-66   Zea mays [maize]
ref|XP_009396449.1|  PREDICTED: leucine-rich repeat receptor-like...    228   1e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004955422.1|  PREDICTED: leucine-rich repeat receptor-like...    228   1e-65   
ref|XP_004981595.1|  PREDICTED: leucine-rich repeat receptor-like...    228   1e-65   Setaria italica
emb|CDY02112.1|  BnaA03g40550D                                          224   1e-64   
ref|XP_003608587.1|  Receptor-like protein kinase                       224   2e-64   Medicago truncatula
ref|NP_001058840.2|  Os07g0134200                                       224   2e-64   
gb|EAZ02682.1|  hypothetical protein OsI_24796                          224   2e-64   Oryza sativa Indica Group [Indian rice]
dbj|BAC82955.1|  putative OsLRK1(receptor-type protein kinase)          224   2e-64   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA59489.1|  TPA: putative leucine-rich repeat receptor-like ...    224   5e-64   
gb|ABF99108.1|  Receptor protein kinase CLAVATA1 precursor, putat...    221   8e-64   Oryza sativa Japonica Group [Japonica rice]
gb|AAP68887.1|  putative receptor-like protein kinase 1                 223   1e-63   Oryza sativa Japonica Group [Japonica rice]
gb|EAY92008.1|  hypothetical protein OsI_13698                          222   1e-63   Oryza sativa Indica Group [Indian rice]
dbj|BAJ89729.1|  predicted protein                                      222   1e-63   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEE60014.1|  hypothetical protein OsJ_12761                          221   4e-63   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009411355.1|  PREDICTED: leucine-rich repeat receptor-like...    221   5e-63   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY23037.1|  BnaC07g31500D                                          219   8e-63   Brassica napus [oilseed rape]
ref|XP_002461427.1|  hypothetical protein SORBIDRAFT_02g002450          219   1e-62   Sorghum bicolor [broomcorn]
ref|XP_003558681.1|  PREDICTED: leucine-rich repeat receptor-like...    218   4e-62   Brachypodium distachyon [annual false brome]
ref|XP_006853709.1|  hypothetical protein AMTR_s00056p00150470          212   3e-60   Amborella trichopoda
ref|XP_010943209.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    213   4e-60   
ref|XP_009399076.1|  PREDICTED: leucine-rich repeat receptor-like...    213   4e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008787754.1|  PREDICTED: leucine-rich repeat receptor-like...    211   1e-59   Phoenix dactylifera
emb|CDY45620.1|  BnaCnng13280D                                          207   2e-58   Brassica napus [oilseed rape]
ref|XP_008440463.1|  PREDICTED: leucine-rich repeat receptor-like...    206   8e-58   Cucumis melo [Oriental melon]
ref|XP_003557615.1|  PREDICTED: leucine-rich repeat receptor-like...    205   3e-57   Brachypodium distachyon [annual false brome]
ref|XP_004143533.1|  PREDICTED: leucine-rich repeat receptor-like...    204   5e-57   Cucumis sativus [cucumbers]
ref|XP_004160944.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    204   5e-57   
gb|AAF73373.1|AF193835_1  LRK1 protein                                  201   3e-56   Oryza sativa [red rice]
ref|XP_010260843.1|  PREDICTED: leucine-rich repeat receptor-like...    197   1e-54   Nelumbo nucifera [Indian lotus]
ref|XP_001754727.1|  CLL1A clavata1-like receptor S/T protein kin...    195   7e-54   
ref|XP_011004295.1|  PREDICTED: leucine-rich repeat receptor-like...    189   4e-52   Populus euphratica
ref|XP_004295533.1|  PREDICTED: leucine-rich repeat receptor-like...    190   5e-52   Fragaria vesca subsp. vesca
ref|XP_011004294.1|  PREDICTED: leucine-rich repeat receptor-like...    190   5e-52   Populus euphratica
ref|XP_007214567.1|  hypothetical protein PRUPE_ppa000837mg             189   1e-51   Prunus persica
ref|XP_008808401.1|  PREDICTED: leucine-rich repeat receptor-like...    188   2e-51   Phoenix dactylifera
ref|XP_002297907.2|  leucine-rich repeat transmembrane protein ki...    187   3e-51   Populus trichocarpa [western balsam poplar]
ref|XP_001752668.1|  CLL1B clavata1-like receptor S/T protein kin...    187   4e-51   
ref|XP_011022287.1|  PREDICTED: leucine-rich repeat receptor-like...    187   6e-51   Populus euphratica
ref|XP_002985227.1|  hypothetical protein SELMODRAFT_121783             187   6e-51   
ref|XP_002304615.1|  leucine-rich repeat transmembrane protein ki...    187   7e-51   Populus trichocarpa [western balsam poplar]
ref|XP_002970036.1|  hypothetical protein SELMODRAFT_146738             187   8e-51   
ref|XP_009418700.1|  PREDICTED: leucine-rich repeat receptor-like...    186   1e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008225951.1|  PREDICTED: leucine-rich repeat receptor-like...    186   1e-50   Prunus mume [ume]
ref|XP_004985112.1|  PREDICTED: leucine-rich repeat receptor-like...    186   2e-50   Setaria italica
ref|XP_006655663.1|  PREDICTED: leucine-rich repeat receptor-like...    185   3e-50   Oryza brachyantha
ref|XP_004960969.1|  PREDICTED: leucine-rich repeat receptor-like...    185   3e-50   Setaria italica
ref|XP_009405747.1|  PREDICTED: leucine-rich repeat receptor-like...    185   3e-50   
gb|AHJ14779.1|  CLAVATA1                                                185   3e-50   Rhododendron ovatum
ref|XP_002307734.1|  receptor protein kinase                            185   3e-50   Populus trichocarpa [western balsam poplar]
ref|XP_002264952.1|  PREDICTED: leucine-rich repeat receptor-like...    185   4e-50   Vitis vinifera
ref|XP_008793129.1|  PREDICTED: leucine-rich repeat receptor-like...    185   4e-50   
ref|XP_009415746.1|  PREDICTED: leucine-rich repeat receptor-like...    184   5e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007040964.1|  Leucine-rich receptor-like protein kinase fa...    184   1e-49   
ref|XP_009108464.1|  PREDICTED: leucine-rich repeat receptor-like...    184   1e-49   Brassica rapa
ref|XP_011045060.1|  PREDICTED: receptor protein kinase CLAVATA1-...    183   1e-49   Populus euphratica
dbj|BAJ99137.1|  predicted protein                                      183   1e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDP04113.1|  unnamed protein product                                183   2e-49   Coffea canephora [robusta coffee]
ref|XP_010228930.1|  PREDICTED: leucine-rich repeat receptor-like...    182   4e-49   
ref|XP_008799579.1|  PREDICTED: leucine-rich repeat receptor-like...    182   5e-49   Phoenix dactylifera
ref|XP_007017845.1|  Leucine-rich receptor-like protein kinase fa...    181   6e-49   
ref|XP_006448558.1|  hypothetical protein CICLE_v10014145mg             181   7e-49   Citrus clementina [clementine]
ref|XP_010935096.1|  PREDICTED: leucine-rich repeat receptor-like...    181   7e-49   Elaeis guineensis
ref|XP_006856744.1|  hypothetical protein AMTR_s00055p00012250          181   1e-48   
ref|XP_008808621.1|  PREDICTED: leucine-rich repeat receptor-like...    180   1e-48   
ref|XP_010428620.1|  PREDICTED: receptor protein kinase CLAVATA1-...    180   1e-48   Camelina sativa [gold-of-pleasure]
emb|CDX87661.1|  BnaA07g32120D                                          180   2e-48   
ref|XP_004291349.1|  PREDICTED: receptor protein kinase CLAVATA1        180   2e-48   Fragaria vesca subsp. vesca
ref|XP_010471715.1|  PREDICTED: receptor protein kinase CLAVATA1 ...    180   2e-48   
ref|XP_006468613.1|  PREDICTED: leucine-rich repeat receptor-like...    179   2e-48   Citrus sinensis [apfelsine]
ref|XP_006468612.1|  PREDICTED: leucine-rich repeat receptor-like...    179   3e-48   Citrus sinensis [apfelsine]
ref|XP_010416487.1|  PREDICTED: receptor protein kinase CLAVATA1-...    179   3e-48   Camelina sativa [gold-of-pleasure]
ref|XP_009106236.1|  PREDICTED: receptor protein kinase CLAVATA1        179   3e-48   Brassica rapa
ref|XP_010918071.1|  PREDICTED: leucine-rich repeat receptor-like...    179   3e-48   Elaeis guineensis
ref|XP_010266811.1|  PREDICTED: receptor protein kinase CLAVATA1        179   4e-48   
ref|XP_003530709.1|  PREDICTED: leucine-rich repeat receptor-like...    179   4e-48   Glycine max [soybeans]
ref|XP_002991545.1|  hypothetical protein SELMODRAFT_186143             179   4e-48   
ref|XP_002971751.1|  hypothetical protein SELMODRAFT_172284             179   5e-48   
ref|XP_008647502.1|  PREDICTED: uncharacterized LOC100272700 isof...    179   7e-48   
emb|CDX73202.1|  BnaC06g36500D                                          178   7e-48   
ref|XP_006300675.1|  hypothetical protein CARUB_v10019714mg             178   7e-48   Capsella rubella
gb|AAP49010.1|  CLV1-like receptor kinase                               178   8e-48   Brassica napus [oilseed rape]
ref|XP_008647500.1|  PREDICTED: uncharacterized LOC100272700 isof...    179   8e-48   
gb|ADD64789.1|  CLAVATA1                                                178   8e-48   Brassica napus [oilseed rape]
gb|KJB29653.1|  hypothetical protein B456_005G112100                    178   8e-48   Gossypium raimondii
ref|XP_006473681.1|  PREDICTED: receptor protein kinase CLAVATA1-...    178   8e-48   Citrus sinensis [apfelsine]
ref|XP_008647501.1|  PREDICTED: uncharacterized LOC100272700 isof...    178   9e-48   Zea mays [maize]
gb|KDP36903.1|  hypothetical protein JCGZ_08194                         178   1e-47   Jatropha curcas
gb|KJB16198.1|  hypothetical protein B456_002G217000                    176   1e-47   Gossypium raimondii
tpg|DAA44225.1|  TPA: putative leucine-rich repeat receptor-like ...    177   1e-47   
ref|XP_008357152.1|  PREDICTED: receptor protein kinase CLAVATA1-...    176   2e-47   
ref|XP_002532709.1|  Receptor protein kinase CLAVATA1 precursor, ...    177   2e-47   Ricinus communis
ref|XP_002526451.1|  Receptor protein kinase CLAVATA1 precursor, ...    177   3e-47   Ricinus communis
gb|KDP23869.1|  hypothetical protein JCGZ_27138                         177   3e-47   Jatropha curcas
gb|EEC79804.1|  hypothetical protein OsI_21242                          177   3e-47   Oryza sativa Indica Group [Indian rice]
ref|XP_008364929.1|  PREDICTED: receptor protein kinase CLAVATA1-...    176   3e-47   
ref|NP_001174552.1|  Os05g0595950                                       177   3e-47   
gb|KHG17337.1|  Leucine-rich repeat receptor-like serine/threonin...    176   4e-47   Gossypium arboreum [tree cotton]
ref|XP_009393965.1|  PREDICTED: leucine-rich repeat receptor-like...    174   4e-47   
ref|XP_002510557.1|  Receptor protein kinase CLAVATA1 precursor, ...    176   4e-47   
ref|XP_006435205.1|  hypothetical protein CICLE_v10000156mg             176   4e-47   Citrus clementina [clementine]
gb|KDO84901.1|  hypothetical protein CISIN_1g002010mg                   176   5e-47   Citrus sinensis [apfelsine]
gb|KEH33614.1|  LRR receptor-like kinase family protein                 176   5e-47   Medicago truncatula
gb|KFK42020.1|  hypothetical protein AALP_AA2G201900                    176   5e-47   Arabis alpina [alpine rockcress]
gb|KCW62729.1|  hypothetical protein EUGRSUZ_G00319                     176   6e-47   Eucalyptus grandis [rose gum]
gb|KHG24572.1|  Receptor protein kinase CLAVATA1                        176   6e-47   Gossypium arboreum [tree cotton]
ref|XP_010110004.1|  Receptor protein kinase CLAVATA1                   176   7e-47   
ref|XP_010065309.1|  PREDICTED: leucine-rich repeat receptor-like...    176   7e-47   Eucalyptus grandis [rose gum]
gb|KJB16199.1|  hypothetical protein B456_002G217000                    176   8e-47   Gossypium raimondii
ref|XP_006390268.1|  hypothetical protein EUTSA_v10018069mg             175   9e-47   Eutrema salsugineum [saltwater cress]
emb|CBI19895.3|  unnamed protein product                                174   9e-47   Vitis vinifera
ref|XP_009415213.1|  PREDICTED: leucine-rich repeat receptor-like...    175   9e-47   
ref|XP_002300697.2|  receptor protein kinase                            175   1e-46   
ref|XP_008356104.1|  PREDICTED: leucine-rich repeat receptor-like...    175   1e-46   
ref|XP_009415217.1|  PREDICTED: leucine-rich repeat receptor-like...    175   1e-46   
ref|XP_010668145.1|  PREDICTED: receptor protein kinase CLAVATA1-...    172   1e-46   
gb|KCW58273.1|  hypothetical protein EUGRSUZ_H00964                     175   1e-46   Eucalyptus grandis [rose gum]
ref|XP_010026074.1|  PREDICTED: receptor protein kinase CLAVATA1        174   2e-46   Eucalyptus grandis [rose gum]
gb|KJB32927.1|  hypothetical protein B456_005G268400                    174   2e-46   Gossypium raimondii
ref|XP_002889046.1|  hypothetical protein ARALYDRAFT_476729             174   2e-46   
ref|XP_002441645.1|  hypothetical protein SORBIDRAFT_09g030870          174   2e-46   Sorghum bicolor [broomcorn]
ref|XP_010246813.1|  PREDICTED: receptor protein kinase CLAVATA1-...    174   3e-46   Nelumbo nucifera [Indian lotus]
ref|XP_002279563.1|  PREDICTED: receptor protein kinase CLAVATA1        174   3e-46   Vitis vinifera
ref|XP_010924539.1|  PREDICTED: leucine-rich repeat receptor-like...    174   3e-46   Elaeis guineensis
ref|XP_004499483.1|  PREDICTED: leucine-rich repeat receptor-like...    174   3e-46   Cicer arietinum [garbanzo]
ref|XP_007041221.1|  Leucine-rich receptor-like protein kinase fa...    174   4e-46   
ref|XP_006283067.1|  hypothetical protein CARUB_v10004060mg             173   5e-46   Capsella rubella
pir||E96787  protein T4O12.5 [imported] - Arabidopsis thaliana          173   5e-46
ref|XP_008221401.1|  PREDICTED: receptor protein kinase CLAVATA1        172   5e-46   
ref|NP_177710.1|  receptor protein kinase CLAVATA1                      173   5e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010030176.1|  PREDICTED: leucine-rich repeat receptor-like...    173   5e-46   Eucalyptus grandis [rose gum]
ref|XP_007225356.1|  hypothetical protein PRUPE_ppa000916mg             172   7e-46   
gb|KJB59753.1|  hypothetical protein B456_009G269700                    170   8e-46   Gossypium raimondii
ref|NP_001051418.1|  Os03g0773700                                       172   9e-46   
gb|KHG23359.1|  Leucine-rich repeat receptor-like serine/threonin...    172   1e-45   Gossypium arboreum [tree cotton]
gb|KDP42443.1|  hypothetical protein JCGZ_00240                         172   1e-45   Jatropha curcas
emb|CBI29704.3|  unnamed protein product                                171   1e-45   Vitis vinifera
ref|XP_011035024.1|  PREDICTED: receptor protein kinase CLAVATA1-...    170   2e-45   Populus euphratica
ref|XP_002263291.2|  PREDICTED: leucine-rich repeat receptor-like...    172   2e-45   Vitis vinifera
emb|CAN71863.1|  hypothetical protein VITISV_023530                     171   2e-45   Vitis vinifera
ref|XP_006602289.1|  PREDICTED: leucine-rich repeat receptor-like...    171   2e-45   Glycine max [soybeans]
ref|XP_009334873.1|  PREDICTED: receptor protein kinase CLAVATA1        171   3e-45   Pyrus x bretschneideri [bai li]
ref|XP_011035001.1|  PREDICTED: receptor protein kinase CLAVATA1-...    171   3e-45   Populus euphratica
emb|CDO97616.1|  unnamed protein product                                170   6e-45   Coffea canephora [robusta coffee]
ref|NP_001049453.1|  Os03g0228800                                       170   7e-45   
gb|AAM27467.1|AC099732_4  Putative receptor-like protein kinase         170   7e-45   Oryza sativa Japonica Group [Japonica rice]
gb|EEC74807.1|  hypothetical protein OsI_10619                          170   7e-45   Oryza sativa Indica Group [Indian rice]
gb|AAB58929.1|  CLV1 receptor kinase                                    170   8e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007146301.1|  hypothetical protein PHAVU_006G029000g             170   8e-45   Phaseolus vulgaris [French bean]
gb|AAD02501.1|  receptor kinase                                         170   8e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006413888.1|  hypothetical protein EUTSA_v10024310mg             170   8e-45   Eutrema salsugineum [saltwater cress]
ref|XP_010449207.1|  PREDICTED: leucine-rich repeat receptor-like...    170   8e-45   Camelina sativa [gold-of-pleasure]
gb|KJB47871.1|  hypothetical protein B456_008G045400                    170   8e-45   Gossypium raimondii
ref|XP_003545159.1|  PREDICTED: leucine-rich repeat receptor-like...    169   9e-45   Glycine max [soybeans]
emb|CDP07377.1|  unnamed protein product                                168   1e-44   Coffea canephora [robusta coffee]
ref|XP_006649672.1|  PREDICTED: leucine-rich repeat receptor-like...    169   1e-44   Oryza brachyantha
ref|XP_008387933.1|  PREDICTED: receptor protein kinase CLAVATA1        169   2e-44   Malus domestica [apple tree]
ref|XP_010439602.1|  PREDICTED: leucine-rich repeat receptor-like...    169   2e-44   Camelina sativa [gold-of-pleasure]
ref|XP_004155230.1|  PREDICTED: leucine-rich repeat receptor-like...    169   2e-44   
ref|XP_010243899.1|  PREDICTED: leucine-rich repeat receptor-like...    168   2e-44   Nelumbo nucifera [Indian lotus]
ref|XP_009403711.1|  PREDICTED: leucine-rich repeat receptor-like...    168   3e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011092305.1|  PREDICTED: leucine-rich repeat receptor-like...    168   3e-44   Sesamum indicum [beniseed]
ref|XP_009603651.1|  PREDICTED: leucine-rich repeat receptor-like...    167   5e-44   Nicotiana tomentosiformis
ref|XP_010685023.1|  PREDICTED: receptor-like protein 12                166   5e-44   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009401113.1|  PREDICTED: leucine-rich repeat receptor-like...    167   5e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009368577.1|  PREDICTED: leucine-rich repeat receptor-like...    167   7e-44   Pyrus x bretschneideri [bai li]
ref|XP_010243895.1|  PREDICTED: leucine-rich repeat receptor-like...    167   7e-44   Nelumbo nucifera [Indian lotus]
ref|XP_004150938.1|  PREDICTED: leucine-rich repeat receptor-like...    167   9e-44   Cucumis sativus [cucumbers]
ref|XP_010671767.1|  PREDICTED: receptor protein kinase CLAVATA1        167   9e-44   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN38370.1|  Leucine-rich repeat receptor-like serine/threonin...    166   1e-43   Glycine soja [wild soybean]
ref|XP_011028346.1|  PREDICTED: leucine-rich repeat receptor-like...    166   1e-43   Populus euphratica
ref|XP_011083584.1|  PREDICTED: receptor protein kinase CLAVATA1        166   1e-43   Sesamum indicum [beniseed]
ref|XP_003518489.2|  PREDICTED: leucine-rich repeat receptor-like...    166   1e-43   
gb|KDO44093.1|  hypothetical protein CISIN_1g001922mg                   166   1e-43   Citrus sinensis [apfelsine]
ref|XP_011074693.1|  PREDICTED: receptor protein kinase CLAVATA1-...    166   2e-43   Sesamum indicum [beniseed]
ref|XP_006492589.1|  PREDICTED: leucine-rich repeat receptor-like...    166   2e-43   Citrus sinensis [apfelsine]
dbj|BAI82122.1|  CLV1-like LRR receptor kinase                          166   2e-43   Silene latifolia
ref|XP_011087678.1|  PREDICTED: leucine-rich repeat receptor-like...    166   2e-43   
ref|XP_004966471.1|  PREDICTED: leucine-rich repeat receptor-like...    166   2e-43   Setaria italica
ref|XP_008349109.1|  PREDICTED: leucine-rich repeat receptor-like...    165   3e-43   Malus domestica [apple tree]
ref|XP_004230451.1|  PREDICTED: leucine-rich repeat receptor-like...    165   5e-43   Solanum lycopersicum
ref|XP_002869943.1|  hypothetical protein ARALYDRAFT_492844             164   8e-43   
ref|XP_006349327.1|  PREDICTED: leucine-rich repeat receptor-like...    164   9e-43   Solanum tuberosum [potatoes]
ref|XP_007131793.1|  hypothetical protein PHAVU_011G042000g             164   9e-43   Phaseolus vulgaris [French bean]
ref|XP_006431638.1|  hypothetical protein CICLE_v10000148mg             164   9e-43   
ref|XP_010675918.1|  PREDICTED: leucine-rich repeat receptor-like...    164   9e-43   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB32855.1|  hypothetical protein B456_005G265400                    164   1e-42   Gossypium raimondii
gb|AIT55304.1|  nodulation autoregulation receptor kinase               164   1e-42   
ref|XP_004983327.1|  PREDICTED: leucine-rich repeat receptor-like...    159   1e-42   
gb|KJB58082.1|  hypothetical protein B456_009G193600                    163   1e-42   
emb|CAD42335.1|  hypernodulation aberrant root formation protein        163   2e-42   
gb|ACN59341.1|  leucine-rich repeat receptor-like protein kinase        163   2e-42   
ref|XP_010687839.1|  PREDICTED: leucine-rich repeat receptor-like...    163   2e-42   
ref|NP_193760.1|  leucine-rich receptor-like protein kinase BAM3        163   2e-42   
ref|XP_007224667.1|  hypothetical protein PRUPE_ppa026134mg             162   3e-42   
ref|XP_004301907.1|  PREDICTED: leucine-rich repeat receptor-like...    162   3e-42   
ref|XP_004238370.1|  PREDICTED: receptor protein kinase CLAVATA1        162   3e-42   
ref|NP_001058593.1|  Os06g0717200                                       162   4e-42   
ref|XP_009787949.1|  PREDICTED: leucine-rich repeat receptor-like...    162   5e-42   
ref|XP_006656496.1|  PREDICTED: leucine-rich repeat receptor-like...    162   5e-42   
ref|XP_010536408.1|  PREDICTED: receptor protein kinase CLAVATA1-...    162   5e-42   
ref|XP_010094628.1|  Leucine-rich repeat receptor-like serine/thr...    162   5e-42   
ref|XP_008233100.1|  PREDICTED: receptor protein kinase CLAVATA1-...    162   6e-42   
ref|XP_009353760.1|  PREDICTED: leucine-rich repeat receptor-like...    162   7e-42   
ref|XP_009415664.1|  PREDICTED: leucine-rich repeat receptor-like...    161   8e-42   
ref|XP_006385034.1|  hypothetical protein POPTR_0004s23260g             161   9e-42   
ref|XP_008786484.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    161   9e-42   
ref|XP_002962293.1|  hypothetical protein SELMODRAFT_77558              161   9e-42   
ref|XP_007131794.1|  hypothetical protein PHAVU_011G042100g             159   1e-41   
gb|EAZ02372.1|  hypothetical protein OsI_24476                          161   1e-41   
ref|XP_008218726.1|  PREDICTED: leucine-rich repeat receptor-like...    161   1e-41   
ref|XP_008339390.1|  PREDICTED: leucine-rich repeat receptor-like...    160   1e-41   
gb|KHG13927.1|  Leucine-rich repeat receptor-like serine/threonin...    160   1e-41   
ref|XP_002965214.1|  hypothetical protein SELMODRAFT_83051              160   1e-41   
gb|KHG14208.1|  Leucine-rich repeat receptor-like serine/threonin...    160   1e-41   
ref|XP_009363288.1|  PREDICTED: leucine-rich repeat receptor-like...    160   2e-41   
ref|XP_010539846.1|  PREDICTED: receptor protein kinase CLAVATA1        160   2e-41   
ref|XP_007213482.1|  hypothetical protein PRUPE_ppa023389mg             160   2e-41   
ref|XP_010023395.1|  PREDICTED: leucine-rich repeat receptor-like...    159   3e-41   
gb|KHG26020.1|  Receptor protein kinase CLAVATA1                        159   3e-41   
ref|XP_003592924.1|  Receptor-like protein kinase                       159   4e-41   
ref|XP_009763204.1|  PREDICTED: leucine-rich repeat receptor-like...    159   5e-41   
ref|XP_008347921.1|  PREDICTED: leucine-rich repeat receptor-like...    159   5e-41   
gb|EYU36796.1|  hypothetical protein MIMGU_mgv1a020841mg                159   5e-41   
gb|ABE79572.2|  Protein kinase                                          159   5e-41   
ref|XP_008452253.1|  PREDICTED: leucine-rich repeat receptor-like...    159   6e-41   
ref|XP_009355307.1|  PREDICTED: leucine-rich repeat receptor-like...    158   1e-40   
ref|XP_010529317.1|  PREDICTED: leucine-rich repeat receptor-like...    157   2e-40   
ref|XP_008466473.1|  PREDICTED: receptor protein kinase CLAVATA1        157   2e-40   
ref|NP_001238004.1|  receptor protein kinase-like protein precursor     157   3e-40   
dbj|BAC41332.1|  LRR receptor-like kinase                               157   3e-40   
gb|KHN25406.1|  Receptor protein kinase CLAVATA1                        157   3e-40   
gb|EYU26470.1|  hypothetical protein MIMGU_mgv1a019834mg                157   3e-40   
ref|XP_009392569.1|  PREDICTED: leucine-rich repeat receptor-like...    156   4e-40   
dbj|BAJ98758.1|  predicted protein                                      157   4e-40   
ref|XP_009392568.1|  PREDICTED: leucine-rich repeat receptor-like...    156   5e-40   
gb|EEC67924.1|  hypothetical protein OsI_35629                          156   6e-40   
emb|CAD42181.1|  serine-threonine protein kinase                        156   6e-40   
gb|AAX96206.1|  Similar to receptor-like protein kinase 3               156   7e-40   
ref|XP_008377848.1|  PREDICTED: receptor protein kinase CLAVATA1-...    155   7e-40   
gb|KCW59634.1|  hypothetical protein EUGRSUZ_H023832                    155   8e-40   
gb|KJB43996.1|  hypothetical protein B456_007G228700                    154   1e-39   
ref|XP_004136488.1|  PREDICTED: receptor protein kinase CLAVATA1-...    155   2e-39   
ref|XP_009600411.1|  PREDICTED: leucine-rich repeat receptor-like...    155   2e-39   
ref|XP_002439033.1|  hypothetical protein SORBIDRAFT_10g030270          155   2e-39   
ref|XP_010912647.1|  PREDICTED: leucine-rich repeat receptor-like...    154   2e-39   
ref|XP_003576141.1|  PREDICTED: leucine-rich repeat receptor-like...    154   3e-39   
gb|AAW71475.1|  CLV1-like receptor kinase                               154   3e-39   
ref|XP_003606988.1|  Receptor protein kinase CLAVATA1                   154   3e-39   
ref|XP_004229499.1|  PREDICTED: leucine-rich repeat receptor-like...    153   5e-39   
ref|XP_006356981.1|  PREDICTED: leucine-rich repeat receptor-like...    153   5e-39   
gb|EPS70741.1|  hypothetical protein M569_04011                         153   6e-39   
gb|ACH59593.1|  LRR receptor-like protein kinase                        141   6e-39   
ref|XP_008795253.1|  PREDICTED: leucine-rich repeat receptor-like...    152   1e-38   
ref|XP_008678021.1|  PREDICTED: leucine-rich repeat receptor-like...    152   1e-38   
gb|ACH59600.1|  LRR receptor-like protein kinase                        140   1e-38   
gb|EPS62062.1|  protein kinase                                          152   1e-38   
ref|NP_001238576.1|  receptor protein kinase-like protein precursor     152   2e-38   
emb|CDM84408.1|  unnamed protein product                                148   2e-38   
ref|XP_006342066.1|  PREDICTED: receptor protein kinase CLAVATA1-...    151   2e-38   
dbj|BAJ90459.1|  predicted protein                                      151   2e-38   
ref|XP_006590881.1|  PREDICTED: receptor protein kinase CLAVATA1-...    149   3e-38   
tpg|DAA41870.1|  TPA: putative leucine-rich repeat receptor-like ...    151   3e-38   
ref|XP_006435207.1|  hypothetical protein CICLE_v10003935mg             147   1e-37   
ref|XP_002450588.1|  hypothetical protein SORBIDRAFT_05g007480          149   2e-37   
gb|KFK28659.1|  hypothetical protein AALP_AA7G028700                    149   2e-37   
ref|XP_010930574.1|  PREDICTED: leucine-rich repeat receptor-like...    149   2e-37   
ref|XP_009137141.1|  PREDICTED: leucine-rich repeat receptor-like...    148   3e-37   
ref|XP_009592786.1|  PREDICTED: receptor protein kinase CLAVATA1        148   3e-37   
ref|XP_004507478.1|  PREDICTED: LOW QUALITY PROTEIN: receptor pro...    148   3e-37   
ref|XP_008803980.1|  PREDICTED: leucine-rich repeat receptor-like...    148   4e-37   
ref|XP_003560328.2|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    148   4e-37   
gb|AFY06667.1|  receptor protein kinase CLAVATA1                        147   5e-37   
ref|XP_010941424.1|  PREDICTED: leucine-rich repeat receptor-like...    147   5e-37   
ref|XP_008645089.1|  PREDICTED: leucine-rich repeat receptor-like...    147   6e-37   
ref|XP_010520784.1|  PREDICTED: leucine-rich repeat receptor-like...    147   6e-37   
ref|XP_010520783.1|  PREDICTED: leucine-rich repeat receptor-like...    147   7e-37   
gb|KJB51410.1|  hypothetical protein B456_008G215400                    147   7e-37   
gb|KJB51409.1|  hypothetical protein B456_008G215400                    147   7e-37   
ref|XP_009340605.1|  PREDICTED: leucine-rich repeat receptor-like...    147   7e-37   
ref|XP_009766393.1|  PREDICTED: receptor protein kinase CLAVATA1        145   2e-36   
ref|XP_010934709.1|  PREDICTED: leucine-rich repeat receptor-like...    145   3e-36   
ref|XP_009374467.1|  PREDICTED: leucine-rich repeat receptor-like...    145   3e-36   
ref|XP_009372861.1|  PREDICTED: leucine-rich repeat receptor-like...    145   4e-36   
ref|XP_004979026.1|  PREDICTED: leucine-rich repeat receptor-like...    145   6e-36   
ref|XP_009370509.1|  PREDICTED: leucine-rich repeat receptor-like...    145   6e-36   
ref|XP_010693707.1|  PREDICTED: leucine-rich repeat receptor-like...    144   8e-36   
ref|XP_010536545.1|  PREDICTED: leucine-rich repeat receptor-like...    144   9e-36   
ref|XP_011019593.1|  PREDICTED: probably inactive leucine-rich re...    144   9e-36   
gb|KEH37840.1|  LRR receptor-like kinase family protein                 144   1e-35   
ref|XP_004491265.1|  PREDICTED: leucine-rich repeat receptor-like...    144   1e-35   
ref|XP_009333803.1|  PREDICTED: receptor protein kinase CLAVATA1-...    143   1e-35   
ref|XP_009333802.1|  PREDICTED: receptor protein kinase CLAVATA1-...    143   2e-35   
ref|XP_004485432.1|  PREDICTED: leucine-rich repeat receptor-like...    143   2e-35   
ref|XP_008376399.1|  PREDICTED: leucine-rich repeat receptor-like...    143   2e-35   
emb|CDY62258.1|  BnaCnng39750D                                          143   2e-35   
gb|EEE51888.1|  hypothetical protein OsJ_33462                          142   2e-35   
ref|XP_008375993.1|  PREDICTED: leucine-rich repeat receptor-like...    143   2e-35   
gb|EMT20446.1|  Receptor protein kinase CLAVATA1                        142   3e-35   
ref|XP_002308597.2|  hypothetical protein POPTR_0006s25380g             142   4e-35   
ref|XP_006382044.1|  hypothetical protein POPTR_0006s25380g             142   4e-35   
gb|KHF97318.1|  Leucine-rich repeat receptor-like protein kinase TDR    142   4e-35   
ref|XP_006657429.1|  PREDICTED: leucine-rich repeat receptor-like...    140   1e-34   
gb|EMS67650.1|  Leucine-rich repeat receptor-like serine/threonin...    140   1e-34   
ref|XP_007220284.1|  hypothetical protein PRUPE_ppa000681mg             140   1e-34   
ref|XP_010087435.1|  Leucine-rich repeat receptor-like serine/thr...    140   1e-34   
ref|XP_007012155.1|  Probably inactive leucine-rich repeat recept...    140   1e-34   
ref|XP_004986996.1|  PREDICTED: leucine-rich repeat receptor-like...    140   2e-34   
ref|XP_008234497.1|  PREDICTED: leucine-rich repeat receptor-like...    140   2e-34   
ref|XP_007131359.1|  hypothetical protein PHAVU_011G007200g             140   2e-34   
gb|KDO84904.1|  hypothetical protein CISIN_1g0460551mg                  137   3e-34   
ref|XP_003606987.1|  CLV1-like receptor kinase                          138   3e-34   
gb|AAX14781.1|  RLP1 leucine-rich repeat receptor-like protein          138   3e-34   
gb|KHN32430.1|  Leucine-rich repeat receptor-like protein kinase TDR    137   3e-34   
gb|KHN28525.1|  Leucine-rich repeat receptor-like serine/threonin...    139   4e-34   
gb|EEC69149.1|  hypothetical protein OsI_38088                          137   4e-34   
gb|KJB11032.1|  hypothetical protein B456_001G237400                    139   4e-34   
ref|XP_009395349.1|  PREDICTED: leucine-rich repeat receptor-like...    139   4e-34   
gb|KJB07870.1|  hypothetical protein B456_001G049500                    139   4e-34   
ref|XP_009341482.1|  PREDICTED: receptor protein kinase CLAVATA1-...    139   5e-34   
ref|XP_007038348.1|  Leucine-rich repeat protein kinase family pr...    139   6e-34   
gb|EAZ38296.1|  hypothetical protein OsJ_22674                          139   6e-34   
ref|XP_007038347.1|  Leucine-rich repeat protein kinase family pr...    139   6e-34   
ref|XP_009626660.1|  PREDICTED: probably inactive leucine-rich re...    139   6e-34   
ref|XP_006286925.1|  hypothetical protein CARUB_v10000068mg             139   7e-34   
emb|CDP05348.1|  unnamed protein product                                138   9e-34   
ref|XP_006359740.1|  PREDICTED: probably inactive leucine-rich re...    138   9e-34   
ref|XP_010107168.1|  Leucine-rich repeat receptor-like protein ki...    137   9e-34   
ref|XP_002268598.2|  PREDICTED: leucine-rich repeat receptor-like...    138   1e-33   
ref|XP_003625388.1|  Receptor-like protein kinase                       138   1e-33   
dbj|BAD33838.1|  CLAVATA1 receptor kinase( CLV1)-like protein           137   1e-33   
gb|EAZ41508.1|  hypothetical protein OsJ_26033                          138   1e-33   
gb|KFK41560.1|  hypothetical protein AALP_AA2G145000                    138   2e-33   
ref|XP_009133589.1|  PREDICTED: leucine-rich repeat receptor-like...    137   2e-33   
ref|XP_003614937.1|  Somatic embryogenesis receptor kinase              133   2e-33   
emb|CDY66353.1|  BnaA01g35050D                                          137   2e-33   
gb|EYU33271.1|  hypothetical protein MIMGU_mgv1a0010741mg               136   2e-33   
ref|XP_004514666.1|  PREDICTED: leucine-rich repeat receptor-like...    137   2e-33   
ref|XP_003539668.1|  PREDICTED: leucine-rich repeat receptor-like...    137   3e-33   
ref|XP_010456432.1|  PREDICTED: leucine-rich repeat receptor prot...    137   3e-33   
gb|EMS66166.1|  Leucine-rich repeat receptor-like protein kinase TDR    136   3e-33   
ref|NP_001048946.2|  Os03g0145000                                       137   3e-33   
gb|KEH29416.1|  LRR receptor-like kinase family protein                 136   4e-33   
ref|XP_006421630.1|  hypothetical protein CICLE_v10004254mg             136   5e-33   
ref|XP_010245532.1|  PREDICTED: leucine-rich repeat receptor-like...    136   5e-33   
gb|EAY88517.1|  hypothetical protein OsI_09989                          136   6e-33   
ref|XP_006587703.1|  PREDICTED: leucine-rich repeat receptor-like...    136   6e-33   
gb|AES64720.2|  LRR receptor-like kinase family protein                 135   8e-33   
ref|XP_003594469.1|  Receptor-like kinase                               135   8e-33   
ref|XP_010069807.1|  PREDICTED: receptor protein kinase CLAVATA1-...    135   9e-33   
ref|XP_010667968.1|  PREDICTED: leucine-rich repeat receptor-like...    135   9e-33   
gb|KCW58271.1|  hypothetical protein EUGRSUZ_H00963                     135   1e-32   
ref|XP_007138433.1|  hypothetical protein PHAVU_009G208500g             135   1e-32   
ref|XP_004952135.1|  PREDICTED: leucine-rich repeat receptor-like...    135   1e-32   
ref|XP_011024490.1|  PREDICTED: leucine-rich repeat receptor-like...    135   2e-32   
ref|XP_006837283.1|  hypothetical protein AMTR_s00111p00013770          135   2e-32   
ref|XP_004307799.1|  PREDICTED: leucine-rich repeat receptor-like...    135   2e-32   
ref|XP_010546091.1|  PREDICTED: leucine-rich repeat receptor prot...    135   2e-32   
ref|XP_003617299.1|  Receptor-like protein kinase                       134   2e-32   
gb|KHG03063.1|  Leucine-rich repeat receptor-like protein kinase ...    134   2e-32   
ref|XP_004245154.1|  PREDICTED: probably inactive leucine-rich re...    134   2e-32   
ref|XP_008793131.1|  PREDICTED: leucine-rich repeat receptor-like...    134   2e-32   
ref|XP_006490143.1|  PREDICTED: leucine-rich repeat receptor-like...    134   2e-32   
gb|KHG05767.1|  Leucine-rich repeat receptor-like protein kinase ...    134   2e-32   
gb|KDO49927.1|  hypothetical protein CISIN_1g043136mg                   134   3e-32   
gb|KDP22440.1|  hypothetical protein JCGZ_26271                         134   3e-32   
ref|XP_003546623.1|  PREDICTED: leucine-rich repeat receptor-like...    134   3e-32   
ref|XP_011027952.1|  PREDICTED: leucine-rich repeat receptor-like...    134   3e-32   
ref|XP_002303493.2|  hypothetical protein POPTR_0003s10680g             134   3e-32   
emb|CBJ26403.1|  Putative Leucine Rich Repeat Protein                   128   4e-32   
ref|XP_009777391.1|  PREDICTED: leucine-rich repeat receptor-like...    134   4e-32   
ref|XP_006848766.1|  hypothetical protein AMTR_s00026p00066510          134   4e-32   
ref|XP_004493833.1|  PREDICTED: leucine-rich repeat receptor-like...    134   5e-32   
ref|XP_010423232.1|  PREDICTED: leucine-rich repeat receptor prot...    134   5e-32   
ref|XP_008779605.1|  PREDICTED: leucine-rich repeat receptor-like...    133   5e-32   
gb|KJB10046.1|  hypothetical protein B456_001G181900                    133   6e-32   
emb|CDP21987.1|  unnamed protein product                                130   6e-32   
ref|XP_011018348.1|  PREDICTED: leucine-rich repeat receptor-like...    133   6e-32   
gb|KHN01704.1|  Leucine-rich repeat receptor-like serine/threonin...    132   7e-32   
ref|XP_010249537.1|  PREDICTED: probably inactive leucine-rich re...    133   7e-32   
ref|XP_007050157.1|  Leucine-rich repeat receptor-like protein ki...    133   7e-32   
ref|XP_002510975.1|  Receptor protein kinase CLAVATA1 precursor, ...    133   7e-32   
gb|KDP38629.1|  hypothetical protein JCGZ_03982                         133   7e-32   
ref|XP_010249536.1|  PREDICTED: probably inactive leucine-rich re...    133   8e-32   
gb|KJB10047.1|  hypothetical protein B456_001G181900                    132   8e-32   
ref|XP_010106880.1|  Leucine-rich repeat receptor-like protein ki...    133   1e-31   
ref|XP_002973575.1|  hypothetical protein SELMODRAFT_30446              132   1e-31   
ref|XP_002975602.1|  hypothetical protein SELMODRAFT_30447              132   1e-31   
gb|KHN20425.1|  Leucine-rich repeat receptor-like protein kinase TDR    132   1e-31   
ref|XP_009788025.1|  PREDICTED: leucine-rich repeat receptor-like...    132   1e-31   
ref|XP_010920315.1|  PREDICTED: probable leucine-rich repeat rece...    132   1e-31   
emb|CDY31445.1|  BnaC03g63790D                                          132   1e-31   
gb|KHN37138.1|  Leucine-rich repeat receptor-like protein kinase TDR    132   1e-31   
ref|XP_002325155.1|  leucine-rich repeat transmembrane protein ki...    132   2e-31   
gb|KDP26461.1|  hypothetical protein JCGZ_17619                         132   2e-31   
ref|XP_006587146.1|  PREDICTED: leucine-rich repeat receptor-like...    132   2e-31   
ref|XP_006368235.1|  hypothetical protein POPTR_0001s00820g             132   2e-31   
gb|KEH29421.1|  LRR receptor-like kinase family protein                 132   2e-31   
ref|XP_011017958.1|  PREDICTED: leucine-rich repeat receptor-like...    131   2e-31   
emb|CBI25609.3|  unnamed protein product                                131   2e-31   
ref|XP_002523535.1|  Receptor protein kinase CLAVATA1 precursor, ...    131   2e-31   
emb|CBJ29199.1|  LRR-GTPase of the ROCO family                          132   2e-31   
ref|XP_004972862.1|  PREDICTED: leucine-rich repeat receptor-like...    131   3e-31   
ref|XP_002264530.2|  PREDICTED: leucine-rich repeat receptor-like...    131   3e-31   
gb|AGO88094.1|  hypothetical protein                                    128   3e-31   
ref|XP_004240244.1|  PREDICTED: leucine-rich repeat receptor-like...    131   3e-31   
ref|XP_010035036.1|  PREDICTED: leucine-rich repeat receptor-like...    131   3e-31   
ref|XP_010491332.1|  PREDICTED: leucine-rich repeat receptor prot...    131   3e-31   



>ref|NP_001274713.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1-like precursor [Solanum lycopersicum]
 dbj|BAK52388.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
lycopersicum]
 dbj|BAK52391.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
lycopersicum]
Length=1016

 Score =   285 bits (728),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 146/202 (72%), Positives = 169/202 (84%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPP  181
            NISTSHCTW  VTCD+  HV SLD+SG NL+G L P+VG L FL NLS+A NQ +GPVP 
Sbjct  49   NISTSHCTWNGVTCDTHRHVTSLDISGFNLTGTLPPEVGNLRFLQNLSVAVNQFTGPVPV  108

Query  182  EISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLH  361
            EIS I  L +LNLSNNIFG  FP QL +L NLQVLDLYNNN+TG+LPVEVY+MT LRHLH
Sbjct  109  EISFIPNLSYLNLSNNIFGMEFPSQLTRLRNLQVLDLYNNNMTGELPVEVYQMTKLRHLH  168

Query  362  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            LGGN+FSGRIPPEYGRFP+LEYLAVSGN L G IP EIGN+  L++LY+GY+N F+GGIP
Sbjct  169  LGGNFFSGRIPPEYGRFPSLEYLAVSGNALVGEIPPEIGNIATLQQLYVGYYNTFTGGIP  228

Query  542  PEMGNLSQLIRXDAANCGLTGE  607
            P +GNLSQL+R DAANCGL+G+
Sbjct  229  PAIGNLSQLLRFDAANCGLSGK  250


 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 66/197 (34%), Positives = 97/197 (49%), Gaps = 26/197 (13%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFL-----------------N  217
             SG + P+ G+ P L  L+++ N L G +PPEI  I+TL+ L                 N
Sbjct  174  FSGRIPPEYGRFPSLEYLAVSGNALVGEIPPEIGNIATLQQLYVGYYNTFTGGIPPAIGN  233

Query  218  LS--------NNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGN  373
            LS        N       P ++ +L NL  L L  N+L+G L  E+  + SL+ L L  N
Sbjct  234  LSQLLRFDAANCGLSGKIPPEIGKLQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNN  293

Query  374  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
             FSG IPP +    N+  + +  N L G IP  I +L +L+ L + + N F+G IP  +G
Sbjct  294  MFSGEIPPTFAELKNITLVNLFRNKLYGSIPEFIEDLPELEVLQL-WENNFTGSIPQGLG  352

Query  554  NLSQLIRXDAANCGLTG  604
              S+L   D ++  LTG
Sbjct  353  TKSKLKTLDLSSNKLTG  369


 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 88/173 (51%), Gaps = 1/173 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            +LSG L+P++G L  L +L ++ N  SG +PP  + +  +  +NL  N    + P  +  
Sbjct  270  SLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAELKNITLVNLFRNKLYGSIPEFIED  329

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L+VL L+ NN TG +P  +   + L+ L L  N  +G +PP      NL+ +   GN
Sbjct  330  LPELEVLQLWENNFTGSIPQGLGTKSKLKTLDLSSNKLTGNLPPNMCSGNNLQTIITLGN  389

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             L G IP  +G    L  + +G  N  +G IP  + +L  L + +  N  LTG
Sbjct  390  FLFGPIPESLGRCESLNRIRMGE-NYLNGSIPKGLLSLPHLSQVELQNNILTG  441


 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 82/174 (47%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P++     L  +    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  366  KLTGNLPPNMCSGNNLQTIITLGNFLFGPIPESLGRCESLNRIRMGENYLNGSIPKGLLS  425

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L +L  ++L NN LTG  P    K  SL  + L  N  +G +PP  G F   + L + GN
Sbjct  426  LPHLSQVELQNNILTGTFPDISSKSNSLGQIILSNNRLTGPLPPSIGNFAVAQKLLLDGN  485

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              SG IP+EIG L +L ++   + N  SG I PE+     L   D +   L+GE
Sbjct  486  KFSGRIPAEIGKLQQLSKIDFSH-NNLSGPIAPEISQCKLLTYVDLSRNQLSGE  538


 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 69/132 (52%), Gaps = 1/132 (1%)
 Frame = +2

Query  146  IAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPV  325
            ++ N+L+GP+PP I   +  + L L  N F    P ++ +L  L  +D  +NNL+G +  
Sbjct  458  LSNNRLTGPLPPSIGNFAVAQKLLLDGNKFSGRIPAEIGKLQQLSKIDFSHNNLSGPIAP  517

Query  326  EVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELY  505
            E+ +   L ++ L  N  SG IP E      L YL +S N L G IP+ I ++  L  + 
Sbjct  518  EISQCKLLTYVDLSRNQLSGEIPTEITGMRILNYLNLSRNHLVGSIPAPISSMQSLTSVD  577

Query  506  IGYFNGFSGGIP  541
              Y N FSG +P
Sbjct  578  FSY-NNFSGLVP  588


 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 85/196 (43%), Gaps = 25/196 (13%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L NNI   TFP   ++ 
Sbjct  391  LFGPIPESLGRCESLNRIRMGENYLNGSIPKGLLSLPHLSQVELQNNILTGTFPDISSKS  450

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLE--------  424
             +L  + L NN LTG LP  +      + L L GN FSGRIP E G+   L         
Sbjct  451  NSLGQIILSNNRLTGPLPPSIGNFAVAQKLLLDGNKFSGRIPAEIGKLQQLSKIDFSHNN  510

Query  425  ----------------YLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  556
                            Y+ +S N LSG IP+EI  +  L  L +   N   G IP  + +
Sbjct  511  LSGPIAPEISQCKLLTYVDLSRNQLSGEIPTEITGMRILNYLNLSR-NHLVGSIPAPISS  569

Query  557  LSQLIRXDAANCGLTG  604
            +  L   D +    +G
Sbjct  570  MQSLTSVDFSYNNFSG  585


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 60/120 (50%), Gaps = 1/120 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
              SG +  ++G+L  L  +  + N LSGP+ PEIS    L +++LS N      P ++  
Sbjct  486  KFSGRIPAEIGKLQQLSKIDFSHNNLSGPIAPEISQCKLLTYVDLSRNQLSGEIPTEITG  545

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            +  L  L+L  N+L G +P  +  M SL  +    N FSG + P  G+F    Y +  GN
Sbjct  546  MRILNYLNLSRNHLVGSIPAPISSMQSLTSVDFSYNNFSGLV-PGTGQFSYFNYTSFLGN  604



>dbj|BAK52389.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
pennellii]
Length=1016

 Score =   284 bits (727),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 146/202 (72%), Positives = 168/202 (83%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPP  181
            NISTSHCTW  VTCD+  HV SLD+SG NL+G L P+VG L FL NLS+A NQ +GPVP 
Sbjct  49   NISTSHCTWNGVTCDTHRHVTSLDISGFNLTGTLPPEVGNLRFLQNLSVAVNQFTGPVPV  108

Query  182  EISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLH  361
            EIS I  L +LNLSNNIFG  FP QL +L NLQVLDLYNNN+TG+LPVEVY+MT LRHLH
Sbjct  109  EISFIPNLSYLNLSNNIFGMEFPSQLTRLRNLQVLDLYNNNMTGELPVEVYQMTKLRHLH  168

Query  362  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            LGGN+F GRIPPEYGRFP+LEYLAVSGN L G IP EIGN+  L++LY+GY+N F+GGIP
Sbjct  169  LGGNFFGGRIPPEYGRFPSLEYLAVSGNALVGEIPPEIGNIATLQQLYVGYYNTFTGGIP  228

Query  542  PEMGNLSQLIRXDAANCGLTGE  607
            P +GNLSQL+R DAANCGL+GE
Sbjct  229  PAIGNLSQLLRFDAANCGLSGE  250


 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 88/173 (51%), Gaps = 1/173 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            +LSG L+P++G L  L +L ++ N  SG +PP  + +  +  +NL  N    + P  +  
Sbjct  270  SLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAELKNITLVNLFRNKLYGSIPEFIED  329

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L+VL L+ NN TG +P  +   + L+ L L  N  +G +PP      NL+ +   GN
Sbjct  330  LPELEVLQLWENNFTGSIPQGLGTKSKLKTLDLSSNKLTGNLPPNMCSGNNLQTIITLGN  389

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             L G IP  +G    L  + +G  N  +G IP  + +L  L + +  N  LTG
Sbjct  390  FLFGPIPESLGRCESLNRIRMGE-NYLNGSIPKGLLSLPHLSQVELQNNILTG  441


 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 62/195 (32%), Positives = 95/195 (49%), Gaps = 26/195 (13%)
 Frame = +2

Query  95   GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFL--------------------  214
            G + P+ G+ P L  L+++ N L G +PPEI  I+TL+ L                    
Sbjct  176  GRIPPEYGRFPSLEYLAVSGNALVGEIPPEIGNIATLQQLYVGYYNTFTGGIPPAIGNLS  235

Query  215  -----NLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYF  379
                 + +N       P ++ +L NL  L L  N+L+G L  E+  + SL+ L L  N F
Sbjct  236  QLLRFDAANCGLSGEIPPEIGKLQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNNMF  295

Query  380  SGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNL  559
            SG IPP +    N+  + +  N L G IP  I +L +L+ L + + N F+G IP  +G  
Sbjct  296  SGEIPPTFAELKNITLVNLFRNKLYGSIPEFIEDLPELEVLQL-WENNFTGSIPQGLGTK  354

Query  560  SQLIRXDAANCGLTG  604
            S+L   D ++  LTG
Sbjct  355  SKLKTLDLSSNKLTG  369


 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 82/174 (47%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P++     L  +    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  366  KLTGNLPPNMCSGNNLQTIITLGNFLFGPIPESLGRCESLNRIRMGENYLNGSIPKGLLS  425

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L +L  ++L NN LTG  P    K  SL  + L  N  +G +PP  G F   + L + GN
Sbjct  426  LPHLSQVELQNNILTGTFPDISSKSNSLGQIILSNNRLTGPLPPSIGNFAVAQKLLLDGN  485

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              SG IP+EIG L +L ++   + N  SG I PE+     L   D +   L+GE
Sbjct  486  KFSGRIPAEIGKLQQLSKIDFSH-NNLSGPIAPEISQCKLLTYVDLSRNQLSGE  538


 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 69/132 (52%), Gaps = 1/132 (1%)
 Frame = +2

Query  146  IAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPV  325
            ++ N+L+GP+PP I   +  + L L  N F    P ++ +L  L  +D  +NNL+G +  
Sbjct  458  LSNNRLTGPLPPSIGNFAVAQKLLLDGNKFSGRIPAEIGKLQQLSKIDFSHNNLSGPIAP  517

Query  326  EVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELY  505
            E+ +   L ++ L  N  SG IP E      L YL +S N L G IP+ I ++  L  + 
Sbjct  518  EISQCKLLTYVDLSRNQLSGEIPTEITGMRILNYLNLSRNHLVGSIPAPISSMQSLTSVD  577

Query  506  IGYFNGFSGGIP  541
              Y N FSG +P
Sbjct  578  FSY-NNFSGLVP  588


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 85/196 (43%), Gaps = 25/196 (13%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L NNI   TFP   ++ 
Sbjct  391  LFGPIPESLGRCESLNRIRMGENYLNGSIPKGLLSLPHLSQVELQNNILTGTFPDISSKS  450

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLE--------  424
             +L  + L NN LTG LP  +      + L L GN FSGRIP E G+   L         
Sbjct  451  NSLGQIILSNNRLTGPLPPSIGNFAVAQKLLLDGNKFSGRIPAEIGKLQQLSKIDFSHNN  510

Query  425  ----------------YLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  556
                            Y+ +S N LSG IP+EI  +  L  L +   N   G IP  + +
Sbjct  511  LSGPIAPEISQCKLLTYVDLSRNQLSGEIPTEITGMRILNYLNLSR-NHLVGSIPAPISS  569

Query  557  LSQLIRXDAANCGLTG  604
            +  L   D +    +G
Sbjct  570  MQSLTSVDFSYNNFSG  585


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 60/120 (50%), Gaps = 1/120 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
              SG +  ++G+L  L  +  + N LSGP+ PEIS    L +++LS N      P ++  
Sbjct  486  KFSGRIPAEIGKLQQLSKIDFSHNNLSGPIAPEISQCKLLTYVDLSRNQLSGEIPTEITG  545

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            +  L  L+L  N+L G +P  +  M SL  +    N FSG + P  G+F    Y +  GN
Sbjct  546  MRILNYLNLSRNHLVGSIPAPISSMQSLTSVDFSYNNFSGLV-PGTGQFSYFNYTSFLGN  604



>ref|XP_006357743.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Solanum tuberosum]
Length=1017

 Score =   283 bits (723),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 145/202 (72%), Positives = 170/202 (84%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPP  181
            NISTSHCTW  VTCD+  HV SLD+SG NL+G L P+VG L FL NLS+A NQ +GP+P 
Sbjct  49   NISTSHCTWNGVTCDTHRHVTSLDISGFNLTGTLPPEVGNLRFLQNLSVAVNQFTGPIPV  108

Query  182  EISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLH  361
            EIS I  L +LNLSNNIFG  FP QL +L NLQVLDLYNNN+TG+LP+EVY+MT+LRHLH
Sbjct  109  EISFIPNLGYLNLSNNIFGMEFPPQLTRLRNLQVLDLYNNNMTGELPLEVYQMTNLRHLH  168

Query  362  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            LGGN+F GRIPPEYGRFP+LEYLAVSGN L G IP EIGN+T L++LY+GY+N F+GGIP
Sbjct  169  LGGNFFGGRIPPEYGRFPSLEYLAVSGNALVGEIPPEIGNITTLQQLYVGYYNTFTGGIP  228

Query  542  PEMGNLSQLIRXDAANCGLTGE  607
            P +GNLSQL+R DAANCGL+GE
Sbjct  229  PAIGNLSQLLRFDAANCGLSGE  250


 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/173 (32%), Positives = 90/173 (52%), Gaps = 1/173 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            +LSG L+P++G L  L +L ++ N  SG +PP  + +  +  +NL  N    + P  +  
Sbjct  270  SLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAELKNITLVNLFRNKLYGSIPEFIED  329

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L+VL L+ NN TG +P  +   + L+++ L  N  +G +PP      NL+ +   GN
Sbjct  330  LPELEVLQLWENNFTGSIPQGLGTKSKLKNVDLSSNKLTGNLPPNMCSGNNLQTIITLGN  389

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             L G IP  +G    L  + +G  N  +G IP  + +L +L + +  N  LTG
Sbjct  390  FLFGPIPESLGRCESLNRIRMGE-NYLNGSIPKGLLSLPRLSQVELQNNILTG  441


 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 65/195 (33%), Positives = 96/195 (49%), Gaps = 26/195 (13%)
 Frame = +2

Query  95   GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFL-----------------NLS  223
            G + P+ G+ P L  L+++ N L G +PPEI  I+TL+ L                 NLS
Sbjct  176  GRIPPEYGRFPSLEYLAVSGNALVGEIPPEIGNITTLQQLYVGYYNTFTGGIPPAIGNLS  235

Query  224  --------NNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYF  379
                    N       P ++ +L NL  L L  N+L+G L  E+  + SL+ L L  N F
Sbjct  236  QLLRFDAANCGLSGEIPPEIGKLQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNNMF  295

Query  380  SGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNL  559
            SG IPP +    N+  + +  N L G IP  I +L +L+ L + + N F+G IP  +G  
Sbjct  296  SGEIPPTFAELKNITLVNLFRNKLYGSIPEFIEDLPELEVLQL-WENNFTGSIPQGLGTK  354

Query  560  SQLIRXDAANCGLTG  604
            S+L   D ++  LTG
Sbjct  355  SKLKNVDLSSNKLTG  369


 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 82/174 (47%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P++     L  +    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  366  KLTGNLPPNMCSGNNLQTIITLGNFLFGPIPESLGRCESLNRIRMGENYLNGSIPKGLLS  425

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L NN LTG  P    K  SL  + L  N  +G +PP  G F   + L + GN
Sbjct  426  LPRLSQVELQNNILTGTFPDISSKSNSLGQIILSNNRLTGPLPPSIGNFAVAQKLLLDGN  485

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              SG IP+EIG L +L ++   + N FSG + PE+     L   D +   L+GE
Sbjct  486  KFSGRIPAEIGKLQQLSKIDFSH-NNFSGPMAPEISQCKLLTYVDLSRNQLSGE  538


 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 68/132 (52%), Gaps = 1/132 (1%)
 Frame = +2

Query  146  IAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPV  325
            ++ N+L+GP+PP I   +  + L L  N F    P ++ +L  L  +D  +NN +G +  
Sbjct  458  LSNNRLTGPLPPSIGNFAVAQKLLLDGNKFSGRIPAEIGKLQQLSKIDFSHNNFSGPMAP  517

Query  326  EVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELY  505
            E+ +   L ++ L  N  SG IP E      L YL +S N L G IPS I ++  L  + 
Sbjct  518  EISQCKLLTYVDLSRNQLSGEIPSEITGMRILNYLNLSRNHLVGSIPSPISSMQSLTSVD  577

Query  506  IGYFNGFSGGIP  541
              Y N FSG +P
Sbjct  578  FSY-NNFSGLVP  588


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 58/196 (30%), Positives = 85/196 (43%), Gaps = 25/196 (13%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L NNI   TFP   ++ 
Sbjct  391  LFGPIPESLGRCESLNRIRMGENYLNGSIPKGLLSLPRLSQVELQNNILTGTFPDISSKS  450

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLE--------  424
             +L  + L NN LTG LP  +      + L L GN FSGRIP E G+   L         
Sbjct  451  NSLGQIILSNNRLTGPLPPSIGNFAVAQKLLLDGNKFSGRIPAEIGKLQQLSKIDFSHNN  510

Query  425  ----------------YLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  556
                            Y+ +S N LSG IPSEI  +  L  L +   N   G IP  + +
Sbjct  511  FSGPMAPEISQCKLLTYVDLSRNQLSGEIPSEITGMRILNYLNLSR-NHLVGSIPSPISS  569

Query  557  LSQLIRXDAANCGLTG  604
            +  L   D +    +G
Sbjct  570  MQSLTSVDFSYNNFSG  585


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 59/120 (49%), Gaps = 1/120 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
              SG +  ++G+L  L  +  + N  SGP+ PEIS    L +++LS N      P ++  
Sbjct  486  KFSGRIPAEIGKLQQLSKIDFSHNNFSGPMAPEISQCKLLTYVDLSRNQLSGEIPSEITG  545

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            +  L  L+L  N+L G +P  +  M SL  +    N FSG + P  G+F    Y +  GN
Sbjct  546  MRILNYLNLSRNHLVGSIPSPISSMQSLTSVDFSYNNFSGLV-PGTGQFSYFNYTSFLGN  604



>dbj|BAK52390.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
peruvianum]
Length=1015

 Score =   281 bits (720),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 145/202 (72%), Positives = 168/202 (83%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPP  181
            NISTSHCTW  VTCD+  HV SLD+SG NL+G L P+VG L FL NLS+A NQ +GPVP 
Sbjct  48   NISTSHCTWNGVTCDTHRHVTSLDISGFNLTGTLPPEVGNLRFLQNLSVAVNQFTGPVPV  107

Query  182  EISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLH  361
            EIS I  L +LNLSNNIFG  FP QL +L NLQVLDLYNNN+TG+LPVEVY+MT LRHLH
Sbjct  108  EISFIPNLSYLNLSNNIFGMEFPSQLTRLRNLQVLDLYNNNMTGELPVEVYQMTKLRHLH  167

Query  362  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            LGGN+FSGRIPPEYGRF +LEYLAVSGN L G IP EIGN+  L++LY+GY+N F+GGIP
Sbjct  168  LGGNFFSGRIPPEYGRFSSLEYLAVSGNALVGEIPPEIGNIATLQQLYVGYYNTFTGGIP  227

Query  542  PEMGNLSQLIRXDAANCGLTGE  607
            P +GNLSQL+R DAANCGL+G+
Sbjct  228  PAIGNLSQLLRFDAANCGLSGK  249


 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 88/173 (51%), Gaps = 1/173 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            +LSG L+P++G L  L +L ++ N  SG +PP  + +  +  +NL  N    + P  +  
Sbjct  269  SLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAELKNITLVNLFRNKLYGSIPEFIED  328

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L+VL L+ NN TG +P  +   + L+ L L  N  +G +PP      NL+ +   GN
Sbjct  329  LPELEVLQLWENNFTGSIPQGLGTKSKLKTLDLSSNKLTGNLPPNMCSGNNLQTIITLGN  388

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             L G IP  +G    L  + +G  N  +G IP  + +L  L + +  N  LTG
Sbjct  389  FLFGPIPESLGRCESLNRIRMGE-NYLNGSIPKGLLSLPHLSQVELQNNILTG  440


 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 58/173 (34%), Positives = 90/173 (52%), Gaps = 2/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            L G + P++G +  L  L +   N  +G +PP I  +S L   + +N       P ++ +
Sbjct  197  LVGEIPPEIGNIATLQQLYVGYYNTFTGGIPPAIGNLSQLLRFDAANCGLSGKIPREIGK  256

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L NL  L L  N+L+G L  E+  + SL+ L L  N FSG IPP +    N+  + +  N
Sbjct  257  LQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAELKNITLVNLFRN  316

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             L G IP  I +L +L+ L + + N F+G IP  +G  S+L   D ++  LTG
Sbjct  317  KLYGSIPEFIEDLPELEVLQL-WENNFTGSIPQGLGTKSKLKTLDLSSNKLTG  368


 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 82/174 (47%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P++     L  +    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  365  KLTGNLPPNMCSGNNLQTIITLGNFLFGPIPESLGRCESLNRIRMGENYLNGSIPKGLLS  424

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L +L  ++L NN LTG  P    K  SL  + L  N  +G +PP  G F   + L + GN
Sbjct  425  LPHLSQVELQNNILTGTFPDISSKSNSLGQIILSNNRLTGPLPPSIGNFAVAQKLLLDGN  484

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              SG IP+EIG L +L ++   + N  SG I PE+     L   D +   L+GE
Sbjct  485  KFSGRIPAEIGKLQQLSKIDFSH-NNLSGPIAPEISQCKLLTYVDLSRNQLSGE  537


 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 69/132 (52%), Gaps = 1/132 (1%)
 Frame = +2

Query  146  IAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPV  325
            ++ N+L+GP+PP I   +  + L L  N F    P ++ +L  L  +D  +NNL+G +  
Sbjct  457  LSNNRLTGPLPPSIGNFAVAQKLLLDGNKFSGRIPAEIGKLQQLSKIDFSHNNLSGPIAP  516

Query  326  EVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELY  505
            E+ +   L ++ L  N  SG IP E      L YL +S N L G IP+ I ++  L  + 
Sbjct  517  EISQCKLLTYVDLSRNQLSGEIPTEITGMRILNYLNLSRNHLVGSIPAPISSMQSLTSVD  576

Query  506  IGYFNGFSGGIP  541
              Y N FSG +P
Sbjct  577  FSY-NNFSGLVP  587


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 85/196 (43%), Gaps = 25/196 (13%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L NNI   TFP   ++ 
Sbjct  390  LFGPIPESLGRCESLNRIRMGENYLNGSIPKGLLSLPHLSQVELQNNILTGTFPDISSKS  449

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLE--------  424
             +L  + L NN LTG LP  +      + L L GN FSGRIP E G+   L         
Sbjct  450  NSLGQIILSNNRLTGPLPPSIGNFAVAQKLLLDGNKFSGRIPAEIGKLQQLSKIDFSHNN  509

Query  425  ----------------YLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  556
                            Y+ +S N LSG IP+EI  +  L  L +   N   G IP  + +
Sbjct  510  LSGPIAPEISQCKLLTYVDLSRNQLSGEIPTEITGMRILNYLNLSR-NHLVGSIPAPISS  568

Query  557  LSQLIRXDAANCGLTG  604
            +  L   D +    +G
Sbjct  569  MQSLTSVDFSYNNFSG  584


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 60/120 (50%), Gaps = 1/120 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
              SG +  ++G+L  L  +  + N LSGP+ PEIS    L +++LS N      P ++  
Sbjct  485  KFSGRIPAEIGKLQQLSKIDFSHNNLSGPIAPEISQCKLLTYVDLSRNQLSGEIPTEITG  544

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            +  L  L+L  N+L G +P  +  M SL  +    N FSG +P   G+F    Y +  GN
Sbjct  545  MRILNYLNLSRNHLVGSIPAPISSMQSLTSVDFSYNNFSGLVPGT-GQFSYFNYTSFLGN  603



>emb|CDP02660.1| unnamed protein product [Coffea canephora]
Length=1017

 Score =   281 bits (718),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 144/203 (71%), Positives = 166/203 (82%), Gaps = 1/203 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVP  178
            N ST+HC+W  VTCDS    V+      LNL+G LSPDV  L  L+NLS+AANQ  GPVP
Sbjct  49   NDSTTHCSWSGVTCDSYGRHVTALDISGLNLTGSLSPDVSHLRLLLNLSVAANQFCGPVP  108

Query  179  PEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHL  358
            PEIS+ISTLR+LNLSNNIF  TFP QL +L NL+VLD YNNN++G LPV+VY++T+LRHL
Sbjct  109  PEISSISTLRYLNLSNNIFNLTFPRQLIRLKNLEVLDFYNNNMSGPLPVDVYQLTNLRHL  168

Query  359  HLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGI  538
            HLGGNYFSG IP EYG FPNLEYLAVSGN L+G IP EI NLTKL+ LYIGYFN FSGGI
Sbjct  169  HLGGNYFSGGIPAEYGSFPNLEYLAVSGNELAGRIPPEIANLTKLQHLYIGYFNTFSGGI  228

Query  539  PPEMGNLSQLIRXDAANCGLTGE  607
            PP++GNLSQL+R DAANCGL+GE
Sbjct  229  PPQIGNLSQLLRFDAANCGLSGE  251


 Score = 89.7 bits (221),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 85/162 (52%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P++G L  L  L +  N LSGP+  E+  + +L+ ++LSNN+F    P   AQL
Sbjct  248  LSGEVPPELGMLQNLDTLFLQVNALSGPLTSELGYLKSLKSMDLSNNMFTGEIPSSFAQL  307

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   G    L+ L +S N 
Sbjct  308  KNLTLLNLFRNQLHGSIPDFIGDLPELEVLQLWDNNFTGSIPQGLGTNGKLQNLDLSSNK  367

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P  I    KL+ L I   N   G IP  +G    L R
Sbjct  368  LTGNLPPNICTGNKLQTL-ITLGNFLFGTIPESLGQCESLSR  408


 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/173 (35%), Positives = 90/173 (52%), Gaps = 2/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            L+G + P++  L  L +L I   N  SG +PP+I  +S L   + +N       P +L  
Sbjct  199  LAGRIPPEIANLTKLQHLYIGYFNTFSGGIPPQIGNLSQLLRFDAANCGLSGEVPPELGM  258

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L NL  L L  N L+G L  E+  + SL+ + L  N F+G IP  + +  NL  L +  N
Sbjct  259  LQNLDTLFLQVNALSGPLTSELGYLKSLKSMDLSNNMFTGEIPSSFAQLKNLTLLNLFRN  318

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             L G IP  IG+L +L+ L + + N F+G IP  +G   +L   D ++  LTG
Sbjct  319  QLHGSIPDFIGDLPELEVLQL-WDNNFTGSIPQGLGTNGKLQNLDLSSNKLTG  370


 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 80/174 (46%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P++     L  L    N L G +P  +    +L  L +  N    + P  L  
Sbjct  367  KLTGNLPPNICTGNKLQTLITLGNFLFGTIPESLGQCESLSRLRMGENYLNGSIPKGLLS  426

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N LTG  P      T+L  + L  N  SG +PP  G F  ++   + GN
Sbjct  427  LPQLTQVELQDNLLTGSFPETDKTSTALGQISLSNNRLSGPLPPSIGNFVGVQKFLLDGN  486

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              +G IP+EIG L +L ++   + N FSG I PE+     L   D +   L GE
Sbjct  487  KFTGPIPAEIGKLQQLSKIDFSH-NSFSGPIAPEISECKLLTFVDLSRNQLAGE  539


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 52/154 (34%), Positives = 75/154 (49%), Gaps = 1/154 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
             SG + P +G L  L+    A   LSG VPPE+  +  L  L L  N        +L  L
Sbjct  224  FSGGIPPQIGNLSQLLRFDAANCGLSGEVPPELGMLQNLDTLFLQVNALSGPLTSELGYL  283

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             +L+ +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N 
Sbjct  284  KSLKSMDLSNNMFTGEIPSSFAQLKNLTLLNLFRNQLHGSIPDFIGDLPELEVLQLWDNN  343

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
             +G IP  +G   KL+ L +   N  +G +PP +
Sbjct  344  FTGSIPQGLGTNGKLQNLDLSS-NKLTGNLPPNI  376


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 88/174 (51%), Gaps = 3/174 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +G +   +G    L NL +++N+L+G +PP I   + L+  + L N +FG T P  L 
Sbjct  343  NFTGSIPQGLGTNGKLQNLDLSSNKLTGNLPPNICTGNKLQTLITLGNFLFG-TIPESLG  401

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            Q  +L  L +  N L G +P  +  +  L  + L  N  +G  P        L  +++S 
Sbjct  402  QCESLSRLRMGENYLNGSIPKGLLSLPQLTQVELQDNLLTGSFPETDKTSTALGQISLSN  461

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            N LSG +P  IGN   +++  +   N F+G IP E+G L QL + D ++   +G
Sbjct  462  NRLSGPLPPSIGNFVGVQKFLLDG-NKFTGPIPAEIGKLQQLSKIDFSHNSFSG  514


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L P +G    +    +  N+ +GP+P EI  +  L  ++ S+N F      ++++ 
Sbjct  464  LSGPLPPSIGNFVGVQKFLLDGNKFTGPIPAEIGKLQQLSKIDFSHNSFSGPIAPEISEC  523

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  +DL  N L G++P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  524  KLLTFVDLSRNQLAGEIPTEITGMRILNYLNLSRNHLVGSIPSPIASMQSLTSVDFSYNN  583

Query  449  LSGVIP  466
            LSG++P
Sbjct  584  LSGMVP  589


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 77/172 (45%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G +   +  LP L  + +  N L+G  P      + L  ++LSNN      P  +   
Sbjct  416  LNGSIPKGLLSLPQLTQVELQDNLLTGSFPETDKTSTALGQISLSNNRLSGPLPPSIGNF  475

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              +Q   L  N  TG +P E+ K+  L  +    N FSG I PE      L ++ +S N 
Sbjct  476  VGVQKFLLDGNKFTGPIPAEIGKLQQLSKIDFSHNSFSGPIAPEISECKLLTFVDLSRNQ  535

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            L+G IP+EI  +  L  L +   N   G IP  + ++  L   D +   L+G
Sbjct  536  LAGEIPTEITGMRILNYLNLSR-NHLVGSIPSPIASMQSLTSVDFSYNNLSG  586


 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 68/137 (50%), Gaps = 1/137 (1%)
 Frame = +2

Query  131  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  310
            L  +S++ N+LSGP+PP I     ++   L  N F    P ++ +L  L  +D  +N+ +
Sbjct  454  LGQISLSNNRLSGPLPPSIGNFVGVQKFLLDGNKFTGPIPAEIGKLQQLSKIDFSHNSFS  513

Query  311  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTK  490
            G +  E+ +   L  + L  N  +G IP E      L YL +S N L G IPS I ++  
Sbjct  514  GPIAPEISECKLLTFVDLSRNQLAGEIPTEITGMRILNYLNLSRNHLVGSIPSPIASMQS  573

Query  491  LKELYIGYFNGFSGGIP  541
            L  +   Y N  SG +P
Sbjct  574  LTSVDFSY-NNLSGMVP  589


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            + SG ++P++ +   L  + ++ NQL+G +P EI+ +  L +LNLS N    + P  +A 
Sbjct  511  SFSGPIAPEISECKLLTFVDLSRNQLAGEIPTEITGMRILNYLNLSRNHLVGSIPSPIAS  570

Query  266  LANLQVLDLYNNNLTGDLP  322
            + +L  +D   NNL+G +P
Sbjct  571  MQSLTSVDFSYNNLSGMVP  589



>ref|XP_011073654.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Sesamum indicum]
Length=1015

 Score =   280 bits (717),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 168/203 (83%), Gaps = 1/203 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsl-lhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVP  178
            N STSHCTW  VTCD    HV +LD+S L+L+G LSPDVG L FLVNLS+AAN LSGPVP
Sbjct  51   NASTSHCTWEGVTCDVSGRHVTALDISNLSLTGTLSPDVGHLRFLVNLSVAANSLSGPVP  110

Query  179  PEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHL  358
            P+IS I  LR+LNLSNN+F  +FP QL +L NLQVLDLYNNN+TGD P + Y +TSLRHL
Sbjct  111  PQISDIPNLRYLNLSNNVFNLSFPPQLYRLKNLQVLDLYNNNMTGDFPSQAYLLTSLRHL  170

Query  359  HLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGI  538
            HLGGN+FSG IP E+G FPNLEYLAVSGN L+G IP EIGNLT+LKELYIGY+N FSGGI
Sbjct  171  HLGGNFFSGEIPAEFGSFPNLEYLAVSGNELTGAIPREIGNLTQLKELYIGYYNTFSGGI  230

Query  539  PPEMGNLSQLIRXDAANCGLTGE  607
            P E+GNLS L+R DAANCGL+GE
Sbjct  231  PKEIGNLSNLVRFDAANCGLSGE  253


 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 59/173 (34%), Positives = 86/173 (50%), Gaps = 2/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            L+G +  ++G L  L  L I   N  SG +P EI  +S L   + +N       P ++  
Sbjct  201  LTGAIPREIGNLTQLKELYIGYYNTFSGGIPKEIGNLSNLVRFDAANCGLSGEIPAEIGN  260

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L NL  L L  N LTG L  E+  + SL+ + L  N  SG +PP +    N+  L +  N
Sbjct  261  LQNLDTLFLQVNGLTGGLTPELGNLKSLKSMDLSNNMLSGELPPSFAELKNMTLLNLFRN  320

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             L+G IP  IG L +L+ L + + N F+G IP  +G    L   D ++  LTG
Sbjct  321  KLTGSIPDFIGELPELQVLQL-WENNFTGSIPQNLGTNGNLHEVDVSSNKLTG  372


 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 86/162 (53%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG +  ++G L  L  L +  N L+G + PE+  + +L+ ++LSNN+     P   A+L
Sbjct  250  LSGEIPAEIGNLQNLDTLFLQVNGLTGGLTPELGNLKSLKSMDLSNNMLSGELPPSFAEL  309

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             N+ +L+L+ N LTG +P  + ++  L+ L L  N F+G IP   G   NL  + VS N 
Sbjct  310  KNMTLLNLFRNKLTGSIPDFIGELPELQVLQLWENNFTGSIPQNLGTNGNLHEVDVSSNK  369

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P  + N  +L  L I   N   G IP  +G    L R
Sbjct  370  LTGNLPPNLCNGKQLHTL-ITLGNFLFGPIPESLGQCESLSR  410


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/172 (31%), Positives = 87/172 (51%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G L+P++G L  L ++ ++ N LSG +PP  + +  +  LNL  N    + P  + +L
Sbjct  274  LTGGLTPELGNLKSLKSMDLSNNMLSGELPPSFAELKNMTLLNLFRNKLTGSIPDFIGEL  333

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              LQVL L+ NN TG +P  +    +L  + +  N  +G +PP       L  L   GN 
Sbjct  334  PELQVLQLWENNFTGSIPQNLGTNGNLHEVDVSSNKLTGNLPPNLCNGKQLHTLITLGNF  393

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            L G IP  +G    L  + +G  N  +G IP  + +L +L + +  +  L+G
Sbjct  394  LFGPIPESLGQCESLSRVRMGE-NYLNGSIPKGLLSLPKLTQVELQDNLLSG  444


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 82/173 (47%), Gaps = 1/173 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P++     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  369  KLTGNLPPNLCNGKQLHTLITLGNFLFGPIPESLGQCESLSRVRMGENYLNGSIPKGLLS  428

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N L+G  P      T+L  + L  N+ SG +PP  G F  ++ L + GN
Sbjct  429  LPKLTQVELQDNLLSGAFPETDRPSTTLGQISLSNNHLSGPLPPSIGNFVGVQKLLLDGN  488

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
              SG IP+EIG L +L ++   + N  SG I PE+     L   D +   L+G
Sbjct  489  KFSGRIPAEIGKLQQLSKMDFSH-NNLSGPIAPEISRCKLLTFVDLSRNQLSG  540


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 70/137 (51%), Gaps = 1/137 (1%)
 Frame = +2

Query  131  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  310
            L  +S++ N LSGP+PP I     ++ L L  N F    P ++ +L  L  +D  +NNL+
Sbjct  456  LGQISLSNNHLSGPLPPSIGNFVGVQKLLLDGNKFSGRIPAEIGKLQQLSKMDFSHNNLS  515

Query  311  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTK  490
            G +  E+ +   L  + L  N  SG +P E      L YL +S N L G IPS I ++  
Sbjct  516  GPIAPEISRCKLLTFVDLSRNQLSGSVPTEITGMRILNYLNLSRNHLVGSIPSSIASMQS  575

Query  491  LKELYIGYFNGFSGGIP  541
            L  +   Y N FSG +P
Sbjct  576  LTSVDFSY-NNFSGLVP  591


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 75/164 (46%), Gaps = 1/164 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G +   +  LP L  + +  N LSG  P      +TL  ++LSNN      P  +   
Sbjct  418  LNGSIPKGLLSLPKLTQVELQDNLLSGAFPETDRPSTTLGQISLSNNHLSGPLPPSIGNF  477

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              +Q L L  N  +G +P E+ K+  L  +    N  SG I PE  R   L ++ +S N 
Sbjct  478  VGVQKLLLDGNKFSGRIPAEIGKLQQLSKMDFSHNNLSGPIAPEISRCKLLTFVDLSRNQ  537

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXD  580
            LSG +P+EI  +  L  L +   N   G IP  + ++  L   D
Sbjct  538  LSGSVPTEITGMRILNYLNLSR-NHLVGSIPSSIASMQSLTSVD  580


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 61/120 (51%), Gaps = 1/120 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
              SG +  ++G+L  L  +  + N LSGP+ PEIS    L F++LS N    + P ++  
Sbjct  489  KFSGRIPAEIGKLQQLSKMDFSHNNLSGPIAPEISRCKLLTFVDLSRNQLSGSVPTEITG  548

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            +  L  L+L  N+L G +P  +  M SL  +    N FSG + P  G+F    Y +  GN
Sbjct  549  MRILNYLNLSRNHLVGSIPSSIASMQSLTSVDFSYNNFSGLV-PGTGQFSYFNYTSFLGN  607



>ref|XP_009613990.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana tomentosiformis]
Length=1019

 Score =   279 bits (713),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 140/201 (70%), Positives = 171/201 (85%), Gaps = 0/201 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPP  181
            NISTSHCTW+ VTCD   HV SL++S LNL+G L P++GQL +LVNLS+A NQ SGP+P 
Sbjct  52   NISTSHCTWKGVTCDKYRHVTSLNISNLNLTGTLPPEIGQLRYLVNLSVAVNQFSGPIPV  111

Query  182  EISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLH  361
            E+S IS LR+LNLSNNIF  +FP QL QL NL+VLD+YNNNLTG+L V V+ +T+L HLH
Sbjct  112  ELSLISNLRYLNLSNNIFNLSFPQQLTQLINLEVLDIYNNNLTGELAVGVHNLTNLYHLH  171

Query  362  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            LGGN+F+GRIPPE+G+FP L+YLAVSGN L+G IP EIGN+T LKELY+GY+N FSGGIP
Sbjct  172  LGGNFFTGRIPPEFGKFPFLKYLAVSGNELAGDIPPEIGNITTLKELYVGYYNTFSGGIP  231

Query  542  PEMGNLSQLIRXDAANCGLTG  604
            PE+GNLS+L+R DAANCGL+G
Sbjct  232  PEIGNLSELVRFDAANCGLSG  252


 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 60/173 (35%), Positives = 93/173 (54%), Gaps = 1/173 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            +LSG L P++G L  L +L ++ N LSG +P  +S +  L  LNL  N    + P  + +
Sbjct  273  SLSGSLIPEIGYLKSLKSLDLSNNLLSGEIPLTLSELKNLTLLNLFRNKLYGSIPEFIQE  332

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L+VL L+ NN TG +P+ + + + L+ L +  N  +G +PP   R  NLE L   GN
Sbjct  333  LPKLEVLQLWENNFTGSIPMGLGQNSKLKTLDISTNKLTGNLPPNMCRGNNLETLITLGN  392

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             L G IP  +G    L  + +G  N  +G IP  + +L +L + +  +  LTG
Sbjct  393  FLFGPIPESLGQCESLSRIRMGE-NYLNGSIPKGLLSLPKLTQVELQDNLLTG  444


 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/174 (34%), Positives = 86/174 (49%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P++ +   L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  369  KLTGNLPPNMCRGNNLETLITLGNFLFGPIPESLGQCESLSRIRMGENYLNGSIPKGLLS  428

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N LTG  PV      SL  + L  N  +GR+P   G F  ++ L + GN
Sbjct  429  LPKLTQVELQDNLLTGTFPVTGSVSASLGQISLSNNRLTGRLPSSIGSFSGVQKLLLDGN  488

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              SG IP+EIG L +L ++     NGFSG IPPE+ N   L   D +   L+GE
Sbjct  489  KFSGRIPAEIGKLQQLSKMDFSG-NGFSGPIPPEISNCKALTFIDLSRNKLSGE  541


 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 80/154 (52%), Gaps = 1/154 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L G +   +GQ   L  + +  N L+G +P  + ++  L  + L +N+   TFP   +  
Sbjct  394  LFGPIPESLGQCESLSRIRMGENYLNGSIPKGLLSLPKLTQVELQDNLLTGTFPVTGSVS  453

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
            A+L  + L NN LTG LP  +   + ++ L L GN FSGRIP E G+   L  +  SGNG
Sbjct  454  ASLGQISLSNNRLTGRLPSSIGSFSGVQKLLLDGNKFSGRIPAEIGKLQQLSKMDFSGNG  513

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
             SG IP EI N   L  + +   N  SG IP E+
Sbjct  514  FSGPIPPEISNCKALTFIDLSR-NKLSGEIPTEI  546


 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 87/165 (53%), Gaps = 6/165 (4%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  265
             SG + P++G L  LV    A   LSG +P EI  +  L  L L  N++ GS  P ++  
Sbjct  226  FSGGIPPEIGNLSELVRFDAANCGLSGNIPSEIGKLKKLDTLFLQVNSLSGSLIP-EIGY  284

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L +L+ LDL NN L+G++P+ + ++ +L  L+L  N   G IP      P LE L +  N
Sbjct  285  LKSLKSLDLSNNLLSGEIPLTLSELKNLTLLNLFRNKLYGSIPEFIQELPKLEVLQLWEN  344

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM---GNLSQLI  571
              +G IP  +G  +KLK L I   N  +G +PP M    NL  LI
Sbjct  345  NFTGSIPMGLGQNSKLKTLDIST-NKLTGNLPPNMCRGNNLETLI  388


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 63/126 (50%), Gaps = 0/126 (0%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G L   +G    +  L +  N+ SG +P EI  +  L  ++ S N F    P +++  
Sbjct  466  LTGRLPSSIGSFSGVQKLLLDGNKFSGRIPAEIGKLQQLSKMDFSGNGFSGPIPPEISNC  525

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  +DL  N L+G++P E+  M  L +L++  N+  G IP       +L  +  S N 
Sbjct  526  KALTFIDLSRNKLSGEIPTEITGMRILNYLNVSRNHLVGSIPASISAMQSLTSVDFSYNN  585

Query  449  LSGVIP  466
            LSG++P
Sbjct  586  LSGLVP  591



>ref|XP_009786199.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana sylvestris]
Length=1015

 Score =   279 bits (713),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 139/200 (70%), Positives = 170/200 (85%), Gaps = 0/200 (0%)
 Frame = +2

Query  8    STSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEI  187
            +TSHCTW+ VTCD   HV SL++S LNL+G L P++GQL +LVNLS+A NQ SGP+P E+
Sbjct  52   TTSHCTWKGVTCDKYRHVTSLNISNLNLTGTLPPEIGQLRYLVNLSVAVNQFSGPIPVEL  111

Query  188  SAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLG  367
            S IS LR+LNLSNNIF  +FP QL QL NL+VLD+YNNNLTG LPV V+ +T+L HLHLG
Sbjct  112  SVISNLRYLNLSNNIFNLSFPQQLTQLINLEVLDIYNNNLTGQLPVGVHNLTNLYHLHLG  171

Query  368  GNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPE  547
            GN+F+GRIPPE+G+FP L+YLAVSGN L+G IP EIGN+T LKELY+GY+N FSGGIPPE
Sbjct  172  GNFFTGRIPPEFGKFPFLKYLAVSGNELAGDIPPEIGNITTLKELYVGYYNTFSGGIPPE  231

Query  548  MGNLSQLIRXDAANCGLTGE  607
            +GNLS+L+R DAANCGL+GE
Sbjct  232  IGNLSELVRFDAANCGLSGE  251


 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 60/174 (34%), Positives = 87/174 (50%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P++ +   L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  367  KLTGNLPPNMCRGNNLETLITLGNFLFGPIPESLGQCESLSRIRMGENYLNGSIPKGLLS  426

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N LTG  PV      SL  + L  N  +GR+PP  G F  ++ L + GN
Sbjct  427  LPKLTQVELQDNLLTGTFPVTGSVSASLGQISLSNNRLTGRLPPSIGNFSGVQKLLLDGN  486

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              SG IP+EIG L +L ++     NGFSG IPPE+ +   L   D +   L+GE
Sbjct  487  KFSGRIPAEIGKLQQLSKMDFSG-NGFSGPIPPEISHCKALTFVDLSRNKLSGE  539


 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 60/173 (35%), Positives = 93/173 (54%), Gaps = 1/173 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            +LSG L P++G L  L +L ++ N LSG +P  +S +  L  LNL  N    + P  + +
Sbjct  271  SLSGSLIPEIGYLKSLKSLDLSNNLLSGEIPLTLSELKNLTLLNLFRNKLYGSIPEFIEE  330

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L+VL L+ NN TG +P+ + + + L+ L +  N  +G +PP   R  NLE L   GN
Sbjct  331  LPKLEVLQLWENNFTGSIPMGLGQNSKLKTLDISTNKLTGNLPPNMCRGNNLETLITLGN  390

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             L G IP  +G    L  + +G  N  +G IP  + +L +L + +  +  LTG
Sbjct  391  FLFGPIPESLGQCESLSRIRMGE-NYLNGSIPKGLLSLPKLTQVELQDNLLTG  442


 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 55/154 (36%), Positives = 80/154 (52%), Gaps = 1/154 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L G +   +GQ   L  + +  N L+G +P  + ++  L  + L +N+   TFP   +  
Sbjct  392  LFGPIPESLGQCESLSRIRMGENYLNGSIPKGLLSLPKLTQVELQDNLLTGTFPVTGSVS  451

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
            A+L  + L NN LTG LP  +   + ++ L L GN FSGRIP E G+   L  +  SGNG
Sbjct  452  ASLGQISLSNNRLTGRLPPSIGNFSGVQKLLLDGNKFSGRIPAEIGKLQQLSKMDFSGNG  511

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
             SG IP EI +   L  + +   N  SG IP E+
Sbjct  512  FSGPIPPEISHCKALTFVDLSR-NKLSGEIPTEI  544


 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 87/165 (53%), Gaps = 6/165 (4%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  265
             SG + P++G L  LV    A   LSG +P EI  +  L  L L  N++ GS  P ++  
Sbjct  224  FSGGIPPEIGNLSELVRFDAANCGLSGEIPAEIGKLKKLDTLFLQVNSLSGSLIP-EIGY  282

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L +L+ LDL NN L+G++P+ + ++ +L  L+L  N   G IP      P LE L +  N
Sbjct  283  LKSLKSLDLSNNLLSGEIPLTLSELKNLTLLNLFRNKLYGSIPEFIEELPKLEVLQLWEN  342

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM---GNLSQLI  571
              +G IP  +G  +KLK L I   N  +G +PP M    NL  LI
Sbjct  343  NFTGSIPMGLGQNSKLKTLDIST-NKLTGNLPPNMCRGNNLETLI  386


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 59/120 (49%), Gaps = 1/120 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
              SG +  ++G+L  L  +  + N  SGP+PPEIS    L F++LS N      P ++  
Sbjct  487  KFSGRIPAEIGKLQQLSKMDFSGNGFSGPIPPEISHCKALTFVDLSRNKLSGEIPTEITG  546

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            +  L  L++  N+L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  547  MRILNYLNVSRNHLVGSIPASISAMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  605



>ref|XP_009375880.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Pyrus x bretschneideri]
Length=1015

 Score =   279 bits (713),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 143/201 (71%), Positives = 160/201 (80%), Gaps = 1/201 (0%)
 Frame = +2

Query  8    STSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPE  184
            +TSHCTW  VTCDS    V+      L+L+G LSPDV  L FL NL++A NQ SGP+PPE
Sbjct  49   TTSHCTWSGVTCDSSRRYVTSLDLSGLDLTGTLSPDVAHLRFLANLTLAENQFSGPIPPE  108

Query  185  ISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHL  364
            ISA+S LR LNLSNN+F +TFP QL+ L  L VLDLYNNNLTGDLPV V  MTSLRHLHL
Sbjct  109  ISALSGLRLLNLSNNVFNTTFPPQLSNLTRLTVLDLYNNNLTGDLPVSVTHMTSLRHLHL  168

Query  365  GGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPP  544
            GGN+FSG+IPPE+GRFP LEYLAVSGN L G IP EIGNLT LKELYIGYFN + GGIPP
Sbjct  169  GGNFFSGQIPPEFGRFPFLEYLAVSGNELGGPIPPEIGNLTTLKELYIGYFNSYEGGIPP  228

Query  545  EMGNLSQLIRXDAANCGLTGE  607
            E+GNLS L+R DAANC LTGE
Sbjct  229  EIGNLSNLVRFDAANCNLTGE  249


 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 57/173 (33%), Positives = 91/173 (53%), Gaps = 1/173 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            NL+G + P+VG+L  +  L +  N LSG +  E+  + +L+ ++LSNN+F    P   ++
Sbjct  245  NLTGEIPPEVGRLQNVDTLFLQVNALSGSLTLELGYLKSLKSMDLSNNVFTGEIPGSFSE  304

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L NL +L+L+ N L G +P  +  +  L+ L L  N F+G IP   G+   L+ L +S N
Sbjct  305  LKNLTLLNLFRNRLHGAIPDFIGDLPELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSN  364

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             L+G +P ++     L+ L I   N   G IP  +G    L R    +  L G
Sbjct  365  KLTGTLPPDMCFGNNLQTL-ITLSNFLFGPIPESLGRCDSLSRIRMGDNYLNG  416


 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 91/188 (48%), Gaps = 25/188 (13%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L G +   +G LP L  L +  N  +G +P  +     L+ L+LS+N    T P  +   
Sbjct  318  LHGAIPDFIGDLPELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSNKLTGTLPPDMCFG  377

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP------PEY---------  403
             NLQ L   +N L G +P  + +  SL  + +G NY +G IP      P+          
Sbjct  378  NNLQTLITLSNFLFGPIPESLGRCDSLSRIRMGDNYLNGSIPKGLLSLPKLTQVELQDNL  437

Query  404  --GRFP-------NLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  556
              G FP       NL  +++S N LSG +P  IGN + +++L +   N FSG IPPE+G 
Sbjct  438  LDGSFPETDSISGNLGQISLSNNRLSGSLPPSIGNFSGVQKLLLDG-NKFSGRIPPEIGR  496

Query  557  LSQLIRXD  580
            L Q+ + D
Sbjct  497  LQQVSKMD  504


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 82/174 (47%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L PD+     L  L   +N L GP+P  +    +L  + + +N    + P  L  
Sbjct  365  KLTGTLPPDMCFGNNLQTLITLSNFLFGPIPESLGRCDSLSRIRMGDNYLNGSIPKGLLS  424

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N L G  P       +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  425  LPKLTQVELQDNLLDGSFPETDSISGNLGQISLSNNRLSGSLPPSIGNFSGVQKLLLDGN  484

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              SG IP EIG L ++ ++   + N F G I PE+ +   L   D +   L+GE
Sbjct  485  KFSGRIPPEIGRLQQVSKMDFKH-NKFMGPITPEISHCKLLTFVDLSRNELSGE  537


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/162 (33%), Positives = 81/162 (50%), Gaps = 4/162 (2%)
 Frame = +2

Query  95   GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  274
            G + P++G L  LV    A   L+G +PPE+  +  +  L L  N    +   +L  L +
Sbjct  224  GGIPPEIGNLSNLVRFDAANCNLTGEIPPEVGRLQNVDTLFLQVNALSGSLTLELGYLKS  283

Query  275  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  454
            L+ +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P L+ L +  N  +
Sbjct  284  LKSMDLSNNVFTGEIPGSFSELKNLTLLNLFRNRLHGAIPDFIGDLPELQVLQLWENNFT  343

Query  455  GVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM---GNLSQLI  571
            G IP  +G   KL+ L +   N  +G +PP+M    NL  LI
Sbjct  344  GSIPQGLGKNGKLQILDLSS-NKLTGTLPPDMCFGNNLQTLI  384


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 56/196 (29%), Positives = 86/196 (44%), Gaps = 25/196 (13%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L +N+   +FP   +  
Sbjct  390  LFGPIPESLGRCDSLSRIRMGDNYLNGSIPKGLLSLPKLTQVELQDNLLDGSFPETDSIS  449

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPN----------  418
             NL  + L NN L+G LP  +   + ++ L L GN FSGRIPPE GR             
Sbjct  450  GNLGQISLSNNRLSGSLPPSIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQVSKMDFKHNK  509

Query  419  --------------LEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  556
                          L ++ +S N LSG IP EI  +  L  L +   N   G IP  +  
Sbjct  510  FMGPITPEISHCKLLTFVDLSRNELSGEIPKEITGMRILNYLNLSR-NHLVGSIPSSIST  568

Query  557  LSQLIRXDAANCGLTG  604
            +  L   D +   L+G
Sbjct  569  MQSLTSVDFSYNNLSG  584


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L P +G    +  L +  N+ SG +PPEI  +  +  ++  +N F      +++  
Sbjct  462  LSGSLPPSIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQVSKMDFKHNKFMGPITPEISHC  521

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  522  KLLTFVDLSRNELSGEIPKEITGMRILNYLNLSRNHLVGSIPSSISTMQSLTSVDFSYNN  581

Query  449  LSGVIP  466
            LSG++P
Sbjct  582  LSGLVP  587


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 65/137 (47%), Gaps = 1/137 (1%)
 Frame = +2

Query  131  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  310
            L  +S++ N+LSG +PP I   S ++ L L  N F    P ++ +L  +  +D  +N   
Sbjct  452  LGQISLSNNRLSGSLPPSIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQVSKMDFKHNKFM  511

Query  311  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTK  490
            G +  E+     L  + L  N  SG IP E      L YL +S N L G IPS I  +  
Sbjct  512  GPITPEISHCKLLTFVDLSRNELSGEIPKEITGMRILNYLNLSRNHLVGSIPSSISTMQS  571

Query  491  LKELYIGYFNGFSGGIP  541
            L  +   Y N  SG +P
Sbjct  572  LTSVDFSY-NNLSGLVP  587



>ref|XP_006364007.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Solanum tuberosum]
Length=1022

 Score =   278 bits (712),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 144/202 (71%), Positives = 168/202 (83%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPP  181
            NISTSHCTWR VTCD   HV SLD+SG NL+G L+P+VG L FL+NLS+A NQ SGP+P 
Sbjct  53   NISTSHCTWRGVTCDRYRHVTSLDISGFNLTGTLTPEVGHLRFLLNLSVAVNQFSGPIPI  112

Query  182  EISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLH  361
            E+S I  L +LNLSNNIF  +FP QL  L  L+VLD+YNNN+TGDLPV VY +T+LRHLH
Sbjct  113  ELSFIPNLSYLNLSNNIFNLSFPPQLTHLRYLKVLDIYNNNMTGDLPVGVYNLTNLRHLH  172

Query  362  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            LGGN+FSG IPPEYGRFP LEYLAVSGN L G+IP EIGN+T L+ELYIGY+N FSGG+P
Sbjct  173  LGGNFFSGSIPPEYGRFPFLEYLAVSGNALVGMIPPEIGNITTLRELYIGYYNTFSGGLP  232

Query  542  PEMGNLSQLIRXDAANCGLTGE  607
             E+GNLS+LIR DAANCGL+GE
Sbjct  233  AEIGNLSELIRLDAANCGLSGE  254


 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 85/162 (52%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P++G+L  L  L +  N LSG V PE+  + +L+ L+LSNN+     P    +L
Sbjct  251  LSGEIPPEIGKLQKLDTLFLQVNGLSGSVTPELGNLKSLKSLDLSNNMLSGEIPFTFTEL  310

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   G+   L  + +S N 
Sbjct  311  KNLTLLNLFRNKLYGSIPEFIEDLPKLEVLQLWENNFTGSIPQGLGKNSKLTNVDISTNK  370

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P  + +  KL+ L I   N   G IP  +G    L R
Sbjct  371  LTGNLPPNMCSGNKLQTL-ITLGNFLFGPIPESLGECQSLNR  411


 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 84/174 (48%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P++     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  370  KLTGNLPPNMCSGNKLQTLITLGNFLFGPIPESLGECQSLNRIRMGENFLNGSIPKGLFS  429

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N LTG  PV     +SL  + L  N F+G +P   G F  ++ L + GN
Sbjct  430  LPKLSQVELQDNLLTGTFPVTGSVSSSLGQICLSNNRFTGPLPSSIGNFTGVQKLLLDGN  489

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              SG IP+E+G L +L ++     N FSG IPPE+     L   D +   L+GE
Sbjct  490  KFSGQIPAELGKLQQLSKMDFSG-NSFSGLIPPEISRCKALTYVDLSRNKLSGE  542


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 82/172 (48%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G +   +  LP L  + +  N L+G  P   S  S+L  + LSNN F    P  +   
Sbjct  419  LNGSIPKGLFSLPKLSQVELQDNLLTGTFPVTGSVSSSLGQICLSNNRFTGPLPSSIGNF  478

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              +Q L L  N  +G +P E+ K+  L  +   GN FSG IPPE  R   L Y+ +S N 
Sbjct  479  TGVQKLLLDGNKFSGQIPAELGKLQQLSKMDFSGNSFSGLIPPEISRCKALTYVDLSRNK  538

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            LSG +P+EI  +  L  L +   N   G IP  +  +  L   D +   L+G
Sbjct  539  LSGEVPTEITGMRILNYLNVSR-NQLVGSIPAPIAAMQSLTSVDFSYNNLSG  589


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 88/172 (51%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG ++P++G L  L +L ++ N LSG +P   + +  L  LNL  N    + P  +  L
Sbjct  275  LSGSVTPELGNLKSLKSLDLSNNMLSGEIPFTFTELKNLTLLNLFRNKLYGSIPEFIEDL  334

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L+VL L+ NN TG +P  + K + L ++ +  N  +G +PP       L+ L   GN 
Sbjct  335  PKLEVLQLWENNFTGSIPQGLGKNSKLTNVDISTNKLTGNLPPNMCSGNKLQTLITLGNF  394

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            L G IP  +G    L  + +G  N  +G IP  + +L +L + +  +  LTG
Sbjct  395  LFGPIPESLGECQSLNRIRMGE-NFLNGSIPKGLFSLPKLSQVELQDNLLTG  445


 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 77/154 (50%), Gaps = 1/154 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
             SG L  ++G L  L+ L  A   LSG +PPEI  +  L  L L  N    +   +L  L
Sbjct  227  FSGGLPAEIGNLSELIRLDAANCGLSGEIPPEIGKLQKLDTLFLQVNGLSGSVTPELGNL  286

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             +L+ LDL NN L+G++P    ++ +L  L+L  N   G IP      P LE L +  N 
Sbjct  287  KSLKSLDLSNNMLSGEIPFTFTELKNLTLLNLFRNKLYGSIPEFIEDLPKLEVLQLWENN  346

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
             +G IP  +G  +KL  + I   N  +G +PP M
Sbjct  347  FTGSIPQGLGKNSKLTNVDIST-NKLTGNLPPNM  379


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/174 (30%), Positives = 90/174 (52%), Gaps = 3/174 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +G +   +G+   L N+ I+ N+L+G +PP + + + L+  + L N +FG   P  L 
Sbjct  346  NFTGSIPQGLGKNSKLTNVDISTNKLTGNLPPNMCSGNKLQTLITLGNFLFGP-IPESLG  404

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            +  +L  + +  N L G +P  ++ +  L  + L  N  +G  P       +L  + +S 
Sbjct  405  ECQSLNRIRMGENFLNGSIPKGLFSLPKLSQVELQDNLLTGTFPVTGSVSSSLGQICLSN  464

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            N  +G +PS IGN T +++L +   N FSG IP E+G L QL + D +    +G
Sbjct  465  NRFTGPLPSSIGNFTGVQKLLLDG-NKFSGQIPAELGKLQQLSKMDFSGNSFSG  517


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/172 (31%), Positives = 84/172 (49%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L +N+   TFP   +  
Sbjct  395  LFGPIPESLGECQSLNRIRMGENFLNGSIPKGLFSLPKLSQVELQDNLLTGTFPVTGSVS  454

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
            ++L  + L NN  TG LP  +   T ++ L L GN FSG+IP E G+   L  +  SGN 
Sbjct  455  SSLGQICLSNNRFTGPLPSSIGNFTGVQKLLLDGNKFSGQIPAELGKLQQLSKMDFSGNS  514

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             SG+IP EI     L  + +   N  SG +P E+  +  L   + +   L G
Sbjct  515  FSGLIPPEISRCKALTYVDLSR-NKLSGEVPTEITGMRILNYLNVSRNQLVG  565


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 57/120 (48%), Gaps = 1/120 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
              SG +  ++G+L  L  +  + N  SG +PPEIS    L +++LS N      P ++  
Sbjct  490  KFSGQIPAELGKLQQLSKMDFSGNSFSGLIPPEISRCKALTYVDLSRNKLSGEVPTEITG  549

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            +  L  L++  N L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  550  MRILNYLNVSRNQLVGSIPAPIAAMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFIGN  608



>ref|XP_009771232.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana sylvestris]
Length=1019

 Score =   278 bits (711),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 145/202 (72%), Positives = 166/202 (82%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPP  181
            NISTSHCTW+ VTCD   HV SLD+SG N++G L P+VG L FL NLS+  NQ SGP+P 
Sbjct  51   NISTSHCTWKGVTCDRYRHVTSLDISGFNVTGTLPPEVGNLRFLQNLSVDLNQFSGPIPV  110

Query  182  EISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLH  361
            EIS I  L +LNLSNNIF   FP QL +L NL+VLDLYNNN+TGDLPV+VY+MT+LRHLH
Sbjct  111  EISFIPNLHYLNLSNNIFSLGFPPQLTRLRNLKVLDLYNNNMTGDLPVDVYQMTNLRHLH  170

Query  362  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            LGGN+F GRIPPEYGRF  LEYLAVSGN L G IP EIGN+T L ELY+GY+N FSGGIP
Sbjct  171  LGGNFFGGRIPPEYGRFQFLEYLAVSGNELVGEIPPEIGNITTLHELYVGYYNTFSGGIP  230

Query  542  PEMGNLSQLIRXDAANCGLTGE  607
            PE+GNLSQL+R DAANCGL+GE
Sbjct  231  PEIGNLSQLVRFDAANCGLSGE  252


 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 91/173 (53%), Gaps = 1/173 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            +LSG L+P++G L  L +L ++ N LSG VPP  + +  L  LNL  N    + P  +  
Sbjct  272  SLSGSLTPEIGTLKSLKSLDLSNNMLSGEVPPTFADLKNLTLLNLFRNKLHGSIPEFIGD  331

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L+VL L+ NN TG +P  +   + L++L L  N  +G +PP      NL+ +   GN
Sbjct  332  LPELEVLQLWENNFTGSIPQGLGTNSKLKNLDLSSNKLTGNLPPNMCAGKNLQTIITLGN  391

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             L G IP  +G    L  + +G  N  +G IP  + +L QL + +  N  LTG
Sbjct  392  FLFGPIPESLGQCESLSRIRMGE-NYLNGSIPKRLLSLPQLSQVELQNNLLTG  443


 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 84/174 (48%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P++     L  +    N L GP+P  +    +L  + +  N    + P +L  
Sbjct  368  KLTGNLPPNMCAGKNLQTIITLGNFLFGPIPESLGQCESLSRIRMGENYLNGSIPKRLLS  427

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L NN LTG  P      TSL  + L  N+ +G +P   G F  ++ L + GN
Sbjct  428  LPQLSQVELQNNLLTGTFPETKSISTSLGQISLSNNHLTGSLPTSIGNFAGVQKLLLDGN  487

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              SG IP+EIG L +L ++   + N FSG I PE+     L   D +   L+GE
Sbjct  488  KFSGRIPAEIGKLQQLSKIDFSH-NDFSGPIAPEISKCKLLTYVDLSRNQLSGE  540


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 77/154 (50%), Gaps = 1/154 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
             SG + P++G L  LV    A   LSG +P E+  +  L  L L  N    +   ++  L
Sbjct  225  FSGGIPPEIGNLSQLVRFDAANCGLSGEIPAELGKLQNLDTLFLQVNSLSGSLTPEIGTL  284

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             +L+ LDL NN L+G++P     + +L  L+L  N   G IP   G  P LE L +  N 
Sbjct  285  KSLKSLDLSNNMLSGEVPPTFADLKNLTLLNLFRNKLHGSIPEFIGDLPELEVLQLWENN  344

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
             +G IP  +G  +KLK L +   N  +G +PP M
Sbjct  345  FTGSIPQGLGTNSKLKNLDLSS-NKLTGNLPPNM  377


 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 52/154 (34%), Positives = 75/154 (49%), Gaps = 1/154 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L G +   +GQ   L  + +  N L+G +P  + ++  L  + L NN+   TFP   +  
Sbjct  393  LFGPIPESLGQCESLSRIRMGENYLNGSIPKRLLSLPQLSQVELQNNLLTGTFPETKSIS  452

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             +L  + L NN+LTG LP  +     ++ L L GN FSGRIP E G+   L  +  S N 
Sbjct  453  TSLGQISLSNNHLTGSLPTSIGNFAGVQKLLLDGNKFSGRIPAEIGKLQQLSKIDFSHND  512

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
             SG I  EI     L  + +   N  SG IP E+
Sbjct  513  FSGPIAPEISKCKLLTYVDLSR-NQLSGEIPTEI  545


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 59/120 (49%), Gaps = 1/120 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
              SG +  ++G+L  L  +  + N  SGP+ PEIS    L +++LS N      P ++  
Sbjct  488  KFSGRIPAEIGKLQQLSKIDFSHNDFSGPIAPEISKCKLLTYVDLSRNQLSGEIPTEITG  547

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            +  L  L+L  N+L G +P  +  M SL  +    N FSG +P   G+F    Y +  GN
Sbjct  548  MRILNYLNLSRNHLVGSIPAPISSMQSLTSVDFSYNNFSGLVPGT-GQFSYFNYTSFLGN  606



>ref|XP_009605676.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana tomentosiformis]
Length=1017

 Score =   278 bits (711),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 145/202 (72%), Positives = 166/202 (82%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPP  181
            N STSHCTW+ VTCD   HV SLD+SG N++G L P+VG   FL NLS+A NQ SGP+P 
Sbjct  50   NNSTSHCTWKGVTCDRYRHVTSLDISGFNVTGTLPPEVGNFRFLQNLSVALNQFSGPIPV  109

Query  182  EISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLH  361
            EIS I  L +LNLSNNIF   FP QL +L NL+VLDLYNNN+TGDLPV+VY+MT+LRHLH
Sbjct  110  EISFIPNLHYLNLSNNIFSLGFPPQLTRLRNLKVLDLYNNNMTGDLPVDVYQMTNLRHLH  169

Query  362  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            LGGN+F GRIPPEYGRF  LEYLAVSGN L GVIP EIGN+T L ELY+GY+N FSGGIP
Sbjct  170  LGGNFFGGRIPPEYGRFQFLEYLAVSGNELVGVIPPEIGNITTLHELYVGYYNTFSGGIP  229

Query  542  PEMGNLSQLIRXDAANCGLTGE  607
            PE+GNLSQL+R DAANCGL+GE
Sbjct  230  PEIGNLSQLVRFDAANCGLSGE  251


 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 91/173 (53%), Gaps = 1/173 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            +LSG L+P++G L  L +L ++ N LSG VPP  + +  L  LNL  N    + P  +  
Sbjct  271  SLSGSLTPEIGTLKSLKSLDLSNNMLSGEVPPTFADLKNLTLLNLFRNKLHGSIPEFIGD  330

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L+VL L+ NN TG +P  +   + L++L L  N  +G +PP      NL+ +   GN
Sbjct  331  LPELEVLQLWENNFTGSIPHGLGTNSKLKNLDLSSNKLTGSLPPNMCAGKNLQTIITLGN  390

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             L G IP  +G    L  + +G  N  +G IP  + +L QL + +  N  LTG
Sbjct  391  FLFGPIPESLGQCESLSRIRMGE-NYLNGSIPKGLLSLPQLSQVELQNNLLTG  442


 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 82/174 (47%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P++     L  +    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  367  KLTGSLPPNMCAGKNLQTIITLGNFLFGPIPESLGQCESLSRIRMGENYLNGSIPKGLLS  426

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L NN LTG  P      TSL  + L  N+ +G +P   G F  ++ L + GN
Sbjct  427  LPQLSQVELQNNLLTGTFPETKSISTSLGQISLSNNHLTGPLPTSIGNFAGVQKLLLDGN  486

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              SG IP EIG L +L ++   + N FSG I PE+     L   D +   L+GE
Sbjct  487  KFSGRIPVEIGKLQQLSKIDFSH-NDFSGPIAPEISKCKLLTYVDLSRNQLSGE  539


 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 77/154 (50%), Gaps = 1/154 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
             SG + P++G L  LV    A   LSG +P EI  +  L  L L  N    +   ++  L
Sbjct  224  FSGGIPPEIGNLSQLVRFDAANCGLSGEIPAEIEKLQNLDTLFLQVNSLSGSLTPEIGTL  283

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             +L+ LDL NN L+G++P     + +L  L+L  N   G IP   G  P LE L +  N 
Sbjct  284  KSLKSLDLSNNMLSGEVPPTFADLKNLTLLNLFRNKLHGSIPEFIGDLPELEVLQLWENN  343

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
             +G IP  +G  +KLK L +   N  +G +PP M
Sbjct  344  FTGSIPHGLGTNSKLKNLDLSS-NKLTGSLPPNM  376


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/154 (34%), Positives = 75/154 (49%), Gaps = 1/154 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L G +   +GQ   L  + +  N L+G +P  + ++  L  + L NN+   TFP   +  
Sbjct  392  LFGPIPESLGQCESLSRIRMGENYLNGSIPKGLLSLPQLSQVELQNNLLTGTFPETKSIS  451

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             +L  + L NN+LTG LP  +     ++ L L GN FSGRIP E G+   L  +  S N 
Sbjct  452  TSLGQISLSNNHLTGPLPTSIGNFAGVQKLLLDGNKFSGRIPVEIGKLQQLSKIDFSHND  511

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
             SG I  EI     L  + +   N  SG IP E+
Sbjct  512  FSGPIAPEISKCKLLTYVDLSR-NQLSGEIPTEI  544


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 59/120 (49%), Gaps = 1/120 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
              SG +  ++G+L  L  +  + N  SGP+ PEIS    L +++LS N      P ++  
Sbjct  487  KFSGRIPVEIGKLQQLSKIDFSHNDFSGPIAPEISKCKLLTYVDLSRNQLSGEIPTEITG  546

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            +  L  L+L  N+L G +P  +  M SL  +    N FSG +P   G+F    Y +  GN
Sbjct  547  MRILNYLNLSRNHLVGSIPTPISSMQSLTSVDFSYNNFSGLVPGT-GQFSYFNYTSFLGN  605



>ref|XP_007208421.1| hypothetical protein PRUPE_ppa000739mg [Prunus persica]
 gb|EMJ09620.1| hypothetical protein PRUPE_ppa000739mg [Prunus persica]
Length=1017

 Score =   277 bits (709),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 146/200 (73%), Positives = 162/200 (81%), Gaps = 0/200 (0%)
 Frame = +2

Query  8    STSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEI  187
            +TSHCTW  VTCDS  HV SLDLS  +L G LS D+  L FL NL++A NQ SGP+P EI
Sbjct  49   TTSHCTWTGVTCDSRRHVTSLDLSSSDLVGTLSSDIAHLRFLSNLTLADNQFSGPIPSEI  108

Query  188  SAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLG  367
            SA+S LR LNLSNNIF +TFP QL+ L  L VLDLYNNNLTGDLPV V  MTSLRHLHLG
Sbjct  109  SALSGLRLLNLSNNIFNTTFPPQLSNLTRLAVLDLYNNNLTGDLPVSVTHMTSLRHLHLG  168

Query  368  GNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPE  547
            GN+FSGRIPPE+GRFP LEYLA+SGN L G IP EIGNLT LKELYIGY+N + GGIPPE
Sbjct  169  GNFFSGRIPPEFGRFPLLEYLAISGNELGGSIPPEIGNLTSLKELYIGYYNIYEGGIPPE  228

Query  548  MGNLSQLIRXDAANCGLTGE  607
            +GNLSQL+R DAANC LTGE
Sbjct  229  IGNLSQLVRLDAANCNLTGE  248


 Score = 95.1 bits (235),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 65/197 (33%), Positives = 100/197 (51%), Gaps = 26/197 (13%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  265
             SG + P+ G+ P L  L+I+ N+L G +PPEI  +++L+ L +   NI+    P ++  
Sbjct  172  FSGRIPPEFGRFPLLEYLAISGNELGGSIPPEIGNLTSLKELYIGYYNIYEGGIPPEIGN  231

Query  266  LANLQVLDLYNNNLTGDLPVEVYK------------------------MTSLRHLHLGGN  373
            L+ L  LD  N NLTG++P E+ +                        + SL+ + L  N
Sbjct  232  LSQLVRLDAANCNLTGEVPRELGRLQNVDTLFLQVNALSGSLTAELGSLKSLKSMDLSNN  291

Query  374  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
             FSG IP  +    NL  L +  N L G IP  IG+L +L+ L + + N F+G IP  +G
Sbjct  292  MFSGEIPGSFSELKNLTLLNLFRNKLHGAIPEFIGDLPELQVLQL-WENNFTGSIPQGLG  350

Query  554  NLSQLIRXDAANCGLTG  604
               +LI  D ++  LTG
Sbjct  351  KNGKLITLDLSSNKLTG  367


 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 83/172 (48%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L+ ++G L  L ++ ++ N  SG +P   S +  L  LNL  N      P  +  L
Sbjct  269  LSGSLTAELGSLKSLKSMDLSNNMFSGEIPGSFSELKNLTLLNLFRNKLHGAIPEFIGDL  328

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              LQVL L+ NN TG +P  + K   L  L L  N  +G +PP+     NL+ L   GN 
Sbjct  329  PELQVLQLWENNFTGSIPQGLGKNGKLITLDLSSNKLTGTLPPDMCFGNNLQTLITLGNF  388

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            L G IP  +G    L  + +G  N  +G IP  +  L +L + +  +  L G
Sbjct  389  LFGPIPESLGRCGSLSRIRMGE-NFLNGSIPKGLFGLPKLSQVELQDNLLAG  439


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/163 (33%), Positives = 87/163 (53%), Gaps = 1/163 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            NL+G +  ++G+L  +  L +  N LSG +  E+ ++ +L+ ++LSNN+F    P   ++
Sbjct  244  NLTGEVPRELGRLQNVDTLFLQVNALSGSLTAELGSLKSLKSMDLSNNMFSGEIPGSFSE  303

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L NL +L+L+ N L G +P  +  +  L+ L L  N F+G IP   G+   L  L +S N
Sbjct  304  LKNLTLLNLFRNKLHGAIPEFIGDLPELQVLQLWENNFTGSIPQGLGKNGKLITLDLSSN  363

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
             L+G +P ++     L+ L I   N   G IP  +G    L R
Sbjct  364  KLTGTLPPDMCFGNNLQTL-ITLGNFLFGPIPESLGRCGSLSR  405


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 90/166 (54%), Gaps = 3/166 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +G +   +G+   L+ L +++N+L+G +PP++   + L+  + L N +FG   P  L 
Sbjct  340  NFTGSIPQGLGKNGKLITLDLSSNKLTGTLPPDMCFGNNLQTLITLGNFLFGP-IPESLG  398

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            +  +L  + +  N L G +P  ++ +  L  + L  N  +G  P       NL  +++S 
Sbjct  399  RCGSLSRIRMGENFLNGSIPKGLFGLPKLSQVELQDNLLAGSFPETDTISVNLGQISLSN  458

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXD  580
            N LSG +P  IGN + +++L +   N FSG IPPE+G L QL + D
Sbjct  459  NRLSGSLPPTIGNFSGVQKLLLDG-NKFSGRIPPEIGRLQQLSKID  503


 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 78/174 (45%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  364  KLTGTLPPDMCFGNNLQTLITLGNFLFGPIPESLGRCGSLSRIRMGENFLNGSIPKGLFG  423

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N L G  P       +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  424  LPKLSQVELQDNLLAGSFPETDTISVNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGN  483

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              SG IP EIG L +L ++   + N F G I PE+     L   D +   L GE
Sbjct  484  KFSGRIPPEIGRLQQLSKIDFSH-NKFLGPIAPEISQCKLLTFVDLSRNELAGE  536


 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 65/126 (52%), Gaps = 0/126 (0%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L P +G    +  L +  N+ SG +PPEI  +  L  ++ S+N F      +++Q 
Sbjct  461  LSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFSHNKFLGPIAPEISQC  520

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  +DL  N L G++P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  521  KLLTFVDLSRNELAGEIPKEITGMRILNYLNLSRNHLVGSIPSSISTMQSLTSVDFSYNN  580

Query  449  LSGVIP  466
            LSG++P
Sbjct  581  LSGLVP  586


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 66/137 (48%), Gaps = 1/137 (1%)
 Frame = +2

Query  131  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  310
            L  +S++ N+LSG +PP I   S ++ L L  N F    P ++ +L  L  +D  +N   
Sbjct  451  LGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFSHNKFL  510

Query  311  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTK  490
            G +  E+ +   L  + L  N  +G IP E      L YL +S N L G IPS I  +  
Sbjct  511  GPIAPEISQCKLLTFVDLSRNELAGEIPKEITGMRILNYLNLSRNHLVGSIPSSISTMQS  570

Query  491  LKELYIGYFNGFSGGIP  541
            L  +   Y N  SG +P
Sbjct  571  LTSVDFSY-NNLSGLVP  586



>ref|XP_011099433.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Sesamum indicum]
Length=1008

 Score =   277 bits (708),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 172/203 (85%), Gaps = 1/203 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCd-sllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVP  178
            N++T+HCTW+ +TCD S  HV SLD+S L+L+G LSPDVGQL FLVNLS+AAN +SGPVP
Sbjct  49   NLTTNHCTWKGITCDPSRRHVTSLDISNLSLTGTLSPDVGQLRFLVNLSVAANFISGPVP  108

Query  179  PEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHL  358
            P+IS I  LR+LNLSNN+F  +FP +L +L NLQVLDLYNNN+TGD P + Y + +LRHL
Sbjct  109  PQISDIPNLRYLNLSNNVFNLSFPPELYRLRNLQVLDLYNNNMTGDFPSKAYLLANLRHL  168

Query  359  HLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGI  538
            HLGGN+FSG IPPE+G FP LEYLAVSGN L+G IP EIGNLT+LKELYIGY+N F+GG+
Sbjct  169  HLGGNFFSGEIPPEFGSFPYLEYLAVSGNELTGAIPPEIGNLTQLKELYIGYYNAFTGGM  228

Query  539  PPEMGNLSQLIRXDAANCGLTGE  607
            P E+GNLSQL+R DAANCGLTGE
Sbjct  229  PKEIGNLSQLVRLDAANCGLTGE  251


 Score = 92.4 bits (228),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 96/197 (49%), Gaps = 26/197 (13%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  265
             SG + P+ G  P+L  L+++ N+L+G +PPEI  ++ L+ L +   N F    P ++  
Sbjct  175  FSGEIPPEFGSFPYLEYLAVSGNELTGAIPPEIGNLTQLKELYIGYYNAFTGGMPKEIGN  234

Query  266  LANLQVLDLYNNNLTGDLPVEVYKM------------------------TSLRHLHLGGN  373
            L+ L  LD  N  LTG++P E+  +                         SL+ + L  N
Sbjct  235  LSQLVRLDAANCGLTGEIPPEIGNLQNLDTLFLQVNGLSGSLTPELGNLKSLKSMDLSNN  294

Query  374  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
             FSG IPP +    N+  L +  N L+G IP  IG L +L+ L + + N F+G IP  +G
Sbjct  295  MFSGEIPPSFAELKNMTLLNLFRNKLTGSIPDFIGELPELEVLQL-WENNFTGIIPQSLG  353

Query  554  NLSQLIRXDAANCGLTG  604
                L   D ++  LTG
Sbjct  354  TNGNLQEVDVSSNKLTG  370


 Score = 92.0 bits (227),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 89/162 (55%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G + P++G L  L  L +  N LSG + PE+  + +L+ ++LSNN+F    P   A+L
Sbjct  248  LTGEIPPEIGNLQNLDTLFLQVNGLSGSLTPELGNLKSLKSMDLSNNMFSGEIPPSFAEL  307

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             N+ +L+L+ N LTG +P  + ++  L  L L  N F+G IP   G   NL+ + VS N 
Sbjct  308  KNMTLLNLFRNKLTGSIPDFIGELPELEVLQLWENNFTGIIPQSLGTNGNLQEVDVSSNK  367

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P  + N  +L+ L I   N   G IP  +G    L R
Sbjct  368  LTGNLPPNLCNGNQLRTL-ITLGNFLFGPIPESLGQCKSLTR  408


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 87/172 (51%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L+P++G L  L ++ ++ N  SG +PP  + +  +  LNL  N    + P  + +L
Sbjct  272  LSGSLTPELGNLKSLKSMDLSNNMFSGEIPPSFAELKNMTLLNLFRNKLTGSIPDFIGEL  331

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L+VL L+ NN TG +P  +    +L+ + +  N  +G +PP       L  L   GN 
Sbjct  332  PELEVLQLWENNFTGIIPQSLGTNGNLQEVDVSSNKLTGNLPPNLCNGNQLRTLITLGNF  391

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            L G IP  +G    L  + +G  N  +G IP  + +L +L + +  +  L+G
Sbjct  392  LFGPIPESLGQCKSLTRIRMGE-NYLNGSIPKGLLSLPKLTQVELQDNLLSG  442


 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 51/160 (32%), Positives = 83/160 (52%), Gaps = 1/160 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
             +G +  ++G L  LV L  A   L+G +PPEI  +  L  L L  N    +   +L  L
Sbjct  224  FTGGMPKEIGNLSQLVRLDAANCGLTGEIPPEIGNLQNLDTLFLQVNGLSGSLTPELGNL  283

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             +L+ +DL NN  +G++P    ++ ++  L+L  N  +G IP   G  P LE L +  N 
Sbjct  284  KSLKSMDLSNNMFSGEIPPSFAELKNMTLLNLFRNKLTGSIPDFIGELPELEVLQLWENN  343

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQL  568
             +G+IP  +G    L+E+ +   N  +G +PP + N +QL
Sbjct  344  FTGIIPQSLGTNGNLQEVDVSS-NKLTGNLPPNLCNGNQL  382


 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 83/174 (48%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P++     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  367  KLTGNLPPNLCNGNQLRTLITLGNFLFGPIPESLGQCKSLTRIRMGENYLNGSIPKGLLS  426

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N L+G  P      TSL  + L  N+ +G +PP  G F  ++ L + GN
Sbjct  427  LPKLTQVELQDNLLSGTFPETDGLSTSLGQISLSDNHLTGPLPPSIGNFVGVQKLLLDGN  486

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              SG IP+EIG L +L ++   + N  +G I PE+     L   D +   L+G+
Sbjct  487  KFSGRIPAEIGKLQQLSKMDFSH-NELTGLIAPEISQCKLLTFVDLSRNQLSGD  539


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 76/154 (49%), Gaps = 1/154 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L G +   +GQ   L  + +  N L+G +P  + ++  L  + L +N+   TFP      
Sbjct  392  LFGPIPESLGQCKSLTRIRMGENYLNGSIPKGLLSLPKLTQVELQDNLLSGTFPETDGLS  451

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             +L  + L +N+LTG LP  +     ++ L L GN FSGRIP E G+   L  +  S N 
Sbjct  452  TSLGQISLSDNHLTGPLPPSIGNFVGVQKLLLDGNKFSGRIPAEIGKLQQLSKMDFSHNE  511

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            L+G+I  EI     L  + +   N  SG IP E+
Sbjct  512  LTGLIAPEISQCKLLTFVDLSR-NQLSGDIPTEI  544


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 72/151 (48%), Gaps = 1/151 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG      G    L  +S++ N L+GP+PP I     ++ L L  N F    P ++ +L
Sbjct  440  LSGTFPETDGLSTSLGQISLSDNHLTGPLPPSIGNFVGVQKLLLDGNKFSGRIPAEIGKL  499

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  +D  +N LTG +  E+ +   L  + L  N  SG IP E      L YL +S N 
Sbjct  500  QQLSKMDFSHNELTGLIAPEISQCKLLTFVDLSRNQLSGDIPTEITGMRILNYLNLSRNH  559

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            L G IPS I ++  L  +   Y N  SG +P
Sbjct  560  LVGSIPSSIASMQSLTSVDFSY-NNLSGLVP  589


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 65/127 (51%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            +L+G L P +G    +  L +  N+ SG +P EI  +  L  ++ S+N        +++Q
Sbjct  463  HLTGPLPPSIGNFVGVQKLLLDGNKFSGRIPAEIGKLQQLSKMDFSHNELTGLIAPEISQ  522

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  +DL  N L+GD+P E+  M  L +L+L  N+  G IP       +L  +  S N
Sbjct  523  CKLLTFVDLSRNQLSGDIPTEITGMRILNYLNLSRNHLVGSIPSSIASMQSLTSVDFSYN  582

Query  446  GLSGVIP  466
             LSG++P
Sbjct  583  NLSGLVP  589



>ref|XP_008344369.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1 [Malus domestica]
Length=1015

 Score =   276 bits (706),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 141/201 (70%), Positives = 160/201 (80%), Gaps = 1/201 (0%)
 Frame = +2

Query  8    STSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPE  184
            +TSHCTW  VTCDS    V+      L+L+G LSPD+  L FL NL++A NQ SGP+PPE
Sbjct  49   TTSHCTWSGVTCDSSRRYVTSLDLSGLDLTGTLSPDLAHLRFLANLTLADNQFSGPIPPE  108

Query  185  ISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHL  364
            ISA+S LR LNLSNN+F +TFP +L+ L  L VLDLYNNNLTGDLPV V  MTSLRHLHL
Sbjct  109  ISALSGLRLLNLSNNVFNTTFPXKLSNLTRLTVLDLYNNNLTGDLPVSVTHMTSLRHLHL  168

Query  365  GGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPP  544
            GGN+FSG+IPPE+GRFP LEYLAVSGN L G IP EIGNLT LKELYIGYFN + GGIPP
Sbjct  169  GGNFFSGQIPPEFGRFPFLEYLAVSGNELGGPIPPEIGNLTTLKELYIGYFNSYEGGIPP  228

Query  545  EMGNLSQLIRXDAANCGLTGE  607
            E+GNLS L+R DAANC LTGE
Sbjct  229  EIGNLSNLVRFDAANCNLTGE  249


 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 57/173 (33%), Positives = 92/173 (53%), Gaps = 1/173 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            NL+G + P++G+L  +  L +  N LSG + PE+  + +L+ ++LSNN+F    P   ++
Sbjct  245  NLTGEVPPELGRLQNVDTLFLQVNALSGSLTPELGYLKSLKSMDLSNNVFTGEIPGSFSE  304

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L NL +L+L+ N L G +P  +  +  L+ L L  N F+G IP   G+   L+ L +S N
Sbjct  305  LKNLTLLNLFRNRLHGAIPDFIGDLPELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSN  364

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             L+G +P ++     L+ L I   N   G IP  +G    L R    +  L G
Sbjct  365  KLTGTLPPDMCFGNNLQTL-ITLSNFLFGPIPESLGRCDSLSRIRMGDNYLNG  416


 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 82/174 (47%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L PD+     L  L   +N L GP+P  +    +L  + + +N    + P  L  
Sbjct  365  KLTGTLPPDMCFGNNLQTLITLSNFLFGPIPESLGRCDSLSRIRMGDNYLNGSIPKGLLS  424

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N L G  P       +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  425  LPKLTQVELQDNLLDGSFPETDSISGNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGN  484

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              SG IP EIG L +L ++   + N F G I PE+ +   L   D +   L+GE
Sbjct  485  KFSGRIPPEIGRLQQLSKIDFKH-NKFMGSITPEISHCKLLTFVDLSRNELSGE  537


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 81/162 (50%), Gaps = 4/162 (2%)
 Frame = +2

Query  95   GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  274
            G + P++G L  LV    A   L+G VPPE+  +  +  L L  N    +   +L  L +
Sbjct  224  GGIPPEIGNLSNLVRFDAANCNLTGEVPPELGRLQNVDTLFLQVNALSGSLTPELGYLKS  283

Query  275  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  454
            L+ +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P L+ L +  N  +
Sbjct  284  LKSMDLSNNVFTGEIPGSFSELKNLTLLNLFRNRLHGAIPDFIGDLPELQVLQLWENNFT  343

Query  455  GVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM---GNLSQLI  571
            G IP  +G   KL+ L +   N  +G +PP+M    NL  LI
Sbjct  344  GSIPQGLGKNGKLQILDLSS-NKLTGTLPPDMCFGNNLQTLI  384


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 89/166 (54%), Gaps = 3/166 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +G +   +G+   L  L +++N+L+G +PP++   + L+  + LSN +FG   P  L 
Sbjct  341  NFTGSIPQGLGKNGKLQILDLSSNKLTGTLPPDMCFGNNLQTLITLSNFLFGP-IPESLG  399

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            +  +L  + + +N L G +P  +  +  L  + L  N   G  P       NL  +++S 
Sbjct  400  RCDSLSRIRMGDNYLNGSIPKGLLSLPKLTQVELQDNLLDGSFPETDSISGNLGQISLSN  459

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXD  580
            N LSG +P  IGN + +++L +   N FSG IPPE+G L QL + D
Sbjct  460  NRLSGSLPPTIGNFSGVQKLLLDG-NKFSGRIPPEIGRLQQLSKID  504


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 85/196 (43%), Gaps = 25/196 (13%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L +N+   +FP   +  
Sbjct  390  LFGPIPESLGRCDSLSRIRMGDNYLNGSIPKGLLSLPKLTQVELQDNLLDGSFPETDSIS  449

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLE--------  424
             NL  + L NN L+G LP  +   + ++ L L GN FSGRIPPE GR   L         
Sbjct  450  GNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFKHNK  509

Query  425  ----------------YLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  556
                            ++ +S N LSG IP E   +  L  L +   N   G IP  +  
Sbjct  510  FMGSITPEISHCKLLTFVDLSRNELSGEIPKEXTGMRILNYLNLSR-NHLVGSIPSSIST  568

Query  557  LSQLIRXDAANCGLTG  604
            +  L   D +   L+G
Sbjct  569  MQSLTSVDFSYNNLSG  584


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L P +G    +  L +  N+ SG +PPEI  +  L  ++  +N F  +   +++  
Sbjct  462  LSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFKHNKFMGSITPEISHC  521

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  +DL  N L+G++P E   M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  522  KLLTFVDLSRNELSGEIPKEXTGMRILNYLNLSRNHLVGSIPSSISTMQSLTSVDFSYNN  581

Query  449  LSGVIP  466
            LSG++P
Sbjct  582  LSGLVP  587


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 65/137 (47%), Gaps = 1/137 (1%)
 Frame = +2

Query  131  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  310
            L  +S++ N+LSG +PP I   S ++ L L  N F    P ++ +L  L  +D  +N   
Sbjct  452  LGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFKHNKFM  511

Query  311  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTK  490
            G +  E+     L  + L  N  SG IP E      L YL +S N L G IPS I  +  
Sbjct  512  GSITPEISHCKLLTFVDLSRNELSGEIPKEXTGMRILNYLNLSRNHLVGSIPSSISTMQS  571

Query  491  LKELYIGYFNGFSGGIP  541
            L  +   Y N  SG +P
Sbjct  572  LTSVDFSY-NNLSGLVP  587



>ref|XP_008354741.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Malus domestica]
Length=1015

 Score =   276 bits (705),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 141/201 (70%), Positives = 160/201 (80%), Gaps = 1/201 (0%)
 Frame = +2

Query  8    STSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPE  184
            +TSHCTW  VTCDS    V+      L+L+G LSPD+  L FL NL++A NQ SGP+PPE
Sbjct  49   TTSHCTWSGVTCDSSRRYVTSLDLSGLDLTGTLSPDLAHLRFLANLTLADNQFSGPIPPE  108

Query  185  ISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHL  364
            ISA+S LR LNLSNN+F +TFP +L+ L  L VLDLYNNNLTGDLPV V  MTSLRHLHL
Sbjct  109  ISALSGLRLLNLSNNVFNTTFPPKLSNLTRLTVLDLYNNNLTGDLPVSVTHMTSLRHLHL  168

Query  365  GGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPP  544
            GGN+FSG+IPPE+GRFP LEYLAVSGN L G IP EIGNLT LKELYIGYFN + GGIPP
Sbjct  169  GGNFFSGQIPPEFGRFPFLEYLAVSGNELGGPIPPEIGNLTTLKELYIGYFNSYEGGIPP  228

Query  545  EMGNLSQLIRXDAANCGLTGE  607
            E+GNLS L+R DAANC LTGE
Sbjct  229  EIGNLSNLVRFDAANCNLTGE  249


 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 57/173 (33%), Positives = 92/173 (53%), Gaps = 1/173 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            NL+G + P++G+L  +  L +  N LSG + PE+  + +L+ ++LSNN+F    P   ++
Sbjct  245  NLTGEVPPELGRLQNVDTLFLQVNALSGSLTPELGYLKSLKSMDLSNNVFTGEIPGSFSE  304

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L NL +L+L+ N L G +P  +  +  L+ L L  N F+G IP   G+   L+ L +S N
Sbjct  305  LKNLTLLNLFRNRLHGAIPDFIGDLPELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSN  364

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             L+G +P ++     L+ L I   N   G IP  +G    L R    +  L G
Sbjct  365  KLTGTLPPDMCFGNNLQTL-ITLSNFLFGPIPESLGRCDSLSRIRMGDNYLNG  416


 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 82/174 (47%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L PD+     L  L   +N L GP+P  +    +L  + + +N    + P  L  
Sbjct  365  KLTGTLPPDMCFGNNLQTLITLSNFLFGPIPESLGRCDSLSRIRMGDNYLNGSIPKGLLS  424

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N L G  P       +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  425  LPKLTQVELQDNLLDGSFPETDSISGNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGN  484

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              SG IP EIG L +L ++   + N F G I PE+ +   L   D +   L+GE
Sbjct  485  KFSGRIPPEIGRLQQLSKIDFKH-NKFMGSITPEISHCKLLTFVDLSRNELSGE  537


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 81/162 (50%), Gaps = 4/162 (2%)
 Frame = +2

Query  95   GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  274
            G + P++G L  LV    A   L+G VPPE+  +  +  L L  N    +   +L  L +
Sbjct  224  GGIPPEIGNLSNLVRFDAANCNLTGEVPPELGRLQNVDTLFLQVNALSGSLTPELGYLKS  283

Query  275  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  454
            L+ +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P L+ L +  N  +
Sbjct  284  LKSMDLSNNVFTGEIPGSFSELKNLTLLNLFRNRLHGAIPDFIGDLPELQVLQLWENNFT  343

Query  455  GVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM---GNLSQLI  571
            G IP  +G   KL+ L +   N  +G +PP+M    NL  LI
Sbjct  344  GSIPQGLGKNGKLQILDLSS-NKLTGTLPPDMCFGNNLQTLI  384


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 89/166 (54%), Gaps = 3/166 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +G +   +G+   L  L +++N+L+G +PP++   + L+  + LSN +FG   P  L 
Sbjct  341  NFTGSIPQGLGKNGKLQILDLSSNKLTGTLPPDMCFGNNLQTLITLSNFLFGP-IPESLG  399

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            +  +L  + + +N L G +P  +  +  L  + L  N   G  P       NL  +++S 
Sbjct  400  RCDSLSRIRMGDNYLNGSIPKGLLSLPKLTQVELQDNLLDGSFPETDSISGNLGQISLSN  459

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXD  580
            N LSG +P  IGN + +++L +   N FSG IPPE+G L QL + D
Sbjct  460  NRLSGSLPPTIGNFSGVQKLLLDG-NKFSGRIPPEIGRLQQLSKID  504


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 85/196 (43%), Gaps = 25/196 (13%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L +N+   +FP   +  
Sbjct  390  LFGPIPESLGRCDSLSRIRMGDNYLNGSIPKGLLSLPKLTQVELQDNLLDGSFPETDSIS  449

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLE--------  424
             NL  + L NN L+G LP  +   + ++ L L GN FSGRIPPE GR   L         
Sbjct  450  GNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFKHNK  509

Query  425  ----------------YLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  556
                            ++ +S N LSG IP E   +  L  L +   N   G IP  +  
Sbjct  510  FMGSITPEISHCKLLTFVDLSRNELSGEIPKEXTGMRILNYLNLSR-NHLVGSIPSSIST  568

Query  557  LSQLIRXDAANCGLTG  604
            +  L   D +   L+G
Sbjct  569  MQSLTSVDFSYNNLSG  584


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L P +G    +  L +  N+ SG +PPEI  +  L  ++  +N F  +   +++  
Sbjct  462  LSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFKHNKFMGSITPEISHC  521

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  +DL  N L+G++P E   M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  522  KLLTFVDLSRNELSGEIPKEXTGMRILNYLNLSRNHLVGSIPSSISTMQSLTSVDFSYNN  581

Query  449  LSGVIP  466
            LSG++P
Sbjct  582  LSGLVP  587


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 65/137 (47%), Gaps = 1/137 (1%)
 Frame = +2

Query  131  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  310
            L  +S++ N+LSG +PP I   S ++ L L  N F    P ++ +L  L  +D  +N   
Sbjct  452  LGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFKHNKFM  511

Query  311  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTK  490
            G +  E+     L  + L  N  SG IP E      L YL +S N L G IPS I  +  
Sbjct  512  GSITPEISHCKLLTFVDLSRNELSGEIPKEXTGMRILNYLNLSRNHLVGSIPSSISTMQS  571

Query  491  LKELYIGYFNGFSGGIP  541
            L  +   Y N  SG +P
Sbjct  572  LTSVDFSY-NNLSGLVP  587



>ref|XP_009354585.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Pyrus x bretschneideri]
Length=1014

 Score =   275 bits (703),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 140/201 (70%), Positives = 160/201 (80%), Gaps = 1/201 (0%)
 Frame = +2

Query  8    STSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPE  184
            +TSHCTW  VTCDS    V+      L+L+G LSPD+  L FL NL++A NQ SGP+PP+
Sbjct  48   TTSHCTWSGVTCDSSRRYVTSLDLSGLDLTGTLSPDLAHLRFLSNLTLAENQFSGPIPPD  107

Query  185  ISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHL  364
            ISA+S LR LNLSNN+F +TFP QL+ L  L VLDLYNNNLTGDLPV V  MTSLRHLHL
Sbjct  108  ISALSGLRLLNLSNNVFNTTFPPQLSNLTRLTVLDLYNNNLTGDLPVSVTHMTSLRHLHL  167

Query  365  GGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPP  544
            GGN+FSG+IPPE+GRFP LEYLAVSGN L G IP EIGNLT LKELYIGYFN + GG+PP
Sbjct  168  GGNFFSGQIPPEFGRFPFLEYLAVSGNELGGSIPPEIGNLTTLKELYIGYFNSYEGGMPP  227

Query  545  EMGNLSQLIRXDAANCGLTGE  607
            E+GNLS L+R DAANC LTGE
Sbjct  228  EIGNLSNLVRFDAANCNLTGE  248


 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 57/173 (33%), Positives = 92/173 (53%), Gaps = 1/173 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            NL+G + P++G+L  +  L +  N LSG + PE+  + +L+ ++LSNN+F    P   ++
Sbjct  244  NLTGEVPPELGRLQNVDTLFLQVNALSGSLTPELGYLKSLKSMDLSNNMFTGEIPGSFSE  303

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L NL +L+L+ N L G +P  +  +  L+ L L  N F+G IP   G+   L+ L +S N
Sbjct  304  LKNLTLLNLFRNRLHGAIPEFIGDLPELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSN  363

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             L+G +P ++     L+ L I   N   G IP  +G    L R    +  L G
Sbjct  364  KLTGTLPPDMCFGNSLQTL-ITLSNFLFGPIPESLGRCDSLSRIRMGDNFLNG  415


 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 81/174 (47%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L PD+     L  L   +N L GP+P  +    +L  + + +N    + P  L  
Sbjct  364  KLTGTLPPDMCFGNSLQTLITLSNFLFGPIPESLGRCDSLSRIRMGDNFLNGSIPKGLFS  423

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N L G  P       +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  424  LPKLTQVELQDNLLDGSFPETDTISGNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGN  483

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              SG IP EIG L +L ++   + N F G I PE+     L   D +   L+GE
Sbjct  484  KFSGRIPPEIGRLQQLSKMDFKH-NKFMGSITPEISQCKLLTFVDLSRNELSGE  536


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 91/166 (55%), Gaps = 3/166 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +G +   +G+   L  L +++N+L+G +PP++   ++L+  + LSN +FG   P  L 
Sbjct  340  NFTGSIPQGLGKNGKLQILDLSSNKLTGTLPPDMCFGNSLQTLITLSNFLFGP-IPESLG  398

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            +  +L  + + +N L G +P  ++ +  L  + L  N   G  P       NL  +++S 
Sbjct  399  RCDSLSRIRMGDNFLNGSIPKGLFSLPKLTQVELQDNLLDGSFPETDTISGNLGQISLSN  458

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXD  580
            N LSG +P  IGN + +++L +   N FSG IPPE+G L QL + D
Sbjct  459  NRLSGSLPPTIGNFSGVQKLLLDG-NKFSGRIPPEIGRLQQLSKMD  503


 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 50/152 (33%), Positives = 77/152 (51%), Gaps = 1/152 (1%)
 Frame = +2

Query  95   GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  274
            G + P++G L  LV    A   L+G VPPE+  +  +  L L  N    +   +L  L +
Sbjct  223  GGMPPEIGNLSNLVRFDAANCNLTGEVPPELGRLQNVDTLFLQVNALSGSLTPELGYLKS  282

Query  275  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  454
            L+ +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P L+ L +  N  +
Sbjct  283  LKSMDLSNNMFTGEIPGSFSELKNLTLLNLFRNRLHGAIPEFIGDLPELQVLQLWENNFT  342

Query  455  GVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            G IP  +G   KL+ L +   N  +G +PP+M
Sbjct  343  GSIPQGLGKNGKLQILDLSS-NKLTGTLPPDM  373


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 66/126 (52%), Gaps = 0/126 (0%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L P +G    +  L +  N+ SG +PPEI  +  L  ++  +N F  +   +++Q 
Sbjct  461  LSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKMDFKHNKFMGSITPEISQC  520

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  521  KLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNHLFGSIPSSISTMQSLTSVDFSYNN  580

Query  449  LSGVIP  466
            LSG++P
Sbjct  581  LSGLVP  586


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 56/196 (29%), Positives = 86/196 (44%), Gaps = 25/196 (13%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L +N+   +FP      
Sbjct  389  LFGPIPESLGRCDSLSRIRMGDNFLNGSIPKGLFSLPKLTQVELQDNLLDGSFPETDTIS  448

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLE--------  424
             NL  + L NN L+G LP  +   + ++ L L GN FSGRIPPE GR   L         
Sbjct  449  GNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKMDFKHNK  508

Query  425  ----------------YLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  556
                            ++ +S N LSG IP+EI  +  L  L +   N   G IP  +  
Sbjct  509  FMGSITPEISQCKLLTFVDLSRNELSGEIPNEITGMRILNYLNLSR-NHLFGSIPSSIST  567

Query  557  LSQLIRXDAANCGLTG  604
            +  L   D +   L+G
Sbjct  568  MQSLTSVDFSYNNLSG  583


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 66/137 (48%), Gaps = 1/137 (1%)
 Frame = +2

Query  131  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  310
            L  +S++ N+LSG +PP I   S ++ L L  N F    P ++ +L  L  +D  +N   
Sbjct  451  LGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKMDFKHNKFM  510

Query  311  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTK  490
            G +  E+ +   L  + L  N  SG IP E      L YL +S N L G IPS I  +  
Sbjct  511  GSITPEISQCKLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNHLFGSIPSSISTMQS  570

Query  491  LKELYIGYFNGFSGGIP  541
            L  +   Y N  SG +P
Sbjct  571  LTSVDFSY-NNLSGLVP  586



>ref|XP_008393812.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Malus domestica]
Length=1014

 Score =   275 bits (702),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 140/201 (70%), Positives = 159/201 (79%), Gaps = 1/201 (0%)
 Frame = +2

Query  8    STSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPE  184
            +TSHCTW  VTCDS    V+      L+L+G LSPD+  L FL NL++A NQ SGP+PP+
Sbjct  48   TTSHCTWSGVTCDSSRRYVTSLDLSGLDLTGTLSPDLAHLRFLSNLTLAENQFSGPIPPD  107

Query  185  ISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHL  364
            ISA+S LR LNLSNN+F +TFP QL+ L  L VLDLYNNNLTG LPV V  MTSLRHLHL
Sbjct  108  ISALSGLRLLNLSNNVFNTTFPRQLSNLTRLTVLDLYNNNLTGKLPVSVTHMTSLRHLHL  167

Query  365  GGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPP  544
            GGN+FSG+IPPE+GRFP LEYLAVSGN L G IP EIGNLT LKELYIGYFN + GGIPP
Sbjct  168  GGNFFSGQIPPEFGRFPFLEYLAVSGNELGGSIPPEIGNLTTLKELYIGYFNSYEGGIPP  227

Query  545  EMGNLSQLIRXDAANCGLTGE  607
            E+GNLS L+R DAANC LTGE
Sbjct  228  EIGNLSNLVRFDAANCNLTGE  248


 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 92/173 (53%), Gaps = 1/173 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            NL+G + P++G+L  +  L +  N LSG + PE+  + +L+ ++LSNN++    P   ++
Sbjct  244  NLTGEVPPELGRLQNVDTLFLQVNALSGWLTPELGYLKSLKSMDLSNNMYTGEIPGSFSE  303

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L NL +L+L+ N L G +P  +  +  L+ L L  N F+G IP   G+   L+ L +S N
Sbjct  304  LKNLTLLNLFRNRLHGAIPEFIGDLPELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSN  363

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             L+G +P ++     L+ L I   N   G IP  +G    L R    +  L G
Sbjct  364  KLTGTLPPDMCFGNSLQTL-ITLSNFLFGPIPESLGRCDSLSRIRMGDNFLNG  415


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 81/174 (47%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L PD+     L  L   +N L GP+P  +    +L  + + +N    + P  L  
Sbjct  364  KLTGTLPPDMCFGNSLQTLITLSNFLFGPIPESLGRCDSLSRIRMGDNFLNGSIPKGLFX  423

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N L G  P       +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  424  LPKLTQVELQDNLLDGSFPETDTISGNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGN  483

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              SG IP EIG L +L ++   + N F G I PE+     L   D +   L+GE
Sbjct  484  KFSGRIPPEIGRLQQLSKMDFKH-NKFMGSITPEISLCKLLTFVDLSRNELSGE  536


 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 91/166 (55%), Gaps = 3/166 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +G +   +G+   L  L +++N+L+G +PP++   ++L+  + LSN +FG   P  L 
Sbjct  340  NFTGSIPQGLGKNGKLQILDLSSNKLTGTLPPDMCFGNSLQTLITLSNFLFGP-IPESLG  398

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            +  +L  + + +N L G +P  ++ +  L  + L  N   G  P       NL  +++S 
Sbjct  399  RCDSLSRIRMGDNFLNGSIPKGLFXLPKLTQVELQDNLLDGSFPETDTISGNLGQISLSN  458

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXD  580
            N LSG +P  IGN + +++L +   N FSG IPPE+G L QL + D
Sbjct  459  NRLSGSLPPTIGNFSGVQKLLLDG-NKFSGRIPPEIGRLQQLSKMD  503


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 50/152 (33%), Positives = 76/152 (50%), Gaps = 1/152 (1%)
 Frame = +2

Query  95   GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  274
            G + P++G L  LV    A   L+G VPPE+  +  +  L L  N        +L  L +
Sbjct  223  GGIPPEIGNLSNLVRFDAANCNLTGEVPPELGRLQNVDTLFLQVNALSGWLTPELGYLKS  282

Query  275  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  454
            L+ +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P L+ L +  N  +
Sbjct  283  LKSMDLSNNMYTGEIPGSFSELKNLTLLNLFRNRLHGAIPEFIGDLPELQVLQLWENNFT  342

Query  455  GVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            G IP  +G   KL+ L +   N  +G +PP+M
Sbjct  343  GSIPQGLGKNGKLQILDLSS-NKLTGTLPPDM  373


 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 56/196 (29%), Positives = 84/196 (43%), Gaps = 25/196 (13%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N+   +FP      
Sbjct  389  LFGPIPESLGRCDSLSRIRMGDNFLNGSIPKGLFXLPKLTQVELQDNLLDGSFPETDTIS  448

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLE--------  424
             NL  + L NN L+G LP  +   + ++ L L GN FSGRIPPE GR   L         
Sbjct  449  GNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKMDFKHNK  508

Query  425  ----------------YLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  556
                            ++ +S N LSG IP EI  +  L  L +   N   G IP  +  
Sbjct  509  FMGSITPEISLCKLLTFVDLSRNELSGEIPKEITGMRILNYLNLSR-NHLXGSIPSSIST  567

Query  557  LSQLIRXDAANCGLTG  604
            +  L   D +   L+G
Sbjct  568  MQSLTSVDFSYNNLSG  583


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 65/126 (52%), Gaps = 0/126 (0%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L P +G    +  L +  N+ SG +PPEI  +  L  ++  +N F  +   +++  
Sbjct  461  LSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKMDFKHNKFMGSITPEISLC  520

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  521  KLLTFVDLSRNELSGEIPKEITGMRILNYLNLSRNHLXGSIPSSISTMQSLTSVDFSYNN  580

Query  449  LSGVIP  466
            LSG++P
Sbjct  581  LSGLVP  586


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 65/137 (47%), Gaps = 1/137 (1%)
 Frame = +2

Query  131  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  310
            L  +S++ N+LSG +PP I   S ++ L L  N F    P ++ +L  L  +D  +N   
Sbjct  451  LGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKMDFKHNKFM  510

Query  311  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTK  490
            G +  E+     L  + L  N  SG IP E      L YL +S N L G IPS I  +  
Sbjct  511  GSITPEISLCKLLTFVDLSRNELSGEIPKEITGMRILNYLNLSRNHLXGSIPSSISTMQS  570

Query  491  LKELYIGYFNGFSGGIP  541
            L  +   Y N  SG +P
Sbjct  571  LTSVDFSY-NNLSGLVP  586



>ref|XP_004234641.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Solanum lycopersicum]
Length=1022

 Score =   272 bits (696),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 142/202 (70%), Positives = 165/202 (82%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPP  181
            NISTSHCTWR VTCD   HV SLD+SG NL+G L+P+VG L FL+NLS+A NQ SGP+P 
Sbjct  53   NISTSHCTWRGVTCDRYRHVTSLDISGFNLTGTLTPEVGHLRFLLNLSVAVNQFSGPIPV  112

Query  182  EISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLH  361
            E+S I  LR+LNLSNNIF  +FP QL  L  L VLD+YNNN+TG+LPV  Y +T+LRHLH
Sbjct  113  ELSFIPNLRYLNLSNNIFNLSFPPQLTHLRYLNVLDIYNNNMTGELPVGFYNLTNLRHLH  172

Query  362  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            LGGN+FSG IPPEYGRFP LEYLAVSGN L G IP EIGN+T L+ELYIGY+N FSGG+P
Sbjct  173  LGGNFFSGSIPPEYGRFPFLEYLAVSGNALVGRIPPEIGNITTLRELYIGYYNTFSGGLP  232

Query  542  PEMGNLSQLIRXDAANCGLTGE  607
             E+G LS+LIR DAANCGL+GE
Sbjct  233  AEIGYLSELIRLDAANCGLSGE  254


 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 85/162 (52%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P++G+L  L  L +  N LSG V PE+  + +L+ L+LSNN+     P    +L
Sbjct  251  LSGEIPPEIGKLQKLDTLFLQVNGLSGSVTPELGNLKSLKSLDLSNNMLSGEIPLTFTEL  310

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  +  M  L  L L  N F+G IP   G+   L  + +S N 
Sbjct  311  KNLTLLNLFRNKLYGSMPEFIEDMPKLEVLQLWENNFTGSIPQGLGKNSKLTNVDISTNK  370

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P  + +  KL+ L I   N   G IP  +G    L R
Sbjct  371  LTGNLPPNMCSGNKLQTL-ITLGNFLFGPIPESLGECQSLNR  411


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 82/174 (47%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P++     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  370  KLTGNLPPNMCSGNKLQTLITLGNFLFGPIPESLGECQSLNRIRMGENFLNGSIPKGLLS  429

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N LTG  PV      SL  + L  N F+G +P   G F  ++ L + GN
Sbjct  430  LPKLSQVELQDNLLTGTFPVTDSVSASLGQICLSNNRFTGPLPSSIGNFTAVQKLLLDGN  489

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              SG IP E+G L +L ++     N FSG IPPE+     L   D +   L+GE
Sbjct  490  KFSGQIPGELGKLQQLSKMDFSG-NSFSGLIPPEISRCKALTYVDLSRNKLSGE  542


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 88/172 (51%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG ++P++G L  L +L ++ N LSG +P   + +  L  LNL  N    + P  +  +
Sbjct  275  LSGSVTPELGNLKSLKSLDLSNNMLSGEIPLTFTELKNLTLLNLFRNKLYGSMPEFIEDM  334

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L+VL L+ NN TG +P  + K + L ++ +  N  +G +PP       L+ L   GN 
Sbjct  335  PKLEVLQLWENNFTGSIPQGLGKNSKLTNVDISTNKLTGNLPPNMCSGNKLQTLITLGNF  394

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            L G IP  +G    L  + +G  N  +G IP  + +L +L + +  +  LTG
Sbjct  395  LFGPIPESLGECQSLNRIRMGE-NFLNGSIPKGLLSLPKLSQVELQDNLLTG  445


 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 85/172 (49%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L +N+   TFP   +  
Sbjct  395  LFGPIPESLGECQSLNRIRMGENFLNGSIPKGLLSLPKLSQVELQDNLLTGTFPVTDSVS  454

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
            A+L  + L NN  TG LP  +   T+++ L L GN FSG+IP E G+   L  +  SGN 
Sbjct  455  ASLGQICLSNNRFTGPLPSSIGNFTAVQKLLLDGNKFSGQIPGELGKLQQLSKMDFSGNS  514

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             SG+IP EI     L  + +   N  SG +P E+  +  L   + +   L G
Sbjct  515  FSGLIPPEISRCKALTYVDLSR-NKLSGEVPTEITGMRILNYLNVSRNQLVG  565


 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 78/154 (51%), Gaps = 1/154 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
             SG L  ++G L  L+ L  A   LSG +PPEI  +  L  L L  N    +   +L  L
Sbjct  227  FSGGLPAEIGYLSELIRLDAANCGLSGEIPPEIGKLQKLDTLFLQVNGLSGSVTPELGNL  286

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             +L+ LDL NN L+G++P+   ++ +L  L+L  N   G +P      P LE L +  N 
Sbjct  287  KSLKSLDLSNNMLSGEIPLTFTELKNLTLLNLFRNKLYGSMPEFIEDMPKLEVLQLWENN  346

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
             +G IP  +G  +KL  + I   N  +G +PP M
Sbjct  347  FTGSIPQGLGKNSKLTNVDIST-NKLTGNLPPNM  379


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 52/174 (30%), Positives = 89/174 (51%), Gaps = 3/174 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +G +   +G+   L N+ I+ N+L+G +PP + + + L+  + L N +FG   P  L 
Sbjct  346  NFTGSIPQGLGKNSKLTNVDISTNKLTGNLPPNMCSGNKLQTLITLGNFLFGP-IPESLG  404

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            +  +L  + +  N L G +P  +  +  L  + L  N  +G  P       +L  + +S 
Sbjct  405  ECQSLNRIRMGENFLNGSIPKGLLSLPKLSQVELQDNLLTGTFPVTDSVSASLGQICLSN  464

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            N  +G +PS IGN T +++L +   N FSG IP E+G L QL + D +    +G
Sbjct  465  NRFTGPLPSSIGNFTAVQKLLLDG-NKFSGQIPGELGKLQQLSKMDFSGNSFSG  517


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 57/120 (48%), Gaps = 1/120 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
              SG +  ++G+L  L  +  + N  SG +PPEIS    L +++LS N      P ++  
Sbjct  490  KFSGQIPGELGKLQQLSKMDFSGNSFSGLIPPEISRCKALTYVDLSRNKLSGEVPTEITG  549

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            +  L  L++  N L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  550  MRILNYLNVSRNQLVGSIPAPIAAMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFIGN  608



>ref|XP_004288299.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Fragaria vesca subsp. vesca]
Length=1023

 Score =   271 bits (692),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 144/199 (72%), Positives = 164/199 (82%), Gaps = 0/199 (0%)
 Frame = +2

Query  11   TSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEIS  190
            TSHCTW  VTCDS  HV SLDLSGLNLSG LSPD+  L +L NL++A N LSGP+PPEIS
Sbjct  60   TSHCTWAGVTCDSHNHVTSLDLSGLNLSGYLSPDIAFLVYLSNLTLAENNLSGPIPPEIS  119

Query  191  AISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGG  370
            A+  LR LNLSNN+F  TFP +L+ L NL+VLDLYNNNLTG LPV V  MT+LRHLHLGG
Sbjct  120  ALPALRLLNLSNNVFNRTFPPELSNLTNLRVLDLYNNNLTGVLPVSVTHMTNLRHLHLGG  179

Query  371  NYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            N+F G IPPEYG+FP LEYLAVSGN ++G IP EIGNLT+LKELYIGYFN + GGIP E+
Sbjct  180  NFFEGSIPPEYGQFPFLEYLAVSGNSITGKIPKEIGNLTRLKELYIGYFNSYDGGIPAEI  239

Query  551  GNLSQLIRXDAANCGLTGE  607
            GNL+QLIR DAANC L+GE
Sbjct  240  GNLTQLIRFDAANCNLSGE  258


 Score = 89.7 bits (221),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 56/163 (34%), Positives = 90/163 (55%), Gaps = 1/163 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            NLSG + P++G+L  +  L +  N LSG +  E+ ++ +L+ ++LSNN+F    P   A+
Sbjct  254  NLSGEIPPELGRLQNVDTLFLQVNALSGSLTSELGSLKSLKSMDLSNNLFSGEIPTSFAE  313

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L NL +L+L+ N L G +P  +  +  L+ L L  N F+G IP   GR   L+ + +S N
Sbjct  314  LKNLTLLNLFRNQLHGAIPDFIGDLPELQVLQLWENNFTGSIPQSLGRNGKLQLVDLSSN  373

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
             L+G +P ++ +   L+ L I   N   G IP  +G    L R
Sbjct  374  KLTGALPPDMCSGNNLQTL-ITLGNFLFGPIPESLGECKSLSR  415


 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 93/197 (47%), Gaps = 26/197 (13%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFL------------------  214
              G + P+ GQ PFL  L+++ N ++G +P EI  ++ L+ L                  
Sbjct  182  FEGSIPPEYGQFPFLEYLAVSGNSITGKIPKEIGNLTRLKELYIGYFNSYDGGIPAEIGN  241

Query  215  -------NLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGN  373
                   + +N       P +L +L N+  L L  N L+G L  E+  + SL+ + L  N
Sbjct  242  LTQLIRFDAANCNLSGEIPPELGRLQNVDTLFLQVNALSGSLTSELGSLKSLKSMDLSNN  301

Query  374  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
             FSG IP  +    NL  L +  N L G IP  IG+L +L+ L + + N F+G IP  +G
Sbjct  302  LFSGEIPTSFAELKNLTLLNLFRNQLHGAIPDFIGDLPELQVLQL-WENNFTGSIPQSLG  360

Query  554  NLSQLIRXDAANCGLTG  604
               +L   D ++  LTG
Sbjct  361  RNGKLQLVDLSSNKLTG  377


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 81/174 (47%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  374  KLTGALPPDMCSGNNLQTLITLGNFLFGPIPESLGECKSLSRIRMGENFLNGSIPKGLFG  433

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N L G  PV       L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  434  LPKLTQVELQDNFLNGPFPVSDSVSAGLGQISLSNNRLSGPLPPAIGNFTGVQKLLLDGN  493

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              SG IP EIG+L +L ++   + N FSG I PE+     L   D +   L+GE
Sbjct  494  KFSGRIPPEIGHLEQLSKIDFSH-NLFSGPIAPEISRCKVLAYVDLSRNELSGE  546


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/174 (30%), Positives = 95/174 (55%), Gaps = 3/174 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +G +   +G+   L  + +++N+L+G +PP++ + + L+  + L N +FG   P  L 
Sbjct  350  NFTGSIPQSLGRNGKLQLVDLSSNKLTGALPPDMCSGNNLQTLITLGNFLFGP-IPESLG  408

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            +  +L  + +  N L G +P  ++ +  L  + L  N+ +G  P        L  +++S 
Sbjct  409  ECKSLSRIRMGENFLNGSIPKGLFGLPKLTQVELQDNFLNGPFPVSDSVSAGLGQISLSN  468

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            N LSG +P  IGN T +++L +   N FSG IPPE+G+L QL + D ++   +G
Sbjct  469  NRLSGPLPPAIGNFTGVQKLLLDG-NKFSGRIPPEIGHLEQLSKIDFSHNLFSG  521


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/163 (31%), Positives = 80/163 (49%), Gaps = 4/163 (2%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
             G +  ++G L  L+    A   LSG +PPE+  +  +  L L  N    +   +L  L 
Sbjct  232  DGGIPAEIGNLTQLIRFDAANCNLSGEIPPELGRLQNVDTLFLQVNALSGSLTSELGSLK  291

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
            +L+ +DL NN  +G++P    ++ +L  L+L  N   G IP   G  P L+ L +  N  
Sbjct  292  SLKSMDLSNNLFSGEIPTSFAELKNLTLLNLFRNQLHGAIPDFIGDLPELQVLQLWENNF  351

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM---GNLSQLI  571
            +G IP  +G   KL+ + +   N  +G +PP+M    NL  LI
Sbjct  352  TGSIPQSLGRNGKLQLVDLSS-NKLTGALPPDMCSGNNLQTLI  393


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 67/126 (53%), Gaps = 0/126 (0%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L P +G    +  L +  N+ SG +PPEI  +  L  ++ S+N+F      ++++ 
Sbjct  471  LSGPLPPAIGNFTGVQKLLLDGNKFSGRIPPEIGHLEQLSKIDFSHNLFSGPIAPEISRC  530

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  531  KVLAYVDLSRNELSGEIPKEITGMRILNYLNLSRNHLVGNIPAPISAMQSLTSVDFSYNN  590

Query  449  LSGVIP  466
            LSG++P
Sbjct  591  LSGLVP  596


 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 78/172 (45%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G +   +  LP L  + +  N L+GP P   S  + L  ++LSNN      P  +   
Sbjct  423  LNGSIPKGLFGLPKLTQVELQDNFLNGPFPVSDSVSAGLGQISLSNNRLSGPLPPAIGNF  482

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              +Q L L  N  +G +P E+  +  L  +    N FSG I PE  R   L Y+ +S N 
Sbjct  483  TGVQKLLLDGNKFSGRIPPEIGHLEQLSKIDFSHNLFSGPIAPEISRCKVLAYVDLSRNE  542

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            LSG IP EI  +  L  L +   N   G IP  +  +  L   D +   L+G
Sbjct  543  LSGEIPKEITGMRILNYLNLSR-NHLVGNIPAPISAMQSLTSVDFSYNNLSG  593



>ref|XP_010268646.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nelumbo nucifera]
Length=1034

 Score =   267 bits (682),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 138/202 (68%), Positives = 168/202 (83%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPP  181
            N+STSHCTW  V+CDS   VVSLDLS +NLSG+LSPDVGQL  L+NL+ AAN  SGP+P 
Sbjct  51   NLSTSHCTWTGVSCDSFNRVVSLDLSNMNLSGILSPDVGQLRNLINLTAAANFFSGPIPS  110

Query  182  EISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLH  361
            EIS IS LR LNLSNN+F  +FP + ++L  L+VLDLYNNN+TGDLPV+V +M +LRHLH
Sbjct  111  EISHISGLRLLNLSNNVFNGSFPSEFSRLKLLEVLDLYNNNMTGDLPVDVSEMPNLRHLH  170

Query  362  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            LGGN+FSGRIP EYGR+  LEYLA+SGN L G IP EIGNLTKL++LY+GY+N + GGIP
Sbjct  171  LGGNFFSGRIPSEYGRWEFLEYLALSGNELGGTIPPEIGNLTKLQQLYLGYYNSYEGGIP  230

Query  542  PEMGNLSQLIRXDAANCGLTGE  607
            PE+GNL++L+R D ANCGL+GE
Sbjct  231  PELGNLTELVRLDMANCGLSGE  252


 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 82/162 (51%), Gaps = 2/162 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            N++G L  DV ++P L +L +  N  SG +P E      L +L LS N  G T P ++  
Sbjct  151  NMTGDLPVDVSEMPNLRHLHLGGNFFSGRIPSEYGRWEFLEYLALSGNELGGTIPPEIGN  210

Query  266  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            L  LQ L L Y N+  G +P E+  +T L  L +     SG IPPE+ +   L+ L +  
Sbjct  211  LTKLQQLYLGYYNSYEGGIPPELGNLTELVRLDMANCGLSGEIPPEFSKLQKLDTLFLQV  270

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQL  568
            NGLSG +  E+G L  LK + +   N  +G IP     L  L
Sbjct  271  NGLSGGLTPELGQLKSLKSMDLSN-NMLAGEIPATFSELKNL  311


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 85/172 (49%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L+P++GQL  L ++ ++ N L+G +P   S +  L  LNL  N      P  +  L
Sbjct  273  LSGGLTPELGQLKSLKSMDLSNNMLAGEIPATFSELKNLTLLNLFRNKLHGAIPDFIGDL  332

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L+VL L+ NN TG +P  + K   L+ L L  N  +G +PP+      L  L   GN 
Sbjct  333  PALEVLQLWENNFTGSIPQGLGKNGRLQLLDLSSNKLTGNLPPDLCFGNRLHTLIALGNF  392

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            L G IP  +G    L  + +G  N  +G IP  + +L  L + +  +  L G
Sbjct  393  LFGPIPESLGRCKSLSRIRMGE-NFLNGTIPKGLFSLPNLAQVELQDNYLVG  443


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 85/162 (52%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P+  +L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P   ++L
Sbjct  249  LSGEIPPEFSKLQKLDTLFLQVNGLSGGLTPELGQLKSLKSMDLSNNMLAGEIPATFSEL  308

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  +  + +L  L L  N F+G IP   G+   L+ L +S N 
Sbjct  309  KNLTLLNLFRNKLHGAIPDFIGDLPALEVLQLWENNFTGSIPQGLGKNGRLQLLDLSSNK  368

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P ++    +L  L I   N   G IP  +G    L R
Sbjct  369  LTGNLPPDLCFGNRLHTL-IALGNFLFGPIPESLGRCKSLSR  409


 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 53/152 (35%), Positives = 79/152 (52%), Gaps = 1/152 (1%)
 Frame = +2

Query  95   GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  274
            G + P++G L  LV L +A   LSG +PPE S +  L  L L  N        +L QL +
Sbjct  227  GGIPPELGNLTELVRLDMANCGLSGEIPPEFSKLQKLDTLFLQVNGLSGGLTPELGQLKS  286

Query  275  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  454
            L+ +DL NN L G++P    ++ +L  L+L  N   G IP   G  P LE L +  N  +
Sbjct  287  LKSMDLSNNMLAGEIPATFSELKNLTLLNLFRNKLHGAIPDFIGDLPALEVLQLWENNFT  346

Query  455  GVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            G IP  +G   +L+ L +   N  +G +PP++
Sbjct  347  GSIPQGLGKNGRLQLLDLSS-NKLTGNLPPDL  377


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/147 (33%), Positives = 74/147 (50%), Gaps = 7/147 (5%)
 Frame = +2

Query  101  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  280
            ++ D+GQ+      S++ NQL+G +P  I   S ++ L L  N F  + P ++ +L  L 
Sbjct  451  IAEDLGQI------SLSNNQLTGSLPRSIGNFSGVQKLLLDGNFFFGSIPAEIGRLQQLS  504

Query  281  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  460
             +D  NN  +G +  E+ +   L  + L  N  SG IPPE      L YL +S N L+G 
Sbjct  505  KMDFSNNRFSGPIASEISQCKLLTFVDLSRNELSGVIPPEMTGMRILNYLNLSRNHLTGS  564

Query  461  IPSEIGNLTKLKELYIGYFNGFSGGIP  541
            IP+ I  +  L  +   Y N  SG +P
Sbjct  565  IPASIATMQSLTSVDFSY-NNLSGLVP  590


 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 91/174 (52%), Gaps = 3/174 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +G +   +G+   L  L +++N+L+G +PP++   + L   + L N +FG   P  L 
Sbjct  344  NFTGSIPQGLGKNGRLQLLDLSSNKLTGNLPPDLCFGNRLHTLIALGNFLFG-PIPESLG  402

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            +  +L  + +  N L G +P  ++ + +L  + L  NY  G  P       +L  +++S 
Sbjct  403  RCKSLSRIRMGENFLNGTIPKGLFSLPNLAQVELQDNYLVGGFPQTDSIAEDLGQISLSN  462

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            N L+G +P  IGN + +++L +   N F G IP E+G L QL + D +N   +G
Sbjct  463  NQLTGSLPRSIGNFSGVQKLLLDG-NFFFGSIPAEIGRLQQLSKMDFSNNRFSG  515


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 53/173 (31%), Positives = 76/173 (44%), Gaps = 1/173 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    T P  L  
Sbjct  368  KLTGNLPPDLCFGNRLHTLIALGNFLFGPIPESLGRCKSLSRIRMGENFLNGTIPKGLFS  427

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L NL  ++L +N L G  P        L  + L  N  +G +P   G F  ++ L + GN
Sbjct  428  LPNLAQVELQDNYLVGGFPQTDSIAEDLGQISLSNNQLTGSLPRSIGNFSGVQKLLLDGN  487

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
               G IP+EIG L +L ++     N FSG I  E+     L   D +   L+G
Sbjct  488  FFFGSIPAEIGRLQQLSKMDFSN-NRFSGPIASEISQCKLLTFVDLSRNELSG  539


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 78/172 (45%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G +   +  LP L  + +  N L G  P   S    L  ++LSNN    + P  +   
Sbjct  417  LNGTIPKGLFSLPNLAQVELQDNYLVGGFPQTDSIAEDLGQISLSNNQLTGSLPRSIGNF  476

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
            + +Q L L  N   G +P E+ ++  L  +    N FSG I  E  +   L ++ +S N 
Sbjct  477  SGVQKLLLDGNFFFGSIPAEIGRLQQLSKMDFSNNRFSGPIASEISQCKLLTFVDLSRNE  536

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            LSGVIP E+  +  L  L +   N  +G IP  +  +  L   D +   L+G
Sbjct  537  LSGVIPPEMTGMRILNYLNLSR-NHLTGSIPASIATMQSLTSVDFSYNNLSG  587


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 51/100 (51%), Gaps = 0/100 (0%)
 Frame = +2

Query  95   GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  274
            G +  ++G+L  L  +  + N+ SGP+  EIS    L F++LS N      P ++  +  
Sbjct  491  GSIPAEIGRLQQLSKMDFSNNRFSGPIASEISQCKLLTFVDLSRNELSGVIPPEMTGMRI  550

Query  275  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  394
            L  L+L  N+LTG +P  +  M SL  +    N  SG +P
Sbjct  551  LNYLNLSRNHLTGSIPASIATMQSLTSVDFSYNNLSGLVP  590


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
             SG ++ ++ Q   L  + ++ N+LSG +PPE++ +  L +LNLS N    + P  +A +
Sbjct  513  FSGPIASEISQCKLLTFVDLSRNELSGVIPPEMTGMRILNYLNLSRNHLTGSIPASIATM  572

Query  269  ANLQVLDLYNNNLTGDLP  322
             +L  +D   NNL+G +P
Sbjct  573  QSLTSVDFSYNNLSGLVP  590



>gb|AIT56194.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Dimocarpus longan]
Length=1015

 Score =   266 bits (680),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 138/202 (68%), Positives = 163/202 (81%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPP  181
            N +TSHCTW  VTCDS  HV SLDL  LNLSG LS DV  L FL NL++AANQ SGP+PP
Sbjct  46   NATTSHCTWTGVTCDSRHHVTSLDLRDLNLSGTLSSDVAHLQFLRNLTVAANQFSGPIPP  105

Query  182  EISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLH  361
            EIS +S LRFLNLSNN+F  +FP QLA+LANL+V+DLYNNN+T +LPV V ++ +L HLH
Sbjct  106  EISQLSALRFLNLSNNVFNGSFPSQLARLANLEVMDLYNNNMTDELPVGVTQLRNLHHLH  165

Query  362  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            LGGN+FSG IP EYG +  LEYLAVSGN L G IP EIGNLT L+ELYIGY+N ++GG+P
Sbjct  166  LGGNFFSGEIPAEYGGWEFLEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNTYTGGLP  225

Query  542  PEMGNLSQLIRXDAANCGLTGE  607
            PE+GNLS L+R DAANC L+GE
Sbjct  226  PEIGNLSSLVRLDAANCALSGE  247


 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 85/173 (49%), Gaps = 1/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L+ ++G L  L ++ ++ N  +G +P   + +  +  LNL  N      P  + +L
Sbjct  268  LSGTLARELGNLKSLKSMDLSNNMFTGEIPASFAELKNMTLLNLFRNKLHGAIPEFIGEL  327

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L+VL L+ NN TG +P  +     L+ L L  N  +G +PP+      LE L   GN 
Sbjct  328  PKLEVLQLWENNFTGSIPQRLGSNGMLQLLDLSSNKLTGTLPPDMCSGNRLETLITLGNF  387

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            L G IP  +G    L  + +G  N  +G IP  +  L +L + +  +  LTGE
Sbjct  388  LFGPIPESLGKCQSLSRIRMGE-NFLNGSIPKGLFGLPKLTQVELQDNYLTGE  439


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 87/162 (54%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG +  ++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN+F    P   A+L
Sbjct  244  LSGEIPGEIGKLQKLDTLFLQVNGLSGTLARELGNLKSLKSMDLSNNMFTGEIPASFAEL  303

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             N+ +L+L+ N L G +P  + ++  L  L L  N F+G IP   G    L+ L +S N 
Sbjct  304  KNMTLLNLFRNKLHGAIPEFIGELPKLEVLQLWENNFTGSIPQRLGSNGMLQLLDLSSNK  363

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P ++ +  +L+ L I   N   G IP  +G    L R
Sbjct  364  LTGTLPPDMCSGNRLETL-ITLGNFLFGPIPESLGKCQSLSR  404


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 81/173 (47%), Gaps = 1/173 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  363  KLTGTLPPDMCSGNRLETLITLGNFLFGPIPESLGKCQSLSRIRMGENFLNGSIPKGLFG  422

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N LTG+ PV      SL  + L  N  SG +P   G F  ++ L + GN
Sbjct  423  LPKLTQVELQDNYLTGEFPVTDSISVSLGQITLSNNQLSGSLPASIGNFSGVQKLLLDGN  482

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
              SG IP E+G+L +L ++     N FSG I PE+     L   D +   L+G
Sbjct  483  KFSGQIPPEVGSLKQLSKMGFSD-NRFSGQIAPEISKCKLLTFVDLSRNELSG  534


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 78/153 (51%), Gaps = 1/153 (1%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
            +G L P++G L  LV L  A   LSG +P EI  +  L  L L  N    T   +L  L 
Sbjct  221  TGGLPPEIGNLSSLVRLDAANCALSGEIPGEIGKLQKLDTLFLQVNGLSGTLARELGNLK  280

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
            +L+ +DL NN  TG++P    ++ ++  L+L  N   G IP   G  P LE L +  N  
Sbjct  281  SLKSMDLSNNMFTGEIPASFAELKNMTLLNLFRNKLHGAIPEFIGELPKLEVLQLWENNF  340

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            +G IP  +G+   L+ L +   N  +G +PP+M
Sbjct  341  TGSIPQRLGSNGMLQLLDLSS-NKLTGTLPPDM  372


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 59/198 (30%), Positives = 96/198 (48%), Gaps = 25/198 (13%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L G +   +G+LP L  L +  N  +G +P  + +   L+ L+LS+N    T P  +  
Sbjct  315  KLHGAIPEFIGELPKLEVLQLWENNFTGSIPQRLGSNGMLQLLDLSSNKLTGTLPPDMCS  374

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP------PEY--------  403
               L+ L    N L G +P  + K  SL  + +G N+ +G IP      P+         
Sbjct  375  GNRLETLITLGNFLFGPIPESLGKCQSLSRIRMGENFLNGSIPKGLFGLPKLTQVELQDN  434

Query  404  ---GRFPNLEYLAVS-------GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
               G FP  + ++VS        N LSG +P+ IGN + +++L +   N FSG IPPE+G
Sbjct  435  YLTGEFPVTDSISVSLGQITLSNNQLSGSLPASIGNFSGVQKLLLDG-NKFSGQIPPEVG  493

Query  554  NLSQLIRXDAANCGLTGE  607
            +L QL +   ++   +G+
Sbjct  494  SLKQLSKMGFSDNRFSGQ  511


 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 77/161 (48%), Gaps = 1/161 (1%)
 Frame = +2

Query  122  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  301
            LP L  + +  N L+G  P   S   +L  + LSNN    + P  +   + +Q L L  N
Sbjct  423  LPKLTQVELQDNYLTGEFPVTDSISVSLGQITLSNNQLSGSLPASIGNFSGVQKLLLDGN  482

Query  302  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGN  481
              +G +P EV  +  L  +    N FSG+I PE  +   L ++ +S N LSGV+P+EI  
Sbjct  483  KFSGQIPPEVGSLKQLSKMGFSDNRFSGQIAPEISKCKLLTFVDLSRNELSGVVPNEITG  542

Query  482  LTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            +  L  L +   N   G IP  + ++  L   D +   L+G
Sbjct  543  MKILNYLNLSR-NHLVGSIPAAIASMQSLTSVDFSYNNLSG  582


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 64/127 (50%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             LSG L   +G    +  L +  N+ SG +PPE+ ++  L  +  S+N F      ++++
Sbjct  459  QLSGSLPASIGNFSGVQKLLLDGNKFSGQIPPEVGSLKQLSKMGFSDNRFSGQIAPEISK  518

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  +DL  N L+G +P E+  M  L +L+L  N+  G IP       +L  +  S N
Sbjct  519  CKLLTFVDLSRNELSGVVPNEITGMKILNYLNLSRNHLVGSIPAAIASMQSLTSVDFSYN  578

Query  446  GLSGVIP  466
             LSG++P
Sbjct  579  NLSGLVP  585



>gb|EYU41357.1| hypothetical protein MIMGU_mgv1a000718mg [Erythranthe guttata]
Length=1006

 Score =   266 bits (679),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 165/203 (81%), Gaps = 1/203 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsl-lhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVP  178
            N +T HCTWR VTCD+    V SLD+S L+L+GVLSPDVG+L FLVN S AAN LSGP+P
Sbjct  51   NATTHHCTWRGVTCDASGRRVASLDISNLSLAGVLSPDVGRLRFLVNFSAAANFLSGPIP  110

Query  179  PEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHL  358
            P+IS I  LR LNLSNN+F  +FP +L  L NL+VLD+YNNN+TGD P + Y +T+LRHL
Sbjct  111  PQISDIPNLRHLNLSNNVFNLSFPAELYHLKNLEVLDVYNNNMTGDFPSQAYLLTNLRHL  170

Query  359  HLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGI  538
            HLGGN+F+G  PPE+G FP+LEYLAVSGN L+G IP +IGNLT LKELYIGYFN F+GGI
Sbjct  171  HLGGNFFTGVFPPEFGSFPHLEYLAVSGNELTGAIPPQIGNLTHLKELYIGYFNTFTGGI  230

Query  539  PPEMGNLSQLIRXDAANCGLTGE  607
            P E+GNLS LIR DAANCGL+G+
Sbjct  231  PKEIGNLSNLIRFDAANCGLSGQ  253


 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 88/161 (55%), Gaps = 2/161 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  265
             +GV  P+ G  P L  L+++ N+L+G +PP+I  ++ L+ L +   N F    P ++  
Sbjct  177  FTGVFPPEFGSFPHLEYLAVSGNELTGAIPPQIGNLTHLKELYIGYFNTFTGGIPKEIGN  236

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L+NL   D  N  L+G +P E+  + +L  L L  N  SG +PPE G   +L+ + +S N
Sbjct  237  LSNLIRFDAANCGLSGQIPAEIGNLQNLDTLFLQVNGISGGLPPELGNLKSLKSMDLSNN  296

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQL  568
             LSG IP     L  +  L + + N F+G IP  +G+L +L
Sbjct  297  ILSGEIPPSFSQLQNITLLNL-FRNKFTGSIPDFIGDLPEL  336


 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 86/162 (53%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG +  ++G L  L  L +  N +SG +PPE+  + +L+ ++LSNNI     P   +QL
Sbjct  250  LSGQIPAEIGNLQNLDTLFLQVNGISGGLPPELGNLKSLKSMDLSNNILSGEIPPSFSQL  309

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             N+ +L+L+ N  TG +P  +  +  L+ L L  N F+G IP   G   NLE + +S N 
Sbjct  310  QNITLLNLFRNKFTGSIPDFIGDLPELQVLQLWENNFTGIIPQNLGDNGNLEEVDLSSNK  369

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P  + N  +L  L I   N   G IP  +G    L R
Sbjct  370  LTGNLPPNLCNGNQLNTL-ITLGNFLFGPIPDSLGRCGSLGR  410


 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 57/173 (33%), Positives = 87/173 (50%), Gaps = 1/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            +SG L P++G L  L ++ ++ N LSG +PP  S +  +  LNL  N F  + P  +  L
Sbjct  274  ISGGLPPELGNLKSLKSMDLSNNILSGEIPPSFSQLQNITLLNLFRNKFTGSIPDFIGDL  333

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              LQVL L+ NN TG +P  +    +L  + L  N  +G +PP       L  L   GN 
Sbjct  334  PELQVLQLWENNFTGIIPQNLGDNGNLEEVDLSSNKLTGNLPPNLCNGNQLNTLITLGNF  393

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            L G IP  +G    L  + +G  N  +G IP  + +L +L + +  +  L+GE
Sbjct  394  LFGPIPDSLGRCGSLGRIRMGE-NYLNGSIPKGLLSLPKLTQVELQDNLLSGE  445


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/160 (32%), Positives = 84/160 (53%), Gaps = 1/160 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
             +G +  ++G L  L+    A   LSG +P EI  +  L  L L  N      P +L  L
Sbjct  226  FTGGIPKEIGNLSNLIRFDAANCGLSGQIPAEIGNLQNLDTLFLQVNGISGGLPPELGNL  285

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             +L+ +DL NN L+G++P    ++ ++  L+L  N F+G IP   G  P L+ L +  N 
Sbjct  286  KSLKSMDLSNNILSGEIPPSFSQLQNITLLNLFRNKFTGSIPDFIGDLPELQVLQLWENN  345

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQL  568
             +G+IP  +G+   L+E+ +   N  +G +PP + N +QL
Sbjct  346  FTGIIPQNLGDNGNLEEVDLSS-NKLTGNLPPNLCNGNQL  384


 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 54/165 (33%), Positives = 80/165 (48%), Gaps = 2/165 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQ  265
            L+G +   +  LP L  + +  N LSG  P     +ST L  ++LSNN      P  +  
Sbjct  418  LNGSIPKGLLSLPKLTQVELQDNLLSGEFPNTDGILSTTLGQISLSNNHLAGRLPPSIGN  477

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
             A +Q L L  N  +G++P E+ K+  L  +    N FSG+I PE  R   L ++ +S N
Sbjct  478  FAAVQKLLLDGNKFSGEIPAEIGKLQQLSKIDFSRNDFSGQISPEISRCKLLTFVDLSHN  537

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXD  580
             LSG IP+EI ++  L  L +   N   G IP  +  +  L   D
Sbjct  538  RLSGPIPTEITSMKILNYLNLSR-NNLMGNIPSSISGMQSLTSVD  581


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 59/120 (49%), Gaps = 1/120 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
              SG +  ++G+L  L  +  + N  SG + PEIS    L F++LS+N      P ++  
Sbjct  490  KFSGEIPAEIGKLQQLSKIDFSRNDFSGQISPEISRCKLLTFVDLSHNRLSGPIPTEITS  549

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            +  L  L+L  NNL G++P  +  M SL  +    N FSG +P   G+F      +  GN
Sbjct  550  MKILNYLNLSRNNLMGNIPSSISGMQSLTSVDFSYNNFSGLVPAT-GQFSYFNRTSFLGN  608



>ref|XP_010271550.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nelumbo nucifera]
Length=1032

 Score =   266 bits (679),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 167/202 (83%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPP  181
            N STSHCTW  V+CDSL  VVSLDLS +N+SG+LSPDVGQL  LVNL++AAN + GP+PP
Sbjct  54   NFSTSHCTWTGVSCDSLNRVVSLDLSNMNISGILSPDVGQLRNLVNLTVAANLIYGPIPP  113

Query  182  EISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLH  361
             IS IS LR LNLSNN+F  TFP QL++L  L+VLDLYNNN+TGDLPVEV  M +LRHLH
Sbjct  114  GISYISGLRLLNLSNNVFNGTFPSQLSRLKYLEVLDLYNNNMTGDLPVEVSDMPNLRHLH  173

Query  362  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
             GGN+FSGRIPPEYGR+  LEY+A+SGN L+G IP  IGNLTKL++LY+GY+N +  GIP
Sbjct  174  FGGNFFSGRIPPEYGRWEFLEYMALSGNELTGPIPPTIGNLTKLQQLYLGYYNTYESGIP  233

Query  542  PEMGNLSQLIRXDAANCGLTGE  607
             EMGNL++L+R D ANCGL+GE
Sbjct  234  AEMGNLTELVRLDMANCGLSGE  255


 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 59/197 (30%), Positives = 96/197 (49%), Gaps = 26/197 (13%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR--------------------  208
             SG + P+ G+  FL  ++++ N+L+GP+PP I  ++ L+                    
Sbjct  179  FSGRIPPEYGRWEFLEYMALSGNELTGPIPPTIGNLTKLQQLYLGYYNTYESGIPAEMGN  238

Query  209  -----FLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGN  373
                  L+++N       PH+L +L  L  L L  N L+G+L  E+ ++ SL+ + L  N
Sbjct  239  LTELVRLDMANCGLSGEIPHELGKLQKLDTLFLQVNGLSGELTPELGQLKSLKSMDLSNN  298

Query  374  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
              SG  P  +    NL  L +  N L G IP  IG+L +L+ L + + N F+G IP  +G
Sbjct  299  MLSGEFPETFSELKNLTLLNLFRNKLHGAIPDFIGDLPELEVLQL-WENNFTGSIPQGLG  357

Query  554  NLSQLIRXDAANCGLTG  604
               +L   D ++  LTG
Sbjct  358  KNGRLQFLDLSSNKLTG  374


 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 55/162 (34%), Positives = 88/162 (54%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG +  ++G+L  L  L +  N LSG + PE+  + +L+ ++LSNN+    FP   ++L
Sbjct  252  LSGEIPHELGKLQKLDTLFLQVNGLSGELTPELGQLKSLKSMDLSNNMLSGEFPETFSEL  311

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   G+   L++L +S N 
Sbjct  312  KNLTLLNLFRNKLHGAIPDFIGDLPELEVLQLWENNFTGSIPQGLGKNGRLQFLDLSSNK  371

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P ++    +L+ L I   N   G IP  +G    L R
Sbjct  372  LTGNLPPDLCFGNRLQTL-IALGNFLFGPIPESLGRCESLSR  412


 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 58/172 (34%), Positives = 85/172 (49%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L+P++GQL  L ++ ++ N LSG  P   S +  L  LNL  N      P  +  L
Sbjct  276  LSGELTPELGQLKSLKSMDLSNNMLSGEFPETFSELKNLTLLNLFRNKLHGAIPDFIGDL  335

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L+VL L+ NN TG +P  + K   L+ L L  N  +G +PP+      L+ L   GN 
Sbjct  336  PELEVLQLWENNFTGSIPQGLGKNGRLQFLDLSSNKLTGNLPPDLCFGNRLQTLIALGNF  395

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            L G IP  +G    L  + +G  N  +G IP  +  L  L++ +  +  L G
Sbjct  396  LFGPIPESLGRCESLSRIRMGE-NFLNGTIPKGLFGLPMLVQVELQDNYLVG  446


 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 78/174 (45%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    T P  L  
Sbjct  371  KLTGNLPPDLCFGNRLQTLIALGNFLFGPIPESLGRCESLSRIRMGENFLNGTIPKGLFG  430

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N L G  P       +L  + L  N   G +P   G F  ++ L + GN
Sbjct  431  LPMLVQVELQDNYLVGGFPETDSVAENLGQISLSNNQLMGSLPRSIGNFSGVQKLLLDGN  490

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              SG IP+EIG L +L ++     N FSG I PE+     L   D +   L+GE
Sbjct  491  FFSGSIPAEIGRLQQLSKMDFSN-NRFSGSIAPEISQCKLLTFVDLSRNELSGE  543


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 79/172 (46%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G +   +  LP LV + +  N L G  P   S    L  ++LSNN    + P  +   
Sbjct  420  LNGTIPKGLFGLPMLVQVELQDNYLVGGFPETDSVAENLGQISLSNNQLMGSLPRSIGNF  479

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
            + +Q L L  N  +G +P E+ ++  L  +    N FSG I PE  +   L ++ +S N 
Sbjct  480  SGVQKLLLDGNFFSGSIPAEIGRLQQLSKMDFSNNRFSGSIAPEISQCKLLTFVDLSRNE  539

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            LSG IP EI  +  L  L +   N   G IP  +  +  L   D +   L+G
Sbjct  540  LSGEIPPEITGMRILNYLNLSR-NHLVGSIPASISTMQSLTSVDFSYNNLSG  590


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 91/174 (52%), Gaps = 3/174 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +G +   +G+   L  L +++N+L+G +PP++   + L+  + L N +FG   P  L 
Sbjct  347  NFTGSIPQGLGKNGRLQFLDLSSNKLTGNLPPDLCFGNRLQTLIALGNFLFGP-IPESLG  405

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            +  +L  + +  N L G +P  ++ +  L  + L  NY  G  P       NL  +++S 
Sbjct  406  RCESLSRIRMGENFLNGTIPKGLFGLPMLVQVELQDNYLVGGFPETDSVAENLGQISLSN  465

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            N L G +P  IGN + +++L +   N FSG IP E+G L QL + D +N   +G
Sbjct  466  NQLMGSLPRSIGNFSGVQKLLLDG-NFFSGSIPAEIGRLQQLSKMDFSNNRFSG  518


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 67/137 (49%), Gaps = 1/137 (1%)
 Frame = +2

Query  131  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  310
            L  +S++ NQL G +P  I   S ++ L L  N F  + P ++ +L  L  +D  NN  +
Sbjct  458  LGQISLSNNQLMGSLPRSIGNFSGVQKLLLDGNFFSGSIPAEIGRLQQLSKMDFSNNRFS  517

Query  311  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTK  490
            G +  E+ +   L  + L  N  SG IPPE      L YL +S N L G IP+ I  +  
Sbjct  518  GSIAPEISQCKLLTFVDLSRNELSGEIPPEITGMRILNYLNLSRNHLVGSIPASISTMQS  577

Query  491  LKELYIGYFNGFSGGIP  541
            L  +   Y N  SG +P
Sbjct  578  LTSVDFSY-NNLSGLVP  593


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
             SG ++P++ Q   L  + ++ N+LSG +PPEI+ +  L +LNLS N    + P  ++ +
Sbjct  516  FSGSIAPEISQCKLLTFVDLSRNELSGEIPPEITGMRILNYLNLSRNHLVGSIPASISTM  575

Query  269  ANLQVLDLYNNNLTGDLP  322
             +L  +D   NNL+G +P
Sbjct  576  QSLTSVDFSYNNLSGLVP  593



>ref|XP_010028033.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Eucalyptus grandis]
 gb|KCW54695.1| hypothetical protein EUGRSUZ_I00635 [Eucalyptus grandis]
Length=1023

 Score =   265 bits (676),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 164/198 (83%), Gaps = 1/198 (1%)
 Frame = +2

Query  17   HCTWRRVTCd-sllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISA  193
            HC+W+ VTCD    HV +LDLS L L+G LSPDV  L FL++LS+AANQLSGP+PP+ISA
Sbjct  66   HCSWQGVTCDPRRRHVTALDLSSLELAGALSPDVAHLRFLISLSVAANQLSGPIPPQISA  125

Query  194  ISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGN  373
            ++ LR+LNLSNN+F  TFP +L  L NL+VLDLYNNN+TGDLPV V +M  LRHLHLGGN
Sbjct  126  LAALRYLNLSNNVFNGTFPPRLGLLRNLRVLDLYNNNMTGDLPVAVAEMPQLRHLHLGGN  185

Query  374  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
            YF GRIPPEYGR+  +EYLAVSG+ L+G IP EIGNLT L+ELY+GY+N + G +PPE+G
Sbjct  186  YFGGRIPPEYGRWEFIEYLAVSGDELTGAIPPEIGNLTTLRELYLGYYNSYDGSLPPEIG  245

Query  554  NLSQLIRXDAANCGLTGE  607
            NLSQL+R DAA+CGL+GE
Sbjct  246  NLSQLVRLDAASCGLSGE  263


 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 89/162 (55%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P++ +L  L  L +  N  +G +P EI  +++L+ L+LSNN+F    P   +QL
Sbjct  260  LSGEIPPEIAKLQNLDTLFLQVNGFAGSLPAEIGYLNSLKSLDLSNNMFAGEIPESFSQL  319

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L L+ N L G++P  +  +  L+ L L  N F+G IP   G+  +L+ + +S N 
Sbjct  320  KNLTLLHLFRNKLNGEIPEFIADLPELQVLQLWENNFTGSIPQGLGKNGHLQIVDLSSNK  379

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P ++    +L ++ I   N   G IP  +G    L R
Sbjct  380  LTGTLPPDLCYGNQL-QILIALSNYLLGPIPESLGKCRSLER  420


 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/174 (34%), Positives = 90/174 (52%), Gaps = 2/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA  262
             L+G + P++G L  L  L +   N   G +PPEI  +S L  L+ ++       P ++A
Sbjct  210  ELTGAIPPEIGNLTTLRELYLGYYNSYDGSLPPEIGNLSQLVRLDAASCGLSGEIPPEIA  269

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            +L NL  L L  N   G LP E+  + SL+ L L  N F+G IP  + +  NL  L +  
Sbjct  270  KLQNLDTLFLQVNGFAGSLPAEIGYLNSLKSLDLSNNMFAGEIPESFSQLKNLTLLHLFR  329

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            N L+G IP  I +L +L+ L + + N F+G IP  +G    L   D ++  LTG
Sbjct  330  NKLNGEIPEFIADLPELQVLQL-WENNFTGSIPQGLGKNGHLQIVDLSSNKLTG  382


 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 89/190 (47%), Gaps = 26/190 (14%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G +   +  LP L  L +  N  +G +P  +     L+ ++LS+N    T P  L  
Sbjct  331  KLNGEIPEFIADLPELQVLQLWENNFTGSIPQGLGKNGHLQIVDLSSNKLTGTLPPDLCY  390

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP------PE---------  400
               LQ+L   +N L G +P  + K  SL  + +GGNY +G IP      PE         
Sbjct  391  GNQLQILIALSNYLLGPIPESLGKCRSLERIRMGGNYLNGSIPRGLFGLPELNQVEFQDN  450

Query  401  --YGRFP--------NLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
               G FP         L  + +S N L G +P  IGN + +++L +   N FSG IPPE+
Sbjct  451  LLVGEFPVSDDSIALKLGQITLSNNKLGGSLPPTIGNFSGVQKLLLDG-NNFSGQIPPEI  509

Query  551  GNLSQLIRXD  580
            G L QL + D
Sbjct  510  GRLQQLAKID  519


 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 66/127 (52%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L G L P +G    +  L +  N  SG +PPEI  +  L  ++ S+N +    P Q++Q
Sbjct  476  KLGGSLPPTIGNFSGVQKLLLDGNNFSGQIPPEIGRLQQLAKIDFSSNRYSGPIPAQISQ  535

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  +DL  N L+G++P E+  M  L +L+L  N  SG IPP      +L  +  S N
Sbjct  536  CKLLTFVDLSGNELSGEIPNEITGMRILNYLNLSSNNLSGSIPPSISTMQSLTSVDFSYN  595

Query  446  GLSGVIP  466
             LSG++P
Sbjct  596  NLSGLVP  602


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 83/178 (47%), Gaps = 8/178 (4%)
 Frame = +2

Query  86   NLSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  256
             L+G L PD+    QL  L+ LS   N L GP+P  +    +L  + +  N    + P  
Sbjct  379  KLTGTLPPDLCYGNQLQILIALS---NYLLGPIPESLGKCRSLERIRMGGNYLNGSIPRG  435

Query  257  LAQLANLQVLDLYNNNLTGDLPVEVYKMT-SLRHLHLGGNYFSGRIPPEYGRFPNLEYLA  433
            L  L  L  ++  +N L G+ PV    +   L  + L  N   G +PP  G F  ++ L 
Sbjct  436  LFGLPELNQVEFQDNLLVGEFPVSDDSIALKLGQITLSNNKLGGSLPPTIGNFSGVQKLL  495

Query  434  VSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            + GN  SG IP EIG L +L ++     N +SG IP ++     L   D +   L+GE
Sbjct  496  LDGNNFSGQIPPEIGRLQQLAKIDFSS-NRYSGPIPAQISQCKLLTFVDLSGNELSGE  552


 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 77/144 (53%), Gaps = 4/144 (3%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            N SG + P++G+L  L  +  ++N+ SGP+P +IS    L F++LS N      P+++  
Sbjct  500  NFSGQIPPEIGRLQQLAKIDFSSNRYSGPIPAQISQCKLLTFVDLSGNELSGEIPNEITG  559

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            +  L  L+L +NNL+G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  560  MRILNYLNLSSNNLSGSIPPSISTMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  618

Query  446  -GLSG--VIPSEIGNLTKLKELYI  508
              L G  + P + G +T + + ++
Sbjct  619  PELCGPYLGPCKDGEMTGIHQAHV  642


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 68/137 (50%), Gaps = 1/137 (1%)
 Frame = +2

Query  131  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  310
            L  ++++ N+L G +PP I   S ++ L L  N F    P ++ +L  L  +D  +N  +
Sbjct  467  LGQITLSNNKLGGSLPPTIGNFSGVQKLLLDGNNFSGQIPPEIGRLQQLAKIDFSSNRYS  526

Query  311  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTK  490
            G +P ++ +   L  + L GN  SG IP E      L YL +S N LSG IP  I  +  
Sbjct  527  GPIPAQISQCKLLTFVDLSGNELSGEIPNEITGMRILNYLNLSSNNLSGSIPPSISTMQS  586

Query  491  LKELYIGYFNGFSGGIP  541
            L  +   Y N  SG +P
Sbjct  587  LTSVDFSY-NNLSGLVP  602



>ref|NP_001235080.1| receptor-like protein kinase 3 precursor [Glycine max]
 gb|AAF91324.1|AF244890_1 receptor-like protein kinase 3 [Glycine max]
Length=1012

 Score =   264 bits (675),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 136/202 (67%), Positives = 169/202 (84%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPP  181
            N ST +C+W  VTCD+  HV SLDL+GL+LSG LS DV  LPFL NLS+A+N+ SGP+PP
Sbjct  50   NSSTPYCSWLGVTCDNRRHVTSLDLTGLDLSGPLSADVAHLPFLSNLSLASNKFSGPIPP  109

Query  182  EISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLH  361
             +SA+S LRFLNLSNN+F  TFP +L++L NL+VLDLYNNN+TG LP+ V +M +LRHLH
Sbjct  110  SLSALSGLRFLNLSNNVFNETFPSELSRLQNLEVLDLYNNNMTGVLPLAVAQMQNLRHLH  169

Query  362  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            LGGN+FSG+IPPEYGR+  L+YLAVSGN L G IP EIGNL+ L+ELYIGY+N ++GGIP
Sbjct  170  LGGNFFSGQIPPEYGRWQRLQYLAVSGNELEGTIPPEIGNLSSLRELYIGYYNTYTGGIP  229

Query  542  PEMGNLSQLIRXDAANCGLTGE  607
            PE+GNLS+L+R DAA CGL+GE
Sbjct  230  PEIGNLSELVRLDAAYCGLSGE  251


 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 84/161 (52%), Gaps = 2/161 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  265
             SG + P+ G+   L  L+++ N+L G +PPEI  +S+LR L +   N +    P ++  
Sbjct  175  FSGQIPPEYGRWQRLQYLAVSGNELEGTIPPEIGNLSSLRELYIGYYNTYTGGIPPEIGN  234

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L+ L  LD     L+G++P  + K+  L  L L  N  SG + PE G   +L+ + +S N
Sbjct  235  LSELVRLDAAYCGLSGEIPAALGKLQKLDTLFLQVNALSGSLTPELGNLKSLKSMDLSNN  294

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQL  568
             LSG IP+  G L  +  L + + N   G IP  +G L  L
Sbjct  295  MLSGEIPARFGELKNITLLNL-FRNKLHGAIPEFIGELPAL  334


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 87/162 (54%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG +   +G+L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P +  +L
Sbjct  248  LSGEIPAALGKLQKLDTLFLQVNALSGSLTPELGNLKSLKSMDLSNNMLSGEIPARFGEL  307

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             N+ +L+L+ N L G +P  + ++ +L  + L  N F+G IP   G+   L  + +S N 
Sbjct  308  KNITLLNLFRNKLHGAIPEFIGELPALEVVQLWENNFTGSIPEGLGKNGRLNLVDLSSNK  367

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P+ + +   L+ L I   N   G IP  +G+   L R
Sbjct  368  LTGTLPTYLCSGNTLQTL-ITLGNFLFGPIPESLGSCESLTR  408


 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 53/173 (31%), Positives = 85/173 (49%), Gaps = 1/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L+P++G L  L ++ ++ N LSG +P     +  +  LNL  N      P  + +L
Sbjct  272  LSGSLTPELGNLKSLKSMDLSNNMLSGEIPARFGELKNITLLNLFRNKLHGAIPEFIGEL  331

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L+V+ L+ NN TG +P  + K   L  + L  N  +G +P        L+ L   GN 
Sbjct  332  PALEVVQLWENNFTGSIPEGLGKNGRLNLVDLSSNKLTGTLPTYLCSGNTLQTLITLGNF  391

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            L G IP  +G+   L  + +G  N  +G IP  +  L +L + +  +  L+GE
Sbjct  392  LFGPIPESLGSCESLTRIRMGE-NFLNGSIPRGLFGLPKLTQVELQDNYLSGE  443


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 59/197 (30%), Positives = 91/197 (46%), Gaps = 25/197 (13%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L G +   +G+LP L  + +  N  +G +P  +     L  ++LS+N    T P  L  
Sbjct  319  KLHGAIPEFIGELPALEVVQLWENNFTGSIPEGLGKNGRLNLVDLSSNKLTGTLPTYLCS  378

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP------PEY--------  403
               LQ L    N L G +P  +    SL  + +G N+ +G IP      P+         
Sbjct  379  GNTLQTLITLGNFLFGPIPESLGSCESLTRIRMGENFLNGSIPRGLFGLPKLTQVELQDN  438

Query  404  ---GRFP-------NLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
               G FP       NL  + +S N LSGV+P  IGN + +++L +   N F+G IPP++G
Sbjct  439  YLSGEFPEVGSVAVNLGQITLSNNQLSGVLPPSIGNFSSVQKLILDG-NMFTGRIPPQIG  497

Query  554  NLSQLIRXDAANCGLTG  604
             L QL + D +    +G
Sbjct  498  RLQQLSKIDFSGNKFSG  514


 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 52/154 (34%), Positives = 74/154 (48%), Gaps = 1/154 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L G +   +G    L  + +  N L+G +P  +  +  L  + L +N     FP   +  
Sbjct  392  LFGPIPESLGSCESLTRIRMGENFLNGSIPRGLFGLPKLTQVELQDNYLSGEFPEVGSVA  451

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL  + L NN L+G LP  +   +S++ L L GN F+GRIPP+ GR   L  +  SGN 
Sbjct  452  VNLGQITLSNNQLSGVLPPSIGNFSSVQKLILDGNMFTGRIPPQIGRLQQLSKIDFSGNK  511

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
             SG I  EI     L  L +   N  SG IP E+
Sbjct  512  FSGPIVPEISQCKLLTFLDLSR-NELSGDIPNEI  544


 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 77/161 (48%), Gaps = 1/161 (1%)
 Frame = +2

Query  122  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  301
            LP L  + +  N LSG  P   S    L  + LSNN      P  +   +++Q L L  N
Sbjct  427  LPKLTQVELQDNYLSGEFPEVGSVAVNLGQITLSNNQLSGVLPPSIGNFSSVQKLILDGN  486

Query  302  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGN  481
              TG +P ++ ++  L  +   GN FSG I PE  +   L +L +S N LSG IP+EI  
Sbjct  487  MFTGRIPPQIGRLQQLSKIDFSGNKFSGPIVPEISQCKLLTFLDLSRNELSGDIPNEITG  546

Query  482  LTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            +  L  L +   N   GGIP  + ++  L   D +   L+G
Sbjct  547  MRILNYLNLSR-NHLVGGIPSSISSMQSLTSVDFSYNNLSG  586


 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 65/127 (51%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             LSGVL P +G    +  L +  N  +G +PP+I  +  L  ++ S N F      +++Q
Sbjct  463  QLSGVLPPSIGNFSSVQKLILDGNMFTGRIPPQIGRLQQLSKIDFSGNKFSGPIVPEISQ  522

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  LDL  N L+GD+P E+  M  L +L+L  N+  G IP       +L  +  S N
Sbjct  523  CKLLTFLDLSRNELSGDIPNEITGMRILNYLNLSRNHLVGGIPSSISSMQSLTSVDFSYN  582

Query  446  GLSGVIP  466
             LSG++P
Sbjct  583  NLSGLVP  589


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 51/146 (35%), Positives = 74/146 (51%), Gaps = 2/146 (1%)
 Frame = +2

Query  107  PDVGQLPF-LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  283
            P+VG +   L  ++++ NQLSG +PP I   S+++ L L  N+F    P Q+ +L  L  
Sbjct  445  PEVGSVAVNLGQITLSNNQLSGVLPPSIGNFSSVQKLILDGNMFTGRIPPQIGRLQQLSK  504

Query  284  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  463
            +D   N  +G +  E+ +   L  L L  N  SG IP E      L YL +S N L G I
Sbjct  505  IDFSGNKFSGPIVPEISQCKLLTFLDLSRNELSGDIPNEITGMRILNYLNLSRNHLVGGI  564

Query  464  PSEIGNLTKLKELYIGYFNGFSGGIP  541
            PS I ++  L  +   Y N  SG +P
Sbjct  565  PSSISSMQSLTSVDFSY-NNLSGLVP  589


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 76/159 (48%), Gaps = 1/159 (1%)
 Frame = +2

Query  131  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  310
            L  L    N L GP+P  + +  +L  + +  N    + P  L  L  L  ++L +N L+
Sbjct  382  LQTLITLGNFLFGPIPESLGSCESLTRIRMGENFLNGSIPRGLFGLPKLTQVELQDNYLS  441

Query  311  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTK  490
            G+ P       +L  + L  N  SG +PP  G F +++ L + GN  +G IP +IG L +
Sbjct  442  GEFPEVGSVAVNLGQITLSNNQLSGVLPPSIGNFSSVQKLILDGNMFTGRIPPQIGRLQQ  501

Query  491  LKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            L ++     N FSG I PE+     L   D +   L+G+
Sbjct  502  LSKIDFSG-NKFSGPIVPEISQCKLLTFLDLSRNELSGD  539


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 74/150 (49%), Gaps = 1/150 (1%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
            +G + P++G L  LV L  A   LSG +P  +  +  L  L L  N    +   +L  L 
Sbjct  225  TGGIPPEIGNLSELVRLDAAYCGLSGEIPAALGKLQKLDTLFLQVNALSGSLTPELGNLK  284

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
            +L+ +DL NN L+G++P    ++ ++  L+L  N   G IP   G  P LE + +  N  
Sbjct  285  SLKSMDLSNNMLSGEIPARFGELKNITLLNLFRNKLHGAIPEFIGELPALEVVQLWENNF  344

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            +G IP  +G   +L  + +   N  +G +P
Sbjct  345  TGSIPEGLGKNGRLNLVDLSS-NKLTGTLP  373



>ref|XP_006466390.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Citrus sinensis]
Length=1010

 Score =   261 bits (667),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 174/202 (86%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPP  181
            N +TSHCTW  VTCDS  HV SLDLSGLNLSG LSPDV  L FL NLS+AANQLSGP+PP
Sbjct  45   NATTSHCTWPGVTCDSRRHVTSLDLSGLNLSGALSPDVAHLRFLQNLSVAANQLSGPIPP  104

Query  182  EISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLH  361
            EISA+S+LR LNLSNN+F  +FP QL+QLA+LQVLDLYNNN+TGDLP+ V ++ +LRHLH
Sbjct  105  EISALSSLRLLNLSNNVFNGSFPPQLSQLASLQVLDLYNNNMTGDLPLAVTQLRNLRHLH  164

Query  362  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            LGGN+FSG+IPPEYG +  LEYLAVSGN L G IP EIGNLTKL++LYIGY+N ++GG+P
Sbjct  165  LGGNFFSGQIPPEYGIWEFLEYLAVSGNELGGKIPGEIGNLTKLQQLYIGYYNSYTGGLP  224

Query  542  PEMGNLSQLIRXDAANCGLTGE  607
            PE+GNLS L+R DAANCGL+GE
Sbjct  225  PEIGNLSSLVRFDAANCGLSGE  246


 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 84/174 (48%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  362  KLTGTLPPDMCAGNCLQTLITLGNFLFGPIPESLGKCDSLSRMRMGENFLNGSIPKGLFG  421

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L +L  ++L +N LTG  PV      +L  + L  N  SG +P   G+F  ++ L + GN
Sbjct  422  LPSLSQVELQDNYLTGQFPVSDSISVNLGQICLSNNQLSGSLPASIGKFSGVQKLLLDGN  481

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              SG IP+EIG L +L ++   + N FSG I PE+     L   D +   L+GE
Sbjct  482  KFSGQIPAEIGKLQQLSKMDFSH-NKFSGRIAPEISQCKLLTFVDLSRNELSGE  534


 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 84/162 (52%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG +  D+G+L  L  L +  N LSGP+  E+  + +L+ ++LSNNIF    P   A+L
Sbjct  243  LSGEIPTDIGRLQNLDTLFLQVNALSGPLTTELGYLKSLKSMDLSNNIFTGEIPASFAEL  302

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  +  M  L  L L  N F+G IP   G    L  L +S N 
Sbjct  303  KNLTLLNLFRNKLHGAIPEFIGVMPRLEVLQLWENNFTGSIPQRLGSNGKLRILDLSSNK  362

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P ++     L+ L I   N   G IP  +G    L R
Sbjct  363  LTGTLPPDMCAGNCLQTL-ITLGNFLFGPIPESLGKCDSLSR  403


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 81/162 (50%), Gaps = 2/162 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            N++G L   V QL  L +L +  N  SG +PPE      L +L +S N  G   P ++  
Sbjct  145  NMTGDLPLAVTQLRNLRHLHLGGNFFSGQIPPEYGIWEFLEYLAVSGNELGGKIPGEIGN  204

Query  266  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            L  LQ L + Y N+ TG LP E+  ++SL          SG IP + GR  NL+ L +  
Sbjct  205  LTKLQQLYIGYYNSYTGGLPPEIGNLSSLVRFDAANCGLSGEIPTDIGRLQNLDTLFLQV  264

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQL  568
            N LSG + +E+G L  LK + +   N F+G IP     L  L
Sbjct  265  NALSGPLTTELGYLKSLKSMDLSN-NIFTGEIPASFAELKNL  305


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/173 (34%), Positives = 88/173 (51%), Gaps = 2/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            L G +  ++G L  L  L I   N  +G +PPEI  +S+L   + +N       P  + +
Sbjct  194  LGGKIPGEIGNLTKLQQLYIGYYNSYTGGLPPEIGNLSSLVRFDAANCGLSGEIPTDIGR  253

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L NL  L L  N L+G L  E+  + SL+ + L  N F+G IP  +    NL  L +  N
Sbjct  254  LQNLDTLFLQVNALSGPLTTELGYLKSLKSMDLSNNIFTGEIPASFAELKNLTLLNLFRN  313

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             L G IP  IG + +L+ L + + N F+G IP  +G+  +L   D ++  LTG
Sbjct  314  KLHGAIPEFIGVMPRLEVLQL-WENNFTGSIPQRLGSNGKLRILDLSSNKLTG  365


 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 54/175 (31%), Positives = 94/175 (54%), Gaps = 3/175 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +G +   +G    L  L +++N+L+G +PP++ A + L+  + L N +FG   P  L 
Sbjct  338  NFTGSIPQRLGSNGKLRILDLSSNKLTGTLPPDMCAGNCLQTLITLGNFLFG-PIPESLG  396

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            +  +L  + +  N L G +P  ++ + SL  + L  NY +G+ P       NL  + +S 
Sbjct  397  KCDSLSRMRMGENFLNGSIPKGLFGLPSLSQVELQDNYLTGQFPVSDSISVNLGQICLSN  456

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            N LSG +P+ IG  + +++L +   N FSG IP E+G L QL + D ++   +G 
Sbjct  457  NQLSGSLPASIGKFSGVQKLLLDG-NKFSGQIPAEIGKLQQLSKMDFSHNKFSGR  510


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 77/153 (50%), Gaps = 1/153 (1%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
            +G L P++G L  LV    A   LSG +P +I  +  L  L L  N        +L  L 
Sbjct  220  TGGLPPEIGNLSSLVRFDAANCGLSGEIPTDIGRLQNLDTLFLQVNALSGPLTTELGYLK  279

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
            +L+ +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N  
Sbjct  280  SLKSMDLSNNIFTGEIPASFAELKNLTLLNLFRNKLHGAIPEFIGVMPRLEVLQLWENNF  339

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            +G IP  +G+  KL+ L +   N  +G +PP+M
Sbjct  340  TGSIPQRLGSNGKLRILDLSS-NKLTGTLPPDM  371


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 77/161 (48%), Gaps = 1/161 (1%)
 Frame = +2

Query  122  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  301
            LP L  + +  N L+G  P   S    L  + LSNN    + P  + + + +Q L L  N
Sbjct  422  LPSLSQVELQDNYLTGQFPVSDSISVNLGQICLSNNQLSGSLPASIGKFSGVQKLLLDGN  481

Query  302  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGN  481
              +G +P E+ K+  L  +    N FSGRI PE  +   L ++ +S N LSG IP+++  
Sbjct  482  KFSGQIPAEIGKLQQLSKMDFSHNKFSGRIAPEISQCKLLTFVDLSRNELSGEIPNQLTG  541

Query  482  LTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            +  L  L +   N   G IP  + ++  L   D +   L+G
Sbjct  542  MRILNYLNLSR-NHLVGSIPASIASMQSLTSVDFSYNNLSG  581


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 59/120 (49%), Gaps = 1/120 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
              SG +  ++G+L  L  +  + N+ SG + PEIS    L F++LS N      P+QL  
Sbjct  482  KFSGQIPAEIGKLQQLSKMDFSHNKFSGRIAPEISQCKLLTFVDLSRNELSGEIPNQLTG  541

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            +  L  L+L  N+L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  542  MRILNYLNLSRNHLVGSIPASIASMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  600



>gb|KDO78771.1| hypothetical protein CISIN_1g001816mg [Citrus sinensis]
Length=1010

 Score =   261 bits (666),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 174/202 (86%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPP  181
            N +TSHCTW  VTCDS  HV SLDLSGLNLSG LSPDV  L FL NLS+AANQLSGP+PP
Sbjct  45   NATTSHCTWPGVTCDSRRHVTSLDLSGLNLSGALSPDVAHLRFLQNLSVAANQLSGPIPP  104

Query  182  EISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLH  361
            EISA+S+LR LNLSNN+F  +FP QL+QLA+LQVLDLYNNN+TGDLP+ V ++ +LRHLH
Sbjct  105  EISALSSLRLLNLSNNVFNGSFPPQLSQLASLQVLDLYNNNMTGDLPLAVTQLRNLRHLH  164

Query  362  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            LGGN+FSG+IPPEYG +  LEYLAVSGN L G IP EIGNLTKL++LYIGY+N ++GG+P
Sbjct  165  LGGNFFSGQIPPEYGIWEFLEYLAVSGNELGGKIPGEIGNLTKLQQLYIGYYNSYTGGLP  224

Query  542  PEMGNLSQLIRXDAANCGLTGE  607
            PE+GNLS L+R DAANCGL+GE
Sbjct  225  PEIGNLSSLVRFDAANCGLSGE  246


 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 84/174 (48%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  362  KLTGTLPPDMCAGNCLQTLITLGNFLFGPIPESLGKCDSLSRMRMGENFLNGSIPKGLFG  421

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L +L  ++L +N LTG  PV      +L  + L  N  SG +P   G+F  ++ L + GN
Sbjct  422  LPSLSQVELQDNYLTGQFPVSDSISVNLGQICLSNNQLSGSLPASIGKFSGVQKLLLDGN  481

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              SG IP+EIG L +L ++   + N FSG I PE+     L   D +   L+GE
Sbjct  482  KFSGQIPAEIGKLQQLSKMDFSH-NKFSGRIAPEISQCKLLTFVDLSRNELSGE  534


 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 84/162 (52%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG +  D+G+L  L  L +  N LSGP+  E+  + +L+ ++LSNNIF    P   A+L
Sbjct  243  LSGEIPTDIGRLQNLDTLFLQVNALSGPLTTELGYLKSLKSMDLSNNIFTGEIPASFAEL  302

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  +  M  L  L L  N F+G IP   G    L  L +S N 
Sbjct  303  KNLTLLNLFRNKLHGAIPEFIGVMPRLEVLQLWENNFTGSIPQRLGSNGKLRILDLSSNK  362

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P ++     L+ L I   N   G IP  +G    L R
Sbjct  363  LTGTLPPDMCAGNCLQTL-ITLGNFLFGPIPESLGKCDSLSR  403


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 81/162 (50%), Gaps = 2/162 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            N++G L   V QL  L +L +  N  SG +PPE      L +L +S N  G   P ++  
Sbjct  145  NMTGDLPLAVTQLRNLRHLHLGGNFFSGQIPPEYGIWEFLEYLAVSGNELGGKIPGEIGN  204

Query  266  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            L  LQ L + Y N+ TG LP E+  ++SL          SG IP + GR  NL+ L +  
Sbjct  205  LTKLQQLYIGYYNSYTGGLPPEIGNLSSLVRFDAANCGLSGEIPTDIGRLQNLDTLFLQV  264

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQL  568
            N LSG + +E+G L  LK + +   N F+G IP     L  L
Sbjct  265  NALSGPLTTELGYLKSLKSMDLSN-NIFTGEIPASFAELKNL  305


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/173 (34%), Positives = 88/173 (51%), Gaps = 2/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            L G +  ++G L  L  L I   N  +G +PPEI  +S+L   + +N       P  + +
Sbjct  194  LGGKIPGEIGNLTKLQQLYIGYYNSYTGGLPPEIGNLSSLVRFDAANCGLSGEIPTDIGR  253

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L NL  L L  N L+G L  E+  + SL+ + L  N F+G IP  +    NL  L +  N
Sbjct  254  LQNLDTLFLQVNALSGPLTTELGYLKSLKSMDLSNNIFTGEIPASFAELKNLTLLNLFRN  313

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             L G IP  IG + +L+ L + + N F+G IP  +G+  +L   D ++  LTG
Sbjct  314  KLHGAIPEFIGVMPRLEVLQL-WENNFTGSIPQRLGSNGKLRILDLSSNKLTG  365


 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 54/175 (31%), Positives = 94/175 (54%), Gaps = 3/175 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +G +   +G    L  L +++N+L+G +PP++ A + L+  + L N +FG   P  L 
Sbjct  338  NFTGSIPQRLGSNGKLRILDLSSNKLTGTLPPDMCAGNCLQTLITLGNFLFG-PIPESLG  396

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            +  +L  + +  N L G +P  ++ + SL  + L  NY +G+ P       NL  + +S 
Sbjct  397  KCDSLSRMRMGENFLNGSIPKGLFGLPSLSQVELQDNYLTGQFPVSDSISVNLGQICLSN  456

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            N LSG +P+ IG  + +++L +   N FSG IP E+G L QL + D ++   +G 
Sbjct  457  NQLSGSLPASIGKFSGVQKLLLDG-NKFSGQIPAEIGKLQQLSKMDFSHNKFSGR  510


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 77/153 (50%), Gaps = 1/153 (1%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
            +G L P++G L  LV    A   LSG +P +I  +  L  L L  N        +L  L 
Sbjct  220  TGGLPPEIGNLSSLVRFDAANCGLSGEIPTDIGRLQNLDTLFLQVNALSGPLTTELGYLK  279

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
            +L+ +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N  
Sbjct  280  SLKSMDLSNNIFTGEIPASFAELKNLTLLNLFRNKLHGAIPEFIGVMPRLEVLQLWENNF  339

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            +G IP  +G+  KL+ L +   N  +G +PP+M
Sbjct  340  TGSIPQRLGSNGKLRILDLSS-NKLTGTLPPDM  371


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 77/161 (48%), Gaps = 1/161 (1%)
 Frame = +2

Query  122  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  301
            LP L  + +  N L+G  P   S    L  + LSNN    + P  + + + +Q L L  N
Sbjct  422  LPSLSQVELQDNYLTGQFPVSDSISVNLGQICLSNNQLSGSLPASIGKFSGVQKLLLDGN  481

Query  302  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGN  481
              +G +P E+ K+  L  +    N FSGRI PE  +   L ++ +S N LSG IP+++  
Sbjct  482  KFSGQIPAEIGKLQQLSKMDFSHNKFSGRIAPEISQCKLLTFVDLSRNELSGEIPNQLTG  541

Query  482  LTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            +  L  L +   N   G IP  + ++  L   D +   L+G
Sbjct  542  MRILNYLNLSR-NHLVGSIPASIASMQSLTSVDFSYNNLSG  581


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 59/120 (49%), Gaps = 1/120 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
              SG +  ++G+L  L  +  + N+ SG + PEIS    L F++LS N      P+QL  
Sbjct  482  KFSGQIPAEIGKLQQLSKMDFSHNKFSGRIAPEISQCKLLTFVDLSRNELSGEIPNQLTG  541

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            +  L  L+L  N+L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  542  MRILNYLNLSRNHLVGSIPASIASMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  600



>ref|XP_006426178.1| hypothetical protein CICLE_v10024796mg [Citrus clementina]
 gb|ESR39418.1| hypothetical protein CICLE_v10024796mg [Citrus clementina]
Length=1012

 Score =   261 bits (666),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 174/202 (86%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPP  181
            N +TSHCTW  VTCDS  HV SLDLSGLNLSG LSPDV  L FL NLS+AANQLSGP+PP
Sbjct  47   NATTSHCTWPGVTCDSRRHVTSLDLSGLNLSGALSPDVAHLRFLQNLSVAANQLSGPIPP  106

Query  182  EISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLH  361
            EISA+S+LR LNLSNN+F  +FP QL+QLA+LQVLDLYNNN+TGDLP+ V ++ +LRHLH
Sbjct  107  EISALSSLRLLNLSNNVFNGSFPPQLSQLASLQVLDLYNNNMTGDLPLAVTQLRNLRHLH  166

Query  362  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            LGGN+FSG+IPPEYG +  LEYLAVSGN L G IP EIGNLTKL++LYIGY+N ++GG+P
Sbjct  167  LGGNFFSGQIPPEYGIWEFLEYLAVSGNELGGKIPGEIGNLTKLQQLYIGYYNSYTGGLP  226

Query  542  PEMGNLSQLIRXDAANCGLTGE  607
            PE+GNLS L+R DAANCGL+GE
Sbjct  227  PEIGNLSSLVRFDAANCGLSGE  248


 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 84/174 (48%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  364  KLTGTLPPDMCAGNCLQTLITLGNFLFGPIPESLGKCDSLSRMRMGENFLNGSIPKGLFG  423

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L +L  ++L +N LTG  PV      +L  + L  N  SG +P   G+F  ++ L + GN
Sbjct  424  LPSLSQVELQDNYLTGQFPVSDSISVNLGQICLSNNQLSGSLPASIGKFSGVQKLLLDGN  483

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              SG IP+EIG L +L ++   + N FSG I PE+     L   D +   L+GE
Sbjct  484  KFSGQIPAEIGKLQQLSKMDFSH-NKFSGRIAPEISQCKLLTFVDLSRNELSGE  536


 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 84/162 (52%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG +  D+G+L  L  L +  N LSGP+  E+  + +L+ ++LSNNIF    P   A+L
Sbjct  245  LSGEIPTDIGRLQNLDTLFLQVNALSGPLTTELGYLKSLKSMDLSNNIFTGEIPASFAEL  304

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  +  M  L  L L  N F+G IP   G    L  L +S N 
Sbjct  305  KNLTLLNLFRNKLHGAIPEFIGVMPRLEVLQLWENNFTGSIPQRLGSNGKLRILDLSSNK  364

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P ++     L+ L I   N   G IP  +G    L R
Sbjct  365  LTGTLPPDMCAGNCLQTL-ITLGNFLFGPIPESLGKCDSLSR  405


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 81/162 (50%), Gaps = 2/162 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            N++G L   V QL  L +L +  N  SG +PPE      L +L +S N  G   P ++  
Sbjct  147  NMTGDLPLAVTQLRNLRHLHLGGNFFSGQIPPEYGIWEFLEYLAVSGNELGGKIPGEIGN  206

Query  266  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            L  LQ L + Y N+ TG LP E+  ++SL          SG IP + GR  NL+ L +  
Sbjct  207  LTKLQQLYIGYYNSYTGGLPPEIGNLSSLVRFDAANCGLSGEIPTDIGRLQNLDTLFLQV  266

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQL  568
            N LSG + +E+G L  LK + +   N F+G IP     L  L
Sbjct  267  NALSGPLTTELGYLKSLKSMDLSN-NIFTGEIPASFAELKNL  307


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/173 (34%), Positives = 88/173 (51%), Gaps = 2/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            L G +  ++G L  L  L I   N  +G +PPEI  +S+L   + +N       P  + +
Sbjct  196  LGGKIPGEIGNLTKLQQLYIGYYNSYTGGLPPEIGNLSSLVRFDAANCGLSGEIPTDIGR  255

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L NL  L L  N L+G L  E+  + SL+ + L  N F+G IP  +    NL  L +  N
Sbjct  256  LQNLDTLFLQVNALSGPLTTELGYLKSLKSMDLSNNIFTGEIPASFAELKNLTLLNLFRN  315

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             L G IP  IG + +L+ L + + N F+G IP  +G+  +L   D ++  LTG
Sbjct  316  KLHGAIPEFIGVMPRLEVLQL-WENNFTGSIPQRLGSNGKLRILDLSSNKLTG  367


 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 54/175 (31%), Positives = 94/175 (54%), Gaps = 3/175 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +G +   +G    L  L +++N+L+G +PP++ A + L+  + L N +FG   P  L 
Sbjct  340  NFTGSIPQRLGSNGKLRILDLSSNKLTGTLPPDMCAGNCLQTLITLGNFLFG-PIPESLG  398

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            +  +L  + +  N L G +P  ++ + SL  + L  NY +G+ P       NL  + +S 
Sbjct  399  KCDSLSRMRMGENFLNGSIPKGLFGLPSLSQVELQDNYLTGQFPVSDSISVNLGQICLSN  458

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            N LSG +P+ IG  + +++L +   N FSG IP E+G L QL + D ++   +G 
Sbjct  459  NQLSGSLPASIGKFSGVQKLLLDG-NKFSGQIPAEIGKLQQLSKMDFSHNKFSGR  512


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 77/153 (50%), Gaps = 1/153 (1%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
            +G L P++G L  LV    A   LSG +P +I  +  L  L L  N        +L  L 
Sbjct  222  TGGLPPEIGNLSSLVRFDAANCGLSGEIPTDIGRLQNLDTLFLQVNALSGPLTTELGYLK  281

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
            +L+ +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N  
Sbjct  282  SLKSMDLSNNIFTGEIPASFAELKNLTLLNLFRNKLHGAIPEFIGVMPRLEVLQLWENNF  341

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            +G IP  +G+  KL+ L +   N  +G +PP+M
Sbjct  342  TGSIPQRLGSNGKLRILDLSS-NKLTGTLPPDM  373


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 77/161 (48%), Gaps = 1/161 (1%)
 Frame = +2

Query  122  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  301
            LP L  + +  N L+G  P   S    L  + LSNN    + P  + + + +Q L L  N
Sbjct  424  LPSLSQVELQDNYLTGQFPVSDSISVNLGQICLSNNQLSGSLPASIGKFSGVQKLLLDGN  483

Query  302  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGN  481
              +G +P E+ K+  L  +    N FSGRI PE  +   L ++ +S N LSG IP+++  
Sbjct  484  KFSGQIPAEIGKLQQLSKMDFSHNKFSGRIAPEISQCKLLTFVDLSRNELSGEIPNQLTG  543

Query  482  LTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            +  L  L +   N   G IP  + ++  L   D +   L+G
Sbjct  544  MRILNYLNLSR-NHLVGSIPASIASMQSLTSVDFSYNNLSG  583


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 59/120 (49%), Gaps = 1/120 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
              SG +  ++G+L  L  +  + N+ SG + PEIS    L F++LS N      P+QL  
Sbjct  484  KFSGQIPAEIGKLQQLSKMDFSHNKFSGRIAPEISQCKLLTFVDLSRNELSGEIPNQLTG  543

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            +  L  L+L  N+L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  544  MRILNYLNLSRNHLVGSIPASIASMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  602



>emb|CBI35733.3| unnamed protein product [Vitis vinifera]
Length=948

 Score =   260 bits (664),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 136/202 (67%), Positives = 165/202 (82%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPP  181
            NISTSHCTW  VTCD+  HVV+L+LSGLNLSG LS D+  L FLVNL++AANQ  GP+PP
Sbjct  70   NISTSHCTWTGVTCDARRHVVALNLSGLNLSGSLSSDIAHLRFLVNLTLAANQFVGPIPP  129

Query  182  EISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLH  361
            E+S +S LR LNLSNN+F  TFP QLA+L  L+VLDLYNNN+TGDLP+ V +M +LRHLH
Sbjct  130  ELSLVSGLRQLNLSNNVFNETFPSQLARLKRLEVLDLYNNNMTGDLPLAVTEMPNLRHLH  189

Query  362  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            LGGN+F+G IPP YG++  LEYLAVSGN L G IP EIGNLT L++LY+GY+N + GGIP
Sbjct  190  LGGNFFTGIIPPAYGQWEFLEYLAVSGNELHGPIPPEIGNLTSLQQLYVGYYNTYDGGIP  249

Query  542  PEMGNLSQLIRXDAANCGLTGE  607
            PE+GNL+ L+R D ANC L+GE
Sbjct  250  PEIGNLTSLVRLDMANCLLSGE  271


 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 89/162 (55%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P++G+L  L  L +  N LSGP+ PE+  + +L+ ++LSNN+     P   A+L
Sbjct  268  LSGEIPPEIGKLQNLDTLFLQVNTLSGPLTPELGNLKSLKSMDLSNNVLAGEIPEAFAEL  327

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   G+   L+ L VS N 
Sbjct  328  KNLTLLNLFRNKLHGAIPEFIGDLPELEVLQLWENNFTGSIPQGLGKNGKLQLLDVSSNK  387

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P ++ +  +L+ L I   N   G IP  +G    L R
Sbjct  388  LTGNLPPDMCSGNRLQTL-ITLGNFLFGPIPESLGRCESLSR  428


 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 97/197 (49%), Gaps = 26/197 (13%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR--------------------  208
             +G++ P  GQ  FL  L+++ N+L GP+PPEI  +++L+                    
Sbjct  195  FTGIIPPAYGQWEFLEYLAVSGNELHGPIPPEIGNLTSLQQLYVGYYNTYDGGIPPEIGN  254

Query  209  -----FLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGN  373
                  L+++N +     P ++ +L NL  L L  N L+G L  E+  + SL+ + L  N
Sbjct  255  LTSLVRLDMANCLLSGEIPPEIGKLQNLDTLFLQVNTLSGPLTPELGNLKSLKSMDLSNN  314

Query  374  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
              +G IP  +    NL  L +  N L G IP  IG+L +L+ L + + N F+G IP  +G
Sbjct  315  VLAGEIPEAFAELKNLTLLNLFRNKLHGAIPEFIGDLPELEVLQL-WENNFTGSIPQGLG  373

Query  554  NLSQLIRXDAANCGLTG  604
               +L   D ++  LTG
Sbjct  374  KNGKLQLLDVSSNKLTG  390


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 78/153 (51%), Gaps = 1/153 (1%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
             G + P++G L  LV L +A   LSG +PPEI  +  L  L L  N        +L  L 
Sbjct  245  DGGIPPEIGNLTSLVRLDMANCLLSGEIPPEIGKLQNLDTLFLQVNTLSGPLTPELGNLK  304

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
            +L+ +DL NN L G++P    ++ +L  L+L  N   G IP   G  P LE L +  N  
Sbjct  305  SLKSMDLSNNVLAGEIPEAFAELKNLTLLNLFRNKLHGAIPEFIGDLPELEVLQLWENNF  364

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            +G IP  +G   KL+ L +   N  +G +PP+M
Sbjct  365  TGSIPQGLGKNGKLQLLDVSS-NKLTGNLPPDM  396


 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/175 (31%), Positives = 96/175 (55%), Gaps = 3/175 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +G +   +G+   L  L +++N+L+G +PP++ + + L+  + L N +FG   P  L 
Sbjct  363  NFTGSIPQGLGKNGKLQLLDVSSNKLTGNLPPDMCSGNRLQTLITLGNFLFGP-IPESLG  421

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            +  +L  + +  N L G +P  ++ +  L  + L  NY +G  P       +L  +++S 
Sbjct  422  RCESLSRIRMGENFLNGSIPKGLFDLPKLTQVELQDNYLTGEFPEIDSTPDSLGQISLSN  481

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            N L+G +P  +GN + L++L +   N FSG IPPE+G L QL + D +N   +GE
Sbjct  482  NQLTGSLPPSVGNFSGLQKLLLDG-NKFSGRIPPEIGMLQQLSKMDFSNNKFSGE  535


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 80/174 (46%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  387  KLTGNLPPDMCSGNRLQTLITLGNFLFGPIPESLGRCESLSRIRMGENFLNGSIPKGLFD  446

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N LTG+ P       SL  + L  N  +G +PP  G F  L+ L + GN
Sbjct  447  LPKLTQVELQDNYLTGEFPEIDSTPDSLGQISLSNNQLTGSLPPSVGNFSGLQKLLLDGN  506

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              SG IP EIG L +L ++     N FSG I PE+     L   D +   L G+
Sbjct  507  KFSGRIPPEIGMLQQLSKMDFSN-NKFSGEITPEISQCKVLTFVDLSRNELFGD  559


 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 55/162 (34%), Positives = 81/162 (50%), Gaps = 2/162 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            N++G L   V ++P L +L +  N  +G +PP       L +L +S N      P ++  
Sbjct  170  NMTGDLPLAVTEMPNLRHLHLGGNFFTGIIPPAYGQWEFLEYLAVSGNELHGPIPPEIGN  229

Query  266  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            L +LQ L + Y N   G +P E+  +TSL  L +     SG IPPE G+  NL+ L +  
Sbjct  230  LTSLQQLYVGYYNTYDGGIPPEIGNLTSLVRLDMANCLLSGEIPPEIGKLQNLDTLFLQV  289

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQL  568
            N LSG +  E+GNL  LK + +   N  +G IP     L  L
Sbjct  290  NTLSGPLTPELGNLKSLKSMDLSN-NVLAGEIPEAFAELKNL  330


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 65/127 (51%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P VG    L  L +  N+ SG +PPEI  +  L  ++ SNN F      +++Q
Sbjct  483  QLTGSLPPSVGNFSGLQKLLLDGNKFSGRIPPEIGMLQQLSKMDFSNNKFSGEITPEISQ  542

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  +DL  N L GD+P E+  M  L +L+L  N+  G IP       +L  +  S N
Sbjct  543  CKVLTFVDLSRNELFGDIPTEITGMRILNYLNLSRNHLIGSIPASLASMQSLTSVDFSYN  602

Query  446  GLSGVIP  466
             LSG++P
Sbjct  603  NLSGLVP  609


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 80/172 (47%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G +   +  LP L  + +  N L+G  P   S   +L  ++LSNN    + P  +   
Sbjct  436  LNGSIPKGLFDLPKLTQVELQDNYLTGEFPEIDSTPDSLGQISLSNNQLTGSLPPSVGNF  495

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
            + LQ L L  N  +G +P E+  +  L  +    N FSG I PE  +   L ++ +S N 
Sbjct  496  SGLQKLLLDGNKFSGRIPPEIGMLQQLSKMDFSNNKFSGEITPEISQCKVLTFVDLSRNE  555

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            L G IP+EI  +  L  L +   N   G IP  + ++  L   D +   L+G
Sbjct  556  LFGDIPTEITGMRILNYLNLSR-NHLIGSIPASLASMQSLTSVDFSYNNLSG  606


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/146 (32%), Positives = 71/146 (49%), Gaps = 2/146 (1%)
 Frame = +2

Query  107  PDVGQLP-FLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  283
            P++   P  L  +S++ NQL+G +PP +   S L+ L L  N F    P ++  L  L  
Sbjct  465  PEIDSTPDSLGQISLSNNQLTGSLPPSVGNFSGLQKLLLDGNKFSGRIPPEIGMLQQLSK  524

Query  284  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  463
            +D  NN  +G++  E+ +   L  + L  N   G IP E      L YL +S N L G I
Sbjct  525  MDFSNNKFSGEITPEISQCKVLTFVDLSRNELFGDIPTEITGMRILNYLNLSRNHLIGSI  584

Query  464  PSEIGNLTKLKELYIGYFNGFSGGIP  541
            P+ + ++  L  +   Y N  SG +P
Sbjct  585  PASLASMQSLTSVDFSY-NNLSGLVP  609



>ref|XP_010105101.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Morus notabilis]
 gb|EXC03886.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Morus notabilis]
Length=1021

 Score =   261 bits (666),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 164/202 (81%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPP  181
            N ST HCTW  +TCDS  HV SLDLSGLNLSG LSP++  L FL N+S+A NQ SGP+P 
Sbjct  51   NASTLHCTWFGITCDSRRHVTSLDLSGLNLSGSLSPELAYLRFLSNVSLADNQFSGPIPA  110

Query  182  EISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLH  361
            EISAIS LR LNLSNN+F  TFP +L+QL NLQ+LDLYNNN+TGDLP++V  + +LRHLH
Sbjct  111  EISAISGLRLLNLSNNVFNGTFPPELSQLKNLQILDLYNNNMTGDLPLDVVDLPNLRHLH  170

Query  362  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            LGGNYFSG IP EYGR+  LEYLAVSGN LSG IP EIG+LT L+ELYIGY+N + GG+P
Sbjct  171  LGGNYFSGAIPKEYGRWEFLEYLAVSGNELSGKIPPEIGSLTNLRELYIGYYNTYEGGLP  230

Query  542  PEMGNLSQLIRXDAANCGLTGE  607
             E+GNLS+L+R D ANC L+GE
Sbjct  231  AEIGNLSELVRFDGANCALSGE  252


 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 90/162 (56%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P++G+L  L  L +  N LSG + PE+ ++++L+ ++LSNN+     P   A+L
Sbjct  249  LSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGSLNSLKSMDLSNNMLSGEIPPSFAEL  308

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP   GR   L+ L +S N 
Sbjct  309  KNLTLLNLFRNKLHGAIPEFIGELPELEVLQLWENNFTGSIPQGLGRNGKLQLLDLSSNK  368

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P ++ +  +L  L I   N   G IP  +G    L R
Sbjct  369  LTGTLPPDMCSGHRLHTL-ITLGNFLFGPIPESLGKCQSLSR  409


 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 88/173 (51%), Gaps = 1/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L+P++G L  L ++ ++ N LSG +PP  + +  L  LNL  N      P  + +L
Sbjct  273  LSGSLTPELGSLNSLKSMDLSNNMLSGEIPPSFAELKNLTLLNLFRNKLHGAIPEFIGEL  332

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L+VL L+ NN TG +P  + +   L+ L L  N  +G +PP+      L  L   GN 
Sbjct  333  PELEVLQLWENNFTGSIPQGLGRNGKLQLLDLSSNKLTGTLPPDMCSGHRLHTLITLGNF  392

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            L G IP  +G    L  + +G  N  +G IP  +  L +L + +  +  L+G+
Sbjct  393  LFGPIPESLGKCQSLSRIRMGE-NFLNGSIPKGLFGLPKLTQVELQDNLLSGD  444


 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 82/175 (47%), Gaps = 2/175 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  368  KLTGTLPPDMCSGHRLHTLITLGNFLFGPIPESLGKCQSLSRIRMGENFLNGSIPKGLFG  427

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTS-LRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            L  L  ++L +N L+GD P       + L  + L  N  SG +PP  G F  ++ L + G
Sbjct  428  LPKLTQVELQDNLLSGDFPESDGTFAANLGQISLSNNQLSGSLPPSIGNFSGVQKLLLDG  487

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            N  SG IP EIG L ++ ++   + N FSG I PE+     L   D +   L+GE
Sbjct  488  NKFSGRIPPEIGRLQQVSKIDFSH-NKFSGLITPEISQCKVLTFVDLSRNELSGE  541


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/152 (35%), Positives = 77/152 (51%), Gaps = 1/152 (1%)
 Frame = +2

Query  95   GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  274
            G L  ++G L  LV    A   LSG +PPEI  +  L  L L  N    +   +L  L +
Sbjct  227  GGLPAEIGNLSELVRFDGANCALSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGSLNS  286

Query  275  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  454
            L+ +DL NN L+G++P    ++ +L  L+L  N   G IP   G  P LE L +  N  +
Sbjct  287  LKSMDLSNNMLSGEIPPSFAELKNLTLLNLFRNKLHGAIPEFIGELPELEVLQLWENNFT  346

Query  455  GVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            G IP  +G   KL+ L +   N  +G +PP+M
Sbjct  347  GSIPQGLGRNGKLQLLDLSS-NKLTGTLPPDM  377


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 66/127 (52%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             LSG L P +G    +  L +  N+ SG +PPEI  +  +  ++ S+N F      +++Q
Sbjct  465  QLSGSLPPSIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQVSKIDFSHNKFSGLITPEISQ  524

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  +DL  N L+G++P E+  M  L +L+L  N+  G IP       +L  +  S N
Sbjct  525  CKVLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNHLVGNIPSSIASMQSLTSVDFSYN  584

Query  446  GLSGVIP  466
             LSG++P
Sbjct  585  NLSGLVP  591


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 73/150 (49%), Gaps = 7/150 (5%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
             G  + ++GQ+      S++ NQLSG +PP I   S ++ L L  N F    P ++ +L 
Sbjct  449  DGTFAANLGQI------SLSNNQLSGSLPPSIGNFSGVQKLLLDGNKFSGRIPPEIGRLQ  502

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
             +  +D  +N  +G +  E+ +   L  + L  N  SG IP E      L YL +S N L
Sbjct  503  QVSKIDFSHNKFSGLITPEISQCKVLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNHL  562

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
             G IPS I ++  L  +   Y N  SG +P
Sbjct  563  VGNIPSSIASMQSLTSVDFSY-NNLSGLVP  591



>ref|XP_003635561.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Vitis vinifera]
Length=1017

 Score =   260 bits (664),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 136/202 (67%), Positives = 165/202 (82%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPP  181
            NISTSHCTW  VTCD+  HVV+L+LSGLNLSG LS D+  L FLVNL++AANQ  GP+PP
Sbjct  51   NISTSHCTWTGVTCDARRHVVALNLSGLNLSGSLSSDIAHLRFLVNLTLAANQFVGPIPP  110

Query  182  EISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLH  361
            E+S +S LR LNLSNN+F  TFP QLA+L  L+VLDLYNNN+TGDLP+ V +M +LRHLH
Sbjct  111  ELSLVSGLRQLNLSNNVFNETFPSQLARLKRLEVLDLYNNNMTGDLPLAVTEMPNLRHLH  170

Query  362  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            LGGN+F+G IPP YG++  LEYLAVSGN L G IP EIGNLT L++LY+GY+N + GGIP
Sbjct  171  LGGNFFTGIIPPAYGQWEFLEYLAVSGNELHGPIPPEIGNLTSLQQLYVGYYNTYDGGIP  230

Query  542  PEMGNLSQLIRXDAANCGLTGE  607
            PE+GNL+ L+R D ANC L+GE
Sbjct  231  PEIGNLTSLVRLDMANCLLSGE  252


 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 89/162 (55%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P++G+L  L  L +  N LSGP+ PE+  + +L+ ++LSNN+     P   A+L
Sbjct  249  LSGEIPPEIGKLQNLDTLFLQVNTLSGPLTPELGNLKSLKSMDLSNNVLAGEIPEAFAEL  308

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   G+   L+ L VS N 
Sbjct  309  KNLTLLNLFRNKLHGAIPEFIGDLPELEVLQLWENNFTGSIPQGLGKNGKLQLLDVSSNK  368

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P ++ +  +L+ L I   N   G IP  +G    L R
Sbjct  369  LTGNLPPDMCSGNRLQTL-ITLGNFLFGPIPESLGRCESLSR  409


 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 97/197 (49%), Gaps = 26/197 (13%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR--------------------  208
             +G++ P  GQ  FL  L+++ N+L GP+PPEI  +++L+                    
Sbjct  176  FTGIIPPAYGQWEFLEYLAVSGNELHGPIPPEIGNLTSLQQLYVGYYNTYDGGIPPEIGN  235

Query  209  -----FLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGN  373
                  L+++N +     P ++ +L NL  L L  N L+G L  E+  + SL+ + L  N
Sbjct  236  LTSLVRLDMANCLLSGEIPPEIGKLQNLDTLFLQVNTLSGPLTPELGNLKSLKSMDLSNN  295

Query  374  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
              +G IP  +    NL  L +  N L G IP  IG+L +L+ L + + N F+G IP  +G
Sbjct  296  VLAGEIPEAFAELKNLTLLNLFRNKLHGAIPEFIGDLPELEVLQL-WENNFTGSIPQGLG  354

Query  554  NLSQLIRXDAANCGLTG  604
               +L   D ++  LTG
Sbjct  355  KNGKLQLLDVSSNKLTG  371


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 78/153 (51%), Gaps = 1/153 (1%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
             G + P++G L  LV L +A   LSG +PPEI  +  L  L L  N        +L  L 
Sbjct  226  DGGIPPEIGNLTSLVRLDMANCLLSGEIPPEIGKLQNLDTLFLQVNTLSGPLTPELGNLK  285

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
            +L+ +DL NN L G++P    ++ +L  L+L  N   G IP   G  P LE L +  N  
Sbjct  286  SLKSMDLSNNVLAGEIPEAFAELKNLTLLNLFRNKLHGAIPEFIGDLPELEVLQLWENNF  345

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            +G IP  +G   KL+ L +   N  +G +PP+M
Sbjct  346  TGSIPQGLGKNGKLQLLDVSS-NKLTGNLPPDM  377


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/175 (31%), Positives = 96/175 (55%), Gaps = 3/175 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +G +   +G+   L  L +++N+L+G +PP++ + + L+  + L N +FG   P  L 
Sbjct  344  NFTGSIPQGLGKNGKLQLLDVSSNKLTGNLPPDMCSGNRLQTLITLGNFLFGP-IPESLG  402

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            +  +L  + +  N L G +P  ++ +  L  + L  NY +G  P       +L  +++S 
Sbjct  403  RCESLSRIRMGENFLNGSIPKGLFDLPKLTQVELQDNYLTGEFPEIDSTPDSLGQISLSN  462

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            N L+G +P  +GN + L++L +   N FSG IPPE+G L QL + D +N   +GE
Sbjct  463  NQLTGSLPPSVGNFSGLQKLLLDG-NKFSGRIPPEIGMLQQLSKMDFSNNKFSGE  516


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 80/174 (46%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  368  KLTGNLPPDMCSGNRLQTLITLGNFLFGPIPESLGRCESLSRIRMGENFLNGSIPKGLFD  427

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N LTG+ P       SL  + L  N  +G +PP  G F  L+ L + GN
Sbjct  428  LPKLTQVELQDNYLTGEFPEIDSTPDSLGQISLSNNQLTGSLPPSVGNFSGLQKLLLDGN  487

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              SG IP EIG L +L ++     N FSG I PE+     L   D +   L G+
Sbjct  488  KFSGRIPPEIGMLQQLSKMDFSN-NKFSGEITPEISQCKVLTFVDLSRNELFGD  540


 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 55/162 (34%), Positives = 81/162 (50%), Gaps = 2/162 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            N++G L   V ++P L +L +  N  +G +PP       L +L +S N      P ++  
Sbjct  151  NMTGDLPLAVTEMPNLRHLHLGGNFFTGIIPPAYGQWEFLEYLAVSGNELHGPIPPEIGN  210

Query  266  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            L +LQ L + Y N   G +P E+  +TSL  L +     SG IPPE G+  NL+ L +  
Sbjct  211  LTSLQQLYVGYYNTYDGGIPPEIGNLTSLVRLDMANCLLSGEIPPEIGKLQNLDTLFLQV  270

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQL  568
            N LSG +  E+GNL  LK + +   N  +G IP     L  L
Sbjct  271  NTLSGPLTPELGNLKSLKSMDLSN-NVLAGEIPEAFAELKNL  311


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 65/127 (51%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P VG    L  L +  N+ SG +PPEI  +  L  ++ SNN F      +++Q
Sbjct  464  QLTGSLPPSVGNFSGLQKLLLDGNKFSGRIPPEIGMLQQLSKMDFSNNKFSGEITPEISQ  523

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  +DL  N L GD+P E+  M  L +L+L  N+  G IP       +L  +  S N
Sbjct  524  CKVLTFVDLSRNELFGDIPTEITGMRILNYLNLSRNHLIGSIPASLASMQSLTSVDFSYN  583

Query  446  GLSGVIP  466
             LSG++P
Sbjct  584  NLSGLVP  590


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 80/172 (47%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G +   +  LP L  + +  N L+G  P   S   +L  ++LSNN    + P  +   
Sbjct  417  LNGSIPKGLFDLPKLTQVELQDNYLTGEFPEIDSTPDSLGQISLSNNQLTGSLPPSVGNF  476

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
            + LQ L L  N  +G +P E+  +  L  +    N FSG I PE  +   L ++ +S N 
Sbjct  477  SGLQKLLLDGNKFSGRIPPEIGMLQQLSKMDFSNNKFSGEITPEISQCKVLTFVDLSRNE  536

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            L G IP+EI  +  L  L +   N   G IP  + ++  L   D +   L+G
Sbjct  537  LFGDIPTEITGMRILNYLNLSR-NHLIGSIPASLASMQSLTSVDFSYNNLSG  587


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/146 (32%), Positives = 71/146 (49%), Gaps = 2/146 (1%)
 Frame = +2

Query  107  PDVGQLP-FLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  283
            P++   P  L  +S++ NQL+G +PP +   S L+ L L  N F    P ++  L  L  
Sbjct  446  PEIDSTPDSLGQISLSNNQLTGSLPPSVGNFSGLQKLLLDGNKFSGRIPPEIGMLQQLSK  505

Query  284  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  463
            +D  NN  +G++  E+ +   L  + L  N   G IP E      L YL +S N L G I
Sbjct  506  MDFSNNKFSGEITPEISQCKVLTFVDLSRNELFGDIPTEITGMRILNYLNLSRNHLIGSI  565

Query  464  PSEIGNLTKLKELYIGYFNGFSGGIP  541
            P+ + ++  L  +   Y N  SG +P
Sbjct  566  PASLASMQSLTSVDFSY-NNLSGLVP  590



>ref|XP_006404116.1| hypothetical protein EUTSA_v10010092mg [Eutrema salsugineum]
 gb|ESQ45569.1| hypothetical protein EUTSA_v10010092mg [Eutrema salsugineum]
Length=1009

 Score =   259 bits (663),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 155/204 (76%), Gaps = 2/204 (1%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVP  178
             +STS C W  VTCD     V+      LNLSG LS DV  LP L NLS+AANQ+SGP+P
Sbjct  63   KLSTSFCLWTGVTCDVSRRHVTSLDLSGLNLSGTLSSDVAHLPLLQNLSVAANQISGPIP  122

Query  179  PEISAISTLRFLNLSNNIFGSTFPHQL-AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRH  355
            PEIS +S LR LNLSNNIF  ++P +L A L NLQVLDLYNNNLTGDLPV +  +T LRH
Sbjct  123  PEISNLSELRHLNLSNNIFNGSYPDELSAGLVNLQVLDLYNNNLTGDLPVSITNLTQLRH  182

Query  356  LHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGG  535
            LHLGGNYF+G IP  YG +P LEYLAVSGN L G IP EIGNLT L+ELYIGY+N F  G
Sbjct  183  LHLGGNYFAGNIPAVYGTWPVLEYLAVSGNELVGKIPPEIGNLTSLRELYIGYYNAFEDG  242

Query  536  IPPEMGNLSQLIRXDAANCGLTGE  607
            +PPE+GNLS+L+R DAANCGLTGE
Sbjct  243  LPPEIGNLSELVRFDAANCGLTGE  266


 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 85/162 (52%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G + P++ +L  L  L +  N  SGP+ PE+  IS+L+ ++LSNN+F    P    QL
Sbjct  263  LTGEIPPEIWKLQKLDTLFLQVNAFSGPLTPELGMISSLKSMDLSNNMFTGEIPASFEQL  322

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP + G    L  L +S N 
Sbjct  323  KNLTLLNLFRNKLYGAIPEFIGDLPELEVLQLWENNFTGSIPQKLGENGKLVILDLSSNK  382

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P  + +  +L  L I   N   G IP  +G    L R
Sbjct  383  LTGTLPPNMCSGNRLMTL-ITLGNFLFGSIPDSLGECESLTR  423


 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 95/188 (51%), Gaps = 26/188 (14%)
 Frame = +2

Query  116  GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQLANLQVLDL  292
            G  P L  L+++ N+L G +PPEI  +++LR L +   N F    P ++  L+ L   D 
Sbjct  199  GTWPVLEYLAVSGNELVGKIPPEIGNLTSLRELYIGYYNAFEDGLPPEIGNLSELVRFDA  258

Query  293  YNNNLTGDLPVEVYKM------------------------TSLRHLHLGGNYFSGRIPPE  400
             N  LTG++P E++K+                        +SL+ + L  N F+G IP  
Sbjct  259  ANCGLTGEIPPEIWKLQKLDTLFLQVNAFSGPLTPELGMISSLKSMDLSNNMFTGEIPAS  318

Query  401  YGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXD  580
            + +  NL  L +  N L G IP  IG+L +L+ L + + N F+G IP ++G   +L+  D
Sbjct  319  FEQLKNLTLLNLFRNKLYGAIPEFIGDLPELEVLQL-WENNFTGSIPQKLGENGKLVILD  377

Query  581  AANCGLTG  604
             ++  LTG
Sbjct  378  LSSNKLTG  385


 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 59/174 (34%), Positives = 86/174 (49%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P++     L+ L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  382  KLTGTLPPNMCSGNRLMTLITLGNFLFGSIPDSLGECESLTRIRMGENFLNGSIPKGLLG  441

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N LTG+LPV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  442  LPKLSQVELQDNYLTGELPVSGGVSVNLGQISLSNNQLSGPLPPAIGNFSGVQKLLLDGN  501

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              SG IPSEIG L +L +L   + N FSG I PE+ +   L   D +   L+GE
Sbjct  502  KFSGQIPSEIGRLQQLSKLDFSH-NLFSGRITPEISHCKLLTFVDLSRNELSGE  554


 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 53/157 (34%), Positives = 81/157 (52%), Gaps = 1/157 (1%)
 Frame = +2

Query  101  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  280
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N F      +L  +++L+
Sbjct  243  LPPEIGNLSELVRFDAANCGLTGEIPPEIWKLQKLDTLFLQVNAFSGPLTPELGMISSLK  302

Query  281  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  460
             +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N  +G 
Sbjct  303  SMDLSNNMFTGEIPASFEQLKNLTLLNLFRNKLYGAIPEFIGDLPELEVLQLWENNFTGS  362

Query  461  IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLI  571
            IP ++G   KL  L +   N  +G +PP M + ++L+
Sbjct  363  IPQKLGENGKLVILDLSS-NKLTGTLPPNMCSGNRLM  398


 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 94/175 (54%), Gaps = 3/175 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEI-SAISTLRFLNLSNNIFGSTFPHQLA  262
            N +G +   +G+   LV L +++N+L+G +PP + S    +  + L N +FGS  P  L 
Sbjct  358  NFTGSIPQKLGENGKLVILDLSSNKLTGTLPPNMCSGNRLMTLITLGNFLFGS-IPDSLG  416

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            +  +L  + +  N L G +P  +  +  L  + L  NY +G +P   G   NL  +++S 
Sbjct  417  ECESLTRIRMGENFLNGSIPKGLLGLPKLSQVELQDNYLTGELPVSGGVSVNLGQISLSN  476

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            N LSG +P  IGN + +++L +   N FSG IP E+G L QL + D ++   +G 
Sbjct  477  NQLSGPLPPAIGNFSGVQKLLLDG-NKFSGQIPSEIGRLQQLSKLDFSHNLFSGR  530


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 75/151 (50%), Gaps = 7/151 (5%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            +SG +S ++GQ+      S++ NQLSGP+PP I   S ++ L L  N F    P ++ +L
Sbjct  461  VSGGVSVNLGQI------SLSNNQLSGPLPPAIGNFSGVQKLLLDGNKFSGQIPSEIGRL  514

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  LD  +N  +G +  E+     L  + L  N  SG IP E      L YL +S N 
Sbjct  515  QQLSKLDFSHNLFSGRITPEISHCKLLTFVDLSRNELSGEIPNEITSMRILNYLNISRNH  574

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            L G IP  I ++  L  +   Y N  SG +P
Sbjct  575  LVGSIPVTIASMQSLTSVDFSY-NNLSGLVP  604


 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 51/161 (32%), Positives = 76/161 (47%), Gaps = 1/161 (1%)
 Frame = +2

Query  122  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  301
            LP L  + +  N L+G +P        L  ++LSNN      P  +   + +Q L L  N
Sbjct  442  LPKLSQVELQDNYLTGELPVSGGVSVNLGQISLSNNQLSGPLPPAIGNFSGVQKLLLDGN  501

Query  302  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGN  481
              +G +P E+ ++  L  L    N FSGRI PE      L ++ +S N LSG IP+EI +
Sbjct  502  KFSGQIPSEIGRLQQLSKLDFSHNLFSGRITPEISHCKLLTFVDLSRNELSGEIPNEITS  561

Query  482  LTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            +  L  L I   N   G IP  + ++  L   D +   L+G
Sbjct  562  MRILNYLNISR-NHLVGSIPVTIASMQSLTSVDFSYNNLSG  601


 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 66/128 (52%), Gaps = 0/128 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             LSG L P +G    +  L +  N+ SG +P EI  +  L  L+ S+N+F      +++ 
Sbjct  478  QLSGPLPPAIGNFSGVQKLLLDGNKFSGQIPSEIGRLQQLSKLDFSHNLFSGRITPEISH  537

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  +DL  N L+G++P E+  M  L +L++  N+  G IP       +L  +  S N
Sbjct  538  CKLLTFVDLSRNELSGEIPNEITSMRILNYLNISRNHLVGSIPVTIASMQSLTSVDFSYN  597

Query  446  GLSGVIPS  469
             LSG++PS
Sbjct  598  NLSGLVPS  605



>ref|NP_190536.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
 sp|Q9M2Z1.1|BAME2_ARATH RecName: Full=Leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2; AltName: Full=Protein BARELY ANY MERISTEM 
2; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB66905.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAO64138.1| putative leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 gb|AAP04098.1| putative leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 dbj|BAF00510.1| receptor protein kinase like protein [Arabidopsis thaliana]
 gb|ACN59331.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE78574.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
Length=1002

 Score =   259 bits (663),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 159/204 (78%), Gaps = 2/204 (1%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVP  178
            N+ST+ C+W  VTCD  L  V+      LNLSG LS DV  LP L NLS+AANQ+SGP+P
Sbjct  51   NLSTTFCSWTGVTCDVSLRHVTSLDLSGLNLSGTLSSDVAHLPLLQNLSLAANQISGPIP  110

Query  179  PEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANLQVLDLYNNNLTGDLPVEVYKMTSLRH  355
            P+IS +  LR LNLSNN+F  +FP +L+  L NL+VLDLYNNNLTGDLPV +  +T LRH
Sbjct  111  PQISNLYELRHLNLSNNVFNGSFPDELSSGLVNLRVLDLYNNNLTGDLPVSLTNLTQLRH  170

Query  356  LHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGG  535
            LHLGGNYFSG+IP  YG +P LEYLAVSGN L+G IP EIGNLT L+ELYIGY+N F  G
Sbjct  171  LHLGGNYFSGKIPATYGTWPVLEYLAVSGNELTGKIPPEIGNLTTLRELYIGYYNAFENG  230

Query  536  IPPEMGNLSQLIRXDAANCGLTGE  607
            +PPE+GNLS+L+R DAANCGLTGE
Sbjct  231  LPPEIGNLSELVRFDAANCGLTGE  254


 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 86/162 (53%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G + P++G+L  L  L +  N  +G +  E+  IS+L+ ++LSNN+F    P   +QL
Sbjct  251  LTGEIPPEIGKLQKLDTLFLQVNAFTGTITQELGLISSLKSMDLSNNMFTGEIPTSFSQL  310

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  + +M  L  L L  N F+G IP + G    L  L +S N 
Sbjct  311  KNLTLLNLFRNKLYGAIPEFIGEMPELEVLQLWENNFTGSIPQKLGENGRLVILDLSSNK  370

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P  + +  +L  L I   N   G IP  +G    L R
Sbjct  371  LTGTLPPNMCSGNRLMTL-ITLGNFLFGSIPDSLGKCESLTR  411


 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 61/197 (31%), Positives = 98/197 (50%), Gaps = 26/197 (13%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  265
             SG +    G  P L  L+++ N+L+G +PPEI  ++TLR L +   N F +  P ++  
Sbjct  178  FSGKIPATYGTWPVLEYLAVSGNELTGKIPPEIGNLTTLRELYIGYYNAFENGLPPEIGN  237

Query  266  LANLQVLDLYNNNLTGDLPVEVYKM------------------------TSLRHLHLGGN  373
            L+ L   D  N  LTG++P E+ K+                        +SL+ + L  N
Sbjct  238  LSELVRFDAANCGLTGEIPPEIGKLQKLDTLFLQVNAFTGTITQELGLISSLKSMDLSNN  297

Query  374  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
             F+G IP  + +  NL  L +  N L G IP  IG + +L+ L + + N F+G IP ++G
Sbjct  298  MFTGEIPTSFSQLKNLTLLNLFRNKLYGAIPEFIGEMPELEVLQL-WENNFTGSIPQKLG  356

Query  554  NLSQLIRXDAANCGLTG  604
               +L+  D ++  LTG
Sbjct  357  ENGRLVILDLSSNKLTG  373


 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 53/157 (34%), Positives = 82/157 (52%), Gaps = 1/157 (1%)
 Frame = +2

Query  101  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  280
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N F  T   +L  +++L+
Sbjct  231  LPPEIGNLSELVRFDAANCGLTGEIPPEIGKLQKLDTLFLQVNAFTGTITQELGLISSLK  290

Query  281  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  460
             +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N  +G 
Sbjct  291  SMDLSNNMFTGEIPTSFSQLKNLTLLNLFRNKLYGAIPEFIGEMPELEVLQLWENNFTGS  350

Query  461  IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLI  571
            IP ++G   +L  L +   N  +G +PP M + ++L+
Sbjct  351  IPQKLGENGRLVILDLSS-NKLTGTLPPNMCSGNRLM  386


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 63/222 (28%), Positives = 95/222 (43%), Gaps = 50/222 (23%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
             +G +     QL  L  L++  N+L G +P  I  +  L  L L  N F  + P +L + 
Sbjct  299  FTGEIPTSFSQLKNLTLLNLFRNKLYGAIPEFIGEMPELEVLQLWENNFTGSIPQKLGEN  358

Query  269  ANLQVLDLYNNNLTGDLPVEVY------------------------KMTSLRHLHLGGNY  376
              L +LDL +N LTG LP  +                         K  SL  + +G N+
Sbjct  359  GRLVILDLSSNKLTGTLPPNMCSGNRLMTLITLGNFLFGSIPDSLGKCESLTRIRMGENF  418

Query  377  FSGRIPPEYGRFPNLE-------------------------YLAVSGNGLSGVIPSEIGN  481
             +G IP E    P L                           +++S N LSG +P+ IGN
Sbjct  419  LNGSIPKELFGLPKLSQVELQDNYLTGELPISGGGVSGDLGQISLSNNQLSGSLPAAIGN  478

Query  482  LTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            L+ +++L +   N FSG IPPE+G L QL + D ++   +G 
Sbjct  479  LSGVQKLLLDG-NKFSGSIPPEIGRLQQLSKLDFSHNLFSGR  519


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/175 (31%), Positives = 84/175 (48%), Gaps = 2/175 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P++     L+ L    N L G +P  +    +L  + +  N    + P +L  
Sbjct  370  KLTGTLPPNMCSGNRLMTLITLGNFLFGSIPDSLGKCESLTRIRMGENFLNGSIPKELFG  429

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMT-SLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            L  L  ++L +N LTG+LP+    ++  L  + L  N  SG +P   G    ++ L + G
Sbjct  430  LPKLSQVELQDNYLTGELPISGGGVSGDLGQISLSNNQLSGSLPAAIGNLSGVQKLLLDG  489

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            N  SG IP EIG L +L +L   + N FSG I PE+     L   D +   L+G+
Sbjct  490  NKFSGSIPPEIGRLQQLSKLDFSH-NLFSGRIAPEISRCKLLTFVDLSRNELSGD  543


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 68/128 (53%), Gaps = 0/128 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             LSG L   +G L  +  L +  N+ SG +PPEI  +  L  L+ S+N+F      ++++
Sbjct  467  QLSGSLPAAIGNLSGVQKLLLDGNKFSGSIPPEIGRLQQLSKLDFSHNLFSGRIAPEISR  526

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  +DL  N L+GD+P E+  M  L +L+L  N+  G IP       +L  +  S N
Sbjct  527  CKLLTFVDLSRNELSGDIPNELTGMKILNYLNLSRNHLVGSIPVTIASMQSLTSVDFSYN  586

Query  446  GLSGVIPS  469
             LSG++PS
Sbjct  587  NLSGLVPS  594


 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 86/173 (50%), Gaps = 2/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAIS-TLRFLNLSNNIFGSTFPHQLAQ  265
            L+G +  ++  LP L  + +  N L+G +P     +S  L  ++LSNN    + P  +  
Sbjct  419  LNGSIPKELFGLPKLSQVELQDNYLTGELPISGGGVSGDLGQISLSNNQLSGSLPAAIGN  478

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L+ +Q L L  N  +G +P E+ ++  L  L    N FSGRI PE  R   L ++ +S N
Sbjct  479  LSGVQKLLLDGNKFSGSIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRCKLLTFVDLSRN  538

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             LSG IP+E+  +  L  L +   N   G IP  + ++  L   D +   L+G
Sbjct  539  ELSGDIPNELTGMKILNYLNLSR-NHLVGSIPVTIASMQSLTSVDFSYNNLSG  590



>ref|XP_010547579.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Tarenaya hassleriana]
Length=1015

 Score =   259 bits (662),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 158/204 (77%), Gaps = 2/204 (1%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVP  178
            N ST+ C W  VTCD+    V       LNLSG LSPD+  L  L NLS+A+NQ+SGP+P
Sbjct  54   NDSTTFCAWTGVTCDASGRHVISLDLSGLNLSGTLSPDIAHLFLLQNLSVASNQISGPIP  113

Query  179  PEISAISTLRFLNLSNNIFGSTFPHQL-AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRH  355
            PE+S++S LR+LNLSNN+F  +FP +L A   NL+VLDLYNNNLTGDLPV V  +T LRH
Sbjct  114  PEVSSLSGLRYLNLSNNVFNGSFPDELSAGAVNLRVLDLYNNNLTGDLPVSVTNLTHLRH  173

Query  356  LHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGG  535
            LHLGGNYF+GRIPP YG +P LEYLAVSGN L G IP EIGNLT L+ELYIGY+N F  G
Sbjct  174  LHLGGNYFAGRIPPAYGSWPVLEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDG  233

Query  536  IPPEMGNLSQLIRXDAANCGLTGE  607
            +PPE+GNLS+L+R DAANCGLTG+
Sbjct  234  LPPEIGNLSELVRFDAANCGLTGK  257


 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 91/162 (56%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G + P+VG+L  L  L +  N LSGP+  E+  +S+L+ ++LSNN+F    P   AQL
Sbjct  254  LTGKIPPEVGKLQKLDTLFLQVNALSGPLTTELGTLSSLKSMDLSNNMFTGEIPASFAQL  313

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP + G+   L++L +S N 
Sbjct  314  KNLTLLNLFRNKLHGAIPEFIGDLPQLEVLQLWENNFTGSIPQKLGQNGKLQFLDLSSNK  373

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P  + +  KL+ L I   N   G IP  +G    L R
Sbjct  374  LTGTLPPNLCSGNKLQTL-ITLSNFLFGSIPDSLGECESLTR  414


 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 63/197 (32%), Positives = 96/197 (49%), Gaps = 26/197 (13%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  265
             +G + P  G  P L  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  181  FAGRIPPAYGSWPVLEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  240

Query  266  LANLQVLDLYNNNLTGDLPVEVYKM------------------------TSLRHLHLGGN  373
            L+ L   D  N  LTG +P EV K+                        +SL+ + L  N
Sbjct  241  LSELVRFDAANCGLTGKIPPEVGKLQKLDTLFLQVNALSGPLTTELGTLSSLKSMDLSNN  300

Query  374  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
             F+G IP  + +  NL  L +  N L G IP  IG+L +L+ L + + N F+G IP ++G
Sbjct  301  MFTGEIPASFAQLKNLTLLNLFRNKLHGAIPEFIGDLPQLEVLQL-WENNFTGSIPQKLG  359

Query  554  NLSQLIRXDAANCGLTG  604
               +L   D ++  LTG
Sbjct  360  QNGKLQFLDLSSNKLTG  376


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 96/175 (55%), Gaps = 3/175 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +G +   +GQ   L  L +++N+L+G +PP + + + L+  + LSN +FGS  P  L 
Sbjct  349  NFTGSIPQKLGQNGKLQFLDLSSNKLTGTLPPNLCSGNKLQTLITLSNFLFGS-IPDSLG  407

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            +  +L  + +  N L G +P  ++ +  L  + L  NY SG  P       NL  +++S 
Sbjct  408  ECESLTRIRMGENFLNGSIPKGLFGLPKLSQVELQDNYLSGEFPVSGRVAVNLGQISLSN  467

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            N LSG +P  IGN   +++L +   N F+G IPP++G L QL + D ++  L+G 
Sbjct  468  NQLSGPLPPAIGNFYGVQKLLLDG-NKFTGPIPPQVGKLQQLSKMDISHNQLSGR  521


 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 52/174 (30%), Positives = 83/174 (48%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P++     L  L   +N L G +P  +    +L  + +  N    + P  L  
Sbjct  373  KLTGTLPPNLCSGNKLQTLITLSNFLFGSIPDSLGECESLTRIRMGENFLNGSIPKGLFG  432

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N L+G+ PV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  433  LPKLSQVELQDNYLSGEFPVSGRVAVNLGQISLSNNQLSGPLPPAIGNFYGVQKLLLDGN  492

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              +G IP ++G L +L ++ I + N  SG I PE+     L   D +   L+GE
Sbjct  493  KFTGPIPPQVGKLQQLSKMDISH-NQLSGRIAPEISQCKLLTFVDLSRNELSGE  545


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 78/151 (52%), Gaps = 7/151 (5%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            +SG ++ ++GQ+      S++ NQLSGP+PP I     ++ L L  N F    P Q+ +L
Sbjct  452  VSGRVAVNLGQI------SLSNNQLSGPLPPAIGNFYGVQKLLLDGNKFTGPIPPQVGKL  505

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  +D+ +N L+G +  E+ +   L  + L  N  SG IP E      L YL +S N 
Sbjct  506  QQLSKMDISHNQLSGRIAPEISQCKLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNH  565

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            L G IP+ + ++  L  +   Y N  SG +P
Sbjct  566  LVGPIPASVASMQSLTSVDFSY-NNLSGLVP  595


 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 67/127 (53%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             LSG L P +G    +  L +  N+ +GP+PP++  +  L  +++S+N        +++Q
Sbjct  469  QLSGPLPPAIGNFYGVQKLLLDGNKFTGPIPPQVGKLQQLSKMDISHNQLSGRIAPEISQ  528

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  +DL  N L+G++P E+  M  L +L+L  N+  G IP       +L  +  S N
Sbjct  529  CKLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNHLVGPIPASVASMQSLTSVDFSYN  588

Query  446  GLSGVIP  466
             LSG++P
Sbjct  589  NLSGLVP  595


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 51/161 (32%), Positives = 74/161 (46%), Gaps = 1/161 (1%)
 Frame = +2

Query  122  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  301
            LP L  + +  N LSG  P        L  ++LSNN      P  +     +Q L L  N
Sbjct  433  LPKLSQVELQDNYLSGEFPVSGRVAVNLGQISLSNNQLSGPLPPAIGNFYGVQKLLLDGN  492

Query  302  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGN  481
              TG +P +V K+  L  + +  N  SGRI PE  +   L ++ +S N LSG IP+EI  
Sbjct  493  KFTGPIPPQVGKLQQLSKMDISHNQLSGRIAPEISQCKLLTFVDLSRNELSGEIPNEITG  552

Query  482  LTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            +  L  L +   N   G IP  + ++  L   D +   L+G
Sbjct  553  MRILNYLNLSR-NHLVGPIPASVASMQSLTSVDFSYNNLSG  592



>ref|NP_001237715.1| receptor-like protein kinase 2 precursor [Glycine max]
 gb|AAF91323.1|AF244889_1 receptor-like protein kinase 2 [Glycine max]
Length=1012

 Score =   259 bits (662),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 131/202 (65%), Positives = 165/202 (82%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPP  181
            N S  +C+W  VTCD+  HV +L+L+GL+LSG LS DV  LPFL NLS+AAN+ SGP+PP
Sbjct  50   NASIPYCSWLGVTCDNRRHVTALNLTGLDLSGTLSADVAHLPFLSNLSLAANKFSGPIPP  109

Query  182  EISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLH  361
             +SA+S LR+LNLSNN+F  TFP +L +L +L+VLDLYNNN+TG LP+ V +M +LRHLH
Sbjct  110  SLSALSGLRYLNLSNNVFNETFPSELWRLQSLEVLDLYNNNMTGVLPLAVAQMQNLRHLH  169

Query  362  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            LGGN+FSG+IPPEYGR+  L+YLAVSGN L G IP EIGNLT L+ELYIGY+N ++GGIP
Sbjct  170  LGGNFFSGQIPPEYGRWQRLQYLAVSGNELDGTIPPEIGNLTSLRELYIGYYNTYTGGIP  229

Query  542  PEMGNLSQLIRXDAANCGLTGE  607
            PE+GNLS+L+R D A C L+GE
Sbjct  230  PEIGNLSELVRLDVAYCALSGE  251


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/173 (32%), Positives = 86/173 (50%), Gaps = 1/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L+P++G L  L ++ ++ N LSG +P     +  +  LNL  N      P  + +L
Sbjct  272  LSGSLTPELGNLKSLKSMDLSNNMLSGEIPASFGELKNITLLNLFRNKLHGAIPEFIGEL  331

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L+V+ L+ NNLTG +P  + K   L  + L  N  +G +PP       L+ L   GN 
Sbjct  332  PALEVVQLWENNLTGSIPEGLGKNGRLNLVDLSSNKLTGTLPPYLCSGNTLQTLITLGNF  391

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            L G IP  +G    L  + +G  N  +G IP  +  L +L + +  +  L+GE
Sbjct  392  LFGPIPESLGTCESLTRIRMGE-NFLNGSIPKGLFGLPKLTQVELQDNYLSGE  443


 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 88/173 (51%), Gaps = 2/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  265
             SG + P+ G+   L  L+++ N+L G +PPEI  +++LR L +   N +    P ++  
Sbjct  175  FSGQIPPEYGRWQRLQYLAVSGNELDGTIPPEIGNLTSLRELYIGYYNTYTGGIPPEIGN  234

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L+ L  LD+    L+G++P  + K+  L  L L  N  SG + PE G   +L+ + +S N
Sbjct  235  LSELVRLDVAYCALSGEIPAALGKLQKLDTLFLQVNALSGSLTPELGNLKSLKSMDLSNN  294

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             LSG IP+  G L  +  L + + N   G IP  +G L  L         LTG
Sbjct  295  MLSGEIPASFGELKNITLLNL-FRNKLHGAIPEFIGELPALEVVQLWENNLTG  346


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 50/162 (31%), Positives = 83/162 (51%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG +   +G+L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P    +L
Sbjct  248  LSGEIPAALGKLQKLDTLFLQVNALSGSLTPELGNLKSLKSMDLSNNMLSGEIPASFGEL  307

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             N+ +L+L+ N L G +P  + ++ +L  + L  N  +G IP   G+   L  + +S N 
Sbjct  308  KNITLLNLFRNKLHGAIPEFIGELPALEVVQLWENNLTGSIPEGLGKNGRLNLVDLSSNK  367

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P  + +   L+ L I   N   G IP  +G    L R
Sbjct  368  LTGTLPPYLCSGNTLQTL-ITLGNFLFGPIPESLGTCESLTR  408


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 64/127 (50%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             LSG LSP +G    +  L +  N  +G +P +I  +  L  ++ S N F      +++Q
Sbjct  463  QLSGALSPSIGNFSSVQKLLLDGNMFTGRIPTQIGRLQQLSKIDFSGNKFSGPIAPEISQ  522

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  LDL  N L+GD+P E+  M  L +L+L  N+  G IP       +L  +  S N
Sbjct  523  CKLLTFLDLSRNELSGDIPNEITGMRILNYLNLSKNHLVGSIPSSISSMQSLTSVDFSYN  582

Query  446  GLSGVIP  466
             LSG++P
Sbjct  583  NLSGLVP  589


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 77/151 (51%), Gaps = 1/151 (1%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
            +G + P++G L  LV L +A   LSG +P  +  +  L  L L  N    +   +L  L 
Sbjct  225  TGGIPPEIGNLSELVRLDVAYCALSGEIPAALGKLQKLDTLFLQVNALSGSLTPELGNLK  284

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
            +L+ +DL NN L+G++P    ++ ++  L+L  N   G IP   G  P LE + +  N L
Sbjct  285  SLKSMDLSNNMLSGEIPASFGELKNITLLNLFRNKLHGAIPEFIGELPALEVVQLWENNL  344

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPP  544
            +G IP  +G   +L  + +   N  +G +PP
Sbjct  345  TGSIPEGLGKNGRLNLVDLSS-NKLTGTLPP  374


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 73/146 (50%), Gaps = 2/146 (1%)
 Frame = +2

Query  107  PDVGQLPF-LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  283
            P+VG +   L  ++++ NQLSG + P I   S+++ L L  N+F    P Q+ +L  L  
Sbjct  445  PEVGSVAVNLGQITLSNNQLSGALSPSIGNFSSVQKLLLDGNMFTGRIPTQIGRLQQLSK  504

Query  284  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  463
            +D   N  +G +  E+ +   L  L L  N  SG IP E      L YL +S N L G I
Sbjct  505  IDFSGNKFSGPIAPEISQCKLLTFLDLSRNELSGDIPNEITGMRILNYLNLSKNHLVGSI  564

Query  464  PSEIGNLTKLKELYIGYFNGFSGGIP  541
            PS I ++  L  +   Y N  SG +P
Sbjct  565  PSSISSMQSLTSVDFSY-NNLSGLVP  589


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 81/174 (47%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P +     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  367  KLTGTLPPYLCSGNTLQTLITLGNFLFGPIPESLGTCESLTRIRMGENFLNGSIPKGLFG  426

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N L+G+ P       +L  + L  N  SG + P  G F +++ L + GN
Sbjct  427  LPKLTQVELQDNYLSGEFPEVGSVAVNLGQITLSNNQLSGALSPSIGNFSSVQKLLLDGN  486

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              +G IP++IG L +L ++     N FSG I PE+     L   D +   L+G+
Sbjct  487  MFTGRIPTQIGRLQQLSKIDFS-GNKFSGPIAPEISQCKLLTFLDLSRNELSGD  539


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 52/174 (30%), Positives = 91/174 (52%), Gaps = 3/174 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            NL+G +   +G+   L  + +++N+L+G +PP + + +TL+  + L N +FG   P  L 
Sbjct  343  NLTGSIPEGLGKNGRLNLVDLSSNKLTGTLPPYLCSGNTLQTLITLGNFLFGP-IPESLG  401

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
               +L  + +  N L G +P  ++ +  L  + L  NY SG  P       NL  + +S 
Sbjct  402  TCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLSGEFPEVGSVAVNLGQITLSN  461

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            N LSG +   IGN + +++L +   N F+G IP ++G L QL + D +    +G
Sbjct  462  NQLSGALSPSIGNFSSVQKLLLD-GNMFTGRIPTQIGRLQQLSKIDFSGNKFSG  514


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/161 (32%), Positives = 75/161 (47%), Gaps = 1/161 (1%)
 Frame = +2

Query  122  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  301
            LP L  + +  N LSG  P   S    L  + LSNN         +   +++Q L L  N
Sbjct  427  LPKLTQVELQDNYLSGEFPEVGSVAVNLGQITLSNNQLSGALSPSIGNFSSVQKLLLDGN  486

Query  302  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGN  481
              TG +P ++ ++  L  +   GN FSG I PE  +   L +L +S N LSG IP+EI  
Sbjct  487  MFTGRIPTQIGRLQQLSKIDFSGNKFSGPIAPEISQCKLLTFLDLSRNELSGDIPNEITG  546

Query  482  LTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            +  L  L +   N   G IP  + ++  L   D +   L+G
Sbjct  547  MRILNYLNLSK-NHLVGSIPSSISSMQSLTSVDFSYNNLSG  586


 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 72/154 (47%), Gaps = 1/154 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L G +   +G    L  + +  N L+G +P  +  +  L  + L +N     FP   +  
Sbjct  392  LFGPIPESLGTCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLSGEFPEVGSVA  451

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL  + L NN L+G L   +   +S++ L L GN F+GRIP + GR   L  +  SGN 
Sbjct  452  VNLGQITLSNNQLSGALSPSIGNFSSVQKLLLDGNMFTGRIPTQIGRLQQLSKIDFSGNK  511

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
             SG I  EI     L  L +   N  SG IP E+
Sbjct  512  FSGPIAPEISQCKLLTFLDLSR-NELSGDIPNEI  544



>ref|XP_002875982.1| hypothetical protein ARALYDRAFT_906265 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52241.1| hypothetical protein ARALYDRAFT_906265 [Arabidopsis lyrata subsp. 
lyrata]
Length=1001

 Score =   258 bits (659),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 158/204 (77%), Gaps = 2/204 (1%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVP  178
            N+ST+ C+W  VTCD  L  V+      LNLSG LS DV  LP L NLS+AANQ+SGP+P
Sbjct  50   NLSTTFCSWTGVTCDVSLRHVTSLDLSGLNLSGTLSSDVSHLPLLQNLSLAANQISGPIP  109

Query  179  PEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANLQVLDLYNNNLTGDLPVEVYKMTSLRH  355
            PEIS +  LR LNLSNN+F  ++P +L+  L NL+VLDLYNNNLTGDLPV +  +T LRH
Sbjct  110  PEISNLYELRHLNLSNNVFNGSYPDELSSGLVNLRVLDLYNNNLTGDLPVSITNLTQLRH  169

Query  356  LHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGG  535
            LHLGGNYFSG+IP  YG +P LEYLAVSGN L G IP EIGNLT L+ELYIGY+N F  G
Sbjct  170  LHLGGNYFSGKIPATYGTWPVLEYLAVSGNELIGKIPPEIGNLTTLRELYIGYYNAFEDG  229

Query  536  IPPEMGNLSQLIRXDAANCGLTGE  607
            +PPE+GNLS+L+R DAANCGLTGE
Sbjct  230  LPPEIGNLSELVRFDAANCGLTGE  253


 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 97/197 (49%), Gaps = 26/197 (13%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  265
             SG +    G  P L  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  177  FSGKIPATYGTWPVLEYLAVSGNELIGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  236

Query  266  LANLQVLDLYNNNLTGDLPVEVYKM------------------------TSLRHLHLGGN  373
            L+ L   D  N  LTG++P E+ K+                        +SL+ + L  N
Sbjct  237  LSELVRFDAANCGLTGEIPPEIGKLQKLDTLFLQVNAFSGTLTSELGFISSLKSMDLSNN  296

Query  374  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
             F+G IP  + +  NL  L +  N L G IP  IG + +L+ L + + N F+GGIP ++G
Sbjct  297  MFTGEIPASFSQLKNLTLLNLFRNKLYGAIPEFIGEMPELEVLQL-WENNFTGGIPHKLG  355

Query  554  NLSQLIRXDAANCGLTG  604
               +L+  D ++  LTG
Sbjct  356  ENGRLVILDLSSNKLTG  372


 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 86/162 (53%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G + P++G+L  L  L +  N  SG +  E+  IS+L+ ++LSNN+F    P   +QL
Sbjct  250  LTGEIPPEIGKLQKLDTLFLQVNAFSGTLTSELGFISSLKSMDLSNNMFTGEIPASFSQL  309

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  + +M  L  L L  N F+G IP + G    L  L +S N 
Sbjct  310  KNLTLLNLFRNKLYGAIPEFIGEMPELEVLQLWENNFTGGIPHKLGENGRLVILDLSSNK  369

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P  + +  +L  L I   N   G IP  +G    L R
Sbjct  370  LTGTLPPNMCSGNRLMTL-ITLGNFLFGSIPDSLGKCESLTR  410


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/157 (34%), Positives = 82/157 (52%), Gaps = 1/157 (1%)
 Frame = +2

Query  101  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  280
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N F  T   +L  +++L+
Sbjct  230  LPPEIGNLSELVRFDAANCGLTGEIPPEIGKLQKLDTLFLQVNAFSGTLTSELGFISSLK  289

Query  281  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  460
             +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N  +G 
Sbjct  290  SMDLSNNMFTGEIPASFSQLKNLTLLNLFRNKLYGAIPEFIGEMPELEVLQLWENNFTGG  349

Query  461  IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLI  571
            IP ++G   +L  L +   N  +G +PP M + ++L+
Sbjct  350  IPHKLGENGRLVILDLSS-NKLTGTLPPNMCSGNRLM  385


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 68/128 (53%), Gaps = 0/128 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             LSG L   +G    +  L +  N+ +GP+PPEI  +  L  L+ S+N+F      ++++
Sbjct  466  QLSGPLPAAIGNFSGVQKLLLDGNKFAGPIPPEIGRLQQLSKLDFSHNLFSGRIAPEISR  525

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  +DL  N L+GD+P E+  M  L +L+L  N+  G IP       +L  +  S N
Sbjct  526  CKLLTFVDLSRNELSGDIPKEITGMRILNYLNLSRNHLVGSIPVTIASMQSLTSVDFSYN  585

Query  446  GLSGVIPS  469
             LSG++PS
Sbjct  586  NLSGLVPS  593


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 54/175 (31%), Positives = 84/175 (48%), Gaps = 2/175 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P++     L+ L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  369  KLTGTLPPNMCSGNRLMTLITLGNFLFGSIPDSLGKCESLTRIRMGENFLNGSIPKGLFG  428

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMT-SLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            L  L  ++L +N LTG+LP+    ++  L  + L  N  SG +P   G F  ++ L + G
Sbjct  429  LPKLSQVELQDNYLTGELPISGGGVSGDLGQISLSNNQLSGPLPAAIGNFSGVQKLLLDG  488

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            N  +G IP EIG L +L +L   + N FSG I PE+     L   D +   L+G+
Sbjct  489  NKFAGPIPPEIGRLQQLSKLDFSH-NLFSGRIAPEISRCKLLTFVDLSRNELSGD  542


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 63/222 (28%), Positives = 97/222 (44%), Gaps = 50/222 (23%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
             +G +     QL  L  L++  N+L G +P  I  +  L  L L  N F    PH+L + 
Sbjct  298  FTGEIPASFSQLKNLTLLNLFRNKLYGAIPEFIGEMPELEVLQLWENNFTGGIPHKLGEN  357

Query  269  ANLQVLDLYNNNLTGDLPVEVY------------------------KMTSLRHLHLGGNY  376
              L +LDL +N LTG LP  +                         K  SL  + +G N+
Sbjct  358  GRLVILDLSSNKLTGTLPPNMCSGNRLMTLITLGNFLFGSIPDSLGKCESLTRIRMGENF  417

Query  377  FSGRIP------PEY-----------GRFP--------NLEYLAVSGNGLSGVIPSEIGN  481
             +G IP      P+            G  P        +L  +++S N LSG +P+ IGN
Sbjct  418  LNGSIPKGLFGLPKLSQVELQDNYLTGELPISGGGVSGDLGQISLSNNQLSGPLPAAIGN  477

Query  482  LTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
             + +++L +   N F+G IPPE+G L QL + D ++   +G 
Sbjct  478  FSGVQKLLLDG-NKFAGPIPPEIGRLQQLSKLDFSHNLFSGR  518


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 73/149 (49%), Gaps = 7/149 (5%)
 Frame = +2

Query  95   GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  274
            G +S D+GQ+      S++ NQLSGP+P  I   S ++ L L  N F    P ++ +L  
Sbjct  451  GGVSGDLGQI------SLSNNQLSGPLPAAIGNFSGVQKLLLDGNKFAGPIPPEIGRLQQ  504

Query  275  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  454
            L  LD  +N  +G +  E+ +   L  + L  N  SG IP E      L YL +S N L 
Sbjct  505  LSKLDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGDIPKEITGMRILNYLNLSRNHLV  564

Query  455  GVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            G IP  I ++  L  +   Y N  SG +P
Sbjct  565  GSIPVTIASMQSLTSVDFSY-NNLSGLVP  592



>gb|KFK34238.1| hypothetical protein AALP_AA5G119100 [Arabis alpina]
Length=998

 Score =   258 bits (659),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 163/204 (80%), Gaps = 2/204 (1%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsl-lhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVP  178
            N+S S C W  VTCD    HV SLDLS LNLSG LS DV  LP L NLS+AANQ+SGP+P
Sbjct  47   NLSKSFCLWAGVTCDVSLRHVTSLDLSSLNLSGTLSSDVAHLPLLQNLSVAANQISGPIP  106

Query  179  PEISAISTLRFLNLSNNIFGSTFPHQL-AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRH  355
            PEI+ +S LR LNLSNN+F  ++P+QL A+LANLQVLDLYNNNLTGDLPV +  +T LRH
Sbjct  107  PEIANLSELRHLNLSNNVFNGSYPNQLSARLANLQVLDLYNNNLTGDLPVSITNLTQLRH  166

Query  356  LHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGG  535
            LHLGGNYF+GRIP  YG +P LEYLAVSGN L G IP EIGNLT LKELYIGY+N F  G
Sbjct  167  LHLGGNYFTGRIPAVYGSWPVLEYLAVSGNELVGKIPPEIGNLTTLKELYIGYYNAFENG  226

Query  536  IPPEMGNLSQLIRXDAANCGLTGE  607
            +PPE+G LS+L+R DAANCGLTGE
Sbjct  227  LPPEIGKLSELVRFDAANCGLTGE  250


 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 85/162 (52%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G + P++G+L  L  L +  N  SGP+  E+  IS+L+ ++LSNN+F    P    QL
Sbjct  247  LTGEIPPEIGKLQKLDTLFLQVNAFSGPLTSELGVISSLKSMDLSNNMFTGEIPASFEQL  306

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP + G    L  L +S N 
Sbjct  307  KNLTLLNLFRNKLYGAIPEFIGDLPELEVLQLWENNFTGSIPQKLGENGRLVILDLSSNK  366

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P  + +  +L  L I   N   G IP  +G    L R
Sbjct  367  LTGTLPVNMCSGNRLMTL-ITLGNFLFGSIPDSLGKCESLTR  407


 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 96/188 (51%), Gaps = 26/188 (14%)
 Frame = +2

Query  116  GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQLANLQVLDL  292
            G  P L  L+++ N+L G +PPEI  ++TL+ L +   N F +  P ++ +L+ L   D 
Sbjct  183  GSWPVLEYLAVSGNELVGKIPPEIGNLTTLKELYIGYYNAFENGLPPEIGKLSELVRFDA  242

Query  293  YNNNLTGDLPVEVYKM------------------------TSLRHLHLGGNYFSGRIPPE  400
             N  LTG++P E+ K+                        +SL+ + L  N F+G IP  
Sbjct  243  ANCGLTGEIPPEIGKLQKLDTLFLQVNAFSGPLTSELGVISSLKSMDLSNNMFTGEIPAS  302

Query  401  YGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXD  580
            + +  NL  L +  N L G IP  IG+L +L+ L + + N F+G IP ++G   +L+  D
Sbjct  303  FEQLKNLTLLNLFRNKLYGAIPEFIGDLPELEVLQL-WENNFTGSIPQKLGENGRLVILD  361

Query  581  AANCGLTG  604
             ++  LTG
Sbjct  362  LSSNKLTG  369


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 69/128 (54%), Gaps = 0/128 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            +LSG L P +G    +  L +  N+  GP+PPEI  +  L  L+ S+N+F      +++Q
Sbjct  463  HLSGPLPPAIGNFSGVQKLLLDGNKFGGPIPPEIGRLQQLSKLDFSHNLFPGRIAPEISQ  522

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  +DL  N L+G++P E+  M  L +L+L  N+  G IP       +L  +  S N
Sbjct  523  CKLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNHLLGSIPVTMASMQSLTSVDFSYN  582

Query  446  GLSGVIPS  469
             LSG++PS
Sbjct  583  NLSGLVPS  590


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 54/175 (31%), Positives = 84/175 (48%), Gaps = 2/175 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L  ++     L+ L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  366  KLTGTLPVNMCSGNRLMTLITLGNFLFGSIPDSLGKCESLTRIRMGENFLNGSIPKGLFG  425

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMT-SLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            L  L  ++L +N LTG+LP+    ++ +L  + L  N+ SG +PP  G F  ++ L + G
Sbjct  426  LPKLSQVELQDNYLTGELPIGGGVVSVNLGQISLSNNHLSGPLPPAIGNFSGVQKLLLDG  485

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            N   G IP EIG L +L +L   + N F G I PE+     L   D +   L+GE
Sbjct  486  NKFGGPIPPEIGRLQQLSKLDFSH-NLFPGRIAPEISQCKLLTFVDLSRNELSGE  539


 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 74/149 (50%), Gaps = 7/149 (5%)
 Frame = +2

Query  95   GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  274
            GV+S ++GQ+      S++ N LSGP+PP I   S ++ L L  N FG   P ++ +L  
Sbjct  448  GVVSVNLGQI------SLSNNHLSGPLPPAIGNFSGVQKLLLDGNKFGGPIPPEIGRLQQ  501

Query  275  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  454
            L  LD  +N   G +  E+ +   L  + L  N  SG IP E      L YL +S N L 
Sbjct  502  LSKLDFSHNLFPGRIAPEISQCKLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNHLL  561

Query  455  GVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            G IP  + ++  L  +   Y N  SG +P
Sbjct  562  GSIPVTMASMQSLTSVDFSY-NNLSGLVP  589



>ref|XP_004509039.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cicer arietinum]
Length=1005

 Score =   258 bits (659),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 162/203 (80%), Gaps = 1/203 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCds-llhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVP  178
            N ST+HC+W  +TC     HV S+DLS L L+  LS  +  LPFL NLS+A N+ SGP+P
Sbjct  48   NSSTTHCSWHGITCTGPHRHVTSIDLSSLTLTATLSDHLSNLPFLSNLSLADNKFSGPIP  107

Query  179  PEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHL  358
            P  S++ +LRFLNLSNN+F  TFP QL++L+NL VLDLYNNN+TG LP+ V +M +LRHL
Sbjct  108  PSFSSLYSLRFLNLSNNVFNGTFPSQLSRLSNLHVLDLYNNNMTGTLPLSVTRMQNLRHL  167

Query  359  HLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGI  538
            HLGGN+F+G+IPPEYG +P+LEYLAVSGN LSG IP EIGNLT L+ELYIGY+N + GGI
Sbjct  168  HLGGNFFTGKIPPEYGTWPHLEYLAVSGNELSGPIPPEIGNLTSLRELYIGYYNTYDGGI  227

Query  539  PPEMGNLSQLIRXDAANCGLTGE  607
            PPE+GNLS ++R DAA CGLTGE
Sbjct  228  PPEIGNLSAMVRFDAAYCGLTGE  250


 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 87/162 (54%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G + P++G+L  L  L +  N LSG + PE+  + +L+ ++LSNN F    P   A+L
Sbjct  247  LTGEIPPELGKLQNLDTLFLQVNALSGSLTPELGNLKSLKSMDLSNNAFDGEVPASFAEL  306

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  + +M +L  L +  N F+G IP   G+   L  + VS N 
Sbjct  307  KNLTLLNLFRNKLHGAIPEFIGEMPALEVLQIWENNFTGSIPQSLGKNGKLTLVDVSSNK  366

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P  +    KL+ L I   N   G IP  +G    L R
Sbjct  367  LTGSLPPYMCFGNKLQTL-ITLGNFLFGPIPDSLGKCESLSR  407


 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 87/174 (50%), Gaps = 3/174 (2%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L+P++G L  L ++ ++ N   G VP   + +  L  LNL  N      P  + ++
Sbjct  271  LSGSLTPELGNLKSLKSMDLSNNAFDGEVPASFAELKNLTLLNLFRNKLHGAIPEFIGEM  330

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPN-LEYLAVSGN  445
              L+VL ++ NN TG +P  + K   L  + +  N  +G +PP Y  F N L+ L   GN
Sbjct  331  PALEVLQIWENNFTGSIPQSLGKNGKLTLVDVSSNKLTGSLPP-YMCFGNKLQTLITLGN  389

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
             L G IP  +G    L  + +G  N  +G IP  +  L QL + +  +  L+GE
Sbjct  390  FLFGPIPDSLGKCESLSRIRMGE-NFLNGSIPKGLFGLPQLTQVELQDNLLSGE  442


 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 92/174 (53%), Gaps = 3/174 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +G +   +G+   L  + +++N+L+G +PP +   + L+  + L N +FG   P  L 
Sbjct  342  NFTGSIPQSLGKNGKLTLVDVSSNKLTGSLPPYMCFGNKLQTLITLGNFLFGP-IPDSLG  400

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            +  +L  + +  N L G +P  ++ +  L  + L  N  SG  P      PNL  + +S 
Sbjct  401  KCESLSRIRMGENFLNGSIPKGLFGLPQLTQVELQDNLLSGEFPQPVSMSPNLGQVTLSN  460

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            N LSG +PS IGN T +++L +   N F+G IP E+G L QL + D ++   +G
Sbjct  461  NKLSGPLPSSIGNFTSVQKLLLDG-NQFTGKIPSEIGKLQQLSKIDFSHNKFSG  513


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 84/174 (48%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P +     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  366  KLTGSLPPYMCFGNKLQTLITLGNFLFGPIPDSLGKCESLSRIRMGENFLNGSIPKGLFG  425

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N L+G+ P  V    +L  + L  N  SG +P   G F +++ L + GN
Sbjct  426  LPQLTQVELQDNLLSGEFPQPVSMSPNLGQVTLSNNKLSGPLPSSIGNFTSVQKLLLDGN  485

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              +G IPSEIG L +L ++   + N FSG I PE+ +   L   D +   L+GE
Sbjct  486  QFTGKIPSEIGKLQQLSKIDFSH-NKFSGPIAPEISHCKLLTFVDLSRNELSGE  538


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 74/153 (48%), Gaps = 1/153 (1%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
             G + P++G L  +V    A   L+G +PPE+  +  L  L L  N    +   +L  L 
Sbjct  224  DGGIPPEIGNLSAMVRFDAAYCGLTGEIPPELGKLQNLDTLFLQVNALSGSLTPELGNLK  283

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
            +L+ +DL NN   G++P    ++ +L  L+L  N   G IP   G  P LE L +  N  
Sbjct  284  SLKSMDLSNNAFDGEVPASFAELKNLTLLNLFRNKLHGAIPEFIGEMPALEVLQIWENNF  343

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            +G IP  +G   KL  + +   N  +G +PP M
Sbjct  344  TGSIPQSLGKNGKLTLVDVSS-NKLTGSLPPYM  375


 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 79/172 (46%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G +   +  LP L  + +  N LSG  P  +S    L  + LSNN      P  +   
Sbjct  415  LNGSIPKGLFGLPQLTQVELQDNLLSGEFPQPVSMSPNLGQVTLSNNKLSGPLPSSIGNF  474

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             ++Q L L  N  TG +P E+ K+  L  +    N FSG I PE      L ++ +S N 
Sbjct  475  TSVQKLLLDGNQFTGKIPSEIGKLQQLSKIDFSHNKFSGPIAPEISHCKLLTFVDLSRNE  534

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            LSG IP+EI  +  L  L +   N   G IP  + ++  L   D +   LTG
Sbjct  535  LSGEIPNEITGMRILNYLNLSR-NHLVGTIPGSIASMQSLTSVDFSYNNLTG  585


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 49/154 (32%), Positives = 76/154 (49%), Gaps = 1/154 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N+    FP  ++  
Sbjct  391  LFGPIPDSLGKCESLSRIRMGENFLNGSIPKGLFGLPQLTQVELQDNLLSGEFPQPVSMS  450

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL  + L NN L+G LP  +   TS++ L L GN F+G+IP E G+   L  +  S N 
Sbjct  451  PNLGQVTLSNNKLSGPLPSSIGNFTSVQKLLLDGNQFTGKIPSEIGKLQQLSKIDFSHNK  510

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
             SG I  EI +   L  + +   N  SG IP E+
Sbjct  511  FSGPIAPEISHCKLLTFVDLSR-NELSGEIPNEI  543


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 72/151 (48%), Gaps = 1/151 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG     V   P L  ++++ N+LSGP+P  I   ++++ L L  N F    P ++ +L
Sbjct  439  LSGEFPQPVSMSPNLGQVTLSNNKLSGPLPSSIGNFTSVQKLLLDGNQFTGKIPSEIGKL  498

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  +D  +N  +G +  E+     L  + L  N  SG IP E      L YL +S N 
Sbjct  499  QQLSKIDFSHNKFSGPIAPEISHCKLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNH  558

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            L G IP  I ++  L  +   Y N  +G +P
Sbjct  559  LVGTIPGSIASMQSLTSVDFSY-NNLTGLVP  588



>ref|XP_004511796.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cicer arietinum]
Length=1009

 Score =   257 bits (657),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 165/202 (82%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPP  181
            N ST+HC W  VTCD+  HV +L+L+GLNLSG L+ D+  LPFL NLS+A N+ SG +PP
Sbjct  48   NPSTTHCIWLGVTCDTRRHVTALNLTGLNLSGTLAADIAHLPFLSNLSLADNKFSGEIPP  107

Query  182  EISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLH  361
             +SA+S LR LNLSNN+F  TFP +L+QL +L+VLDLYNNN+TG LP+ V ++ +LRHLH
Sbjct  108  SLSAVSGLRLLNLSNNVFNGTFPSELSQLKSLEVLDLYNNNMTGTLPLAVTELPNLRHLH  167

Query  362  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            LGGNYF+G+IPPEYG + +LEYLAVSGN L G IP  IGNLT L+ELYIGY+N ++GGIP
Sbjct  168  LGGNYFTGQIPPEYGLWQHLEYLAVSGNELDGTIPPGIGNLTSLRELYIGYYNTYAGGIP  227

Query  542  PEMGNLSQLIRXDAANCGLTGE  607
            PE+GNL++L+R DAA CGL+GE
Sbjct  228  PEIGNLTELVRLDAAYCGLSGE  249


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 56/172 (33%), Positives = 88/172 (51%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG +  ++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN+     P   +QL
Sbjct  246  LSGEIPAEMGKLQKLDTLFLQVNALSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSFSQL  305

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  +  M +L  + L  N F+G IP   G    L  L +S N 
Sbjct  306  KNLTLLNLFRNKLHGAIPEFIGDMPALEVVQLWENNFTGNIPMGLGSNGKLTLLDLSSNK  365

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            L+G +P  + +  +L+ L I   N   G IP  +G+   L R    +  L G
Sbjct  366  LTGTLPPYLCSGNRLQTL-ITLGNFLFGPIPESLGSCESLNRIRMGDNFLNG  416


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 91/174 (52%), Gaps = 3/174 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +G +   +G    L  L +++N+L+G +PP + + + L+  + L N +FG   P  L 
Sbjct  341  NFTGNIPMGLGSNGKLTLLDLSSNKLTGTLPPYLCSGNRLQTLITLGNFLFGP-IPESLG  399

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
               +L  + + +N L G +P  ++ +  L  + L  NY SG  P  +    NL  + +S 
Sbjct  400  SCESLNRIRMGDNFLNGSIPKGLFGLPKLTQVELQDNYLSGNFPETHSVSVNLGQITLSN  459

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            N LSGV+P  IGN T +++  +   N F+G IP ++G L QL   D ++   +G
Sbjct  460  NQLSGVLPPSIGNFTSMQKFLLD-GNMFTGKIPSQIGRLQQLSNIDFSHNKFSG  512


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 85/172 (49%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L+ ++G L  L ++ ++ N L+G +P   S +  L  LNL  N      P  +  +
Sbjct  270  LSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSFSQLKNLTLLNLFRNKLHGAIPEFIGDM  329

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L+V+ L+ NN TG++P+ +     L  L L  N  +G +PP       L+ L   GN 
Sbjct  330  PALEVVQLWENNFTGNIPMGLGSNGKLTLLDLSSNKLTGTLPPYLCSGNRLQTLITLGNF  389

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            L G IP  +G+   L  + +G  N  +G IP  +  L +L + +  +  L+G
Sbjct  390  LFGPIPESLGSCESLNRIRMGD-NFLNGSIPKGLFGLPKLTQVELQDNYLSG  440


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 77/151 (51%), Gaps = 1/151 (1%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
            +G + P++G L  LV L  A   LSG +P E+  +  L  L L  N    +   +L  L 
Sbjct  223  AGGIPPEIGNLTELVRLDAAYCGLSGEIPAEMGKLQKLDTLFLQVNALSGSLTWELGNLK  282

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
            +L+ +DL NN LTG++P    ++ +L  L+L  N   G IP   G  P LE + +  N  
Sbjct  283  SLKSMDLSNNMLTGEIPTSFSQLKNLTLLNLFRNKLHGAIPEFIGDMPALEVVQLWENNF  342

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPP  544
            +G IP  +G+  KL  L +   N  +G +PP
Sbjct  343  TGNIPMGLGSNGKLTLLDLSS-NKLTGTLPP  372


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 81/173 (47%), Gaps = 1/173 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P +     L  L    N L GP+P  + +  +L  + + +N    + P  L  
Sbjct  365  KLTGTLPPYLCSGNRLQTLITLGNFLFGPIPESLGSCESLNRIRMGDNFLNGSIPKGLFG  424

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N L+G+ P       +L  + L  N  SG +PP  G F +++   + GN
Sbjct  425  LPKLTQVELQDNYLSGNFPETHSVSVNLGQITLSNNQLSGVLPPSIGNFTSMQKFLLDGN  484

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
              +G IPS+IG L +L  +   + N FSG I  E+     L   D +   L+G
Sbjct  485  MFTGKIPSQIGRLQQLSNIDFSH-NKFSGPIASEISQCKLLTFVDLSRNELSG  536


 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 68/137 (50%), Gaps = 1/137 (1%)
 Frame = +2

Query  131  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  310
            L  ++++ NQLSG +PP I   ++++   L  N+F    P Q+ +L  L  +D  +N  +
Sbjct  452  LGQITLSNNQLSGVLPPSIGNFTSMQKFLLDGNMFTGKIPSQIGRLQQLSNIDFSHNKFS  511

Query  311  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTK  490
            G +  E+ +   L  + L  N  SG IP E      L YL +S N L G IP  I ++  
Sbjct  512  GPIASEISQCKLLTFVDLSRNELSGVIPNEITGMRILNYLNLSRNHLVGSIPISISSMQS  571

Query  491  LKELYIGYFNGFSGGIP  541
            L  +   Y N  SG +P
Sbjct  572  LTSVDFSY-NNLSGLVP  587


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 79/172 (46%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G +   +  LP L  + +  N LSG  P   S    L  + LSNN      P  +   
Sbjct  414  LNGSIPKGLFGLPKLTQVELQDNYLSGNFPETHSVSVNLGQITLSNNQLSGVLPPSIGNF  473

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             ++Q   L  N  TG +P ++ ++  L ++    N FSG I  E  +   L ++ +S N 
Sbjct  474  TSMQKFLLDGNMFTGKIPSQIGRLQQLSNIDFSHNKFSGPIASEISQCKLLTFVDLSRNE  533

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            LSGVIP+EI  +  L  L +   N   G IP  + ++  L   D +   L+G
Sbjct  534  LSGVIPNEITGMRILNYLNLSR-NHLVGSIPISISSMQSLTSVDFSYNNLSG  584


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 60/119 (50%), Gaps = 1/119 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
             +G +   +G+L  L N+  + N+ SGP+  EIS    L F++LS N      P+++  +
Sbjct  486  FTGKIPSQIGRLQQLSNIDFSHNKFSGPIASEISQCKLLTFVDLSRNELSGVIPNEITGM  545

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
              L  L+L  N+L G +P+ +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  546  RILNYLNLSRNHLVGSIPISISSMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  603



>ref|XP_010484412.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Camelina sativa]
Length=1005

 Score =   257 bits (657),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 156/204 (76%), Gaps = 2/204 (1%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVP  178
             +STS CTW  VTCD     V+      LNLSG LSPDV  L  L NLS+A NQ+SGP+P
Sbjct  52   KVSTSFCTWVGVTCDVSRRHVTSLDLSGLNLSGTLSPDVSHLRLLQNLSLAENQISGPIP  111

Query  179  PEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANLQVLDLYNNNLTGDLPVEVYKMTSLRH  355
            PEIS +S LR LNLSNN+F  +FP +L+  L NL+VLD+YNNNLTGDLP+ V  +T LRH
Sbjct  112  PEISILSGLRHLNLSNNVFNGSFPDELSSGLVNLRVLDVYNNNLTGDLPLSVTNLTQLRH  171

Query  356  LHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGG  535
            LHLGGNYF+G+IPP YG +P +EYLAVSGN L G IP EIGNLT L+ELYIGY+N F  G
Sbjct  172  LHLGGNYFAGKIPPSYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDG  231

Query  536  IPPEMGNLSQLIRXDAANCGLTGE  607
            +PPE+GNLS+L+R D ANCGLTGE
Sbjct  232  LPPEIGNLSELVRLDGANCGLTGE  255


 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 88/162 (54%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   A+L
Sbjct  252  LTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNNMFTGEIPASFAEL  311

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G++P  +  +  L  L L  N F+G IP + G    L  + +S N 
Sbjct  312  KNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGSIPQKLGENGKLNLVDLSSNK  371

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P  + +  KL+ L I   N   G IP  +G    L R
Sbjct  372  LTGTLPPNMCSGNKLETL-ITLGNFLFGSIPDSLGKCESLTR  412


 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 97/197 (49%), Gaps = 26/197 (13%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  265
             +G + P  G  P +  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  179  FAGKIPPSYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  238

Query  266  LANLQVLDLYNNNLTGDLPVEVYK------------------------MTSLRHLHLGGN  373
            L+ L  LD  N  LTG++P E+ K                        ++SL+ + L  N
Sbjct  239  LSELVRLDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNN  298

Query  374  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
             F+G IP  +    NL  L +  N L G IP  IG+L +L+ L + + N F+G IP ++G
Sbjct  299  MFTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQL-WENNFTGSIPQKLG  357

Query  554  NLSQLIRXDAANCGLTG  604
               +L   D ++  LTG
Sbjct  358  ENGKLNLVDLSSNKLTG  374


 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 78/150 (52%), Gaps = 1/150 (1%)
 Frame = +2

Query  101  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  280
            L P++G L  LV L  A   L+G +PPEI  +  L  L L  N+F      +L  L++L+
Sbjct  232  LPPEIGNLSELVRLDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLK  291

Query  281  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  460
             +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N  +G 
Sbjct  292  SMDLSNNMFTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGS  351

Query  461  IPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            IP ++G   KL  + +   N  +G +PP M
Sbjct  352  IPQKLGENGKLNLVDLSS-NKLTGTLPPNM  380


 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 83/174 (48%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P++     L  L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  371  KLTGTLPPNMCSGNKLETLITLGNFLFGSIPDSLGKCESLTRIRIGQNFLNGSIPKGLFG  430

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N L+G+LPV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  431  LPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  490

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
               G IPSE+G L +L ++   + N FSG I PE+     L   D +   L+GE
Sbjct  491  KFEGQIPSEVGKLQQLSKIDFSH-NLFSGRIAPEISRCKLLTFVDLSRNELSGE  543


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 94/175 (54%), Gaps = 3/175 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +G +   +G+   L  + +++N+L+G +PP + + + L   + L N +FGS  P  L 
Sbjct  347  NFTGSIPQKLGENGKLNLVDLSSNKLTGTLPPNMCSGNKLETLITLGNFLFGS-IPDSLG  405

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            +  +L  + +  N L G +P  ++ +  L  + L  NY SG +P   G   NL  +++S 
Sbjct  406  KCESLTRIRIGQNFLNGSIPKGLFGLPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSN  465

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            N LSG +P  IGN T +++L +   N F G IP E+G L QL + D ++   +G 
Sbjct  466  NQLSGPLPPAIGNFTGVQKLLLDG-NKFEGQIPSEVGKLQQLSKIDFSHNLFSGR  519


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 74/161 (46%), Gaps = 1/161 (1%)
 Frame = +2

Query  122  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  301
            LP L  + +  N LSG +P        L  ++LSNN      P  +     +Q L L  N
Sbjct  431  LPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  490

Query  302  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGN  481
               G +P EV K+  L  +    N FSGRI PE  R   L ++ +S N LSG IP+EI  
Sbjct  491  KFEGQIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITG  550

Query  482  LTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            +  L  L +   N   G IP  + ++  L   D +   L+G
Sbjct  551  MRILNYLNLSR-NHLLGSIPGSISSMQSLTSLDFSYNNLSG  590


 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 76/151 (50%), Gaps = 7/151 (5%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            ++G +S ++GQ+      S++ NQLSGP+PP I   + ++ L L  N F    P ++ +L
Sbjct  450  VAGGVSVNLGQI------SLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFEGQIPSEVGKL  503

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  +D  +N  +G +  E+ +   L  + L  N  SG IP E      L YL +S N 
Sbjct  504  QQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNH  563

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            L G IP  I ++  L  L   Y N  SG +P
Sbjct  564  LLGSIPGSISSMQSLTSLDFSY-NNLSGLVP  593



>ref|XP_010444585.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Camelina sativa]
Length=1006

 Score =   257 bits (657),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 156/204 (76%), Gaps = 2/204 (1%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVP  178
             +STS CTW  VTCD     V+      LNLSG LSPDV  L  L NLS+A NQ+SGP+P
Sbjct  52   KVSTSFCTWVGVTCDVSRRHVTSLDLSGLNLSGTLSPDVSHLRLLQNLSLAENQISGPIP  111

Query  179  PEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANLQVLDLYNNNLTGDLPVEVYKMTSLRH  355
            PEIS +S LR LNLSNN+F  +FP +L+  L NL+VLD+YNNNLTGDLP+ V  +T LRH
Sbjct  112  PEISILSGLRHLNLSNNVFNGSFPDELSSGLVNLRVLDVYNNNLTGDLPLSVTNLTQLRH  171

Query  356  LHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGG  535
            LHLGGNYF+G+IPP YG +P +EYLAVSGN L G IP EIGNLT L+ELYIGY+N F  G
Sbjct  172  LHLGGNYFAGKIPPSYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDG  231

Query  536  IPPEMGNLSQLIRXDAANCGLTGE  607
            +PPE+GNLS+L+R D ANCGLTGE
Sbjct  232  LPPEIGNLSELVRLDGANCGLTGE  255


 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 88/162 (54%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   A+L
Sbjct  252  LTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNNMFTGEIPASFAEL  311

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G++P  +  +  L  L L  N F+G IP + G    L  + +S N 
Sbjct  312  KNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGSIPQKLGENGKLNLVDLSSNK  371

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P  + +  KL+ L I   N   G IP  +G    L R
Sbjct  372  LTGTLPPNMCSGNKLETL-ITLGNFLFGSIPDSLGKCESLTR  412


 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 97/197 (49%), Gaps = 26/197 (13%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  265
             +G + P  G  P +  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  179  FAGKIPPSYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  238

Query  266  LANLQVLDLYNNNLTGDLPVEVYK------------------------MTSLRHLHLGGN  373
            L+ L  LD  N  LTG++P E+ K                        ++SL+ + L  N
Sbjct  239  LSELVRLDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNN  298

Query  374  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
             F+G IP  +    NL  L +  N L G IP  IG+L +L+ L + + N F+G IP ++G
Sbjct  299  MFTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQL-WENNFTGSIPQKLG  357

Query  554  NLSQLIRXDAANCGLTG  604
               +L   D ++  LTG
Sbjct  358  ENGKLNLVDLSSNKLTG  374


 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 78/150 (52%), Gaps = 1/150 (1%)
 Frame = +2

Query  101  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  280
            L P++G L  LV L  A   L+G +PPEI  +  L  L L  N+F      +L  L++L+
Sbjct  232  LPPEIGNLSELVRLDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLK  291

Query  281  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  460
             +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N  +G 
Sbjct  292  SMDLSNNMFTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGS  351

Query  461  IPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            IP ++G   KL  + +   N  +G +PP M
Sbjct  352  IPQKLGENGKLNLVDLSS-NKLTGTLPPNM  380


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 84/174 (48%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P++     L  L    N L G +P  +    +L  + +  N   ++ P  L  
Sbjct  371  KLTGTLPPNMCSGNKLETLITLGNFLFGSIPDSLGKCESLTRIRMGQNFLNASIPKGLFG  430

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N L+G+LPV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  431  LPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  490

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
               G IPSE+G L +L ++   + N FSG I PE+     L   D +   L+GE
Sbjct  491  KFEGQIPSEVGKLQQLSKIDFSH-NLFSGRIAPEISRCKLLTFVDLSRNELSGE  543


 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 89/166 (54%), Gaps = 3/166 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +G +   +G+   L  + +++N+L+G +PP + + + L   + L N +FGS  P  L 
Sbjct  347  NFTGSIPQKLGENGKLNLVDLSSNKLTGTLPPNMCSGNKLETLITLGNFLFGS-IPDSLG  405

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            +  +L  + +  N L   +P  ++ +  L  + L  NY SG +P   G   NL  +++S 
Sbjct  406  KCESLTRIRMGQNFLNASIPKGLFGLPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSN  465

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXD  580
            N LSG +P  IGN T +++L +   N F G IP E+G L QL + D
Sbjct  466  NQLSGPLPPAIGNFTGVQKLLLDG-NKFEGQIPSEVGKLQQLSKID  510


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 74/161 (46%), Gaps = 1/161 (1%)
 Frame = +2

Query  122  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  301
            LP L  + +  N LSG +P        L  ++LSNN      P  +     +Q L L  N
Sbjct  431  LPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  490

Query  302  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGN  481
               G +P EV K+  L  +    N FSGRI PE  R   L ++ +S N LSG IP+EI  
Sbjct  491  KFEGQIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITG  550

Query  482  LTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            +  L  L +   N   G IP  + ++  L   D +   L+G
Sbjct  551  MRILNYLNLSR-NHLLGSIPGSISSMQSLTSLDFSYNNLSG  590


 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 76/151 (50%), Gaps = 7/151 (5%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            ++G +S ++GQ+      S++ NQLSGP+PP I   + ++ L L  N F    P ++ +L
Sbjct  450  VAGGVSVNLGQI------SLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFEGQIPSEVGKL  503

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  +D  +N  +G +  E+ +   L  + L  N  SG IP E      L YL +S N 
Sbjct  504  QQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNH  563

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            L G IP  I ++  L  L   Y N  SG +P
Sbjct  564  LLGSIPGSISSMQSLTSLDFSY-NNLSGLVP  593



>ref|XP_002864974.1| hypothetical protein ARALYDRAFT_496807 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41233.1| hypothetical protein ARALYDRAFT_496807 [Arabidopsis lyrata subsp. 
lyrata]
Length=1003

 Score =   256 bits (655),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 156/204 (76%), Gaps = 2/204 (1%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVP  178
             +STS CTW  VTCD     V+      LNLSG LSPDV  L  L NLS+A NQ+SGP+P
Sbjct  51   KVSTSFCTWTGVTCDVSRRHVTSLDLSGLNLSGTLSPDVSHLRLLQNLSLADNQISGPIP  110

Query  179  PEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANLQVLDLYNNNLTGDLPVEVYKMTSLRH  355
            PEIS++S LR LNLSNN+F  +FP +++  L NL+VLD+YNNNLTGDLPV V  +T LRH
Sbjct  111  PEISSLSGLRHLNLSNNVFNGSFPDEISSGLVNLRVLDVYNNNLTGDLPVSVTNLTQLRH  170

Query  356  LHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGG  535
            LHLGGNYF+ +IPP YG +P +EYLAVSGN L G IP EIGNL  L+ELYIGY+N F  G
Sbjct  171  LHLGGNYFAEKIPPSYGSWPVIEYLAVSGNELVGKIPPEIGNLKTLRELYIGYYNAFEDG  230

Query  536  IPPEMGNLSQLIRXDAANCGLTGE  607
            +PPE+GNLS+L+R DAANCGLTGE
Sbjct  231  LPPEIGNLSELVRFDAANCGLTGE  254


 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/162 (34%), Positives = 87/162 (54%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G + P++G+L  L  L +  N  SG +  E+  +S+L+ ++LSNN+F    P   A+L
Sbjct  251  LTGEIPPEIGKLQKLDTLFLQVNVFSGSLTWELGTLSSLKSMDLSNNMFTGEIPASFAEL  310

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G++P  +  +  L  L L  N F+G IP + G    L  + +S N 
Sbjct  311  KNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGTIPQKLGENGKLNLVDLSSNK  370

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P  + +  KL+ L I   N   G IP  +G    L R
Sbjct  371  LTGTLPPNMCSGNKLETL-ITLGNFLFGSIPDSLGKCESLTR  411


 Score = 86.3 bits (212),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 78/150 (52%), Gaps = 1/150 (1%)
 Frame = +2

Query  101  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  280
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N+F  +   +L  L++L+
Sbjct  231  LPPEIGNLSELVRFDAANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGSLTWELGTLSSLK  290

Query  281  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  460
             +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N  +G 
Sbjct  291  SMDLSNNMFTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGT  350

Query  461  IPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            IP ++G   KL  + +   N  +G +PP M
Sbjct  351  IPQKLGENGKLNLVDLSS-NKLTGTLPPNM  379


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 92/191 (48%), Gaps = 26/191 (14%)
 Frame = +2

Query  107  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQLANLQV  283
            P  G  P +  L+++ N+L G +PPEI  + TLR L +   N F    P ++  L+ L  
Sbjct  184  PSYGSWPVIEYLAVSGNELVGKIPPEIGNLKTLRELYIGYYNAFEDGLPPEIGNLSELVR  243

Query  284  LDLYNNNLTGDLPVEVYK------------------------MTSLRHLHLGGNYFSGRI  391
             D  N  LTG++P E+ K                        ++SL+ + L  N F+G I
Sbjct  244  FDAANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGSLTWELGTLSSLKSMDLSNNMFTGEI  303

Query  392  PPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLI  571
            P  +    NL  L +  N L G IP  IG+L +L+ L + + N F+G IP ++G   +L 
Sbjct  304  PASFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQL-WENNFTGTIPQKLGENGKLN  362

Query  572  RXDAANCGLTG  604
              D ++  LTG
Sbjct  363  LVDLSSNKLTG  373


 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 83/174 (48%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P++     L  L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  370  KLTGTLPPNMCSGNKLETLITLGNFLFGSIPDSLGKCESLTRIRMGENFLNGSIPKGLFG  429

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N L+G+LPV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  430  LPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  489

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
               G IPSE+G L +L ++   + N FSG I PE+     L   D +   L+GE
Sbjct  490  KFEGPIPSEVGKLQQLSKIDFSH-NLFSGRIAPEISRCKLLTFVDLSRNELSGE  542


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 94/175 (54%), Gaps = 3/175 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +G +   +G+   L  + +++N+L+G +PP + + + L   + L N +FGS  P  L 
Sbjct  346  NFTGTIPQKLGENGKLNLVDLSSNKLTGTLPPNMCSGNKLETLITLGNFLFGS-IPDSLG  404

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            +  +L  + +  N L G +P  ++ +  L  + L  NY SG +P   G   NL  +++S 
Sbjct  405  KCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSN  464

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            N LSG +P  IGN T +++L +   N F G IP E+G L QL + D ++   +G 
Sbjct  465  NQLSGPLPPAIGNFTGVQKLLLDG-NKFEGPIPSEVGKLQQLSKIDFSHNLFSGR  518


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 74/161 (46%), Gaps = 1/161 (1%)
 Frame = +2

Query  122  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  301
            LP L  + +  N LSG +P        L  ++LSNN      P  +     +Q L L  N
Sbjct  430  LPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  489

Query  302  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGN  481
               G +P EV K+  L  +    N FSGRI PE  R   L ++ +S N LSG IP+EI  
Sbjct  490  KFEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITG  549

Query  482  LTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            +  L  L +   N   G IP  + ++  L   D +   L+G
Sbjct  550  MKILNYLNLSR-NNLVGSIPGSISSMQSLTSLDFSYNNLSG  589


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 76/151 (50%), Gaps = 7/151 (5%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            ++G +S ++GQ+      S++ NQLSGP+PP I   + ++ L L  N F    P ++ +L
Sbjct  449  VAGGVSVNLGQI------SLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKL  502

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  +D  +N  +G +  E+ +   L  + L  N  SG IP E      L YL +S N 
Sbjct  503  QQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITGMKILNYLNLSRNN  562

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            L G IP  I ++  L  L   Y N  SG +P
Sbjct  563  LVGSIPGSISSMQSLTSLDFSY-NNLSGLVP  592



>ref|XP_008237309.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Prunus mume]
Length=968

 Score =   255 bits (652),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 142/174 (82%), Gaps = 0/174 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            +L G LS D+  L FL N ++A NQ SGP+P EISA+S LR LNLSNNIF +TFP QL+ 
Sbjct  26   DLVGTLSSDIAHLRFLSNGTLADNQFSGPIPSEISALSGLRLLNLSNNIFNTTFPPQLSN  85

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L VLDLYNNNLTGDLPV V  MTSLRHLHLGGN+FSGRIPPE+GRFP LEYLAVSGN
Sbjct  86   LTRLAVLDLYNNNLTGDLPVAVTHMTSLRHLHLGGNFFSGRIPPEFGRFPLLEYLAVSGN  145

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
             L G IP EIGNLT LKELYIGY+N + GGIPPE+GNLSQL+R DAANC LTGE
Sbjct  146  ELGGSIPPEIGNLTSLKELYIGYYNVYEGGIPPEIGNLSQLVRLDAANCNLTGE  199


 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/197 (32%), Positives = 100/197 (51%), Gaps = 26/197 (13%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  265
             SG + P+ G+ P L  L+++ N+L G +PPEI  +++L+ L +   N++    P ++  
Sbjct  123  FSGRIPPEFGRFPLLEYLAVSGNELGGSIPPEIGNLTSLKELYIGYYNVYEGGIPPEIGN  182

Query  266  LANLQVLDLYNNNLTGDLPVEVYK------------------------MTSLRHLHLGGN  373
            L+ L  LD  N NLTG++P E+ +                        + SL+ + L  N
Sbjct  183  LSQLVRLDAANCNLTGEVPRELGRLQNVDTLFLQVNALSGSLTAELGSLKSLKSMDLSNN  242

Query  374  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
             FSG IP  +    NL  L +  N L G IP  IG+L +L+ L + + N F+G IP  +G
Sbjct  243  MFSGEIPGSFSELKNLTLLNLFRNKLHGAIPEFIGDLPELQVLQL-WENNFTGSIPQGLG  301

Query  554  NLSQLIRXDAANCGLTG  604
               +LI  D ++  LTG
Sbjct  302  KNGKLITLDLSSNKLTG  318


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 83/172 (48%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L+ ++G L  L ++ ++ N  SG +P   S +  L  LNL  N      P  +  L
Sbjct  220  LSGSLTAELGSLKSLKSMDLSNNMFSGEIPGSFSELKNLTLLNLFRNKLHGAIPEFIGDL  279

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              LQVL L+ NN TG +P  + K   L  L L  N  +G +PP+     NL+ L   GN 
Sbjct  280  PELQVLQLWENNFTGSIPQGLGKNGKLITLDLSSNKLTGTLPPDMCFGNNLQTLITLGNF  339

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            L G IP  +G    L  + +G  N  +G IP  +  L +L + +  +  L G
Sbjct  340  LFGPIPESLGKCGSLSRIRMGE-NFLNGSIPKGLFGLPKLTQVELQDNLLAG  390


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 90/166 (54%), Gaps = 3/166 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +G +   +G+   L+ L +++N+L+G +PP++   + L+  + L N +FG   P  L 
Sbjct  291  NFTGSIPQGLGKNGKLITLDLSSNKLTGTLPPDMCFGNNLQTLITLGNFLFGP-IPESLG  349

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            +  +L  + +  N L G +P  ++ +  L  + L  N  +G  P       NL  +++S 
Sbjct  350  KCGSLSRIRMGENFLNGSIPKGLFGLPKLTQVELQDNLLAGSFPETETISANLGQISLSN  409

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXD  580
            N LSG +P  IGN + +++L +   N FSG IPPE+G L QL + D
Sbjct  410  NRLSGSLPPTIGNFSGVQKLLLDG-NKFSGRIPPEIGRLQQLSKID  454


 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/163 (33%), Positives = 87/163 (53%), Gaps = 1/163 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            NL+G +  ++G+L  +  L +  N LSG +  E+ ++ +L+ ++LSNN+F    P   ++
Sbjct  195  NLTGEVPRELGRLQNVDTLFLQVNALSGSLTAELGSLKSLKSMDLSNNMFSGEIPGSFSE  254

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L NL +L+L+ N L G +P  +  +  L+ L L  N F+G IP   G+   L  L +S N
Sbjct  255  LKNLTLLNLFRNKLHGAIPEFIGDLPELQVLQLWENNFTGSIPQGLGKNGKLITLDLSSN  314

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
             L+G +P ++     L+ L I   N   G IP  +G    L R
Sbjct  315  KLTGTLPPDMCFGNNLQTL-ITLGNFLFGPIPESLGKCGSLSR  356


 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 78/174 (45%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  315  KLTGTLPPDMCFGNNLQTLITLGNFLFGPIPESLGKCGSLSRIRMGENFLNGSIPKGLFG  374

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N L G  P       +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  375  LPKLTQVELQDNLLAGSFPETETISANLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGN  434

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              SG IP EIG L +L ++   + N F G I PE+     L   D +   L GE
Sbjct  435  KFSGRIPPEIGRLQQLSKIDFSH-NKFLGPIAPEISQCKLLTFVDLSRNELAGE  487


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 74/154 (48%), Gaps = 1/154 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N+   +FP      
Sbjct  340  LFGPIPESLGKCGSLSRIRMGENFLNGSIPKGLFGLPKLTQVELQDNLLAGSFPETETIS  399

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
            ANL  + L NN L+G LP  +   + ++ L L GN FSGRIPPE GR   L  +  S N 
Sbjct  400  ANLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFSHNK  459

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
              G I  EI     L  + +   N  +G IP E+
Sbjct  460  FLGPIAPEISQCKLLTFVDLSR-NELAGEIPKEI  492


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 65/126 (52%), Gaps = 0/126 (0%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L P +G    +  L +  N+ SG +PPEI  +  L  ++ S+N F      +++Q 
Sbjct  412  LSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFSHNKFLGPIAPEISQC  471

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  +DL  N L G++P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  472  KLLTFVDLSRNELAGEIPKEITGMRILNYLNLSRNHLVGSIPSSISTMQSLTSVDFSYNN  531

Query  449  LSGVIP  466
            LSG++P
Sbjct  532  LSGLVP  537



>ref|XP_010463501.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Camelina sativa]
Length=1006

 Score =   255 bits (652),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 156/204 (76%), Gaps = 2/204 (1%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVP  178
             +STS CTW  VTCD     V+      LNLSG LSPDV  L  L NLS+A NQ+SGP+P
Sbjct  52   KVSTSFCTWVGVTCDVSRRHVTSLDLSGLNLSGTLSPDVSHLRLLQNLSLAENQISGPIP  111

Query  179  PEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANLQVLDLYNNNLTGDLPVEVYKMTSLRH  355
            PEIS +S LR LNLSNN+F  +FP +L+  L NL+VLD+YNNNLTGDLP+ V  +T LRH
Sbjct  112  PEISNLSGLRHLNLSNNVFNGSFPDELSSGLVNLRVLDVYNNNLTGDLPLSVTNLTQLRH  171

Query  356  LHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGG  535
            LHLGGNYF+G+IPP YG +P +EYLAVSGN L G IP EIGNLT L+ELYIGY+N F  G
Sbjct  172  LHLGGNYFAGKIPPLYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFENG  231

Query  536  IPPEMGNLSQLIRXDAANCGLTGE  607
            +PPE+GNLS+L+R D ANCGLTGE
Sbjct  232  LPPEIGNLSELVRLDGANCGLTGE  255


 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 89/162 (55%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G + P++G+L  L  L +  N  SGP+  E+ ++S+L+ ++LSNN+F    P   A+L
Sbjct  252  LTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGSLSSLKSMDLSNNMFTGEIPTSFAEL  311

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G++P  +  +  L  L L  N F+G IP + G    L  + +S N 
Sbjct  312  KNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGSIPEKLGENGKLNLVDLSSNK  371

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P  + +  KL+ L I   N   G IP  +G    L R
Sbjct  372  LTGTLPPNMCSGNKLETL-ITLGNFVFGSIPESLGKCESLTR  412


 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 98/197 (50%), Gaps = 26/197 (13%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  265
             +G + P  G  P +  L+++ N+L G +PPEI  ++TLR L +   N F +  P ++  
Sbjct  179  FAGKIPPLYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFENGLPPEIGN  238

Query  266  LANLQVLDLYNNNLTGDLPVEVYK------------------------MTSLRHLHLGGN  373
            L+ L  LD  N  LTG++P E+ K                        ++SL+ + L  N
Sbjct  239  LSELVRLDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGSLSSLKSMDLSNN  298

Query  374  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
             F+G IP  +    NL  L +  N L G IP  IG+L +L+ L + + N F+G IP ++G
Sbjct  299  MFTGEIPTSFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQL-WENNFTGSIPEKLG  357

Query  554  NLSQLIRXDAANCGLTG  604
               +L   D ++  LTG
Sbjct  358  ENGKLNLVDLSSNKLTG  374


 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 78/150 (52%), Gaps = 1/150 (1%)
 Frame = +2

Query  101  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  280
            L P++G L  LV L  A   L+G +PPEI  +  L  L L  N+F      +L  L++L+
Sbjct  232  LPPEIGNLSELVRLDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGSLSSLK  291

Query  281  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  460
             +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N  +G 
Sbjct  292  SMDLSNNMFTGEIPTSFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGS  351

Query  461  IPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            IP ++G   KL  + +   N  +G +PP M
Sbjct  352  IPEKLGENGKLNLVDLSS-NKLTGTLPPNM  380


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 89/166 (54%), Gaps = 3/166 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +G +   +G+   L  + +++N+L+G +PP + + + L   + L N +FGS  P  L 
Sbjct  347  NFTGSIPEKLGENGKLNLVDLSSNKLTGTLPPNMCSGNKLETLITLGNFVFGS-IPESLG  405

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            +  +L  + +  N L G +P  ++ +  L  +    NY SG +P   G   NL  +++S 
Sbjct  406  KCESLTRIRMGQNFLNGSIPKGLFGLPKLTQVEFQDNYLSGELPVAGGVSVNLGQISLSN  465

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXD  580
            N LSG +P  IGN T +++L +   N F G IP E+G L QL + D
Sbjct  466  NQLSGPLPPAIGNFTGVQKLLLDG-NKFEGQIPSEVGKLQQLSKID  510


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 82/174 (47%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P++     L  L    N + G +P  +    +L  + +  N    + P  L  
Sbjct  371  KLTGTLPPNMCSGNKLETLITLGNFVFGSIPESLGKCESLTRIRMGQNFLNGSIPKGLFG  430

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++  +N L+G+LPV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  431  LPKLTQVEFQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  490

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
               G IPSE+G L +L ++   + N FSG I PE+     L   D +   L+GE
Sbjct  491  KFEGQIPSEVGKLQQLSKIDFSH-NLFSGRIAPEISRCKLLTFVDLSRNELSGE  543


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 78/172 (45%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G +   +  LP L  +    N LSG +P        L  ++LSNN      P  +   
Sbjct  420  LNGSIPKGLFGLPKLTQVEFQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNF  479

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              +Q L L  N   G +P EV K+  L  +    N FSGRI PE  R   L ++ +S N 
Sbjct  480  TGVQKLLLDGNKFEGQIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNE  539

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            LSG IP+EI  +  L  L +   N   G IP  + ++  L   D +   L+G
Sbjct  540  LSGEIPNEITGMRILNYLNLSR-NHLLGSIPGSISSMQSLTSLDFSYNNLSG  590


 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 76/151 (50%), Gaps = 7/151 (5%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            ++G +S ++GQ+      S++ NQLSGP+PP I   + ++ L L  N F    P ++ +L
Sbjct  450  VAGGVSVNLGQI------SLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFEGQIPSEVGKL  503

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  +D  +N  +G +  E+ +   L  + L  N  SG IP E      L YL +S N 
Sbjct  504  QQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNH  563

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            L G IP  I ++  L  L   Y N  SG +P
Sbjct  564  LLGSIPGSISSMQSLTSLDFSY-NNLSGLVP  593



>gb|ADB85326.1| putative receptor protein kinase [Phyllostachys edulis]
Length=265

 Score =   239 bits (611),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 155/202 (77%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPP  181
            N + SHC W  VTC +   VV LD++GLNLSG L P + +L  L  LS+AAN  SGP+P 
Sbjct  47   NGTASHCAWAGVTCSTRGTVVGLDVAGLNLSGALPPALSRLRGLFRLSVAANAFSGPIPA  106

Query  182  EISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLH  361
             ++ +  L  LNLSNN F  +FP  LA+L +L+VLDLYNNNLT  LP+EV +M  LRHLH
Sbjct  107  SLARLQFLVHLNLSNNAFDGSFPAPLARLRSLRVLDLYNNNLTSPLPLEVVQMPQLRHLH  166

Query  362  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            LGGN+FSG IPPEYGR+  L+YLAVSGN LSG IP E+GNLT L+ELYIGY+N +SGG+P
Sbjct  167  LGGNFFSGEIPPEYGRWGRLQYLAVSGNELSGKIPPELGNLTSLRELYIGYYNSYSGGLP  226

Query  542  PEMGNLSQLIRXDAANCGLTGE  607
            PE+GNL++L+R DAANCGL+GE
Sbjct  227  PELGNLTELVRFDAANCGLSGE  248



>ref|NP_201371.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Arabidopsis thaliana]
 ref|NP_001190624.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Arabidopsis thaliana]
 sp|O49545.1|BAME1_ARATH RecName: Full=Leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1; AltName: Full=Protein BARELY ANY MERISTEM 
1; Flags: Precursor [Arabidopsis thaliana]
 emb|CAA16688.1| receptor protein kinase - like protein [Arabidopsis thaliana]
 dbj|BAB10677.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAM20665.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAP68249.1| At5g65700 [Arabidopsis thaliana]
 dbj|BAE98627.1| receptor protein kinase like protein [Arabidopsis thaliana]
 gb|ACN59407.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED98091.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
 gb|AED98092.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
Length=1003

 Score =   255 bits (651),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 156/204 (76%), Gaps = 2/204 (1%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVP  178
             +STS CTW  VTCD     V+      LNLSG LSPDV  L  L NLS+A N +SGP+P
Sbjct  51   KVSTSFCTWIGVTCDVSRRHVTSLDLSGLNLSGTLSPDVSHLRLLQNLSLAENLISGPIP  110

Query  179  PEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANLQVLDLYNNNLTGDLPVEVYKMTSLRH  355
            PEIS++S LR LNLSNN+F  +FP +++  L NL+VLD+YNNNLTGDLPV V  +T LRH
Sbjct  111  PEISSLSGLRHLNLSNNVFNGSFPDEISSGLVNLRVLDVYNNNLTGDLPVSVTNLTQLRH  170

Query  356  LHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGG  535
            LHLGGNYF+G+IPP YG +P +EYLAVSGN L G IP EIGNLT L+ELYIGY+N F  G
Sbjct  171  LHLGGNYFAGKIPPSYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDG  230

Query  536  IPPEMGNLSQLIRXDAANCGLTGE  607
            +PPE+GNLS+L+R D ANCGLTGE
Sbjct  231  LPPEIGNLSELVRFDGANCGLTGE  254


 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 88/162 (54%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   A+L
Sbjct  251  LTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNNMFTGEIPASFAEL  310

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G++P  +  +  L  L L  N F+G IP + G    L  + +S N 
Sbjct  311  KNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGSIPQKLGENGKLNLVDLSSNK  370

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P  + +  KL+ L I   N   G IP  +G    L R
Sbjct  371  LTGTLPPNMCSGNKLETL-ITLGNFLFGSIPDSLGKCESLTR  411


 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 61/197 (31%), Positives = 96/197 (49%), Gaps = 26/197 (13%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  265
             +G + P  G  P +  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  178  FAGKIPPSYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  237

Query  266  LANLQVLDLYNNNLTGDLPVEVYK------------------------MTSLRHLHLGGN  373
            L+ L   D  N  LTG++P E+ K                        ++SL+ + L  N
Sbjct  238  LSELVRFDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNN  297

Query  374  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
             F+G IP  +    NL  L +  N L G IP  IG+L +L+ L + + N F+G IP ++G
Sbjct  298  MFTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQL-WENNFTGSIPQKLG  356

Query  554  NLSQLIRXDAANCGLTG  604
               +L   D ++  LTG
Sbjct  357  ENGKLNLVDLSSNKLTG  373


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 77/150 (51%), Gaps = 1/150 (1%)
 Frame = +2

Query  101  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  280
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N+F      +L  L++L+
Sbjct  231  LPPEIGNLSELVRFDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLK  290

Query  281  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  460
             +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N  +G 
Sbjct  291  SMDLSNNMFTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGS  350

Query  461  IPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            IP ++G   KL  + +   N  +G +PP M
Sbjct  351  IPQKLGENGKLNLVDLSS-NKLTGTLPPNM  379


 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 83/174 (48%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P++     L  L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  370  KLTGTLPPNMCSGNKLETLITLGNFLFGSIPDSLGKCESLTRIRMGENFLNGSIPKGLFG  429

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N L+G+LPV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  430  LPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  489

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
               G IPSE+G L +L ++   + N FSG I PE+     L   D +   L+GE
Sbjct  490  KFQGPIPSEVGKLQQLSKIDFSH-NLFSGRIAPEISRCKLLTFVDLSRNELSGE  542


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 94/175 (54%), Gaps = 3/175 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +G +   +G+   L  + +++N+L+G +PP + + + L   + L N +FGS  P  L 
Sbjct  346  NFTGSIPQKLGENGKLNLVDLSSNKLTGTLPPNMCSGNKLETLITLGNFLFGS-IPDSLG  404

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            +  +L  + +  N L G +P  ++ +  L  + L  NY SG +P   G   NL  +++S 
Sbjct  405  KCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSN  464

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            N LSG +P  IGN T +++L +   N F G IP E+G L QL + D ++   +G 
Sbjct  465  NQLSGPLPPAIGNFTGVQKLLLDG-NKFQGPIPSEVGKLQQLSKIDFSHNLFSGR  518


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 66/127 (52%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             LSG L P +G    +  L +  N+  GP+P E+  +  L  ++ S+N+F      ++++
Sbjct  466  QLSGPLPPAIGNFTGVQKLLLDGNKFQGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISR  525

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  +DL  N L+G++P E+  M  L +L+L  N+  G IP       +L  L  S N
Sbjct  526  CKLLTFVDLSRNELSGEIPNEITAMKILNYLNLSRNHLVGSIPGSISSMQSLTSLDFSYN  585

Query  446  GLSGVIP  466
             LSG++P
Sbjct  586  NLSGLVP  592


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 76/151 (50%), Gaps = 7/151 (5%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            ++G +S ++GQ+      S++ NQLSGP+PP I   + ++ L L  N F    P ++ +L
Sbjct  449  VAGGVSVNLGQI------SLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFQGPIPSEVGKL  502

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  +D  +N  +G +  E+ +   L  + L  N  SG IP E      L YL +S N 
Sbjct  503  QQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITAMKILNYLNLSRNH  562

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            L G IP  I ++  L  L   Y N  SG +P
Sbjct  563  LVGSIPGSISSMQSLTSLDFSY-NNLSGLVP  592


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 74/161 (46%), Gaps = 1/161 (1%)
 Frame = +2

Query  122  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  301
            LP L  + +  N LSG +P        L  ++LSNN      P  +     +Q L L  N
Sbjct  430  LPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  489

Query  302  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGN  481
               G +P EV K+  L  +    N FSGRI PE  R   L ++ +S N LSG IP+EI  
Sbjct  490  KFQGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITA  549

Query  482  LTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            +  L  L +   N   G IP  + ++  L   D +   L+G
Sbjct  550  MKILNYLNLSR-NHLVGSIPGSISSMQSLTSLDFSYNNLSG  589



>ref|XP_006279943.1| hypothetical protein CARUB_v10025808mg [Capsella rubella]
 gb|EOA12841.1| hypothetical protein CARUB_v10025808mg [Capsella rubella]
Length=1004

 Score =   255 bits (651),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 155/204 (76%), Gaps = 2/204 (1%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVP  178
             +STS CTW  VTCD     V+      LNLSG LSPDV  L  L NLS+A NQ+SGP+P
Sbjct  52   KVSTSFCTWVGVTCDVSRRHVTSLDLSGLNLSGTLSPDVSHLRLLQNLSLAENQISGPIP  111

Query  179  PEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANLQVLDLYNNNLTGDLPVEVYKMTSLRH  355
             EIS +S LR LNLSNN+F  +FP +L+  L NL+VLD+YNNNLTGDLPV V  +T LRH
Sbjct  112  TEISNLSGLRHLNLSNNVFNGSFPDELSYGLVNLRVLDVYNNNLTGDLPVSVTNLTQLRH  171

Query  356  LHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGG  535
            LHLGGNYF+G+IPP YG +P +EYLAVSGN L G IP EIGNLT L+ELYIGY+N F  G
Sbjct  172  LHLGGNYFAGKIPPSYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFENG  231

Query  536  IPPEMGNLSQLIRXDAANCGLTGE  607
            +PPE+GNLS+L+R D ANCGLTGE
Sbjct  232  LPPEIGNLSELVRLDGANCGLTGE  255


 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 88/162 (54%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   A+L
Sbjct  252  LTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNNMFTGEIPASFAEL  311

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G++P  +  +  L  L L  N F+G IP + G    L  + +S N 
Sbjct  312  KNLTLLNLFRNKLHGEIPEFIGVLPELEVLQLWENNFTGSIPQKLGENGKLNLVDLSSNK  371

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P  + +  KL+ L I   N   G IP  +G    L R
Sbjct  372  LTGTLPPNMCSGNKLETL-ITLGNFLFGSIPDSLGKCESLTR  412


 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 97/197 (49%), Gaps = 26/197 (13%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  265
             +G + P  G  P +  L+++ N+L G +PPEI  ++TLR L +   N F +  P ++  
Sbjct  179  FAGKIPPSYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFENGLPPEIGN  238

Query  266  LANLQVLDLYNNNLTGDLPVEVYK------------------------MTSLRHLHLGGN  373
            L+ L  LD  N  LTG++P E+ K                        ++SL+ + L  N
Sbjct  239  LSELVRLDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNN  298

Query  374  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
             F+G IP  +    NL  L +  N L G IP  IG L +L+ L + + N F+G IP ++G
Sbjct  299  MFTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGVLPELEVLQL-WENNFTGSIPQKLG  357

Query  554  NLSQLIRXDAANCGLTG  604
               +L   D ++  LTG
Sbjct  358  ENGKLNLVDLSSNKLTG  374


 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 78/150 (52%), Gaps = 1/150 (1%)
 Frame = +2

Query  101  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  280
            L P++G L  LV L  A   L+G +PPEI  +  L  L L  N+F      +L  L++L+
Sbjct  232  LPPEIGNLSELVRLDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLK  291

Query  281  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  460
             +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N  +G 
Sbjct  292  SMDLSNNMFTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGVLPELEVLQLWENNFTGS  351

Query  461  IPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            IP ++G   KL  + +   N  +G +PP M
Sbjct  352  IPQKLGENGKLNLVDLSS-NKLTGTLPPNM  380


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 82/174 (47%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P++     L  L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  371  KLTGTLPPNMCSGNKLETLITLGNFLFGSIPDSLGKCESLTRIRMGENFLNGSIPKGLFG  430

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N L+G LPV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  431  LPKLTQVELQDNYLSGQLPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  490

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
               G IPSE+G L +L ++   + N FSG I PE+     L   D +   L+GE
Sbjct  491  KFEGPIPSEVGKLQQLSKIDFSH-NLFSGRIAPEISRCKLLTFVDLSRNELSGE  543


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 91/166 (55%), Gaps = 3/166 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +G +   +G+   L  + +++N+L+G +PP + + + L   + L N +FGS  P  L 
Sbjct  347  NFTGSIPQKLGENGKLNLVDLSSNKLTGTLPPNMCSGNKLETLITLGNFLFGS-IPDSLG  405

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            +  +L  + +  N L G +P  ++ +  L  + L  NY SG++P   G   NL  +++S 
Sbjct  406  KCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLSGQLPVAGGVSVNLGQISLSN  465

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXD  580
            N LSG +P  IGN T +++L +   N F G IP E+G L QL + D
Sbjct  466  NQLSGPLPPAIGNFTGVQKLLLDG-NKFEGPIPSEVGKLQQLSKID  510


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 72/149 (48%), Gaps = 8/149 (5%)
 Frame = +2

Query  116  GQLPF-------LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  274
            GQLP        L  +S++ NQLSGP+PP I   + ++ L L  N F    P ++ +L  
Sbjct  446  GQLPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQ  505

Query  275  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  454
            L  +D  +N  +G +  E+ +   L  + L  N  SG IP E      L YL +S N L 
Sbjct  506  LSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITGMKILNYLNLSRNHLV  565

Query  455  GVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            G IP  I ++  L  L   Y N  SG +P
Sbjct  566  GSIPGSISSMQSLTSLDFSY-NNLSGLVP  593


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 74/161 (46%), Gaps = 1/161 (1%)
 Frame = +2

Query  122  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  301
            LP L  + +  N LSG +P        L  ++LSNN      P  +     +Q L L  N
Sbjct  431  LPKLTQVELQDNYLSGQLPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  490

Query  302  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGN  481
               G +P EV K+  L  +    N FSGRI PE  R   L ++ +S N LSG IP+EI  
Sbjct  491  KFEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITG  550

Query  482  LTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            +  L  L +   N   G IP  + ++  L   D +   L+G
Sbjct  551  MKILNYLNLSR-NHLVGSIPGSISSMQSLTSLDFSYNNLSG  590


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 66/127 (52%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             LSG L P +G    +  L +  N+  GP+P E+  +  L  ++ S+N+F      ++++
Sbjct  467  QLSGPLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISR  526

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  +DL  N L+G++P E+  M  L +L+L  N+  G IP       +L  L  S N
Sbjct  527  CKLLTFVDLSRNELSGEIPNEITGMKILNYLNLSRNHLVGSIPGSISSMQSLTSLDFSYN  586

Query  446  GLSGVIP  466
             LSG++P
Sbjct  587  NLSGLVP  593



>ref|XP_006393995.1| hypothetical protein EUTSA_v10003584mg [Eutrema salsugineum]
 gb|ESQ31281.1| hypothetical protein EUTSA_v10003584mg [Eutrema salsugineum]
Length=1007

 Score =   254 bits (650),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 131/202 (65%), Positives = 156/202 (77%), Gaps = 2/202 (1%)
 Frame = +2

Query  8    STSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPE  184
            STS CTW  VTCD     V+      LNLSG LSPDV +LP L NLS+A NQ+SGP+PPE
Sbjct  53   STSFCTWTGVTCDISRRHVTSLDLSGLNLSGTLSPDVSRLPLLQNLSVADNQISGPIPPE  112

Query  185  ISAISTLRFLNLSNNIFGSTFPHQLAQ-LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLH  361
            IS +  LR LNLSNN+F  +FP +++  L NL+VLD+YNNNLTGDLP+ V  +T LRHLH
Sbjct  113  ISNLYGLRHLNLSNNVFNGSFPDEISSGLVNLRVLDVYNNNLTGDLPLSVTNLTQLRHLH  172

Query  362  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            LGGNYF+G+IP  YG +P +EYLAVSGN L G IP EIGNLT L+ELYIGY+N F  G+P
Sbjct  173  LGGNYFAGQIPSSYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDGLP  232

Query  542  PEMGNLSQLIRXDAANCGLTGE  607
            PE+GNLS+L+R DAANCGLTGE
Sbjct  233  PEIGNLSELVRFDAANCGLTGE  254


 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/162 (34%), Positives = 88/162 (54%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   A+L
Sbjct  251  LTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNNMFTGEIPASFAEL  310

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G++P  + ++  L  L L  N F+G IP + G    L  + +S N 
Sbjct  311  KNLTLLNLFRNKLHGEIPEFIGELPELEVLQLWENNFTGSIPQKLGENGKLNLVDLSSNK  370

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P  + +   L+ L I   N   G IP  +G    L R
Sbjct  371  LTGALPPNMCSGNNLETL-ITLGNFLFGSIPDSLGKCESLSR  411


 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 81/160 (51%), Gaps = 4/160 (3%)
 Frame = +2

Query  101  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  280
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N+F      +L  L++L+
Sbjct  231  LPPEIGNLSELVRFDAANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLK  290

Query  281  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  460
             +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N  +G 
Sbjct  291  SMDLSNNMFTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGELPELEVLQLWENNFTGS  350

Query  461  IPSEIGNLTKLKELYIGYFNGFSGGIPPEM---GNLSQLI  571
            IP ++G   KL  + +   N  +G +PP M    NL  LI
Sbjct  351  IPQKLGENGKLNLVDLSS-NKLTGALPPNMCSGNNLETLI  389


 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 94/197 (48%), Gaps = 26/197 (13%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  265
             +G +    G  P +  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  178  FAGQIPSSYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  237

Query  266  LANLQVLDLYNNNLTGDLPVEVYK------------------------MTSLRHLHLGGN  373
            L+ L   D  N  LTG++P E+ K                        ++SL+ + L  N
Sbjct  238  LSELVRFDAANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNN  297

Query  374  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
             F+G IP  +    NL  L +  N L G IP  IG L +L+ L + + N F+G IP ++G
Sbjct  298  MFTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGELPELEVLQL-WENNFTGSIPQKLG  356

Query  554  NLSQLIRXDAANCGLTG  604
               +L   D ++  LTG
Sbjct  357  ENGKLNLVDLSSNKLTG  373


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 83/174 (48%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P++     L  L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  370  KLTGALPPNMCSGNNLETLITLGNFLFGSIPDSLGKCESLSRIRMGQNFLNGSIPKGLFG  429

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N LTG LPV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  430  LPKLTQVELQDNYLTGQLPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  489

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
               G IPSE+G L +L ++   + N FSG I PE+ +   L   D +   L+G+
Sbjct  490  KFEGPIPSEVGKLQQLSKIDFSH-NLFSGRIAPEISHCKLLTFVDLSRNELSGD  542


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 91/166 (55%), Gaps = 3/166 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +G +   +G+   L  + +++N+L+G +PP + + + L   + L N +FGS  P  L 
Sbjct  346  NFTGSIPQKLGENGKLNLVDLSSNKLTGALPPNMCSGNNLETLITLGNFLFGS-IPDSLG  404

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            +  +L  + +  N L G +P  ++ +  L  + L  NY +G++P   G   NL  +++S 
Sbjct  405  KCESLSRIRMGQNFLNGSIPKGLFGLPKLTQVELQDNYLTGQLPVAGGVSVNLGQISLSN  464

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXD  580
            N LSG +P  IGN T +++L +   N F G IP E+G L QL + D
Sbjct  465  NQLSGPLPPAIGNFTGVQKLLLDG-NKFEGPIPSEVGKLQQLSKID  509


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 65/127 (51%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             LSG L P +G    +  L +  N+  GP+P E+  +  L  ++ S+N+F      +++ 
Sbjct  466  QLSGPLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISH  525

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  +DL  N L+GD+P E+  M  L +L+L  N+  G IP       +L  L  S N
Sbjct  526  CKLLTFVDLSRNELSGDIPNEITGMRILNYLNLSRNHLVGTIPGSISSMQSLTSLDFSYN  585

Query  446  GLSGVIP  466
             LSG++P
Sbjct  586  NLSGLVP  592


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 71/150 (47%), Gaps = 8/150 (5%)
 Frame = +2

Query  113  VGQLPF-------LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
             GQLP        L  +S++ NQLSGP+PP I   + ++ L L  N F    P ++ +L 
Sbjct  444  TGQLPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQ  503

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
             L  +D  +N  +G +  E+     L  + L  N  SG IP E      L YL +S N L
Sbjct  504  QLSKIDFSHNLFSGRIAPEISHCKLLTFVDLSRNELSGDIPNEITGMRILNYLNLSRNHL  563

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
             G IP  I ++  L  L   Y N  SG +P
Sbjct  564  VGTIPGSISSMQSLTSLDFSY-NNLSGLVP  592


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 51/161 (32%), Positives = 73/161 (45%), Gaps = 1/161 (1%)
 Frame = +2

Query  122  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  301
            LP L  + +  N L+G +P        L  ++LSNN      P  +     +Q L L  N
Sbjct  430  LPKLTQVELQDNYLTGQLPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  489

Query  302  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGN  481
               G +P EV K+  L  +    N FSGRI PE      L ++ +S N LSG IP+EI  
Sbjct  490  KFEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISHCKLLTFVDLSRNELSGDIPNEITG  549

Query  482  LTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            +  L  L +   N   G IP  + ++  L   D +   L+G
Sbjct  550  MRILNYLNLSR-NHLVGTIPGSISSMQSLTSLDFSYNNLSG  589



>ref|XP_009136515.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Brassica rapa]
Length=993

 Score =   254 bits (649),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 157/204 (77%), Gaps = 2/204 (1%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVP  178
            ++STS C W  VTCD+ L  V       LNLSG L   V  LP L NLS+AANQ+SG +P
Sbjct  52   DLSTSFCLWTGVTCDASLRHVISLDLSGLNLSGTLPSSVAHLPLLRNLSLAANQISGHIP  111

Query  179  PEISAISTLRFLNLSNNIFGSTFPHQL-AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRH  355
            PE++++S LR LNLSNN+F  +FP +L A L NL+VLDLYNNNLTGDLPV +  +T LRH
Sbjct  112  PEMASLSELRRLNLSNNVFNGSFPDELSAGLVNLRVLDLYNNNLTGDLPVSITNLTELRH  171

Query  356  LHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGG  535
            LHLGGNYF+GRIPP YG +P LEYLAVSGN L+G IP EIGNLT L+ELYIGYFN F GG
Sbjct  172  LHLGGNYFAGRIPPAYGSWPALEYLAVSGNELAGKIPPEIGNLTTLRELYIGYFNAFDGG  231

Query  536  IPPEMGNLSQLIRXDAANCGLTGE  607
            +P E+GNLS+L+R DAANCGL GE
Sbjct  232  LPAEIGNLSELLRLDAANCGLRGE  255


 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 85/162 (52%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L G + P++G+L  L  L +  N  SG +PPE+  IS+L+ ++LSNN+F    P +  QL
Sbjct  252  LRGEIPPEIGRLRRLDTLFLQVNAFSGTLPPELGTISSLKSMDLSNNMFTGEIPPRFEQL  311

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  +  M  L  L L  N F+G IP + G    L  L +S N 
Sbjct  312  RNLTLLNLFRNKLYGAIPEFIGDMPGLEVLQLWENNFTGSIPRKLGENGRLVILDLSSNK  371

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P  +    +L  L I   N   G IP  +G    L R
Sbjct  372  LTGTLPPNMCFGNRLVTL-ITLGNFLFGSIPDSLGKCESLTR  412


 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 89/176 (51%), Gaps = 3/176 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P++     LV L    N L G +P  +    +L  + +  N    + P+ L  
Sbjct  371  KLTGTLPPNMCFGNRLVTLITLGNFLFGSIPDSLGKCESLTRIRMGQNFLNGSIPNGLFG  430

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTS--LRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  439
            L  L  ++L +N LTG+LP+ +    S  L  + L  N  SG +PP  G F  ++ L + 
Sbjct  431  LPELSQVELQDNYLTGELPLPISGGVSVNLGQISLSNNQLSGPLPPAIGSFSGVQKLLLD  490

Query  440  GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            GN  SG IPSEIG L +L +L   + N FSGGIPPE+     L   D +   L+GE
Sbjct  491  GNKFSGAIPSEIGRLQQLSKLDFSH-NLFSGGIPPEISRCKLLTYVDLSRNELSGE  545


 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 61/197 (31%), Positives = 99/197 (50%), Gaps = 26/197 (13%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  265
             +G + P  G  P L  L+++ N+L+G +PPEI  ++TLR L +   N F    P ++  
Sbjct  179  FAGRIPPAYGSWPALEYLAVSGNELAGKIPPEIGNLTTLRELYIGYFNAFDGGLPAEIGN  238

Query  266  LANLQVLDLYNNNLTGDLPVEVYKM------------------------TSLRHLHLGGN  373
            L+ L  LD  N  L G++P E+ ++                        +SL+ + L  N
Sbjct  239  LSELLRLDAANCGLRGEIPPEIGRLRRLDTLFLQVNAFSGTLPPELGTISSLKSMDLSNN  298

Query  374  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
             F+G IPP + +  NL  L +  N L G IP  IG++  L+ L + + N F+G IP ++G
Sbjct  299  MFTGEIPPRFEQLRNLTLLNLFRNKLYGAIPEFIGDMPGLEVLQL-WENNFTGSIPRKLG  357

Query  554  NLSQLIRXDAANCGLTG  604
               +L+  D ++  LTG
Sbjct  358  ENGRLVILDLSSNKLTG  374


 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 79/151 (52%), Gaps = 7/151 (5%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            +SG +S ++GQ+      S++ NQLSGP+PP I + S ++ L L  N F    P ++ +L
Sbjct  452  ISGGVSVNLGQI------SLSNNQLSGPLPPAIGSFSGVQKLLLDGNKFSGAIPSEIGRL  505

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  LD  +N  +G +P E+ +   L ++ L  N  SG IP E      L YL VS N 
Sbjct  506  QQLSKLDFSHNLFSGGIPPEISRCKLLTYVDLSRNELSGEIPNEITSMRILNYLNVSRNH  565

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            L G IP  I ++  L  +   Y N  SG +P
Sbjct  566  LVGSIPVTISSMQSLTSIDFSY-NNLSGLVP  595


 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 78/154 (51%), Gaps = 1/154 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
              G L  ++G L  L+ L  A   L G +PPEI  +  L  L L  N F  T P +L  +
Sbjct  228  FDGGLPAEIGNLSELLRLDAANCGLRGEIPPEIGRLRRLDTLFLQVNAFSGTLPPELGTI  287

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
            ++L+ +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N 
Sbjct  288  SSLKSMDLSNNMFTGEIPPRFEQLRNLTLLNLFRNKLYGAIPEFIGDMPGLEVLQLWENN  347

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
             +G IP ++G   +L  L +   N  +G +PP M
Sbjct  348  FTGSIPRKLGENGRLVILDLSS-NKLTGTLPPNM  380


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 68/128 (53%), Gaps = 0/128 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             LSG L P +G    +  L +  N+ SG +P EI  +  L  L+ S+N+F    P ++++
Sbjct  469  QLSGPLPPAIGSFSGVQKLLLDGNKFSGAIPSEIGRLQQLSKLDFSHNLFSGGIPPEISR  528

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  +DL  N L+G++P E+  M  L +L++  N+  G IP       +L  +  S N
Sbjct  529  CKLLTYVDLSRNELSGEIPNEITSMRILNYLNVSRNHLVGSIPVTISSMQSLTSIDFSYN  588

Query  446  GLSGVIPS  469
             LSG++PS
Sbjct  589  NLSGLVPS  596


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/163 (33%), Positives = 80/163 (49%), Gaps = 3/163 (2%)
 Frame = +2

Query  122  LPFLVNLSIAANQLSGPVPPEISAISTLRF--LNLSNNIFGSTFPHQLAQLANLQVLDLY  295
            LP L  + +  N L+G +P  IS   ++    ++LSNN      P  +   + +Q L L 
Sbjct  431  LPELSQVELQDNYLTGELPLPISGGVSVNLGQISLSNNQLSGPLPPAIGSFSGVQKLLLD  490

Query  296  NNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEI  475
             N  +G +P E+ ++  L  L    N FSG IPPE  R   L Y+ +S N LSG IP+EI
Sbjct  491  GNKFSGAIPSEIGRLQQLSKLDFSHNLFSGGIPPEISRCKLLTYVDLSRNELSGEIPNEI  550

Query  476  GNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             ++  L  L +   N   G IP  + ++  L   D +   L+G
Sbjct  551  TSMRILNYLNVSR-NHLVGSIPVTISSMQSLTSIDFSYNNLSG  592



>ref|XP_010515326.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Camelina sativa]
Length=1000

 Score =   254 bits (648),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 156/201 (78%), Gaps = 2/201 (1%)
 Frame = +2

Query  8    STSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPE  184
            +T+ C+W  VTCD     V+      LNLSG LS DV  LP L NLS+AANQ+SGP+PPE
Sbjct  52   TTTFCSWTGVTCDVSRRHVTSLDLSGLNLSGTLSSDVSHLPLLQNLSLAANQISGPIPPE  111

Query  185  ISAISTLRFLNLSNNIFGSTFPHQLAQ-LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLH  361
            IS +S LR LNLSNN+F  ++P +L+  L NL+VLDLYNNNLTGDLP+ +  +T LRHLH
Sbjct  112  ISNLSELRLLNLSNNVFNGSYPDELSSGLVNLRVLDLYNNNLTGDLPLSITNLTELRHLH  171

Query  362  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            LGGNYFSG+IP  YG +P LEYLAVSGN L+G IP EIGNLT L+ELYIGY+N F  G+P
Sbjct  172  LGGNYFSGKIPATYGTWPVLEYLAVSGNELTGKIPPEIGNLTTLRELYIGYYNAFEDGLP  231

Query  542  PEMGNLSQLIRXDAANCGLTG  604
            PE+GNL++L+R DAANCGLTG
Sbjct  232  PEIGNLTELLRFDAANCGLTG  252


 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 63/197 (32%), Positives = 96/197 (49%), Gaps = 26/197 (13%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  265
             SG +    G  P L  L+++ N+L+G +PPEI  ++TLR L +   N F    P ++  
Sbjct  177  FSGKIPATYGTWPVLEYLAVSGNELTGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  236

Query  266  LANLQVLDLYNNNLTGDLPVEVYKM------------------------TSLRHLHLGGN  373
            L  L   D  N  LTG +P E+ K+                        +SL+ + L  N
Sbjct  237  LTELLRFDAANCGLTGAIPPEIGKLQNLDTLFLQVNAFSGPLTSELGLISSLKSMDLSNN  296

Query  374  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
             F+G IP  +    NL  L +  N L G IP  IG L +L+ L + + N F+GGIP ++G
Sbjct  297  MFTGEIPTSFSELKNLTLLNLFRNKLYGAIPEFIGELPELEVLQL-WENNFTGGIPQKLG  355

Query  554  NLSQLIRXDAANCGLTG  604
            +  +L+  D ++  LTG
Sbjct  356  DNGRLVILDLSSNKLTG  372


 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 87/162 (54%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G + P++G+L  L  L +  N  SGP+  E+  IS+L+ ++LSNN+F    P   ++L
Sbjct  250  LTGAIPPEIGKLQNLDTLFLQVNAFSGPLTSELGLISSLKSMDLSNNMFTGEIPTSFSEL  309

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP + G    L  L +S N 
Sbjct  310  KNLTLLNLFRNKLYGAIPEFIGELPELEVLQLWENNFTGGIPQKLGDNGRLVILDLSSNK  369

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P  + +  +L  L I   N   G IP  +G    L R
Sbjct  370  LTGTLPPNMCSGNRLMTL-ITLGNFLFGSIPDSLGKCESLTR  410


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/175 (31%), Positives = 96/175 (55%), Gaps = 3/175 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEI-SAISTLRFLNLSNNIFGSTFPHQLA  262
            N +G +   +G    LV L +++N+L+G +PP + S    +  + L N +FGS  P  L 
Sbjct  345  NFTGGIPQKLGDNGRLVILDLSSNKLTGTLPPNMCSGNRLMTLITLGNFLFGS-IPDSLG  403

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            +  +L  + +  N L G +P  ++ +  L  + L  NY +G +P   G   +L  +++S 
Sbjct  404  KCESLTRIRMGQNFLNGSIPKGLFGLPKLSQVELQDNYLTGELPISGGVSSDLGQVSLSN  463

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            N LSG +P+ IGN + +++L +   N F+G IPP++G L QL + D ++   +G 
Sbjct  464  NKLSGSLPAAIGNFSGVQKLLLDG-NKFTGPIPPDIGRLQQLSKLDFSHNLFSGR  517


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 82/157 (52%), Gaps = 1/157 (1%)
 Frame = +2

Query  101  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  280
            L P++G L  L+    A   L+G +PPEI  +  L  L L  N F      +L  +++L+
Sbjct  230  LPPEIGNLTELLRFDAANCGLTGAIPPEIGKLQNLDTLFLQVNAFSGPLTSELGLISSLK  289

Query  281  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  460
             +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N  +G 
Sbjct  290  SMDLSNNMFTGEIPTSFSELKNLTLLNLFRNKLYGAIPEFIGELPELEVLQLWENNFTGG  349

Query  461  IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLI  571
            IP ++G+  +L  L +   N  +G +PP M + ++L+
Sbjct  350  IPQKLGDNGRLVILDLSS-NKLTGTLPPNMCSGNRLM  385


 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 83/174 (48%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P++     L+ L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  369  KLTGTLPPNMCSGNRLMTLITLGNFLFGSIPDSLGKCESLTRIRMGQNFLNGSIPKGLFG  428

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N LTG+LP+     + L  + L  N  SG +P   G F  ++ L + GN
Sbjct  429  LPKLSQVELQDNYLTGELPISGGVSSDLGQVSLSNNKLSGSLPAAIGNFSGVQKLLLDGN  488

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              +G IP +IG L +L +L   + N FSG I PE+     L   D +   L+G+
Sbjct  489  KFTGPIPPDIGRLQQLSKLDFSH-NLFSGRIAPEISRCKLLTFVDLSRNELSGD  541


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 68/128 (53%), Gaps = 0/128 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             LSG L   +G    +  L +  N+ +GP+PP+I  +  L  L+ S+N+F      ++++
Sbjct  465  KLSGSLPAAIGNFSGVQKLLLDGNKFTGPIPPDIGRLQQLSKLDFSHNLFSGRIAPEISR  524

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  +DL  N L+GD+P E+  M  L +L+L  N+  G IP       +L  +  S N
Sbjct  525  CKLLTFVDLSRNELSGDIPNEITGMRILNYLNLSRNHLVGSIPVSIASMQSLTSVDFSYN  584

Query  446  GLSGVIPS  469
             LSG++PS
Sbjct  585  NLSGLVPS  592


 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 78/161 (48%), Gaps = 1/161 (1%)
 Frame = +2

Query  122  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  301
            LP L  + +  N L+G +P      S L  ++LSNN    + P  +   + +Q L L  N
Sbjct  429  LPKLSQVELQDNYLTGELPISGGVSSDLGQVSLSNNKLSGSLPAAIGNFSGVQKLLLDGN  488

Query  302  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGN  481
              TG +P ++ ++  L  L    N FSGRI PE  R   L ++ +S N LSG IP+EI  
Sbjct  489  KFTGPIPPDIGRLQQLSKLDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGDIPNEITG  548

Query  482  LTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            +  L  L +   N   G IP  + ++  L   D +   L+G
Sbjct  549  MRILNYLNLSR-NHLVGSIPVSIASMQSLTSVDFSYNNLSG  588



>gb|KJB18115.1| hypothetical protein B456_003G034500 [Gossypium raimondii]
Length=1014

 Score =   253 bits (647),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 163/203 (80%), Gaps = 1/203 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsl-lhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVP  178
            N ST  C++  VTCD    HV S+DL+ + L+G LSP +  L FL NLS+A N LSGP+P
Sbjct  52   NASTPLCSFAGVTCDLTGRHVTSIDLTNVTLAGTLSPSLAHLRFLQNLSVAGNDLSGPIP  111

Query  179  PEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHL  358
             E++ +S LR+LNLSNN+F  +FP QL+QL NLQ+LDLYNNN+TG+LPV V ++ +LRHL
Sbjct  112  TELAVLSNLRYLNLSNNVFNGSFPTQLSQLKNLQILDLYNNNMTGELPVSVTELPNLRHL  171

Query  359  HLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGI  538
            HLGGNYFSG+IP  YGR+ +LEYLAVSGN LSG IP EIGNLTKLK+LYIGYFN F GG+
Sbjct  172  HLGGNYFSGQIPSSYGRWEHLEYLAVSGNELSGKIPPEIGNLTKLKQLYIGYFNSFEGGL  231

Query  539  PPEMGNLSQLIRXDAANCGLTGE  607
            PPE+GNLS+L+R DAANC L+GE
Sbjct  232  PPEIGNLSELVRFDAANCMLSGE  254


 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 90/162 (56%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P++G+L  L  L +  N LSG + PE+  +++L+ ++LSNN+F    P   AQL
Sbjct  251  LSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGTLNSLKSMDLSNNMFTGEIPASFAQL  310

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP + G    L+ L +S N 
Sbjct  311  KNLTLLNLFRNKLHGRIPDFIGELPELEVLQLWENNFTGSIPQKLGSNKKLQVLDLSSNK  370

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P ++ +   L+ L I   N   G IP  +G    L R
Sbjct  371  LTGTLPPDMCSGNTLQTL-ITLGNFLLGPIPESLGKCESLSR  411


 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 81/155 (52%), Gaps = 1/155 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            +  G L P++G L  LV    A   LSG +PPEI  +  L  L L  N    +   +L  
Sbjct  226  SFEGGLPPEIGNLSELVRFDAANCMLSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGT  285

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L +L+ +DL NN  TG++P    ++ +L  L+L  N   GRIP   G  P LE L +  N
Sbjct  286  LNSLKSMDLSNNMFTGEIPASFAQLKNLTLLNLFRNKLHGRIPDFIGELPELEVLQLWEN  345

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
              +G IP ++G+  KL+ L +   N  +G +PP+M
Sbjct  346  NFTGSIPQKLGSNKKLQVLDLSS-NKLTGTLPPDM  379


 Score = 89.7 bits (221),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 60/173 (35%), Positives = 91/173 (53%), Gaps = 2/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            LSG + P++G L  L  L I   N   G +PPEI  +S L   + +N +     P ++ +
Sbjct  202  LSGKIPPEIGNLTKLKQLYIGYFNSFEGGLPPEIGNLSELVRFDAANCMLSGEIPPEIGK  261

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  L L  N L+G L  E+  + SL+ + L  N F+G IP  + +  NL  L +  N
Sbjct  262  LQKLDTLFLQVNALSGSLTPELGTLNSLKSMDLSNNMFTGEIPASFAQLKNLTLLNLFRN  321

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             L G IP  IG L +L+ L + + N F+G IP ++G+  +L   D ++  LTG
Sbjct  322  KLHGRIPDFIGELPELEVLQL-WENNFTGSIPQKLGSNKKLQVLDLSSNKLTG  373


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 84/175 (48%), Gaps = 2/175 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  370  KLTGTLPPDMCSGNTLQTLITLGNFLLGPIPESLGKCESLSRIRMGENYLNGSIPKGLLG  429

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTS-LRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            L  L  ++L +N LTG+ PV    +++ L  + L  N  SG +P   G F  ++ L + G
Sbjct  430  LPQLTQVELQDNYLTGEFPVTDSSISANLGQISLSNNQLSGALPASVGNFSGVQKLLLDG  489

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            N  SG IP+EIG L +L ++   + N  SG IPPE+     L   D +   L+G 
Sbjct  490  NKFSGPIPAEIGKLQQLSKIDFSH-NKLSGLIPPEICKCKLLTFVDLSGNELSGR  543


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 70/137 (51%), Gaps = 1/137 (1%)
 Frame = +2

Query  131  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  310
            L  +S++ NQLSG +P  +   S ++ L L  N F    P ++ +L  L  +D  +N L+
Sbjct  458  LGQISLSNNQLSGALPASVGNFSGVQKLLLDGNKFSGPIPAEIGKLQQLSKIDFSHNKLS  517

Query  311  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTK  490
            G +P E+ K   L  + L GN  SGRIP E      L YL +S N L G IPS I  +  
Sbjct  518  GLIPPEICKCKLLTFVDLSGNELSGRIPTEITSMRILNYLNLSRNHLLGSIPSSISTMQS  577

Query  491  LKELYIGYFNGFSGGIP  541
            L  +   Y N  SG +P
Sbjct  578  LTSVDFSY-NNLSGLVP  593


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 53/162 (33%), Positives = 79/162 (49%), Gaps = 2/162 (1%)
 Frame = +2

Query  122  LPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQLANLQVLDLYN  298
            LP L  + +  N L+G  P   S+IS  L  ++LSNN      P  +   + +Q L L  
Sbjct  430  LPQLTQVELQDNYLTGEFPVTDSSISANLGQISLSNNQLSGALPASVGNFSGVQKLLLDG  489

Query  299  NNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIG  478
            N  +G +P E+ K+  L  +    N  SG IPPE  +   L ++ +SGN LSG IP+EI 
Sbjct  490  NKFSGPIPAEIGKLQQLSKIDFSHNKLSGLIPPEICKCKLLTFVDLSGNELSGRIPTEIT  549

Query  479  NLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            ++  L  L +   N   G IP  +  +  L   D +   L+G
Sbjct  550  SMRILNYLNLSR-NHLLGSIPSSISTMQSLTSVDFSYNNLSG  590


 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 63/127 (50%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             LSG L   VG    +  L +  N+ SGP+P EI  +  L  ++ S+N      P ++ +
Sbjct  467  QLSGALPASVGNFSGVQKLLLDGNKFSGPIPAEIGKLQQLSKIDFSHNKLSGLIPPEICK  526

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  +DL  N L+G +P E+  M  L +L+L  N+  G IP       +L  +  S N
Sbjct  527  CKLLTFVDLSGNELSGRIPTEITSMRILNYLNLSRNHLLGSIPSSISTMQSLTSVDFSYN  586

Query  446  GLSGVIP  466
             LSG++P
Sbjct  587  NLSGLVP  593



>ref|XP_009150662.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Brassica rapa]
Length=997

 Score =   253 bits (646),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 152/202 (75%), Gaps = 2/202 (1%)
 Frame = +2

Query  8    STSHCTWRRVTCdsllhvvsldlsglNLS-GVLSPDVGQLPFLVNLSIAANQLSGPVPPE  184
            +TS CTW  VTCD     V+          G LSPDV  LP L NLS+A NQ+SGP+PPE
Sbjct  51   TTSFCTWTGVTCDVSRRHVTSLDLSSLNLSGTLSPDVSHLPLLQNLSLADNQISGPIPPE  110

Query  185  ISAISTLRFLNLSNNIFGSTFPHQL-AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLH  361
            IS +S LR LNLSNNIF  +FP ++ A LANL+VLD+YNNN+TGDLP+ V  +T LRHLH
Sbjct  111  ISNLSGLRHLNLSNNIFNGSFPGEISAGLANLRVLDVYNNNMTGDLPLSVTNLTQLRHLH  170

Query  362  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            LGGNYF+G IPP YG +P +EYLAVSGN L+G IP EIGNLT L+ELYIGYFN F  G+P
Sbjct  171  LGGNYFAGEIPPSYGTWPEIEYLAVSGNELTGKIPPEIGNLTTLRELYIGYFNAFEDGLP  230

Query  542  PEMGNLSQLIRXDAANCGLTGE  607
            PE+GNLS+L+R DAANC L GE
Sbjct  231  PEIGNLSELVRFDAANCALNGE  252


 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 55/162 (34%), Positives = 87/162 (54%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   + L
Sbjct  249  LNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLKSMDLSNNMFTGEIPASFSDL  308

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G++P  + ++  L  L L  N F+G IP + G    L  + +S N 
Sbjct  309  KNLTLLNLFRNKLHGEIPEFIGELPDLEVLQLWENNFTGSIPEKLGENGRLHLVDLSSNK  368

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P  +    KL+ L I   N   G IP  +G    L R
Sbjct  369  LTGTLPPNMCAGNKLETL-ITLGNFLFGSIPESLGKCESLTR  409


 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 85/174 (49%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P++     L  L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  368  KLTGTLPPNMCAGNKLETLITLGNFLFGSIPESLGKCESLTRIRMGENFLNGSIPKGLFG  427

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N LTG+LPV      +L  L L  N  SG++PP  G F  ++ L + GN
Sbjct  428  LPKLTQVELQDNYLTGELPVTGSVSVNLGQLSLSNNQLSGQLPPAIGNFTGVQKLLLDGN  487

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
               G IPSE+G L +L ++   + N FSGGI PE+     L   D +   L+GE
Sbjct  488  KFEGPIPSEVGRLQQLSKIDFSH-NLFSGGIAPEISRCKLLTFVDLSRNELSGE  540


 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 78/150 (52%), Gaps = 1/150 (1%)
 Frame = +2

Query  101  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  280
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N+F      +L +L++L+
Sbjct  229  LPPEIGNLSELVRFDAANCALNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLK  288

Query  281  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  460
             +DL NN  TG++P     + +L  L+L  N   G IP   G  P+LE L +  N  +G 
Sbjct  289  SMDLSNNMFTGEIPASFSDLKNLTLLNLFRNKLHGEIPEFIGELPDLEVLQLWENNFTGS  348

Query  461  IPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            IP ++G   +L  + +   N  +G +PP M
Sbjct  349  IPEKLGENGRLHLVDLSS-NKLTGTLPPNM  377


 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 94/197 (48%), Gaps = 26/197 (13%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  265
             +G + P  G  P +  L+++ N+L+G +PPEI  ++TLR L +   N F    P ++  
Sbjct  176  FAGEIPPSYGTWPEIEYLAVSGNELTGKIPPEIGNLTTLRELYIGYFNAFEDGLPPEIGN  235

Query  266  LANLQVLDLYNNNLTGDLPVEV------------------------YKMTSLRHLHLGGN  373
            L+ L   D  N  L G++P E+                         K++SL+ + L  N
Sbjct  236  LSELVRFDAANCALNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLKSMDLSNN  295

Query  374  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
             F+G IP  +    NL  L +  N L G IP  IG L  L+ L + + N F+G IP ++G
Sbjct  296  MFTGEIPASFSDLKNLTLLNLFRNKLHGEIPEFIGELPDLEVLQL-WENNFTGSIPEKLG  354

Query  554  NLSQLIRXDAANCGLTG  604
               +L   D ++  LTG
Sbjct  355  ENGRLHLVDLSSNKLTG  371


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 86/173 (50%), Gaps = 1/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
             SG L+ ++G+L  L ++ ++ N  +G +P   S +  L  LNL  N      P  + +L
Sbjct  273  FSGPLTWELGKLSSLKSMDLSNNMFTGEIPASFSDLKNLTLLNLFRNKLHGEIPEFIGEL  332

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             +L+VL L+ NN TG +P ++ +   L  + L  N  +G +PP       LE L   GN 
Sbjct  333  PDLEVLQLWENNFTGSIPEKLGENGRLHLVDLSSNKLTGTLPPNMCAGNKLETLITLGNF  392

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            L G IP  +G    L  + +G  N  +G IP  +  L +L + +  +  LTGE
Sbjct  393  LFGSIPESLGKCESLTRIRMGE-NFLNGSIPKGLFGLPKLTQVELQDNYLTGE  444


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 89/166 (54%), Gaps = 3/166 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +G +   +G+   L  + +++N+L+G +PP + A + L   + L N +FGS  P  L 
Sbjct  344  NFTGSIPEKLGENGRLHLVDLSSNKLTGTLPPNMCAGNKLETLITLGNFLFGS-IPESLG  402

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            +  +L  + +  N L G +P  ++ +  L  + L  NY +G +P       NL  L++S 
Sbjct  403  KCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLTGELPVTGSVSVNLGQLSLSN  462

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXD  580
            N LSG +P  IGN T +++L +   N F G IP E+G L QL + D
Sbjct  463  NQLSGQLPPAIGNFTGVQKLLLDG-NKFEGPIPSEVGRLQQLSKID  507


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 66/127 (52%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             LSG L P +G    +  L +  N+  GP+P E+  +  L  ++ S+N+F      ++++
Sbjct  464  QLSGQLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGRLQQLSKIDFSHNLFSGGIAPEISR  523

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  +DL  N L+G++P E+  M  L +L+L  N+  G IP       +L  L  S N
Sbjct  524  CKLLTFVDLSRNELSGEIPKEITGMKILNYLNLSRNHLIGSIPGSISSMQSLTSLDFSYN  583

Query  446  GLSGVIP  466
             LSG++P
Sbjct  584  NLSGLVP  590


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 75/151 (50%), Gaps = 7/151 (5%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            ++G +S ++GQL      S++ NQLSG +PP I   + ++ L L  N F    P ++ +L
Sbjct  447  VTGSVSVNLGQL------SLSNNQLSGQLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGRL  500

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  +D  +N  +G +  E+ +   L  + L  N  SG IP E      L YL +S N 
Sbjct  501  QQLSKIDFSHNLFSGGIAPEISRCKLLTFVDLSRNELSGEIPKEITGMKILNYLNLSRNH  560

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            L G IP  I ++  L  L   Y N  SG +P
Sbjct  561  LIGSIPGSISSMQSLTSLDFSY-NNLSGLVP  590


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 78/172 (45%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G +   +  LP L  + +  N L+G +P   S    L  L+LSNN      P  +   
Sbjct  417  LNGSIPKGLFGLPKLTQVELQDNYLTGELPVTGSVSVNLGQLSLSNNQLSGQLPPAIGNF  476

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              +Q L L  N   G +P EV ++  L  +    N FSG I PE  R   L ++ +S N 
Sbjct  477  TGVQKLLLDGNKFEGPIPSEVGRLQQLSKIDFSHNLFSGGIAPEISRCKLLTFVDLSRNE  536

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            LSG IP EI  +  L  L +   N   G IP  + ++  L   D +   L+G
Sbjct  537  LSGEIPKEITGMKILNYLNLSR-NHLIGSIPGSISSMQSLTSLDFSYNNLSG  587



>gb|KHG04200.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
Length=1014

 Score =   253 bits (646),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 133/203 (66%), Positives = 162/203 (80%), Gaps = 1/203 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsl-lhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVP  178
            N +T  C++  VTCD    HV S+DL+   LSG LSP +  L FL NLS+A N L+GP+P
Sbjct  52   NATTPLCSFAGVTCDLTGRHVTSIDLTNFTLSGTLSPSLAHLRFLQNLSVADNNLTGPIP  111

Query  179  PEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHL  358
             E++ +S LR+LNLSNN+F  +FP QL+QL NLQVLDLYNNN+TG+LPV V ++ +LRHL
Sbjct  112  TELAVLSNLRYLNLSNNVFNGSFPTQLSQLKNLQVLDLYNNNMTGELPVSVTELPNLRHL  171

Query  359  HLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGI  538
            HLGGNYFSG+IP  YGR+ +LEYLAVSGN LSG IP EIGNLTKLKELYIGYFN F GG+
Sbjct  172  HLGGNYFSGQIPSSYGRWEHLEYLAVSGNELSGKIPPEIGNLTKLKELYIGYFNNFEGGL  231

Query  539  PPEMGNLSQLIRXDAANCGLTGE  607
            PPE+GNLS+L+R DAANC L+GE
Sbjct  232  PPEIGNLSELVRFDAANCMLSGE  254


 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 90/162 (56%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P++G+L  L  L +  N LSG + PE+  +++L+ ++LSNN+F    P   AQL
Sbjct  251  LSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGTLNSLKSMDLSNNMFTGEIPASFAQL  310

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP + G    L+ L +S N 
Sbjct  311  KNLTLLNLFRNKLHGQIPDFIGELPELEVLQLWENNFTGSIPQKLGSNKKLQVLDLSSNK  370

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P ++ +   L+ L I   N   G IP  +G    L R
Sbjct  371  LTGTLPPDMCSGNTLQTL-ITLGNFLFGSIPESLGKCESLSR  411


 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 81/155 (52%), Gaps = 1/155 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            N  G L P++G L  LV    A   LSG +PPEI  +  L  L L  N    +   +L  
Sbjct  226  NFEGGLPPEIGNLSELVRFDAANCMLSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGT  285

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L +L+ +DL NN  TG++P    ++ +L  L+L  N   G+IP   G  P LE L +  N
Sbjct  286  LNSLKSMDLSNNMFTGEIPASFAQLKNLTLLNLFRNKLHGQIPDFIGELPELEVLQLWEN  345

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
              +G IP ++G+  KL+ L +   N  +G +PP+M
Sbjct  346  NFTGSIPQKLGSNKKLQVLDLSS-NKLTGTLPPDM  379


 Score = 83.2 bits (204),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 62/198 (31%), Positives = 96/198 (48%), Gaps = 26/198 (13%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L G +   +G+LP L  L +  N  +G +P ++ +   L+ L+LS+N    T P  +  
Sbjct  322  KLHGQIPDFIGELPELEVLQLWENNFTGSIPQKLGSNKKLQVLDLSSNKLTGTLPPDMCS  381

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP------PEY--------  403
               LQ L    N L G +P  + K  SL  + +G NY +G IP      P+         
Sbjct  382  GNTLQTLITLGNFLFGSIPESLGKCESLSRIRMGENYLNGSIPKGLLGLPQLTQVELQNN  441

Query  404  ---GRFP--------NLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
               G FP        NL  +++S N LSG +P+ IGN + +++L +   N FSG IP E+
Sbjct  442  YLTGEFPVTDSSISVNLGQISLSNNQLSGALPASIGNFSGVQKLLLDG-NKFSGPIPAEI  500

Query  551  GNLSQLIRXDAANCGLTG  604
            G L QL + D ++   +G
Sbjct  501  GTLQQLSKIDFSHNKFSG  518


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 84/175 (48%), Gaps = 2/175 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L PD+     L  L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  370  KLTGTLPPDMCSGNTLQTLITLGNFLFGSIPESLGKCESLSRIRMGENYLNGSIPKGLLG  429

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMT-SLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            L  L  ++L NN LTG+ PV    ++ +L  + L  N  SG +P   G F  ++ L + G
Sbjct  430  LPQLTQVELQNNYLTGEFPVTDSSISVNLGQISLSNNQLSGALPASIGNFSGVQKLLLDG  489

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            N  SG IP+EIG L +L ++   + N FSG IPPE+     L   D +   L+G 
Sbjct  490  NKFSGPIPAEIGTLQQLSKIDFSH-NKFSGLIPPEICKCELLTFVDLSRNELSGR  543


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 63/127 (50%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             LSG L   +G    +  L +  N+ SGP+P EI  +  L  ++ S+N F    P ++ +
Sbjct  467  QLSGALPASIGNFSGVQKLLLDGNKFSGPIPAEIGTLQQLSKIDFSHNKFSGLIPPEICK  526

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  +DL  N L+G +P E+  M  L  L+L  N+  G IP       +L  +  S N
Sbjct  527  CELLTFVDLSRNELSGRIPTEITSMRILNFLNLSRNHLLGSIPSSISTMQSLTSVDFSYN  586

Query  446  GLSGVIP  466
             LSG++P
Sbjct  587  NLSGLVP  593


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 67/137 (49%), Gaps = 1/137 (1%)
 Frame = +2

Query  131  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  310
            L  +S++ NQLSG +P  I   S ++ L L  N F    P ++  L  L  +D  +N  +
Sbjct  458  LGQISLSNNQLSGALPASIGNFSGVQKLLLDGNKFSGPIPAEIGTLQQLSKIDFSHNKFS  517

Query  311  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTK  490
            G +P E+ K   L  + L  N  SGRIP E      L +L +S N L G IPS I  +  
Sbjct  518  GLIPPEICKCELLTFVDLSRNELSGRIPTEITSMRILNFLNLSRNHLLGSIPSSISTMQS  577

Query  491  LKELYIGYFNGFSGGIP  541
            L  +   Y N  SG +P
Sbjct  578  LTSVDFSY-NNLSGLVP  593


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 51/161 (32%), Positives = 77/161 (48%), Gaps = 2/161 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L NN     FP   + +
Sbjct  395  LFGSIPESLGKCESLSRIRMGENYLNGSIPKGLLGLPQLTQVELQNNYLTGEFPVTDSSI  454

Query  269  A-NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            + NL  + L NN L+G LP  +   + ++ L L GN FSG IP E G    L  +  S N
Sbjct  455  SVNLGQISLSNNQLSGALPASIGNFSGVQKLLLDGNKFSGPIPAEIGTLQQLSKIDFSHN  514

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQL  568
              SG+IP EI     L  + +   N  SG IP E+ ++  L
Sbjct  515  KFSGLIPPEICKCELLTFVDLSR-NELSGRIPTEITSMRIL  554



>ref|XP_010426489.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Camelina sativa]
Length=1000

 Score =   253 bits (645),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 154/201 (77%), Gaps = 2/201 (1%)
 Frame = +2

Query  8    STSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPE  184
            ST+ C+W  V CD     V+      LNLSG LS DV  LP L NLS+AANQ+SGP+PPE
Sbjct  52   STTFCSWTGVKCDVSRRHVTSLDLSGLNLSGTLSSDVSHLPLLQNLSLAANQISGPIPPE  111

Query  185  ISAISTLRFLNLSNNIFGSTFPHQLAQ-LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLH  361
            IS +S LR LNLSNN+F  ++P +L+  L NL+VLDLYNNNLTGDLP+ +  +T LRHLH
Sbjct  112  ISKLSELRLLNLSNNVFNGSYPDELSSGLVNLRVLDLYNNNLTGDLPLSITNLTELRHLH  171

Query  362  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            LGGNYFSG+IP  YG +P LEYLAVSGN L G IP EIGNLT L+ELYIGY+N F  G+P
Sbjct  172  LGGNYFSGKIPATYGTWPVLEYLAVSGNELIGKIPPEIGNLTTLRELYIGYYNAFEDGLP  231

Query  542  PEMGNLSQLIRXDAANCGLTG  604
            PE+GNL++L+R DAANCGLTG
Sbjct  232  PEIGNLTELLRFDAANCGLTG  252


 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 63/197 (32%), Positives = 95/197 (48%), Gaps = 26/197 (13%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  265
             SG +    G  P L  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  177  FSGKIPATYGTWPVLEYLAVSGNELIGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  236

Query  266  LANLQVLDLYNNNLTGDLPVEVYKM------------------------TSLRHLHLGGN  373
            L  L   D  N  LTG +P E+ K+                        +SL+ + L  N
Sbjct  237  LTELLRFDAANCGLTGAIPPEIGKLQNLDTLFLQVNAFAGPLTSELGLISSLKSMDLSNN  296

Query  374  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
             F+G IP  +    NL  L +  N L G IP  IG L +L+ L + + N F+GGIP ++G
Sbjct  297  MFTGEIPTSFSELKNLTLLNLFRNKLYGAIPEFIGELPELEVLQL-WENNFTGGIPQKLG  355

Query  554  NLSQLIRXDAANCGLTG  604
            +  +L+  D ++  LTG
Sbjct  356  DNGRLVILDLSSNKLTG  372


 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/162 (34%), Positives = 87/162 (54%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G + P++G+L  L  L +  N  +GP+  E+  IS+L+ ++LSNN+F    P   ++L
Sbjct  250  LTGAIPPEIGKLQNLDTLFLQVNAFAGPLTSELGLISSLKSMDLSNNMFTGEIPTSFSEL  309

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP + G    L  L +S N 
Sbjct  310  KNLTLLNLFRNKLYGAIPEFIGELPELEVLQLWENNFTGGIPQKLGDNGRLVILDLSSNK  369

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P  + +  +L  L I   N   G IP  +G    L R
Sbjct  370  LTGTLPPNMCSGNRLMTL-ITLGNFLFGSIPDSLGKCESLTR  410


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 92/166 (55%), Gaps = 3/166 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEI-SAISTLRFLNLSNNIFGSTFPHQLA  262
            N +G +   +G    LV L +++N+L+G +PP + S    +  + L N +FGS  P  L 
Sbjct  345  NFTGGIPQKLGDNGRLVILDLSSNKLTGTLPPNMCSGNRLMTLITLGNFLFGS-IPDSLG  403

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            +  +L  + +  N L G +P  ++ +  L  + L  NY +G +P   G   +L  +++S 
Sbjct  404  KCESLTRIRMGQNFLNGSIPKGLFGLPKLSQVELQDNYLTGELPISGGVSSDLGQVSLSN  463

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXD  580
            N LSG +P+ IGN + +++L +   N F+G IPPE+G L QL + D
Sbjct  464  NQLSGSLPAAIGNFSGVQKLLLDG-NKFAGPIPPEIGRLQQLSKLD  508


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 82/157 (52%), Gaps = 1/157 (1%)
 Frame = +2

Query  101  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  280
            L P++G L  L+    A   L+G +PPEI  +  L  L L  N F      +L  +++L+
Sbjct  230  LPPEIGNLTELLRFDAANCGLTGAIPPEIGKLQNLDTLFLQVNAFAGPLTSELGLISSLK  289

Query  281  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  460
             +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N  +G 
Sbjct  290  SMDLSNNMFTGEIPTSFSELKNLTLLNLFRNKLYGAIPEFIGELPELEVLQLWENNFTGG  349

Query  461  IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLI  571
            IP ++G+  +L  L +   N  +G +PP M + ++L+
Sbjct  350  IPQKLGDNGRLVILDLSS-NKLTGTLPPNMCSGNRLM  385


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 83/174 (48%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P++     L+ L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  369  KLTGTLPPNMCSGNRLMTLITLGNFLFGSIPDSLGKCESLTRIRMGQNFLNGSIPKGLFG  428

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N LTG+LP+     + L  + L  N  SG +P   G F  ++ L + GN
Sbjct  429  LPKLSQVELQDNYLTGELPISGGVSSDLGQVSLSNNQLSGSLPAAIGNFSGVQKLLLDGN  488

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              +G IP EIG L +L +L   + N FSG I PE+     L   D +   L+G+
Sbjct  489  KFAGPIPPEIGRLQQLSKLDFSH-NLFSGRIAPEISRCKLLTFVDLSRNELSGD  541


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 68/128 (53%), Gaps = 0/128 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             LSG L   +G    +  L +  N+ +GP+PPEI  +  L  L+ S+N+F      ++++
Sbjct  465  QLSGSLPAAIGNFSGVQKLLLDGNKFAGPIPPEIGRLQQLSKLDFSHNLFSGRIAPEISR  524

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  +DL  N L+GD+P E+  M  L +L+L  N+  G IP       +L  +  S N
Sbjct  525  CKLLTFVDLSRNELSGDIPNEITGMRILNYLNLSRNHLVGSIPVSIASMQSLTSVDFSYN  584

Query  446  GLSGVIPS  469
             LSG++PS
Sbjct  585  NLSGLVPS  592


 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 77/161 (48%), Gaps = 1/161 (1%)
 Frame = +2

Query  122  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  301
            LP L  + +  N L+G +P      S L  ++LSNN    + P  +   + +Q L L  N
Sbjct  429  LPKLSQVELQDNYLTGELPISGGVSSDLGQVSLSNNQLSGSLPAAIGNFSGVQKLLLDGN  488

Query  302  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGN  481
               G +P E+ ++  L  L    N FSGRI PE  R   L ++ +S N LSG IP+EI  
Sbjct  489  KFAGPIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGDIPNEITG  548

Query  482  LTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            +  L  L +   N   G IP  + ++  L   D +   L+G
Sbjct  549  MRILNYLNLSR-NHLVGSIPVSIASMQSLTSVDFSYNNLSG  588



>gb|EPS74129.1| hypothetical protein M569_00625, partial [Genlisea aurea]
Length=970

 Score =   252 bits (643),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 166/203 (82%), Gaps = 1/203 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvs-ldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVP  178
            N   SHC+WR VTCDSL   V+ LD+S L+LSG LSPDVGQL FLVNLS AAN LSGPVP
Sbjct  52   NSGASHCSWRGVTCDSLGRHVTGLDISNLSLSGSLSPDVGQLLFLVNLSAAANLLSGPVP  111

Query  179  PEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHL  358
             EI+ I  LR+LNLSNN+F  +FP +L +L NLQVLDLYNNN+TGD P   Y + +LRHL
Sbjct  112  AEIADIPNLRYLNLSNNVFNLSFPTELYRLKNLQVLDLYNNNMTGDFPSRAYLLANLRHL  171

Query  359  HLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGI  538
            HLGGN+F+G +PPE+G FP+LEYLAVSGN LSG IP E+GNLT+LKELY+GY+N FSGG+
Sbjct  172  HLGGNFFTGTMPPEFGSFPHLEYLAVSGNELSGTIPPELGNLTQLKELYVGYYNTFSGGL  231

Query  539  PPEMGNLSQLIRXDAANCGLTGE  607
            P E+GNLS L+R DAA+CGL+G+
Sbjct  232  PKEIGNLSNLLRLDAASCGLSGD  254


 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/161 (37%), Positives = 89/161 (55%), Gaps = 2/161 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  265
             +G + P+ G  P L  L+++ N+LSG +PPE+  ++ L+ L +   N F    P ++  
Sbjct  178  FTGTMPPEFGSFPHLEYLAVSGNELSGTIPPELGNLTQLKELYVGYYNTFSGGLPKEIGN  237

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L+NL  LD  +  L+GD+P E+  + +L  L L  N FSG + PE G   NL+ + +S N
Sbjct  238  LSNLLRLDAASCGLSGDIPSEIGMLQNLDTLFLQVNGFSGGLTPELGNLKNLKSMDLSNN  297

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQL  568
             LSG IPS    L  L  L + + N  +G IP  +G L QL
Sbjct  298  ALSGEIPSSFAELKNLTLLNL-FRNKLNGSIPNFIGELPQL  337


 Score = 83.2 bits (204),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 81/174 (47%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G LSP +     L  L    N L+GP+P  +    +L  + +  N      P  L  
Sbjct  370  KLTGSLSPKLCHGNQLHTLITLGNFLTGPIPDSMGHCESLSRVRMGENYLNGHIPKGLLS  429

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  L+L +N ++G  P       +L  + L  N+ SG +PP  G F  ++   + GN
Sbjct  430  LPMLTQLELQDNLISGPFPETDVLSQNLGQISLSNNHLSGPLPPSIGNFVAVQKFLLDGN  489

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              SG IP+EIG L +L ++     N FSG IPPE+    QL   D +   L G 
Sbjct  490  SFSGSIPAEIGKLQQLSKMDFSS-NKFSGQIPPELSQCKQLAFVDLSRNQLNGR  542


 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 49/150 (33%), Positives = 77/150 (51%), Gaps = 7/150 (5%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
            + VLS ++GQ+      S++ N LSGP+PP I     ++   L  N F  + P ++ +L 
Sbjct  450  TDVLSQNLGQI------SLSNNHLSGPLPPSIGNFVAVQKFLLDGNSFSGSIPAEIGKLQ  503

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
             L  +D  +N  +G +P E+ +   L  + L  N  +GR+P E      L YL +S N L
Sbjct  504  QLSKMDFSSNKFSGQIPPELSQCKQLAFVDLSRNQLNGRVPSEISAMKILNYLNLSRNQL  563

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
             G IPS I ++  L  +   Y N F+G +P
Sbjct  564  DGNIPSSISSMQSLTSVDFSY-NNFTGLVP  592


 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 85/162 (52%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG +  ++G L  L  L +  N  SG + PE+  +  L+ ++LSNN      P   A+L
Sbjct  251  LSGDIPSEIGMLQNLDTLFLQVNGFSGGLTPELGNLKNLKSMDLSNNALSGEIPSSFAEL  310

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  + ++  L+ L L  N F+G IP   G   NL+ + +S N 
Sbjct  311  KNLTLLNLFRNKLNGSIPNFIGELPQLQVLQLWENNFTGSIPENLGSNGNLQEVDLSSNK  370

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +  ++ +  +L  L I   N  +G IP  MG+   L R
Sbjct  371  LTGSLSPKLCHGNQLHTL-ITLGNFLTGPIPDSMGHCESLSR  411


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 88/172 (51%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
             SG L+P++G L  L ++ ++ N LSG +P   + +  L  LNL  N    + P+ + +L
Sbjct  275  FSGGLTPELGNLKNLKSMDLSNNALSGEIPSSFAELKNLTLLNLFRNKLNGSIPNFIGEL  334

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              LQVL L+ NN TG +P  +    +L+ + L  N  +G + P+      L  L   GN 
Sbjct  335  PQLQVLQLWENNFTGSIPENLGSNGNLQEVDLSSNKLTGSLSPKLCHGNQLHTLITLGNF  394

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            L+G IP  +G+   L  + +G  N  +G IP  + +L  L + +  +  ++G
Sbjct  395  LTGPIPDSMGHCESLSRVRMGE-NYLNGHIPKGLLSLPMLTQLELQDNLISG  445


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 80/172 (47%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G +   +  LP L  L +  N +SGP P        L  ++LSNN      P  +   
Sbjct  419  LNGHIPKGLLSLPMLTQLELQDNLISGPFPETDVLSQNLGQISLSNNHLSGPLPPSIGNF  478

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              +Q   L  N+ +G +P E+ K+  L  +    N FSG+IPPE  +   L ++ +S N 
Sbjct  479  VAVQKFLLDGNSFSGSIPAEIGKLQQLSKMDFSSNKFSGQIPPELSQCKQLAFVDLSRNQ  538

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            L+G +PSEI  +  L  L +   N   G IP  + ++  L   D +    TG
Sbjct  539  LNGRVPSEISAMKILNYLNLSR-NQLDGNIPSSISSMQSLTSVDFSYNNFTG  589


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 64/221 (29%), Positives = 94/221 (43%), Gaps = 49/221 (22%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG +     +L  L  L++  N+L+G +P  I  +  L+ L L  N F  + P  L   
Sbjct  299  LSGEIPSSFAELKNLTLLNLFRNKLNGSIPNFIGELPQLQVLQLWENNFTGSIPENLGSN  358

Query  269  ANLQVLDLYNNNLTGDL------------------------PVEVYKMTSLRHLHLGGNY  376
             NLQ +DL +N LTG L                        P  +    SL  + +G NY
Sbjct  359  GNLQEVDLSSNKLTGSLSPKLCHGNQLHTLITLGNFLTGPIPDSMGHCESLSRVRMGENY  418

Query  377  FSGRIPPEY-----------------GRFP-------NLEYLAVSGNGLSGVIPSEIGNL  484
             +G IP                    G FP       NL  +++S N LSG +P  IGN 
Sbjct  419  LNGHIPKGLLSLPMLTQLELQDNLISGPFPETDVLSQNLGQISLSNNHLSGPLPPSIGNF  478

Query  485  TKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              +++  +   N FSG IP E+G L QL + D ++   +G+
Sbjct  479  VAVQKFLLDG-NSFSGSIPAEIGKLQQLSKMDFSSNKFSGQ  518


 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 76/160 (48%), Gaps = 1/160 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G +   +G    L  + +  N L+G +P  + ++  L  L L +N+    FP      
Sbjct  395  LTGPIPDSMGHCESLSRVRMGENYLNGHIPKGLLSLPMLTQLELQDNLISGPFPETDVLS  454

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL  + L NN+L+G LP  +    +++   L GN FSG IP E G+   L  +  S N 
Sbjct  455  QNLGQISLSNNHLSGPLPPSIGNFVAVQKFLLDGNSFSGSIPAEIGKLQQLSKMDFSSNK  514

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQL  568
             SG IP E+    +L  + +   N  +G +P E+  +  L
Sbjct  515  FSGQIPPELSQCKQLAFVDLSR-NQLNGRVPSEISAMKIL  553



>ref|XP_006290548.1| hypothetical protein CARUB_v10016631mg [Capsella rubella]
 gb|EOA23446.1| hypothetical protein CARUB_v10016631mg [Capsella rubella]
Length=997

 Score =   252 bits (643),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 130/203 (64%), Positives = 156/203 (77%), Gaps = 2/203 (1%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVP  178
            N+ST+ C+W  VTCD     V+      L+LSG LS DV  LP L NLS+AANQ+SGP+P
Sbjct  47   NLSTTFCSWTGVTCDVSRRHVTSLDLSGLDLSGTLSSDVSHLPLLQNLSLAANQISGPIP  106

Query  179  PEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANLQVLDLYNNNLTGDLPVEVYKMTSLRH  355
            PEIS +S LR LNLSNN+F  ++P +L+  L NL+VLDLYNNNLTG LP+ +  +T LRH
Sbjct  107  PEISNLSELRHLNLSNNVFNGSYPDELSSGLVNLRVLDLYNNNLTGVLPLSITNLTELRH  166

Query  356  LHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGG  535
            LHLGGNYFSG+IP  YG +P LEYLAVSGN L G IP EIGNLT L+ELYIGY+N F  G
Sbjct  167  LHLGGNYFSGKIPATYGTWPVLEYLAVSGNELIGKIPPEIGNLTSLRELYIGYYNAFEDG  226

Query  536  IPPEMGNLSQLIRXDAANCGLTG  604
            +PPE+GNLS+L+R DAANCGLTG
Sbjct  227  LPPEIGNLSELVRFDAANCGLTG  249


 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 61/197 (31%), Positives = 94/197 (48%), Gaps = 26/197 (13%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  265
             SG +    G  P L  L+++ N+L G +PPEI  +++LR L +   N F    P ++  
Sbjct  174  FSGKIPATYGTWPVLEYLAVSGNELIGKIPPEIGNLTSLRELYIGYYNAFEDGLPPEIGN  233

Query  266  LANLQVLDLYNNNLTGDLPVEVYKM------------------------TSLRHLHLGGN  373
            L+ L   D  N  LTG +P E+ K+                        +SL+ +    N
Sbjct  234  LSELVRFDAANCGLTGAIPPEIGKLQNLDTLFLQVNAFAGTLTQELGWISSLKSMDFSNN  293

Query  374  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
             F+G IP  +    NL  L +  N L G IP  IG L +L+ L + + N F+GGIP ++G
Sbjct  294  MFTGEIPASFAELKNLTLLNLFRNKLYGAIPEFIGELPELEVLQL-WENNFTGGIPQKLG  352

Query  554  NLSQLIRXDAANCGLTG  604
               +L+  D ++  LTG
Sbjct  353  ENGRLVILDLSSNKLTG  369


 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 85/162 (52%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G + P++G+L  L  L +  N  +G +  E+  IS+L+ ++ SNN+F    P   A+L
Sbjct  247  LTGAIPPEIGKLQNLDTLFLQVNAFAGTLTQELGWISSLKSMDFSNNMFTGEIPASFAEL  306

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP + G    L  L +S N 
Sbjct  307  KNLTLLNLFRNKLYGAIPEFIGELPELEVLQLWENNFTGGIPQKLGENGRLVILDLSSNK  366

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P  + +  +L  L I   N   G IP  +G    L R
Sbjct  367  LTGTLPPNMCSGNRLVTL-ITLGNFLFGSIPDSLGKCESLTR  407


 Score = 83.2 bits (204),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 81/157 (52%), Gaps = 1/157 (1%)
 Frame = +2

Query  101  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  280
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N F  T   +L  +++L+
Sbjct  227  LPPEIGNLSELVRFDAANCGLTGAIPPEIGKLQNLDTLFLQVNAFAGTLTQELGWISSLK  286

Query  281  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  460
             +D  NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N  +G 
Sbjct  287  SMDFSNNMFTGEIPASFAELKNLTLLNLFRNKLYGAIPEFIGELPELEVLQLWENNFTGG  346

Query  461  IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLI  571
            IP ++G   +L  L +   N  +G +PP M + ++L+
Sbjct  347  IPQKLGENGRLVILDLSS-NKLTGTLPPNMCSGNRLV  382


 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 94/166 (57%), Gaps = 3/166 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTL-RFLNLSNNIFGSTFPHQLA  262
            N +G +   +G+   LV L +++N+L+G +PP + + + L   + L N +FGS  P  L 
Sbjct  342  NFTGGIPQKLGENGRLVILDLSSNKLTGTLPPNMCSGNRLVTLITLGNFLFGS-IPDSLG  400

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            +  +L  + +  N L G +P  ++ +  L  + L  NY +G +P   G   +L  +++S 
Sbjct  401  KCESLTRIRMGENFLNGSIPKGLFGLPKLSQVELQDNYLTGGLPISGGVSGDLGQISLSN  460

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXD  580
            N LSG +P+ IGN + +++L +   N F+G IPPE+G L QL + D
Sbjct  461  NQLSGPLPAAIGNFSGVQKLLLDG-NKFAGPIPPEIGRLQQLSKLD  505


 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 81/174 (47%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P++     LV L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  366  KLTGTLPPNMCSGNRLVTLITLGNFLFGSIPDSLGKCESLTRIRMGENFLNGSIPKGLFG  425

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N LTG LP+       L  + L  N  SG +P   G F  ++ L + GN
Sbjct  426  LPKLSQVELQDNYLTGGLPISGGVSGDLGQISLSNNQLSGPLPAAIGNFSGVQKLLLDGN  485

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              +G IP EIG L +L +L   + N FSG I PE+     L   D +   L+G+
Sbjct  486  KFAGPIPPEIGRLQQLSKLDFSH-NLFSGRIAPEISRCKLLTFVDLSRNELSGD  538


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 68/128 (53%), Gaps = 0/128 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             LSG L   +G    +  L +  N+ +GP+PPEI  +  L  L+ S+N+F      ++++
Sbjct  462  QLSGPLPAAIGNFSGVQKLLLDGNKFAGPIPPEIGRLQQLSKLDFSHNLFSGRIAPEISR  521

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  +DL  N L+GD+P E+  M  L +L+L  N+  G IP       +L  +  S N
Sbjct  522  CKLLTFVDLSRNELSGDIPNEITGMKILNYLNLSRNHLVGSIPVTIASMQSLTSVDFSYN  581

Query  446  GLSGVIPS  469
             LSG++PS
Sbjct  582  NLSGLVPS  589


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 75/151 (50%), Gaps = 7/151 (5%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            +SG +S D+GQ+      S++ NQLSGP+P  I   S ++ L L  N F    P ++ +L
Sbjct  445  ISGGVSGDLGQI------SLSNNQLSGPLPAAIGNFSGVQKLLLDGNKFAGPIPPEIGRL  498

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  LD  +N  +G +  E+ +   L  + L  N  SG IP E      L YL +S N 
Sbjct  499  QQLSKLDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGDIPNEITGMKILNYLNLSRNH  558

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            L G IP  I ++  L  +   Y N  SG +P
Sbjct  559  LVGSIPVTIASMQSLTSVDFSY-NNLSGLVP  588


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/161 (32%), Positives = 75/161 (47%), Gaps = 1/161 (1%)
 Frame = +2

Query  122  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  301
            LP L  + +  N L+G +P        L  ++LSNN      P  +   + +Q L L  N
Sbjct  426  LPKLSQVELQDNYLTGGLPISGGVSGDLGQISLSNNQLSGPLPAAIGNFSGVQKLLLDGN  485

Query  302  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGN  481
               G +P E+ ++  L  L    N FSGRI PE  R   L ++ +S N LSG IP+EI  
Sbjct  486  KFAGPIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGDIPNEITG  545

Query  482  LTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            +  L  L +   N   G IP  + ++  L   D +   L+G
Sbjct  546  MKILNYLNLSR-NHLVGSIPVTIASMQSLTSVDFSYNNLSG  585



>ref|XP_002310320.2| hypothetical protein POPTR_0007s14500g [Populus trichocarpa]
 gb|EEE90770.2| hypothetical protein POPTR_0007s14500g [Populus trichocarpa]
Length=1020

 Score =   251 bits (642),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 128/203 (63%), Positives = 157/203 (77%), Gaps = 1/203 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVP  178
            N +T  C+W  +TCD     V+      LNLSG LS DV  L +L NLS+A NQ SGP+P
Sbjct  53   NSTTPLCSWTGITCDHTGRRVTSLDLSGLNLSGTLSSDVAHLRYLQNLSLAVNQFSGPIP  112

Query  179  PEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHL  358
              +SA+++LR LNLSNNIF STFP QL+ L NLQVLDLYNNN+TG LP+ V +M +LRHL
Sbjct  113  ASLSAVTSLRSLNLSNNIFNSTFPPQLSSLKNLQVLDLYNNNMTGGLPLTVVEMPNLRHL  172

Query  359  HLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGI  538
            HLGGNY+SG+IP EYG++  LEYLA+SGN L G IP E+GNLTKL+ELYIGYFN + GG+
Sbjct  173  HLGGNYYSGKIPSEYGKWGFLEYLAISGNELEGSIPVELGNLTKLRELYIGYFNTYEGGL  232

Query  539  PPEMGNLSQLIRXDAANCGLTGE  607
            PPE+GNLS L+R DAANCGL+G+
Sbjct  233  PPEIGNLSSLVRFDAANCGLSGQ  255


 Score = 89.4 bits (220),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 88/162 (54%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P++G+L  L  L +  N LSG + PE+ ++ +L+ ++LSNN+F    P   A+L
Sbjct  252  LSGQIPPEIGRLQKLDTLFLQVNGLSGSLTPELGSLKSLKSMDLSNNMFTGEIPTSFAEL  311

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  + ++  L+ L L  N F+  IP   G+   LE L +S N 
Sbjct  312  KNLTLLNLFRNKLYGAIPEFIAELPELQVLQLWENNFTSTIPQALGQNGKLEILDLSSNK  371

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P  +     L+ L I   N   G IP  +G    L R
Sbjct  372  LTGTLPPNMCLGNNLQTL-ITLSNFLFGPIPESLGQCQSLSR  412


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 83/174 (48%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P++     L  L   +N L GP+P  +    +L  + +  N    + P  L  
Sbjct  371  KLTGTLPPNMCLGNNLQTLITLSNFLFGPIPESLGQCQSLSRIRMGENFLNGSIPKGLFD  430

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L NL  ++L +N L G+ PV      +L  L L  N  +G +PP  G F  ++   + GN
Sbjct  431  LPNLSQVELQDNLLAGEFPVIGTLAVNLGQLSLSNNRLTGSLPPSVGNFSGVQKFLLDGN  490

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              SG IP EIG L +L ++   + N FSG I PE+     L   D +   L+GE
Sbjct  491  KFSGSIPPEIGRLQQLTKMDFSH-NKFSGPIAPEISQCKLLTFVDLSRNELSGE  543


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/173 (32%), Positives = 84/173 (49%), Gaps = 1/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L+P++G L  L ++ ++ N  +G +P   + +  L  LNL  N      P  +A+L
Sbjct  276  LSGSLTPELGSLKSLKSMDLSNNMFTGEIPTSFAELKNLTLLNLFRNKLYGAIPEFIAEL  335

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              LQVL L+ NN T  +P  + +   L  L L  N  +G +PP      NL+ L    N 
Sbjct  336  PELQVLQLWENNFTSTIPQALGQNGKLEILDLSSNKLTGTLPPNMCLGNNLQTLITLSNF  395

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            L G IP  +G    L  + +G  N  +G IP  + +L  L + +  +  L GE
Sbjct  396  LFGPIPESLGQCQSLSRIRMGE-NFLNGSIPKGLFDLPNLSQVELQDNLLAGE  447


 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 92/174 (53%), Gaps = 3/174 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +  +   +GQ   L  L +++N+L+G +PP +   + L+  + LSN +FG   P  L 
Sbjct  347  NFTSTIPQALGQNGKLEILDLSSNKLTGTLPPNMCLGNNLQTLITLSNFLFGP-IPESLG  405

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            Q  +L  + +  N L G +P  ++ + +L  + L  N  +G  P       NL  L++S 
Sbjct  406  QCQSLSRIRMGENFLNGSIPKGLFDLPNLSQVELQDNLLAGEFPVIGTLAVNLGQLSLSN  465

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            N L+G +P  +GN + +++  +   N FSG IPPE+G L QL + D ++   +G
Sbjct  466  NRLTGSLPPSVGNFSGVQKFLLDG-NKFSGSIPPEIGRLQQLTKMDFSHNKFSG  518


 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 55/162 (34%), Positives = 78/162 (48%), Gaps = 4/162 (2%)
 Frame = +2

Query  95   GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  274
            G L P++G L  LV    A   LSG +PPEI  +  L  L L  N    +   +L  L +
Sbjct  230  GGLPPEIGNLSSLVRFDAANCGLSGQIPPEIGRLQKLDTLFLQVNGLSGSLTPELGSLKS  289

Query  275  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  454
            L+ +DL NN  TG++P    ++ +L  L+L  N   G IP      P L+ L +  N  +
Sbjct  290  LKSMDLSNNMFTGEIPTSFAELKNLTLLNLFRNKLYGAIPEFIAELPELQVLQLWENNFT  349

Query  455  GVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM---GNLSQLI  571
              IP  +G   KL+ L +   N  +G +PP M    NL  LI
Sbjct  350  STIPQALGQNGKLEILDLSS-NKLTGTLPPNMCLGNNLQTLI  390


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 63/125 (50%), Gaps = 2/125 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
              SG + P++G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P ++  
Sbjct  491  KFSGSIPPEIGRLQQLTKMDFSHNKFSGPIAPEISQCKLLTFVDLSRNELSGEIPTEITG  550

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            +  L  L+L  N+L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  551  MRILNYLNLSRNHLVGSIPAPIATMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  609

Query  446  -GLSG  457
             GL G
Sbjct  610  PGLCG  614


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 58/196 (30%), Positives = 82/196 (42%), Gaps = 25/196 (13%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L G +   +GQ   L  + +  N L+G +P  +  +  L  + L +N+    FP      
Sbjct  396  LFGPIPESLGQCQSLSRIRMGENFLNGSIPKGLFDLPNLSQVELQDNLLAGEFPVIGTLA  455

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLE--------  424
             NL  L L NN LTG LP  V   + ++   L GN FSG IPPE GR   L         
Sbjct  456  VNLGQLSLSNNRLTGSLPPSVGNFSGVQKFLLDGNKFSGSIPPEIGRLQQLTKMDFSHNK  515

Query  425  ----------------YLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  556
                            ++ +S N LSG IP+EI  +  L  L +   N   G IP  +  
Sbjct  516  FSGPIAPEISQCKLLTFVDLSRNELSGEIPTEITGMRILNYLNLSR-NHLVGSIPAPIAT  574

Query  557  LSQLIRXDAANCGLTG  604
            +  L   D +   L+G
Sbjct  575  MQSLTSVDFSYNNLSG  590



>ref|XP_007155783.1| hypothetical protein PHAVU_003G231400g [Phaseolus vulgaris]
 gb|ESW27777.1| hypothetical protein PHAVU_003G231400g [Phaseolus vulgaris]
Length=1018

 Score =   251 bits (640),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 131/202 (65%), Positives = 161/202 (80%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPP  181
            N ST++C+W  +TCDS LHV +L+L+  +LSG L   +  LPFL  LS+A NQ SGP+P 
Sbjct  52   NSSTTYCSWLGITCDSRLHVTTLNLTSSSLSGTLYDHLSHLPFLSYLSLADNQFSGPIPA  111

Query  182  EISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLH  361
              S++S LR LNLSNN F +TFP  L++LANLQVLDLYNNN+TG LP+ V  M  LRHLH
Sbjct  112  SFSSLSALRHLNLSNNAFNATFPSNLSRLANLQVLDLYNNNMTGPLPLAVASMPLLRHLH  171

Query  362  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            LGGN+FSG+IPPEYG + +L+YLAVSGN LSG IP E+GNLT L+ELYIGY+N +SGGIP
Sbjct  172  LGGNFFSGQIPPEYGTWQHLQYLAVSGNELSGNIPPELGNLTALRELYIGYYNAYSGGIP  231

Query  542  PEMGNLSQLIRXDAANCGLTGE  607
            PE+GNLSQL+R DAA CGL+GE
Sbjct  232  PEIGNLSQLVRFDAAYCGLSGE  253


 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 87/162 (54%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG +  D+G+L  +  L +  N LSG + PE+  + +L+ ++LSNNI     P    +L
Sbjct  250  LSGEIPADLGRLQNMDTLFLQVNALSGSLTPELGNLKSLKSMDLSNNILSGEVPASFTEL  309

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  V ++ +L  L L  N F+G IP   GR   L  + +S N 
Sbjct  310  KNLTLLNLFRNKLHGAIPEFVGELPALEVLQLWENNFTGSIPQSLGRNGKLTVVDLSSNK  369

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G++P ++    +L+ L I   N   G IP  +G    L R
Sbjct  370  LTGMLPPDMCYGNRLQTL-ITLGNYLFGPIPDSIGKCESLNR  410


 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/173 (34%), Positives = 87/173 (50%), Gaps = 1/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L+P++G L  L ++ ++ N LSG VP   + +  L  LNL  N      P  + +L
Sbjct  274  LSGSLTPELGNLKSLKSMDLSNNILSGEVPASFTELKNLTLLNLFRNKLHGAIPEFVGEL  333

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L+VL L+ NN TG +P  + +   L  + L  N  +G +PP+      L+ L   GN 
Sbjct  334  PALEVLQLWENNFTGSIPQSLGRNGKLTVVDLSSNKLTGMLPPDMCYGNRLQTLITLGNY  393

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            L G IP  IG    L  + +G  N  +G IP  +  L +L + +  N  LTG+
Sbjct  394  LFGPIPDSIGKCESLNRIRMGE-NFLNGSIPIGLFGLPKLTQVELQNNLLTGQ  445


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/174 (34%), Positives = 83/174 (48%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G+L PD+     L  L    N L GP+P  I    +L  + +  N    + P  L  
Sbjct  369  KLTGMLPPDMCYGNRLQTLITLGNYLFGPIPDSIGKCESLNRIRMGENFLNGSIPIGLFG  428

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L NN LTG  P       +L  + L  N  SG +PP  G F +++ L + GN
Sbjct  429  LPKLTQVELQNNLLTGQFPEGGSIAVNLGQISLSNNKLSGSLPPTIGNFTSMQKLLLDGN  488

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              SG IPS+IG L +L ++     N FSG I PE+     L   D +   L+GE
Sbjct  489  KFSGQIPSQIGRLQQLSKIDFSR-NEFSGPIAPEISRCKLLTFIDLSRNELSGE  541


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 77/153 (50%), Gaps = 1/153 (1%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
            SG + P++G L  LV    A   LSG +P ++  +  +  L L  N    +   +L  L 
Sbjct  227  SGGIPPEIGNLSQLVRFDAAYCGLSGEIPADLGRLQNMDTLFLQVNALSGSLTPELGNLK  286

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
            +L+ +DL NN L+G++P    ++ +L  L+L  N   G IP   G  P LE L +  N  
Sbjct  287  SLKSMDLSNNILSGEVPASFTELKNLTLLNLFRNKLHGAIPEFVGELPALEVLQLWENNF  346

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            +G IP  +G   KL  + +   N  +G +PP+M
Sbjct  347  TGSIPQSLGRNGKLTVVDLSS-NKLTGMLPPDM  378


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 67/137 (49%), Gaps = 1/137 (1%)
 Frame = +2

Query  131  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  310
            L  +S++ N+LSG +PP I   ++++ L L  N F    P Q+ +L  L  +D   N  +
Sbjct  456  LGQISLSNNKLSGSLPPTIGNFTSMQKLLLDGNKFSGQIPSQIGRLQQLSKIDFSRNEFS  515

Query  311  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTK  490
            G +  E+ +   L  + L  N  SG IP +      L YL +S N L G IP  I ++  
Sbjct  516  GPIAPEISRCKLLTFIDLSRNELSGEIPNQITAMRILNYLNLSRNHLVGSIPGSIASMQS  575

Query  491  LKELYIGYFNGFSGGIP  541
            L  +   Y N  SG +P
Sbjct  576  LTSVDFSY-NNLSGLVP  591


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 76/161 (47%), Gaps = 1/161 (1%)
 Frame = +2

Query  122  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  301
            LP L  + +  N L+G  P   S    L  ++LSNN    + P  +    ++Q L L  N
Sbjct  429  LPKLTQVELQNNLLTGQFPEGGSIAVNLGQISLSNNKLSGSLPPTIGNFTSMQKLLLDGN  488

Query  302  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGN  481
              +G +P ++ ++  L  +    N FSG I PE  R   L ++ +S N LSG IP++I  
Sbjct  489  KFSGQIPSQIGRLQQLSKIDFSRNEFSGPIAPEISRCKLLTFIDLSRNELSGEIPNQITA  548

Query  482  LTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            +  L  L +   N   G IP  + ++  L   D +   L+G
Sbjct  549  MRILNYLNLSR-NHLVGSIPGSIASMQSLTSVDFSYNNLSG  588


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 59/120 (49%), Gaps = 1/120 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
              SG +   +G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P+Q+  
Sbjct  489  KFSGQIPSQIGRLQQLSKIDFSRNEFSGPIAPEISRCKLLTFIDLSRNELSGEIPNQITA  548

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            +  L  L+L  N+L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  549  MRILNYLNLSRNHLVGSIPGSIASMQSLTSVDFSYNNLSGLVPGT-GQFGYFNYTSFLGN  607



>ref|XP_011021820.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Populus euphratica]
Length=1020

 Score =   250 bits (639),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 154/197 (78%), Gaps = 1/197 (1%)
 Frame = +2

Query  20   CTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAI  196
            C+W  +TCD     V+      LNLSG LS D+  L +L NLS+A NQ SGP+P  +SA+
Sbjct  59   CSWTGITCDHTGRRVTSLDLSGLNLSGTLSSDIAHLRYLQNLSLAVNQFSGPIPASLSAV  118

Query  197  STLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNY  376
            ++LR LNLSNNIF STFP QL+ L NLQVLDLYNNN+TG LP+ V +M +LRHLHLGGNY
Sbjct  119  TSLRSLNLSNNIFNSTFPPQLSSLKNLQVLDLYNNNMTGGLPLTVVEMPNLRHLHLGGNY  178

Query  377  FSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  556
            +SG+IP EYG++  LEYLA+SGN L G IP E+GNLTKL+ELYIGYFN + GG+PPE+GN
Sbjct  179  YSGKIPSEYGKWEFLEYLAISGNELEGSIPVELGNLTKLRELYIGYFNTYEGGLPPEIGN  238

Query  557  LSQLIRXDAANCGLTGE  607
            LS L+R DAANCGL+G+
Sbjct  239  LSNLVRFDAANCGLSGQ  255


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 84/174 (48%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P++     L  L   +N L GP+P  +    +L  + +  N    + P  L  
Sbjct  371  KLTGTLPPNMCLGNNLQTLITLSNFLFGPIPESLGQCQSLSRIRMGENFLNGSIPKGLFD  430

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L NL  ++L +N L G+ PV      +L  L L  N  +G +PP  G F  ++ L + GN
Sbjct  431  LPNLSQVELQDNLLAGEFPVIGTLAVNLGQLSLSNNRLTGSLPPSVGNFSGVQKLLLDGN  490

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              SG IP EIG L +L ++   + N FSG I PE+     L   D +   L+GE
Sbjct  491  KFSGSIPPEIGRLQQLTKMDFSH-NKFSGPIAPEISQCKLLTFVDLSRNELSGE  543


 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 55/162 (34%), Positives = 87/162 (54%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P++G+L  L  L +  N LSG +  E+ ++ +L+ ++LSNN+F    P   A+L
Sbjct  252  LSGQIPPEIGRLQKLDTLFLQVNGLSGSLTLELGSLKSLKSMDLSNNMFTGEIPTSFAEL  311

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  + ++  L+ L L  N F+  IP   G+   L+ L +S N 
Sbjct  312  KNLTLLNLFRNKLYGAIPEFIAELPELQVLQLWENNFTSTIPQALGQNGKLQILDLSSNK  371

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P  +     L+ L I   N   G IP  +G    L R
Sbjct  372  LTGTLPPNMCLGNNLQTL-ITLSNFLFGPIPESLGQCQSLSR  412


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 65/220 (30%), Positives = 98/220 (45%), Gaps = 49/220 (22%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
             +G +     +L  L  L++  N+L G +P  I+ +  L+ L L  N F ST P  L Q 
Sbjct  300  FTGEIPTSFAELKNLTLLNLFRNKLYGAIPEFIAELPELQVLQLWENNFTSTIPQALGQN  359

Query  269  ANLQVLDLYNNNLTGDLPVEVY------------------------KMTSLRHLHLGGNY  376
              LQ+LDL +N LTG LP  +                         +  SL  + +G N+
Sbjct  360  GKLQILDLSSNKLTGTLPPNMCLGNNLQTLITLSNFLFGPIPESLGQCQSLSRIRMGENF  419

Query  377  FSGRIPPEY-----------------GRFP-------NLEYLAVSGNGLSGVIPSEIGNL  484
             +G IP                    G FP       NL  L++S N L+G +P  +GN 
Sbjct  420  LNGSIPKGLFDLPNLSQVELQDNLLAGEFPVIGTLAVNLGQLSLSNNRLTGSLPPSVGNF  479

Query  485  TKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            + +++L +   N FSG IPPE+G L QL + D ++   +G
Sbjct  480  SGVQKLLLDG-NKFSGSIPPEIGRLQQLTKMDFSHNKFSG  518


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 84/173 (49%), Gaps = 1/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L+ ++G L  L ++ ++ N  +G +P   + +  L  LNL  N      P  +A+L
Sbjct  276  LSGSLTLELGSLKSLKSMDLSNNMFTGEIPTSFAELKNLTLLNLFRNKLYGAIPEFIAEL  335

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              LQVL L+ NN T  +P  + +   L+ L L  N  +G +PP      NL+ L    N 
Sbjct  336  PELQVLQLWENNFTSTIPQALGQNGKLQILDLSSNKLTGTLPPNMCLGNNLQTLITLSNF  395

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            L G IP  +G    L  + +G  N  +G IP  + +L  L + +  +  L GE
Sbjct  396  LFGPIPESLGQCQSLSRIRMGE-NFLNGSIPKGLFDLPNLSQVELQDNLLAGE  447


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/162 (34%), Positives = 78/162 (48%), Gaps = 4/162 (2%)
 Frame = +2

Query  95   GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  274
            G L P++G L  LV    A   LSG +PPEI  +  L  L L  N    +   +L  L +
Sbjct  230  GGLPPEIGNLSNLVRFDAANCGLSGQIPPEIGRLQKLDTLFLQVNGLSGSLTLELGSLKS  289

Query  275  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  454
            L+ +DL NN  TG++P    ++ +L  L+L  N   G IP      P L+ L +  N  +
Sbjct  290  LKSMDLSNNMFTGEIPTSFAELKNLTLLNLFRNKLYGAIPEFIAELPELQVLQLWENNFT  349

Query  455  GVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM---GNLSQLI  571
              IP  +G   KL+ L +   N  +G +PP M    NL  LI
Sbjct  350  STIPQALGQNGKLQILDLSS-NKLTGTLPPNMCLGNNLQTLI  390


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 83/196 (42%), Gaps = 25/196 (13%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L G +   +GQ   L  + +  N L+G +P  +  +  L  + L +N+    FP      
Sbjct  396  LFGPIPESLGQCQSLSRIRMGENFLNGSIPKGLFDLPNLSQVELQDNLLAGEFPVIGTLA  455

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLE--------  424
             NL  L L NN LTG LP  V   + ++ L L GN FSG IPPE GR   L         
Sbjct  456  VNLGQLSLSNNRLTGSLPPSVGNFSGVQKLLLDGNKFSGSIPPEIGRLQQLTKMDFSHNK  515

Query  425  ----------------YLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  556
                            ++ +S N LSG IP+EI  +  L  L +   N   G IP  +  
Sbjct  516  FSGPIAPEISQCKLLTFVDLSRNELSGEIPTEITGMRILNYLNLSR-NHLVGSIPSPIAT  574

Query  557  LSQLIRXDAANCGLTG  604
            +  L   D +   L+G
Sbjct  575  MQSLTSVDFSYNNLSG  590


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 63/125 (50%), Gaps = 2/125 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
              SG + P++G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P ++  
Sbjct  491  KFSGSIPPEIGRLQQLTKMDFSHNKFSGPIAPEISQCKLLTFVDLSRNELSGEIPTEITG  550

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            +  L  L+L  N+L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  551  MRILNYLNLSRNHLVGSIPSPIATMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  609

Query  446  -GLSG  457
             GL G
Sbjct  610  PGLCG  614



>gb|KJB48795.1| hypothetical protein B456_008G087500 [Gossypium raimondii]
Length=1013

 Score =   250 bits (638),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 160/203 (79%), Gaps = 1/203 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsl-lhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVP  178
            N +T  C++  VTCD    HV SL+LS  NLSG LSP    L FL N S+AANQL GP+P
Sbjct  49   NATTPLCSFTGVTCDYTGRHVTSLNLSYFNLSGTLSPSFSHLQFLQNFSLAANQLYGPIP  108

Query  179  PEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHL  358
             E++A+S LR+LNLSNN+F  +FP QL+QL NLQVLDLYNNN+TG+LP+ V  + +LRHL
Sbjct  109  TELAALSALRYLNLSNNVFNGSFPTQLSQLKNLQVLDLYNNNMTGELPISVTDLPNLRHL  168

Query  359  HLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGI  538
            HLGGN+F+G+IP  YGR+ +LEYLAVSGN L G IP EIGNL KLKELYIGY+N F GG+
Sbjct  169  HLGGNFFTGQIPASYGRWEHLEYLAVSGNELGGRIPPEIGNLKKLKELYIGYYNSFEGGL  228

Query  539  PPEMGNLSQLIRXDAANCGLTGE  607
            PPE+GNLS+L+R DAANC L+GE
Sbjct  229  PPEIGNLSELVRFDAANCMLSGE  251


 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 86/162 (53%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P++G+L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P   A L
Sbjct  248  LSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGTLESLKSMDLSNNMLAGEIPESFADL  307

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP   G    L+ L +S N 
Sbjct  308  KNLTLLNLFRNKLHGQIPEFIGELPELEVLQLWENNFTGNIPQTLGSNRKLQLLDLSSNK  367

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G++P ++ +   L  L I   N   G IP  +G    L R
Sbjct  368  LTGILPPDMCSGNTLHTL-ITLGNFLFGSIPESLGKCESLSR  408


 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 87/173 (50%), Gaps = 1/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L+P++G L  L ++ ++ N L+G +P   + +  L  LNL  N      P  + +L
Sbjct  272  LSGSLTPELGTLESLKSMDLSNNMLAGEIPESFADLKNLTLLNLFRNKLHGQIPEFIGEL  331

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L+VL L+ NN TG++P  +     L+ L L  N  +G +PP+      L  L   GN 
Sbjct  332  PELEVLQLWENNFTGNIPQTLGSNRKLQLLDLSSNKLTGILPPDMCSGNTLHTLITLGNF  391

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            L G IP  +G    L  + +G  N  +G IP  +  L +L + +  +  LTGE
Sbjct  392  LFGSIPESLGKCESLSRIRMGE-NFLNGSIPKGLFGLPKLTQVELQDNYLTGE  443


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 79/155 (51%), Gaps = 1/155 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            +  G L P++G L  LV    A   LSG +PPEI  +  L  L L  N    +   +L  
Sbjct  223  SFEGGLPPEIGNLSELVRFDAANCMLSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGT  282

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L +L+ +DL NN L G++P     + +L  L+L  N   G+IP   G  P LE L +  N
Sbjct  283  LESLKSMDLSNNMLAGEIPESFADLKNLTLLNLFRNKLHGQIPEFIGELPELEVLQLWEN  342

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
              +G IP  +G+  KL+ L +   N  +G +PP+M
Sbjct  343  NFTGNIPQTLGSNRKLQLLDLSS-NKLTGILPPDM  376


 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 85/175 (49%), Gaps = 2/175 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G+L PD+     L  L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  367  KLTGILPPDMCSGNTLHTLITLGNFLFGSIPESLGKCESLSRIRMGENFLNGSIPKGLFG  426

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMT-SLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            L  L  ++L +N LTG+ PV    ++ +L  + L  N  SG +P   G F  ++ L + G
Sbjct  427  LPKLTQVELQDNYLTGEFPVTDSSISLNLGQISLSNNRLSGPLPATVGNFSGVQKLLLDG  486

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            N  SG IP+EIGNL +L ++   + N FSG + P +     L   D +   L+GE
Sbjct  487  NKFSGPIPAEIGNLQQLSKMDFSH-NKFSGPVAPGISKCKLLTFVDLSRNELSGE  540


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 76/162 (47%), Gaps = 2/162 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            N++G L   V  LP L +L +  N  +G +P        L +L +S N  G   P ++  
Sbjct  150  NMTGELPISVTDLPNLRHLHLGGNFFTGQIPASYGRWEHLEYLAVSGNELGGRIPPEIGN  209

Query  266  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            L  L+ L + Y N+  G LP E+  ++ L          SG IPPE G+   L+ L +  
Sbjct  210  LKKLKELYIGYYNSFEGGLPPEIGNLSELVRFDAANCMLSGEIPPEIGKLQKLDTLFLQV  269

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQL  568
            N LSG +  E+G L  LK + +   N  +G IP    +L  L
Sbjct  270  NALSGSLTPELGTLESLKSMDLSN-NMLAGEIPESFADLKNL  310


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 65/127 (51%), Gaps = 0/127 (0%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L   VG    +  L +  N+ SGP+P EI  +  L  ++ S+N F       +++ 
Sbjct  465  LSGPLPATVGNFSGVQKLLLDGNKFSGPIPAEIGNLQQLSKMDFSHNKFSGPVAPGISKC  524

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  525  KLLTFVDLSRNELSGEIPTEITGMRILNYLNLSRNHLIGSIPSSISTMQSLTSVDFSYNN  584

Query  449  LSGVIPS  469
            LSG++PS
Sbjct  585  LSGLVPS  591


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 65/137 (47%), Gaps = 1/137 (1%)
 Frame = +2

Query  131  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  310
            L  +S++ N+LSGP+P  +   S ++ L L  N F    P ++  L  L  +D  +N  +
Sbjct  455  LGQISLSNNRLSGPLPATVGNFSGVQKLLLDGNKFSGPIPAEIGNLQQLSKMDFSHNKFS  514

Query  311  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTK  490
            G +   + K   L  + L  N  SG IP E      L YL +S N L G IPS I  +  
Sbjct  515  GPVAPGISKCKLLTFVDLSRNELSGEIPTEITGMRILNYLNLSRNHLIGSIPSSISTMQS  574

Query  491  LKELYIGYFNGFSGGIP  541
            L  +   Y N  SG +P
Sbjct  575  LTSVDFSY-NNLSGLVP  590


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 71/155 (46%), Gaps = 2/155 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N     FP   + +
Sbjct  392  LFGSIPESLGKCESLSRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLTGEFPVTDSSI  451

Query  269  A-NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            + NL  + L NN L+G LP  V   + ++ L L GN FSG IP E G    L  +  S N
Sbjct  452  SLNLGQISLSNNRLSGPLPATVGNFSGVQKLLLDGNKFSGPIPAEIGNLQQLSKMDFSHN  511

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
              SG +   I     L  + +   N  SG IP E+
Sbjct  512  KFSGPVAPGISKCKLLTFVDLSR-NELSGEIPTEI  545



>gb|KJB18113.1| hypothetical protein B456_003G034400 [Gossypium raimondii]
 gb|KJB18114.1| hypothetical protein B456_003G034400 [Gossypium raimondii]
Length=1026

 Score =   250 bits (638),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 161/203 (79%), Gaps = 1/203 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsl-lhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVP  178
            N +T  C++  V CD    HV S+DL+   LSG LSP +  L FL NLS+AAN LSGP+P
Sbjct  52   NANTPLCSFAGVACDLTGRHVTSIDLTNFTLSGTLSPSLAHLRFLQNLSVAANDLSGPIP  111

Query  179  PEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHL  358
             E++ +S LR+LNLSNN+F  +FP QL+QL NLQ+LDLYNNN+TG+LPV V ++ +LRHL
Sbjct  112  TELAVLSNLRYLNLSNNVFNGSFPTQLSQLKNLQILDLYNNNMTGELPVSVTELPNLRHL  171

Query  359  HLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGI  538
            HLGGNYFSG+IP  YGR+ +LEYLAVSGN LSG IP EIGNLTKLK+LYIGYFN F GG+
Sbjct  172  HLGGNYFSGQIPSSYGRWEHLEYLAVSGNELSGKIPPEIGNLTKLKQLYIGYFNSFEGGL  231

Query  539  PPEMGNLSQLIRXDAANCGLTGE  607
            PPE+GNLS+L+  DAANC L+GE
Sbjct  232  PPEIGNLSELVLFDAANCMLSGE  254


 Score = 95.1 bits (235),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 90/162 (56%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P+VG+L  L  L +  N LSG + PE+  +++L+ ++LSNN+F    P   AQL
Sbjct  251  LSGEIPPEVGKLQRLHTLFLQVNALSGSLTPELGTLNSLKSMDLSNNMFTGEIPASFAQL  310

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP + G    L+ L +S N 
Sbjct  311  KNLTLLNLFRNKLHGQIPDFIGELPELEVLQLWENNFTGSIPQKLGSNKKLQVLDLSSNK  370

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P ++ +   L+ L I   N   G IP  +G    L R
Sbjct  371  LTGTLPPDMCSGNTLQTL-ITLGNFLLGPIPESLGKCESLSR  411


 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 60/173 (35%), Positives = 91/173 (53%), Gaps = 2/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            LSG + P++G L  L  L I   N   G +PPEI  +S L   + +N +     P ++ +
Sbjct  202  LSGKIPPEIGNLTKLKQLYIGYFNSFEGGLPPEIGNLSELVLFDAANCMLSGEIPPEVGK  261

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  L L  N L+G L  E+  + SL+ + L  N F+G IP  + +  NL  L +  N
Sbjct  262  LQRLHTLFLQVNALSGSLTPELGTLNSLKSMDLSNNMFTGEIPASFAQLKNLTLLNLFRN  321

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             L G IP  IG L +L+ L + + N F+G IP ++G+  +L   D ++  LTG
Sbjct  322  KLHGQIPDFIGELPELEVLQL-WENNFTGSIPQKLGSNKKLQVLDLSSNKLTG  373


 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 81/155 (52%), Gaps = 1/155 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            +  G L P++G L  LV    A   LSG +PPE+  +  L  L L  N    +   +L  
Sbjct  226  SFEGGLPPEIGNLSELVLFDAANCMLSGEIPPEVGKLQRLHTLFLQVNALSGSLTPELGT  285

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L +L+ +DL NN  TG++P    ++ +L  L+L  N   G+IP   G  P LE L +  N
Sbjct  286  LNSLKSMDLSNNMFTGEIPASFAQLKNLTLLNLFRNKLHGQIPDFIGELPELEVLQLWEN  345

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
              +G IP ++G+  KL+ L +   N  +G +PP+M
Sbjct  346  NFTGSIPQKLGSNKKLQVLDLSS-NKLTGTLPPDM  379


 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 86/175 (49%), Gaps = 2/175 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  370  KLTGTLPPDMCSGNTLQTLITLGNFLLGPIPESLGKCESLSRIRMGENYLNGSIPKGLLG  429

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMT-SLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            L  L  ++L +N LTG+ PV    ++ +L  + L  N  SG +P   G F  ++ L + G
Sbjct  430  LPQLTQVELQDNYLTGEFPVTDSSISVNLGQISLSNNQLSGALPASVGNFSGVQKLLLDG  489

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            N  SG IP+EIG L +L ++   + N FSG IPPE+     L   D +   L+G+
Sbjct  490  NKFSGPIPAEIGKLQQLSKIDFSH-NKFSGLIPPEICKCKLLTFVDLSRNELSGQ  543


 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 64/127 (50%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             LSG L   VG    +  L +  N+ SGP+P EI  +  L  ++ S+N F    P ++ +
Sbjct  467  QLSGALPASVGNFSGVQKLLLDGNKFSGPIPAEIGKLQQLSKIDFSHNKFSGLIPPEICK  526

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  +DL  N L+G +P E+  M  L +L+L  N+  G IP       +L  +  S N
Sbjct  527  CKLLTFVDLSRNELSGQIPTEITSMRILNYLNLSRNHLLGSIPSSISTMQSLTSVDFSYN  586

Query  446  GLSGVIP  466
             LSG++P
Sbjct  587  NLSGLVP  593


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 68/137 (50%), Gaps = 1/137 (1%)
 Frame = +2

Query  131  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  310
            L  +S++ NQLSG +P  +   S ++ L L  N F    P ++ +L  L  +D  +N  +
Sbjct  458  LGQISLSNNQLSGALPASVGNFSGVQKLLLDGNKFSGPIPAEIGKLQQLSKIDFSHNKFS  517

Query  311  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTK  490
            G +P E+ K   L  + L  N  SG+IP E      L YL +S N L G IPS I  +  
Sbjct  518  GLIPPEICKCKLLTFVDLSRNELSGQIPTEITSMRILNYLNLSRNHLLGSIPSSISTMQS  577

Query  491  LKELYIGYFNGFSGGIP  541
            L  +   Y N  SG +P
Sbjct  578  LTSVDFSY-NNLSGLVP  593


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 51/161 (32%), Positives = 78/161 (48%), Gaps = 2/161 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N     FP   + +
Sbjct  395  LLGPIPESLGKCESLSRIRMGENYLNGSIPKGLLGLPQLTQVELQDNYLTGEFPVTDSSI  454

Query  269  A-NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            + NL  + L NN L+G LP  V   + ++ L L GN FSG IP E G+   L  +  S N
Sbjct  455  SVNLGQISLSNNQLSGALPASVGNFSGVQKLLLDGNKFSGPIPAEIGKLQQLSKIDFSHN  514

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQL  568
              SG+IP EI     L  + +   N  SG IP E+ ++  L
Sbjct  515  KFSGLIPPEICKCKLLTFVDLSR-NELSGQIPTEITSMRIL  554



>ref|XP_010518800.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Tarenaya hassleriana]
Length=1011

 Score =   250 bits (638),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 154/202 (76%), Gaps = 2/202 (1%)
 Frame = +2

Query  8    STSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPE  184
            STS C W  VTCD+    V       LNLSG LS D+  L  L N S++ANQ+SGP+PPE
Sbjct  52   STSFCGWAGVTCDASRRHVISLDLSGLNLSGTLSSDIAHLRLLQNFSVSANQISGPIPPE  111

Query  185  ISAISTLRFLNLSNNIFGSTFPHQL-AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLH  361
            IS++  LR+LNLSNN+F  +FP +L A L NL+VLDLYNNNLTGDLPV V  +T LRHLH
Sbjct  112  ISSLFGLRYLNLSNNVFNGSFPDELSAGLVNLRVLDLYNNNLTGDLPVSVTNLTQLRHLH  171

Query  362  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            LGGNYF+GRIP  YG +P +EYLAVSGN L G IP EIGNL+ L+ELYIGY+N F  G+P
Sbjct  172  LGGNYFAGRIPAAYGSWPVIEYLAVSGNELVGKIPPEIGNLSTLRELYIGYYNAFEDGLP  231

Query  542  PEMGNLSQLIRXDAANCGLTGE  607
            PE+GNLS+L+R DAANCGLTG+
Sbjct  232  PEIGNLSELVRFDAANCGLTGQ  253


 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 86/162 (53%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G + P++G+L  L  L +  N LSGP+ PE+  +  L  ++LSNN+F    P   AQL
Sbjct  250  LTGQIPPEIGKLQKLDTLFLQVNGLSGPLTPELGTLPILESMDLSNNMFVGEIPASFAQL  309

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP + G    L+ L +S N 
Sbjct  310  KNLTLLNLFRNKLHGAIPEFIGDLPELEVLQLWENNFTGSIPRKLGENGKLQLLDLSSNK  369

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P  + +   L+ L I   N   G IP  +G    L R
Sbjct  370  LTGTLPPNMCSGNNLQTL-ITLSNFLFGPIPDSLGECESLTR  410


 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 86/173 (50%), Gaps = 1/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L+P++G LP L ++ ++ N   G +P   + +  L  LNL  N      P  +  L
Sbjct  274  LSGPLTPELGTLPILESMDLSNNMFVGEIPASFAQLKNLTLLNLFRNKLHGAIPEFIGDL  333

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L+VL L+ NN TG +P ++ +   L+ L L  N  +G +PP      NL+ L    N 
Sbjct  334  PELEVLQLWENNFTGSIPRKLGENGKLQLLDLSSNKLTGTLPPNMCSGNNLQTLITLSNF  393

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            L G IP  +G    L  + +G  N  +G IP  +  L +L + +  +  LTGE
Sbjct  394  LFGPIPDSLGECESLTRIRMGE-NFLNGSIPKGLFGLPKLTQVELQDNYLTGE  445


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 84/174 (48%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P++     L  L   +N L GP+P  +    +L  + +  N    + P  L  
Sbjct  369  KLTGTLPPNMCSGNNLQTLITLSNFLFGPIPDSLGECESLTRIRMGENFLNGSIPKGLFG  428

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N LTG+ PV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  429  LPKLTQVELQDNYLTGEFPVTGRVAFNLGQISLSNNQLSGPLPPTIGNFSGVQKLLLDGN  488

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              +G+IP +IG L +L ++   + N FSG I PE+     L   D +   L GE
Sbjct  489  KFTGLIPQQIGKLQQLSKMDFSH-NRFSGRIAPEISQCKLLTFVDLSRNELAGE  541


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 77/160 (48%), Gaps = 4/160 (3%)
 Frame = +2

Query  101  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  280
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N        +L  L  L+
Sbjct  230  LPPEIGNLSELVRFDAANCGLTGQIPPEIGKLQKLDTLFLQVNGLSGPLTPELGTLPILE  289

Query  281  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  460
             +DL NN   G++P    ++ +L  L+L  N   G IP   G  P LE L +  N  +G 
Sbjct  290  SMDLSNNMFVGEIPASFAQLKNLTLLNLFRNKLHGAIPEFIGDLPELEVLQLWENNFTGS  349

Query  461  IPSEIGNLTKLKELYIGYFNGFSGGIPPEM---GNLSQLI  571
            IP ++G   KL+ L +   N  +G +PP M    NL  LI
Sbjct  350  IPRKLGENGKLQLLDLSS-NKLTGTLPPNMCSGNNLQTLI  388


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 59/198 (30%), Positives = 95/198 (48%), Gaps = 25/198 (13%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L G +   +G LP L  L +  N  +G +P ++     L+ L+LS+N    T P  +  
Sbjct  321  KLHGAIPEFIGDLPELEVLQLWENNFTGSIPRKLGENGKLQLLDLSSNKLTGTLPPNMCS  380

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP------PEY--------  403
              NLQ L   +N L G +P  + +  SL  + +G N+ +G IP      P+         
Sbjct  381  GNNLQTLITLSNFLFGPIPDSLGECESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDN  440

Query  404  ---GRFP-------NLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
               G FP       NL  +++S N LSG +P  IGN + +++L +   N F+G IP ++G
Sbjct  441  YLTGEFPVTGRVAFNLGQISLSNNQLSGPLPPTIGNFSGVQKLLLDG-NKFTGLIPQQIG  499

Query  554  NLSQLIRXDAANCGLTGE  607
             L QL + D ++   +G 
Sbjct  500  KLQQLSKMDFSHNRFSGR  517


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 74/146 (51%), Gaps = 2/146 (1%)
 Frame = +2

Query  107  PDVGQLPF-LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  283
            P  G++ F L  +S++ NQLSGP+PP I   S ++ L L  N F    P Q+ +L  L  
Sbjct  447  PVTGRVAFNLGQISLSNNQLSGPLPPTIGNFSGVQKLLLDGNKFTGLIPQQIGKLQQLSK  506

Query  284  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  463
            +D  +N  +G +  E+ +   L  + L  N  +G IP E      L YL +S N L G I
Sbjct  507  MDFSHNRFSGRIAPEISQCKLLTFVDLSRNELAGEIPNEITGMRILNYLNLSRNHLVGPI  566

Query  464  PSEIGNLTKLKELYIGYFNGFSGGIP  541
            P+ I ++  L  +   Y N  SG +P
Sbjct  567  PASISSMQSLTSVDFSY-NNLSGLVP  591


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 80/172 (47%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G +   +  LP L  + +  N L+G  P        L  ++LSNN      P  +   
Sbjct  418  LNGSIPKGLFGLPKLTQVELQDNYLTGEFPVTGRVAFNLGQISLSNNQLSGPLPPTIGNF  477

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
            + +Q L L  N  TG +P ++ K+  L  +    N FSGRI PE  +   L ++ +S N 
Sbjct  478  SGVQKLLLDGNKFTGLIPQQIGKLQQLSKMDFSHNRFSGRIAPEISQCKLLTFVDLSRNE  537

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            L+G IP+EI  +  L  L +   N   G IP  + ++  L   D +   L+G
Sbjct  538  LAGEIPNEITGMRILNYLNLSR-NHLVGPIPASISSMQSLTSVDFSYNNLSG  588


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
             SG ++P++ Q   L  + ++ N+L+G +P EI+ +  L +LNLS N      P  ++ +
Sbjct  514  FSGRIAPEISQCKLLTFVDLSRNELAGEIPNEITGMRILNYLNLSRNHLVGPIPASISSM  573

Query  269  ANLQVLDLYNNNLTGDLP  322
             +L  +D   NNL+G +P
Sbjct  574  QSLTSVDFSYNNLSGLVP  591



>gb|KHG03710.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
 gb|KHG03906.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
Length=1013

 Score =   248 bits (634),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 130/197 (66%), Positives = 157/197 (80%), Gaps = 1/197 (1%)
 Frame = +2

Query  20   CTWRRVTCdsl-lhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAI  196
            C++  VTCD    HV SLDLS  NLSG LSP    L FL N S+AANQL GP+P E++A+
Sbjct  55   CSFTGVTCDYTGRHVTSLDLSYFNLSGTLSPSFSHLRFLQNFSLAANQLYGPIPTELAAL  114

Query  197  STLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNY  376
            S LR+LNLSNN+F  +FP QL+QL NLQVLDLYNNN+TGDLP+ V  + +LRHLHLGGN+
Sbjct  115  SALRYLNLSNNVFNGSFPTQLSQLKNLQVLDLYNNNMTGDLPISVTDLPNLRHLHLGGNF  174

Query  377  FSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  556
            F+G+IP  YGR+ +LEYLAVSGN L G IP EIGNL KL+ELYIGY+N F GG+PPE+GN
Sbjct  175  FTGQIPASYGRWEHLEYLAVSGNELGGRIPPEIGNLEKLQELYIGYYNSFEGGLPPEIGN  234

Query  557  LSQLIRXDAANCGLTGE  607
            LS+L+R DAANC L+GE
Sbjct  235  LSELVRFDAANCMLSGE  251


 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 85/162 (52%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P++G+L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P   A L
Sbjct  248  LSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGTLKSLKSMDLSNNMLAGEIPESFADL  307

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP   G    L+ L +S N 
Sbjct  308  KNLTLLNLFRNKLHGQIPGFIGELPELEVLQLWENNFTGSIPQTLGSNRKLQLLDLSSNK  367

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P ++ +   L  L I   N   G IP  +G    L R
Sbjct  368  LTGTLPPDMCSGNTLHTL-ITLGNFLFGSIPESLGKCESLSR  408


 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 86/173 (50%), Gaps = 1/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L+P++G L  L ++ ++ N L+G +P   + +  L  LNL  N      P  + +L
Sbjct  272  LSGSLTPELGTLKSLKSMDLSNNMLAGEIPESFADLKNLTLLNLFRNKLHGQIPGFIGEL  331

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L+VL L+ NN TG +P  +     L+ L L  N  +G +PP+      L  L   GN 
Sbjct  332  PELEVLQLWENNFTGSIPQTLGSNRKLQLLDLSSNKLTGTLPPDMCSGNTLHTLITLGNF  391

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            L G IP  +G    L  + +G  N  +G IP  +  L +L + +  +  LTGE
Sbjct  392  LFGSIPESLGKCESLSRIRMGE-NFLNGSIPKGLFRLPKLTQVELQDNYLTGE  443


 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 79/155 (51%), Gaps = 1/155 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            +  G L P++G L  LV    A   LSG +PPEI  +  L  L L  N    +   +L  
Sbjct  223  SFEGGLPPEIGNLSELVRFDAANCMLSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGT  282

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L +L+ +DL NN L G++P     + +L  L+L  N   G+IP   G  P LE L +  N
Sbjct  283  LKSLKSMDLSNNMLAGEIPESFADLKNLTLLNLFRNKLHGQIPGFIGELPELEVLQLWEN  342

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
              +G IP  +G+  KL+ L +   N  +G +PP+M
Sbjct  343  NFTGSIPQTLGSNRKLQLLDLSS-NKLTGTLPPDM  376


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 76/162 (47%), Gaps = 2/162 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            N++G L   V  LP L +L +  N  +G +P        L +L +S N  G   P ++  
Sbjct  150  NMTGDLPISVTDLPNLRHLHLGGNFFTGQIPASYGRWEHLEYLAVSGNELGGRIPPEIGN  209

Query  266  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            L  LQ L + Y N+  G LP E+  ++ L          SG IPPE G+   L+ L +  
Sbjct  210  LEKLQELYIGYYNSFEGGLPPEIGNLSELVRFDAANCMLSGEIPPEIGKLQKLDTLFLQV  269

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQL  568
            N LSG +  E+G L  LK + +   N  +G IP    +L  L
Sbjct  270  NALSGSLTPELGTLKSLKSMDLSN-NMLAGEIPESFADLKNL  310


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 65/127 (51%), Gaps = 0/127 (0%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L   VG    +  L +  N+ SGP+P EI  +  L  ++ S+N F       +++ 
Sbjct  465  LSGPLPATVGNFSGVQKLLLDGNKFSGPIPAEIGNLQQLSKMDFSHNKFSGPVAPGISKC  524

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  525  KLLTFVDLSRNELSGEIPTEITGMRILNYLNLSRNHLIGSIPSSISTMQSLTSVDFSYNN  584

Query  449  LSGVIPS  469
            LSG++PS
Sbjct  585  LSGLVPS  591


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 65/137 (47%), Gaps = 1/137 (1%)
 Frame = +2

Query  131  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  310
            L  +S++ N+LSGP+P  +   S ++ L L  N F    P ++  L  L  +D  +N  +
Sbjct  455  LGQISLSNNRLSGPLPATVGNFSGVQKLLLDGNKFSGPIPAEIGNLQQLSKMDFSHNKFS  514

Query  311  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTK  490
            G +   + K   L  + L  N  SG IP E      L YL +S N L G IPS I  +  
Sbjct  515  GPVAPGISKCKLLTFVDLSRNELSGEIPTEITGMRILNYLNLSRNHLIGSIPSSISTMQS  574

Query  491  LKELYIGYFNGFSGGIP  541
            L  +   Y N  SG +P
Sbjct  575  LTSVDFSY-NNLSGLVP  590


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 71/155 (46%), Gaps = 2/155 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N     FP   + +
Sbjct  392  LFGSIPESLGKCESLSRIRMGENFLNGSIPKGLFRLPKLTQVELQDNYLTGEFPVTDSSI  451

Query  269  A-NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            + NL  + L NN L+G LP  V   + ++ L L GN FSG IP E G    L  +  S N
Sbjct  452  SLNLGQISLSNNRLSGPLPATVGNFSGVQKLLLDGNKFSGPIPAEIGNLQQLSKMDFSHN  511

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
              SG +   I     L  + +   N  SG IP E+
Sbjct  512  KFSGPVAPGISKCKLLTFVDLSR-NELSGEIPTEI  545



>ref|XP_008441113.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1, partial [Cucumis melo]
Length=977

 Score =   248 bits (632),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 165/202 (82%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPP  181
            N STSHCTW  VTCD   HV +LDL+ L LSG LSPDV  L FL NLS+AAN+ SGP+PP
Sbjct  9    NASTSHCTWFGVTCDLRRHVTALDLTALGLSGSLSPDVAFLRFLTNLSLAANEFSGPIPP  68

Query  182  EISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLH  361
            E+S+IS+LR LNLSNN+F  +FP + +QL NL VLDLYNNN+TGD P+ V +M+SLRHLH
Sbjct  69   ELSSISSLRLLNLSNNVFDGSFPSRFSQLQNLHVLDLYNNNMTGDFPIVVTEMSSLRHLH  128

Query  362  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            LGGN+F+GRIPPE GR  +LEYLAVSGN LSG IP E+GNLT L+ELYIGYFN + GG+P
Sbjct  129  LGGNFFAGRIPPEVGRMQSLEYLAVSGNELSGPIPPELGNLTNLRELYIGYFNAYDGGLP  188

Query  542  PEMGNLSQLIRXDAANCGLTGE  607
             E+GNLSQL+R DAANCGL+G 
Sbjct  189  AEIGNLSQLVRLDAANCGLSGR  210


 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 89/162 (55%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P++G+L  L  L +  N LSGP+ PEI  +++L+ L+LSNN+     P   AQL
Sbjct  207  LSGRIPPELGKLQNLDTLFLQVNALSGPLTPEIGQLNSLKSLDLSNNMLVGEIPVSFAQL  266

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  +  +  L  L L  N F+  IP   G+   L+ L +S N 
Sbjct  267  KNLTLLNLFRNKLHGAIPSFIGDLPKLEVLQLWENNFTEAIPQNLGKNGMLQILDLSSNK  326

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P ++    +L ++ I   N   G IP  +G  + L R
Sbjct  327  LTGTLPPDMCFGNRL-QILIALSNFLFGPIPESLGKCASLNR  367


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 86/177 (49%), Gaps = 7/177 (4%)
 Frame = +2

Query  86   NLSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  256
             L+G L PD+    +L  L+ LS   N L GP+P  +   ++L  + +  N    + P  
Sbjct  326  KLTGTLPPDMCFGNRLQILIALS---NFLFGPIPESLGKCASLNRIRMGENFLNGSIPKG  382

Query  257  LAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  436
            L  L  L  ++L +N L+G+ P+      +L  + L  N  +G IPP  G F  ++ L +
Sbjct  383  LLSLPKLSQVELQDNFLSGEFPITDSISLNLGQISLSNNRLTGSIPPTIGNFSGVQKLLL  442

Query  437  SGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
             GN  SG IP EIG L +L ++     N  SG I PE+     L   D +   L+GE
Sbjct  443  DGNKFSGQIPPEIGRLQQLSKIDFSS-NMLSGPIAPEISQCKLLTFVDLSRNQLSGE  498


 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 86/173 (50%), Gaps = 1/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L+P++GQL  L +L ++ N L G +P   + +  L  LNL  N      P  +  L
Sbjct  231  LSGPLTPEIGQLNSLKSLDLSNNMLVGEIPVSFAQLKNLTLLNLFRNKLHGAIPSFIGDL  290

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L+VL L+ NN T  +P  + K   L+ L L  N  +G +PP+      L+ L    N 
Sbjct  291  PKLEVLQLWENNFTEAIPQNLGKNGMLQILDLSSNKLTGTLPPDMCFGNRLQILIALSNF  350

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            L G IP  +G    L  + +G  N  +G IP  + +L +L + +  +  L+GE
Sbjct  351  LFGPIPESLGKCASLNRIRMGE-NFLNGSIPKGLLSLPKLSQVELQDNFLSGE  402


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 81/162 (50%), Gaps = 3/162 (2%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
             G L  ++G L  LV L  A   LSG +PPE+  +  L  L L  N        ++ QL 
Sbjct  184  DGGLPAEIGNLSQLVRLDAANCGLSGRIPPELGKLQNLDTLFLQVNALSGPLTPEIGQLN  243

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
            +L+ LDL NN L G++PV   ++ +L  L+L  N   G IP   G  P LE L +  N  
Sbjct  244  SLKSLDLSNNMLVGEIPVSFAQLKNLTLLNLFRNKLHGAIPSFIGDLPKLEVLQLWENNF  303

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM--GNLSQLI  571
            +  IP  +G    L+ L +   N  +G +PP+M  GN  Q++
Sbjct  304  TEAIPQNLGKNGMLQILDLSS-NKLTGTLPPDMCFGNRLQIL  344


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 78/160 (49%), Gaps = 1/160 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L +N     FP   +  
Sbjct  351  LFGPIPESLGKCASLNRIRMGENFLNGSIPKGLLSLPKLSQVELQDNFLSGEFPITDSIS  410

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL  + L NN LTG +P  +   + ++ L L GN FSG+IPPE GR   L  +  S N 
Sbjct  411  LNLGQISLSNNRLTGSIPPTIGNFSGVQKLLLDGNKFSGQIPPEIGRLQQLSKIDFSSNM  470

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQL  568
            LSG I  EI     L  + +   N  SG IP E+ ++  L
Sbjct  471  LSGPIAPEISQCKLLTFVDLSR-NQLSGEIPNEITSMRIL  509


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 62/120 (52%), Gaps = 1/120 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
              SG + P++G+L  L  +  ++N LSGP+ PEIS    L F++LS N      P+++  
Sbjct  446  KFSGQIPPEIGRLQQLSKIDFSSNMLSGPIAPEISQCKLLTFVDLSRNQLSGEIPNEITS  505

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            +  L  L+L  N+L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  506  MRILNYLNLSKNHLVGGIPATIASMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  564



>ref|XP_002531999.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
 gb|EEF30398.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
Length=1021

 Score =   247 bits (631),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 162/197 (82%), Gaps = 1/197 (1%)
 Frame = +2

Query  20   CTWRRVTCd-sllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAI  196
            CTW  VTCD +  H+ SLDLS LNLSG LSPD+  L +L NL++AANQ+SGP+P ++SAI
Sbjct  57   CTWSFVTCDYNNRHITSLDLSSLNLSGTLSPDIAHLRYLQNLTLAANQISGPIPIQLSAI  116

Query  197  STLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNY  376
            S LR LNLSNN+F  +FP QL+QL NLQVLDLYNNN+TGDLP+ V +M +LRHLHLGGN+
Sbjct  117  SGLRCLNLSNNVFNGSFPTQLSQLKNLQVLDLYNNNMTGDLPLAVTEMPNLRHLHLGGNF  176

Query  377  FSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  556
            FSG IP EYG++  LEYLAVSGN L G IP EIGNLTKL++LYIGY+N + GG+PPE+GN
Sbjct  177  FSGAIPREYGKWEFLEYLAVSGNELEGPIPPEIGNLTKLQQLYIGYYNTYEGGLPPEIGN  236

Query  557  LSQLIRXDAANCGLTGE  607
            LS L+R DAANC L+GE
Sbjct  237  LSDLVRFDAANCMLSGE  253


 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 87/161 (54%), Gaps = 2/161 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  265
             SG +  + G+  FL  L+++ N+L GP+PPEI  ++ L+ L +   N +    P ++  
Sbjct  177  FSGAIPREYGKWEFLEYLAVSGNELEGPIPPEIGNLTKLQQLYIGYYNTYEGGLPPEIGN  236

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L++L   D  N  L+G++P E+ K+  L  L L  N  SG +  E G   +L+ + +S N
Sbjct  237  LSDLVRFDAANCMLSGEIPKEIGKLQKLDTLFLQVNGLSGSLIEELGNLKSLKSMDLSNN  296

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQL  568
             LSG IP+    L+ L  L + + N   G IP  +G+L QL
Sbjct  297  MLSGEIPTSFAQLSNLTLLNL-FRNKLHGAIPEFIGDLPQL  336


 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 86/174 (49%), Gaps = 2/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L PD+     L  L   +N L GP+P  +    +L  + +  N    + P  L  
Sbjct  369  KLTGNLPPDMCSGDRLQTLITLSNFLFGPIPESLGKCQSLSRIRMGENFLNGSLPKGLFG  428

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMT-SLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            L  L  ++L +N LTG+ PV   K+  +L  + L  N+ +G +P   G+F  ++ L + G
Sbjct  429  LPKLTQVELQDNLLTGEFPVTDDKIAVNLGQISLSNNHLTGSLPSSIGKFSGVQKLLLDG  488

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            N  SG IP EIG L +L ++   + N FSG I PE+     L   D +   L+G
Sbjct  489  NKFSGPIPPEIGKLQQLSKVDFSH-NKFSGPIAPEISQCKLLTFVDLSRNELSG  541


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/162 (34%), Positives = 87/162 (54%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG +  ++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN+     P   AQL
Sbjct  250  LSGEIPKEIGKLQKLDTLFLQVNGLSGSLIEELGNLKSLKSMDLSNNMLSGEIPTSFAQL  309

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
            +NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   G+  NL  + +S N 
Sbjct  310  SNLTLLNLFRNKLHGAIPEFIGDLPQLEVLQLWENNFTGSIPQGLGKNGNLVLVDLSSNK  369

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P ++ +  +L+ L I   N   G IP  +G    L R
Sbjct  370  LTGNLPPDMCSGDRLQTL-ITLSNFLFGPIPESLGKCQSLSR  410


 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 55/173 (32%), Positives = 85/173 (49%), Gaps = 1/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L  ++G L  L ++ ++ N LSG +P   + +S L  LNL  N      P  +  L
Sbjct  274  LSGSLIEELGNLKSLKSMDLSNNMLSGEIPTSFAQLSNLTLLNLFRNKLHGAIPEFIGDL  333

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L+VL L+ NN TG +P  + K  +L  + L  N  +G +PP+      L+ L    N 
Sbjct  334  PQLEVLQLWENNFTGSIPQGLGKNGNLVLVDLSSNKLTGNLPPDMCSGDRLQTLITLSNF  393

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            L G IP  +G    L  + +G  N  +G +P  +  L +L + +  +  LTGE
Sbjct  394  LFGPIPESLGKCQSLSRIRMGE-NFLNGSLPKGLFGLPKLTQVELQDNLLTGE  445


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 76/153 (50%), Gaps = 1/153 (1%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
             G L P++G L  LV    A   LSG +P EI  +  L  L L  N    +   +L  L 
Sbjct  227  EGGLPPEIGNLSDLVRFDAANCMLSGEIPKEIGKLQKLDTLFLQVNGLSGSLIEELGNLK  286

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
            +L+ +DL NN L+G++P    ++++L  L+L  N   G IP   G  P LE L +  N  
Sbjct  287  SLKSMDLSNNMLSGEIPTSFAQLSNLTLLNLFRNKLHGAIPEFIGDLPQLEVLQLWENNF  346

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            +G IP  +G    L  + +   N  +G +PP+M
Sbjct  347  TGSIPQGLGKNGNLVLVDLSS-NKLTGNLPPDM  378


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 67/127 (53%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            +L+G L   +G+   +  L +  N+ SGP+PPEI  +  L  ++ S+N F      +++Q
Sbjct  466  HLTGSLPSSIGKFSGVQKLLLDGNKFSGPIPPEIGKLQQLSKVDFSHNKFSGPIAPEISQ  525

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  +DL  N L+G +P E+  M  L +L+L  N+  G IP       +L  +  S N
Sbjct  526  CKLLTFVDLSRNELSGAIPTEITGMRILNYLNLSRNHLVGSIPASIATMQSLTSVDFSYN  585

Query  446  GLSGVIP  466
             L+G++P
Sbjct  586  NLTGLVP  592


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 82/173 (47%), Gaps = 2/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQ  265
            L+G L   +  LP L  + +  N L+G  P     I+  L  ++LSNN    + P  + +
Sbjct  418  LNGSLPKGLFGLPKLTQVELQDNLLTGEFPVTDDKIAVNLGQISLSNNHLTGSLPSSIGK  477

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
             + +Q L L  N  +G +P E+ K+  L  +    N FSG I PE  +   L ++ +S N
Sbjct  478  FSGVQKLLLDGNKFSGPIPPEIGKLQQLSKVDFSHNKFSGPIAPEISQCKLLTFVDLSRN  537

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             LSG IP+EI  +  L  L +   N   G IP  +  +  L   D +   LTG
Sbjct  538  ELSGAIPTEITGMRILNYLNLSR-NHLVGSIPASIATMQSLTSVDFSYNNLTG  589



>gb|KDP32143.1| hypothetical protein JCGZ_12604 [Jatropha curcas]
Length=1013

 Score =   247 bits (631),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 136/203 (67%), Positives = 164/203 (81%), Gaps = 1/203 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCd-sllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVP  178
            N S S C+W  VTCD S  HV SLDLS LNLSG+LS D+  L +L NL++AANQLSGP+P
Sbjct  47   NSSNSLCSWSGVTCDPSGRHVTSLDLSSLNLSGILSSDIAHLRYLQNLTLAANQLSGPIP  106

Query  179  PEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHL  358
            P++SAI  LR LNLSNN+F  TFP QL+QL NLQVLDLYNNN+T  LP+ V  M +LRHL
Sbjct  107  PQLSAIPGLRSLNLSNNVFNGTFPSQLSQLKNLQVLDLYNNNMTDVLPLAVTDMPNLRHL  166

Query  359  HLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGI  538
            HLGGN+FSG+IPPEYG++  LEYLA+SGN L G IP EIGNLT+L++LYIGY+N + GG+
Sbjct  167  HLGGNFFSGKIPPEYGKWEFLEYLAISGNELVGPIPPEIGNLTRLQQLYIGYYNSYEGGL  226

Query  539  PPEMGNLSQLIRXDAANCGLTGE  607
            PPE+GNLS L+R DAANC L+GE
Sbjct  227  PPEIGNLSDLVRFDAANCMLSGE  249


 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 55/173 (32%), Positives = 82/173 (47%), Gaps = 1/173 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P++     L  L   +N L GP+P  +    +L  + +  N    + P  L  
Sbjct  365  KLTGNLPPNMCLGNRLQTLITLSNFLFGPIPESLGKCESLSRIRMGENFLNGSIPKGLFG  424

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N LTG+ PV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  425  LPKLSQVELQDNLLTGEFPVTDTIAMNLGQISLSNNRLSGSLPPSIGNFSGVQKLLLDGN  484

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
              SG IP +IG L +L ++     N FSG I PE+     L   D +   L+G
Sbjct  485  KFSGAIPPQIGRLQQLSKMDFSS-NKFSGPITPEISQCKLLTFVDLSRNELSG  536


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 84/173 (49%), Gaps = 1/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L+ ++G L  L ++ ++ N L+G +P   S +  L  LNL  N      P  +  L
Sbjct  270  LSGSLTEELGNLKSLKSMDLSNNMLTGEIPSSFSELKNLTLLNLFRNKLYGAIPEFIGDL  329

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L+VL L+ NN TG +P  + K  +L  L L  N  +G +PP       L+ L    N 
Sbjct  330  PKLEVLQLWENNFTGSIPQGLGKNGNLVLLDLSSNKLTGNLPPNMCLGNRLQTLITLSNF  389

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            L G IP  +G    L  + +G  N  +G IP  +  L +L + +  +  LTGE
Sbjct  390  LFGPIPESLGKCESLSRIRMGE-NFLNGSIPKGLFGLPKLSQVELQDNLLTGE  441


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 84/162 (52%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG +  ++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN+     P   ++L
Sbjct  246  LSGEIPKEIGKLQKLDTLFLQVNGLSGSLTEELGNLKSLKSMDLSNNMLTGEIPSSFSEL  305

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   G+  NL  L +S N 
Sbjct  306  KNLTLLNLFRNKLYGAIPEFIGDLPKLEVLQLWENNFTGSIPQGLGKNGNLVLLDLSSNK  365

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P  +    +L+ L I   N   G IP  +G    L R
Sbjct  366  LTGNLPPNMCLGNRLQTL-ITLSNFLFGPIPESLGKCESLSR  406


 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 94/174 (54%), Gaps = 3/174 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +G +   +G+   LV L +++N+L+G +PP +   + L+  + LSN +FG   P  L 
Sbjct  341  NFTGSIPQGLGKNGNLVLLDLSSNKLTGNLPPNMCLGNRLQTLITLSNFLFGP-IPESLG  399

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            +  +L  + +  N L G +P  ++ +  L  + L  N  +G  P       NL  +++S 
Sbjct  400  KCESLSRIRMGENFLNGSIPKGLFGLPKLSQVELQDNLLTGEFPVTDTIAMNLGQISLSN  459

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            N LSG +P  IGN + +++L +   N FSG IPP++G L QL + D ++   +G
Sbjct  460  NRLSGSLPPSIGNFSGVQKLLLDG-NKFSGAIPPQIGRLQQLSKMDFSSNKFSG  512


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/152 (35%), Positives = 74/152 (49%), Gaps = 1/152 (1%)
 Frame = +2

Query  95   GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  274
            G L P++G L  LV    A   LSG +P EI  +  L  L L  N    +   +L  L +
Sbjct  224  GGLPPEIGNLSDLVRFDAANCMLSGEIPKEIGKLQKLDTLFLQVNGLSGSLTEELGNLKS  283

Query  275  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  454
            L+ +DL NN LTG++P    ++ +L  L+L  N   G IP   G  P LE L +  N  +
Sbjct  284  LKSMDLSNNMLTGEIPSSFSELKNLTLLNLFRNKLYGAIPEFIGDLPKLEVLQLWENNFT  343

Query  455  GVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            G IP  +G    L  L +   N  +G +PP M
Sbjct  344  GSIPQGLGKNGNLVLLDLSS-NKLTGNLPPNM  374


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 65/126 (52%), Gaps = 0/126 (0%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L P +G    +  L +  N+ SG +PP+I  +  L  ++ S+N F      +++Q 
Sbjct  462  LSGSLPPSIGNFSGVQKLLLDGNKFSGAIPPQIGRLQQLSKMDFSSNKFSGPITPEISQC  521

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  +DL  N L+G +P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  522  KLLTFVDLSRNELSGAIPTEITGMRILNYLNLSRNHLIGSIPSSIATMQSLTSVDFSYNN  581

Query  449  LSGVIP  466
            L+G++P
Sbjct  582  LTGLVP  587


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 67/137 (49%), Gaps = 1/137 (1%)
 Frame = +2

Query  131  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  310
            L  +S++ N+LSG +PP I   S ++ L L  N F    P Q+ +L  L  +D  +N  +
Sbjct  452  LGQISLSNNRLSGSLPPSIGNFSGVQKLLLDGNKFSGAIPPQIGRLQQLSKMDFSSNKFS  511

Query  311  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTK  490
            G +  E+ +   L  + L  N  SG IP E      L YL +S N L G IPS I  +  
Sbjct  512  GPITPEISQCKLLTFVDLSRNELSGAIPTEITGMRILNYLNLSRNHLIGSIPSSIATMQS  571

Query  491  LKELYIGYFNGFSGGIP  541
            L  +   Y N  +G +P
Sbjct  572  LTSVDFSY-NNLTGLVP  587


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 75/161 (47%), Gaps = 1/161 (1%)
 Frame = +2

Query  122  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  301
            LP L  + +  N L+G  P   +    L  ++LSNN    + P  +   + +Q L L  N
Sbjct  425  LPKLSQVELQDNLLTGEFPVTDTIAMNLGQISLSNNRLSGSLPPSIGNFSGVQKLLLDGN  484

Query  302  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGN  481
              +G +P ++ ++  L  +    N FSG I PE  +   L ++ +S N LSG IP+EI  
Sbjct  485  KFSGAIPPQIGRLQQLSKMDFSSNKFSGPITPEISQCKLLTFVDLSRNELSGAIPTEITG  544

Query  482  LTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            +  L  L +   N   G IP  +  +  L   D +   LTG
Sbjct  545  MRILNYLNLSR-NHLIGSIPSSIATMQSLTSVDFSYNNLTG  584



>ref|XP_004143422.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cucumis sativus]
 ref|XP_004163335.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cucumis sativus]
 gb|KGN48657.1| hypothetical protein Csa_6G497080 [Cucumis sativus]
Length=1019

 Score =   247 bits (630),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 138/202 (68%), Positives = 164/202 (81%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPP  181
            N STSHCTW  VTCD   HV +LDL+ L LSG LSPDV  L FL NLS+AAN+ SGP+PP
Sbjct  51   NASTSHCTWFGVTCDLRRHVTALDLTALGLSGSLSPDVAFLRFLTNLSLAANEFSGPIPP  110

Query  182  EISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLH  361
            E+S+IS+LR LNLSNN+F  +FP + +QL NL VLDLYNNN+TGD P+ V +M+ LRHLH
Sbjct  111  ELSSISSLRLLNLSNNVFDGSFPSRFSQLQNLHVLDLYNNNMTGDFPIVVTQMSGLRHLH  170

Query  362  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            LGGN+F+GRIPPE GR  +LEYLAVSGN LSG IP E+GNLT L+ELYIGYFN + GG+P
Sbjct  171  LGGNFFAGRIPPEVGRMQSLEYLAVSGNELSGSIPPELGNLTNLRELYIGYFNAYDGGLP  230

Query  542  PEMGNLSQLIRXDAANCGLTGE  607
             E+GNLSQL+R DAANCGL+G 
Sbjct  231  AEIGNLSQLVRLDAANCGLSGR  252


 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 88/162 (54%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P++G+L  L  L +  N LSGP+ PEI  +++L+ L+LSNN+     P   AQL
Sbjct  249  LSGRIPPELGKLQNLDTLFLQVNALSGPLTPEIGQLNSLKSLDLSNNMLVGEIPVSFAQL  308

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  +  +  L  L L  N F+  IP   G+   L+ L +S N 
Sbjct  309  KNLTLLNLFRNKLHGAIPSFIGDLPKLEVLQLWENNFTEAIPQNLGKNGMLQILDLSSNK  368

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P ++    +L ++ I   N   G IP  +G    L R
Sbjct  369  LTGTLPPDMCFGNRL-QILIALSNFLFGPIPESLGKCVSLNR  409


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 85/177 (48%), Gaps = 7/177 (4%)
 Frame = +2

Query  86   NLSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  256
             L+G L PD+    +L  L+ LS   N L GP+P  +    +L  + +  N    + P  
Sbjct  368  KLTGTLPPDMCFGNRLQILIALS---NFLFGPIPESLGKCVSLNRIRMGENFLNGSIPKG  424

Query  257  LAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  436
            L  L  L  ++L +N L+G+ P+      +L  + L  N  +G IPP  G F  ++ L +
Sbjct  425  LLSLPKLSQVELQDNFLSGEFPITDSISLNLGQISLSNNRLTGSIPPTIGNFSGVQKLLL  484

Query  437  SGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
             GN  SG IP EIG L +L ++     N  SG I PE+     L   D +   L+GE
Sbjct  485  DGNKFSGQIPPEIGRLQQLSKIDFSS-NMLSGPIAPEISQCKLLTFVDLSRNQLSGE  540


 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 86/173 (50%), Gaps = 1/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L+P++GQL  L +L ++ N L G +P   + +  L  LNL  N      P  +  L
Sbjct  273  LSGPLTPEIGQLNSLKSLDLSNNMLVGEIPVSFAQLKNLTLLNLFRNKLHGAIPSFIGDL  332

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L+VL L+ NN T  +P  + K   L+ L L  N  +G +PP+      L+ L    N 
Sbjct  333  PKLEVLQLWENNFTEAIPQNLGKNGMLQILDLSSNKLTGTLPPDMCFGNRLQILIALSNF  392

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            L G IP  +G    L  + +G  N  +G IP  + +L +L + +  +  L+GE
Sbjct  393  LFGPIPESLGKCVSLNRIRMGE-NFLNGSIPKGLLSLPKLSQVELQDNFLSGE  444


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 81/162 (50%), Gaps = 3/162 (2%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
             G L  ++G L  LV L  A   LSG +PPE+  +  L  L L  N        ++ QL 
Sbjct  226  DGGLPAEIGNLSQLVRLDAANCGLSGRIPPELGKLQNLDTLFLQVNALSGPLTPEIGQLN  285

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
            +L+ LDL NN L G++PV   ++ +L  L+L  N   G IP   G  P LE L +  N  
Sbjct  286  SLKSLDLSNNMLVGEIPVSFAQLKNLTLLNLFRNKLHGAIPSFIGDLPKLEVLQLWENNF  345

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM--GNLSQLI  571
            +  IP  +G    L+ L +   N  +G +PP+M  GN  Q++
Sbjct  346  TEAIPQNLGKNGMLQILDLSS-NKLTGTLPPDMCFGNRLQIL  386


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 78/160 (49%), Gaps = 1/160 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L +N     FP   +  
Sbjct  393  LFGPIPESLGKCVSLNRIRMGENFLNGSIPKGLLSLPKLSQVELQDNFLSGEFPITDSIS  452

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL  + L NN LTG +P  +   + ++ L L GN FSG+IPPE GR   L  +  S N 
Sbjct  453  LNLGQISLSNNRLTGSIPPTIGNFSGVQKLLLDGNKFSGQIPPEIGRLQQLSKIDFSSNM  512

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQL  568
            LSG I  EI     L  + +   N  SG IP E+ ++  L
Sbjct  513  LSGPIAPEISQCKLLTFVDLSR-NQLSGEIPNEITSMRIL  551


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 62/120 (52%), Gaps = 1/120 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
              SG + P++G+L  L  +  ++N LSGP+ PEIS    L F++LS N      P+++  
Sbjct  488  KFSGQIPPEIGRLQQLSKIDFSSNMLSGPIAPEISQCKLLTFVDLSRNQLSGEIPNEITS  547

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            +  L  L+L  N+L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  548  MRILNYLNLSKNHLVGGIPATIASMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  606



>ref|XP_010503631.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Camelina sativa]
Length=999

 Score =   246 bits (629),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 127/201 (63%), Positives = 152/201 (76%), Gaps = 2/201 (1%)
 Frame = +2

Query  8    STSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPE  184
            +T+ C+W  VTCD     V+      LNLSG LS DV  LP L NLS+AANQ+SGP+PPE
Sbjct  51   TTTFCSWTGVTCDVSRRHVTSLDLSGLNLSGTLSSDVSHLPLLQNLSLAANQISGPIPPE  110

Query  185  ISAISTLRFLNLSNNIFGSTFPHQLAQ-LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLH  361
             S +  LR LNLSNN+F  ++P +L+  L NL+VLDLYNNNLTG LP+ +  +T LRHLH
Sbjct  111  FSNLYELRLLNLSNNVFNGSYPDELSSGLVNLRVLDLYNNNLTGHLPLSITNLTQLRHLH  170

Query  362  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            LGGNYFSG+IP  YG +P LEYLAVSGN L G IP EIGNLT L+ELYIGY+N F  G+P
Sbjct  171  LGGNYFSGKIPATYGTWPVLEYLAVSGNELIGKIPPEIGNLTTLRELYIGYYNAFEDGLP  230

Query  542  PEMGNLSQLIRXDAANCGLTG  604
            PE+GNLS+L+R DAANCGLTG
Sbjct  231  PEIGNLSELLRFDAANCGLTG  251


 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 63/197 (32%), Positives = 96/197 (49%), Gaps = 26/197 (13%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  265
             SG +    G  P L  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  176  FSGKIPATYGTWPVLEYLAVSGNELIGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  235

Query  266  LANLQVLDLYNNNLTGDLPVEVYKM------------------------TSLRHLHLGGN  373
            L+ L   D  N  LTG +P E+ K+                        +SL+ + L  N
Sbjct  236  LSELLRFDAANCGLTGAIPPEIGKLQNLDTLFLQVNAFSGPLTSELGLISSLKSMDLSNN  295

Query  374  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
             F+G IP  +    NL  L +  N L G IP  IG L +L+ L + + N F+GGIP ++G
Sbjct  296  MFTGEIPTSFSELKNLTLLNLFRNKLYGAIPEFIGELPELEVLQL-WENNFTGGIPQKLG  354

Query  554  NLSQLIRXDAANCGLTG  604
            +  +L+  D ++  LTG
Sbjct  355  DNGRLVILDLSSNKLTG  371


 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 86/162 (53%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G + P++G+L  L  L +  N  SGP+  E+  IS+L+ ++LSNN+F    P   ++L
Sbjct  249  LTGAIPPEIGKLQNLDTLFLQVNAFSGPLTSELGLISSLKSMDLSNNMFTGEIPTSFSEL  308

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP + G    L  L +S N 
Sbjct  309  KNLTLLNLFRNKLYGAIPEFIGELPELEVLQLWENNFTGGIPQKLGDNGRLVILDLSSNK  368

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P  +    +L  L I   N   G IP  +G    L R
Sbjct  369  LTGTLPPNMCAGNRLMTL-ITLGNFLFGSIPDSLGKCESLTR  409


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 97/175 (55%), Gaps = 3/175 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTL-RFLNLSNNIFGSTFPHQLA  262
            N +G +   +G    LV L +++N+L+G +PP + A + L   + L N +FGS  P  L 
Sbjct  344  NFTGGIPQKLGDNGRLVILDLSSNKLTGTLPPNMCAGNRLMTLITLGNFLFGS-IPDSLG  402

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            +  +L  + +  N L G +P  ++ +  L  + L  NY +G +P   G   +L  +++S 
Sbjct  403  KCESLTRIRMGQNFLNGSIPKGLFGLPKLSQVELQDNYLTGELPVSGGVSSDLGQVSLSN  462

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            N LSG +P+ IGN + +++L +   N F+G IPPE+G L QL + D ++   +G 
Sbjct  463  NQLSGSLPAAIGNFSGVQKLLLDG-NKFAGPIPPEIGRLQQLSKLDFSHNLFSGR  516


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 83/174 (48%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P++     L+ L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  368  KLTGTLPPNMCAGNRLMTLITLGNFLFGSIPDSLGKCESLTRIRMGQNFLNGSIPKGLFG  427

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N LTG+LPV     + L  + L  N  SG +P   G F  ++ L + GN
Sbjct  428  LPKLSQVELQDNYLTGELPVSGGVSSDLGQVSLSNNQLSGSLPAAIGNFSGVQKLLLDGN  487

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              +G IP EIG L +L +L   + N FSG I PE+     L   D +   L+G+
Sbjct  488  KFAGPIPPEIGRLQQLSKLDFSH-NLFSGRIAPEISRCKLLTFVDLSRNELSGD  540


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 77/150 (51%), Gaps = 1/150 (1%)
 Frame = +2

Query  101  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  280
            L P++G L  L+    A   L+G +PPEI  +  L  L L  N F      +L  +++L+
Sbjct  229  LPPEIGNLSELLRFDAANCGLTGAIPPEIGKLQNLDTLFLQVNAFSGPLTSELGLISSLK  288

Query  281  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  460
             +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N  +G 
Sbjct  289  SMDLSNNMFTGEIPTSFSELKNLTLLNLFRNKLYGAIPEFIGELPELEVLQLWENNFTGG  348

Query  461  IPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            IP ++G+  +L  L +   N  +G +PP M
Sbjct  349  IPQKLGDNGRLVILDLSS-NKLTGTLPPNM  377


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 68/127 (54%), Gaps = 0/127 (0%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L   +G    +  L +  N+ +GP+PPEI  +  L  L+ S+N+F      ++++ 
Sbjct  465  LSGSLPAAIGNFSGVQKLLLDGNKFAGPIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRC  524

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  +DL  N L+GD+P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  525  KLLTFVDLSRNELSGDIPNEITGMRILNYLNLSRNHLVGSIPVSIASMQSLTSVDFSYNN  584

Query  449  LSGVIPS  469
            LSG++PS
Sbjct  585  LSGLVPS  591


 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 82/172 (48%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G +   +  LP L  + +  N L+G +P      S L  ++LSNN    + P  +   
Sbjct  417  LNGSIPKGLFGLPKLSQVELQDNYLTGELPVSGGVSSDLGQVSLSNNQLSGSLPAAIGNF  476

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
            + +Q L L  N   G +P E+ ++  L  L    N FSGRI PE  R   L ++ +S N 
Sbjct  477  SGVQKLLLDGNKFAGPIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRCKLLTFVDLSRNE  536

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            LSG IP+EI  +  L  L +   N   G IP  + ++  L   D +   L+G
Sbjct  537  LSGDIPNEITGMRILNYLNLSR-NHLVGSIPVSIASMQSLTSVDFSYNNLSG  587



>gb|KFK28239.1| hypothetical protein AALP_AA8G490400 [Arabis alpina]
Length=1002

 Score =   246 bits (628),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 125/204 (61%), Positives = 153/204 (75%), Gaps = 2/204 (1%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVP  178
             ++TS CTW  VTCD     V+      LNL G LSP++  L  L NLS+A NQ+SG +P
Sbjct  52   KLTTSFCTWTGVTCDVSRRHVTSLDLSGLNLPGTLSPEISHLRLLQNLSLAENQISGQIP  111

Query  179  PEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANLQVLDLYNNNLTGDLPVEVYKMTSLRH  355
            P+IS +S LR+LNLSNN+F  TFP +++  L NL++LD+YNNNLTGDLP+ V  +T LRH
Sbjct  112  PQISNLSGLRYLNLSNNVFNGTFPDEISSGLVNLRILDVYNNNLTGDLPISVTNLTQLRH  171

Query  356  LHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGG  535
            LHLGGNYFSG IP  YG +P +EYLAVSGN L G IP EIGNLT L+ELYIGY+N F  G
Sbjct  172  LHLGGNYFSGSIPSSYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDG  231

Query  536  IPPEMGNLSQLIRXDAANCGLTGE  607
            +PPE+GNLS+L+R D ANCGLTGE
Sbjct  232  LPPEIGNLSELVRFDGANCGLTGE  255


 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 87/162 (54%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G +  ++G+L  L  L +  N  SGP+  E+ ++S+L+ ++LSNN+F    P   A+L
Sbjct  252  LTGEIPSEIGKLKKLDTLFLQVNVFSGPLTWELGSLSSLKSMDLSNNMFTGEIPTSFAEL  311

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G++P  +  +  L  L L  N F+G IP + G    L  + +S N 
Sbjct  312  KNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGSIPQKLGENGKLHLVDLSSNK  371

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P  + +   L+ L I   N   G IP  +G    L R
Sbjct  372  LTGTLPPNMCSGNNLETL-ITLGNFLFGSIPDSLGKCESLTR  412


 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/197 (31%), Positives = 95/197 (48%), Gaps = 26/197 (13%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  265
             SG +    G  P +  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  179  FSGSIPSSYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  238

Query  266  LANLQVLDLYNNNLTGDLPVEVYK------------------------MTSLRHLHLGGN  373
            L+ L   D  N  LTG++P E+ K                        ++SL+ + L  N
Sbjct  239  LSELVRFDGANCGLTGEIPSEIGKLKKLDTLFLQVNVFSGPLTWELGSLSSLKSMDLSNN  298

Query  374  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
             F+G IP  +    NL  L +  N L G IP  IG+L +L+ L + + N F+G IP ++G
Sbjct  299  MFTGEIPTSFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQL-WENNFTGSIPQKLG  357

Query  554  NLSQLIRXDAANCGLTG  604
               +L   D ++  LTG
Sbjct  358  ENGKLHLVDLSSNKLTG  374


 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 80/160 (50%), Gaps = 4/160 (3%)
 Frame = +2

Query  101  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  280
            L P++G L  LV    A   L+G +P EI  +  L  L L  N+F      +L  L++L+
Sbjct  232  LPPEIGNLSELVRFDGANCGLTGEIPSEIGKLKKLDTLFLQVNVFSGPLTWELGSLSSLK  291

Query  281  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  460
             +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N  +G 
Sbjct  292  SMDLSNNMFTGEIPTSFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGS  351

Query  461  IPSEIGNLTKLKELYIGYFNGFSGGIPPEM---GNLSQLI  571
            IP ++G   KL  + +   N  +G +PP M    NL  LI
Sbjct  352  IPQKLGENGKLHLVDLSS-NKLTGTLPPNMCSGNNLETLI  390


 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 84/174 (48%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P++     L  L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  371  KLTGTLPPNMCSGNNLETLITLGNFLFGSIPDSLGKCESLTRIRMGENFLNGSIPKGLFG  430

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N LTG+LPV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  431  LPKLTQVELQDNYLTGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  490

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
               G IPSE+G L +L ++   + N FSG I PE+ +   L   D +   L+G+
Sbjct  491  KFEGPIPSEVGKLQQLSKIDFSH-NLFSGRIAPEISHCKLLTFVDLSRNELSGD  543


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 54/175 (31%), Positives = 94/175 (54%), Gaps = 3/175 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +G +   +G+   L  + +++N+L+G +PP + + + L   + L N +FGS  P  L 
Sbjct  347  NFTGSIPQKLGENGKLHLVDLSSNKLTGTLPPNMCSGNNLETLITLGNFLFGS-IPDSLG  405

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            +  +L  + +  N L G +P  ++ +  L  + L  NY +G +P   G   NL  +++S 
Sbjct  406  KCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLTGELPVAGGVSVNLGQISLSN  465

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            N LSG +P  IGN T +++L +   N F G IP E+G L QL + D ++   +G 
Sbjct  466  NQLSGPLPPAIGNFTGVQKLLLDG-NKFEGPIPSEVGKLQQLSKIDFSHNLFSGR  519


 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 65/127 (51%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             LSG L P +G    +  L +  N+  GP+P E+  +  L  ++ S+N+F      +++ 
Sbjct  467  QLSGPLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISH  526

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  +DL  N L+GD+P E+  M  L +L+L  N+  G IP       +L  L  S N
Sbjct  527  CKLLTFVDLSRNELSGDIPNEITGMRILNYLNLSRNHLVGAIPSSISSMQSLTSLDFSYN  586

Query  446  GLSGVIP  466
             LSG++P
Sbjct  587  NLSGLVP  593


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 76/151 (50%), Gaps = 7/151 (5%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            ++G +S ++GQ+      S++ NQLSGP+PP I   + ++ L L  N F    P ++ +L
Sbjct  450  VAGGVSVNLGQI------SLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKL  503

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  +D  +N  +G +  E+     L  + L  N  SG IP E      L YL +S N 
Sbjct  504  QQLSKIDFSHNLFSGRIAPEISHCKLLTFVDLSRNELSGDIPNEITGMRILNYLNLSRNH  563

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            L G IPS I ++  L  L   Y N  SG +P
Sbjct  564  LVGAIPSSISSMQSLTSLDFSY-NNLSGLVP  593


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/161 (32%), Positives = 73/161 (45%), Gaps = 1/161 (1%)
 Frame = +2

Query  122  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  301
            LP L  + +  N L+G +P        L  ++LSNN      P  +     +Q L L  N
Sbjct  431  LPKLTQVELQDNYLTGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  490

Query  302  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGN  481
               G +P EV K+  L  +    N FSGRI PE      L ++ +S N LSG IP+EI  
Sbjct  491  KFEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISHCKLLTFVDLSRNELSGDIPNEITG  550

Query  482  LTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            +  L  L +   N   G IP  + ++  L   D +   L+G
Sbjct  551  MRILNYLNLSR-NHLVGAIPSSISSMQSLTSLDFSYNNLSG  590



>ref|XP_007047661.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOX91818.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=1018

 Score =   246 bits (628),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 128/203 (63%), Positives = 161/203 (79%), Gaps = 1/203 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsl-lhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVP  178
            N +T  C++  V CD    HV S+DLS  NLSG LSP    L FL +LS+AANQ+SGP+P
Sbjct  48   NATTRFCSFTGVACDYTGRHVTSIDLSNFNLSGTLSPSFSHLRFLQSLSLAANQISGPIP  107

Query  179  PEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHL  358
             E++A+S+LR+ NLSNN+F  +FP QL+QL NLQVLDLYNNN+TG+LP+ V ++ +L HL
Sbjct  108  TELAALSSLRYFNLSNNVFNGSFPSQLSQLKNLQVLDLYNNNMTGELPISVTELPNLLHL  167

Query  359  HLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGI  538
            HLGGN+FSG+IP  YGR+  LEYLAVSGN L G IP EIGNLTKL++LYIGY+N F GG+
Sbjct  168  HLGGNFFSGQIPSSYGRWEFLEYLAVSGNELDGKIPPEIGNLTKLQQLYIGYYNSFEGGL  227

Query  539  PPEMGNLSQLIRXDAANCGLTGE  607
            PPE+GNLS+L+R DAANC L+GE
Sbjct  228  PPEIGNLSELVRFDAANCMLSGE  250


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 84/175 (48%), Gaps = 2/175 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L  D+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  366  KLTGTLPLDMCSGNTLHTLITLGNFLFGPIPESLGKCESLSRIRMGENFLNGSIPKGLFG  425

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTS-LRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            L  L  ++L +N LTG+ PV    +++ L  + L  N  SG +P   G F  ++ L + G
Sbjct  426  LPKLTQVELQDNYLTGEFPVTESSISANLGQISLSNNKLSGTLPASVGNFSGVQKLLLDG  485

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            N  SG IP+EIG L +L ++   + N FSG I PE+     L   D +   L+GE
Sbjct  486  NKFSGRIPAEIGKLQQLSKMDFSH-NKFSGTIAPEISKCKLLTFVDLSRNELSGE  539


 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 90/197 (46%), Gaps = 25/197 (13%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA--  262
            LSG + P++G+L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P   A  
Sbjct  247  LSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGTLKSLKSMDLSNNMLAGEIPESFANL  306

Query  263  ----------------------QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNY  376
                                  +L  L+VL L+ NN TG +P ++     L+ L L  N 
Sbjct  307  KNLTLLNLFRNKLHGQIPEFIGELPELEVLQLWENNFTGSIPQQLGSNKKLQLLDLSSNK  366

Query  377  FSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  556
             +G +P +      L  L   GN L G IP  +G    L  + +G  N  +G IP  +  
Sbjct  367  LTGTLPLDMCSGNTLHTLITLGNFLFGPIPESLGKCESLSRIRMGE-NFLNGSIPKGLFG  425

Query  557  LSQLIRXDAANCGLTGE  607
            L +L + +  +  LTGE
Sbjct  426  LPKLTQVELQDNYLTGE  442


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 79/155 (51%), Gaps = 1/155 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            +  G L P++G L  LV    A   LSG +PPEI  +  L  L L  N    +   +L  
Sbjct  222  SFEGGLPPEIGNLSELVRFDAANCMLSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGT  281

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L +L+ +DL NN L G++P     + +L  L+L  N   G+IP   G  P LE L +  N
Sbjct  282  LKSLKSMDLSNNMLAGEIPESFANLKNLTLLNLFRNKLHGQIPEFIGELPELEVLQLWEN  341

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
              +G IP ++G+  KL+ L +   N  +G +P +M
Sbjct  342  NFTGSIPQQLGSNKKLQLLDLSS-NKLTGTLPLDM  375


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/162 (33%), Positives = 78/162 (48%), Gaps = 2/162 (1%)
 Frame = +2

Query  122  LPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQLANLQVLDLYN  298
            LP L  + +  N L+G  P   S+IS  L  ++LSNN    T P  +   + +Q L L  
Sbjct  426  LPKLTQVELQDNYLTGEFPVTESSISANLGQISLSNNKLSGTLPASVGNFSGVQKLLLDG  485

Query  299  NNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIG  478
            N  +G +P E+ K+  L  +    N FSG I PE  +   L ++ +S N LSG IP+EI 
Sbjct  486  NKFSGRIPAEIGKLQQLSKMDFSHNKFSGTIAPEISKCKLLTFVDLSRNELSGEIPTEIT  545

Query  479  NLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             +  L  L +   N   G IP  +  +  L   D +   L+G
Sbjct  546  GMRILNYLNLSR-NHLIGSIPSSIATMQSLTSVDFSYNNLSG  586


 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 50/153 (33%), Positives = 74/153 (48%), Gaps = 2/153 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            N++G L   V +LP L++L +  N  SG +P        L +L +S N      P ++  
Sbjct  149  NMTGELPISVTELPNLLHLHLGGNFFSGQIPSSYGRWEFLEYLAVSGNELDGKIPPEIGN  208

Query  266  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            L  LQ L + Y N+  G LP E+  ++ L          SG IPPE G+   L+ L +  
Sbjct  209  LTKLQQLYIGYYNSFEGGLPPEIGNLSELVRFDAANCMLSGEIPPEIGKLQKLDTLFLQV  268

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            N LSG +  E+G L  LK + +   N  +G IP
Sbjct  269  NALSGSLTPELGTLKSLKSMDLSN-NMLAGEIP  300


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
              SG ++P++ +   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  +A 
Sbjct  511  KFSGTIAPEISKCKLLTFVDLSRNELSGEIPTEITGMRILNYLNLSRNHLIGSIPSSIAT  570

Query  266  LANLQVLDLYNNNLTGDLP  322
            + +L  +D   NNL+G +P
Sbjct  571  MQSLTSVDFSYNNLSGLVP  589



>ref|NP_001235065.1| receptor-like protein kinase 1 precursor [Glycine max]
 gb|AAF91322.1|AF244888_1 receptor-like protein kinase 1 [Glycine max]
Length=1008

 Score =   246 bits (627),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 163/202 (81%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPP  181
            N ST  C+W  +TCDS  HV SL+L+ L+LSG LS D+  LPFL +LS+A N+ SGP+P 
Sbjct  45   NSSTPFCSWFGLTCDSRRHVTSLNLTSLSLSGTLSDDLSHLPFLSHLSLADNKFSGPIPA  104

Query  182  EISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLH  361
              SA+S LRFLNLSNN+F +TFP QL +LANL+VLDLYNNN+TG+LP+ V  M  LRHLH
Sbjct  105  SFSALSALRFLNLSNNVFNATFPSQLNRLANLEVLDLYNNNMTGELPLSVAAMPLLRHLH  164

Query  362  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            LGGN+FSG+IPPEYG + +L+YLA+SGN L+G I  E+GNL+ L+ELYIGY+N +SGGIP
Sbjct  165  LGGNFFSGQIPPEYGTWQHLQYLALSGNELAGTIAPELGNLSSLRELYIGYYNTYSGGIP  224

Query  542  PEMGNLSQLIRXDAANCGLTGE  607
            PE+GNLS L+R DAA CGL+GE
Sbjct  225  PEIGNLSNLVRLDAAYCGLSGE  246


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 85/173 (49%), Gaps = 1/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L+P++G L  L ++ ++ N LSG VP   + +  L  LNL  N      P  + +L
Sbjct  267  LSGSLTPELGSLKSLKSMDLSNNMLSGEVPASFAELKNLTLLNLFRNKLHGAIPEFVGEL  326

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L+VL L+ NN TG +P  +     L  + L  N  +G +PP       L+ L   GN 
Sbjct  327  PALEVLQLWENNFTGSIPQNLGNNGRLTLVDLSSNKITGTLPPNMCYGNRLQTLITLGNY  386

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            L G IP  +G    L  + +G  N  +G IP  +  L +L + +  +  LTG+
Sbjct  387  LFGPIPDSLGKCKSLNRIRMGE-NFLNGSIPKGLFGLPKLTQVELQDNLLTGQ  438


 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 86/162 (53%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG +  ++G+L  L  L +  N LSG + PE+ ++ +L+ ++LSNN+     P   A+L
Sbjct  243  LSGEIPAELGKLQNLDTLFLQVNALSGSLTPELGSLKSLKSMDLSNNMLSGEVPASFAEL  302

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  V ++ +L  L L  N F+G IP   G    L  + +S N 
Sbjct  303  KNLTLLNLFRNKLHGAIPEFVGELPALEVLQLWENNFTGSIPQNLGNNGRLTLVDLSSNK  362

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            ++G +P  +    +L+ L I   N   G IP  +G    L R
Sbjct  363  ITGTLPPNMCYGNRLQTL-ITLGNYLFGPIPDSLGKCKSLNR  403


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 61/197 (31%), Positives = 95/197 (48%), Gaps = 25/197 (13%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L G +   VG+LP L  L +  N  +G +P  +     L  ++LS+N    T P  +  
Sbjct  314  KLHGAIPEFVGELPALEVLQLWENNFTGSIPQNLGNNGRLTLVDLSSNKITGTLPPNMCY  373

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP------PEY--------  403
               LQ L    N L G +P  + K  SL  + +G N+ +G IP      P+         
Sbjct  374  GNRLQTLITLGNYLFGPIPDSLGKCKSLNRIRMGENFLNGSIPKGLFGLPKLTQVELQDN  433

Query  404  ---GRFP-------NLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
               G+FP       +L  +++S N LSG +PS IGN T +++L +   N F+G IPP++G
Sbjct  434  LLTGQFPEDGSIATDLGQISLSNNQLSGSLPSTIGNFTSMQKLLLNG-NEFTGRIPPQIG  492

Query  554  NLSQLIRXDAANCGLTG  604
             L QL + D ++   +G
Sbjct  493  MLQQLSKIDFSHNKFSG  509


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 78/153 (51%), Gaps = 1/153 (1%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
            SG + P++G L  LV L  A   LSG +P E+  +  L  L L  N    +   +L  L 
Sbjct  220  SGGIPPEIGNLSNLVRLDAAYCGLSGEIPAELGKLQNLDTLFLQVNALSGSLTPELGSLK  279

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
            +L+ +DL NN L+G++P    ++ +L  L+L  N   G IP   G  P LE L +  N  
Sbjct  280  SLKSMDLSNNMLSGEVPASFAELKNLTLLNLFRNKLHGAIPEFVGELPALEVLQLWENNF  339

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            +G IP  +GN  +L  + +   N  +G +PP M
Sbjct  340  TGSIPQNLGNNGRLTLVDLSS-NKITGTLPPNM  371


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 83/174 (48%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             ++G L P++     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  362  KITGTLPPNMCYGNRLQTLITLGNYLFGPIPDSLGKCKSLNRIRMGENFLNGSIPKGLFG  421

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N LTG  P +    T L  + L  N  SG +P   G F +++ L ++GN
Sbjct  422  LPKLTQVELQDNLLTGQFPEDGSIATDLGQISLSNNQLSGSLPSTIGNFTSMQKLLLNGN  481

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              +G IP +IG L +L ++   + N FSG I PE+     L   D +   L+GE
Sbjct  482  EFTGRIPPQIGMLQQLSKIDFSH-NKFSGPIAPEISKCKLLTFIDLSGNELSGE  534


 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 49/164 (30%), Positives = 80/164 (49%), Gaps = 1/164 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G +   +  LP L  + +  N L+G  P + S  + L  ++LSNN    + P  +   
Sbjct  411  LNGSIPKGLFGLPKLTQVELQDNLLTGQFPEDGSIATDLGQISLSNNQLSGSLPSTIGNF  470

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             ++Q L L  N  TG +P ++  +  L  +    N FSG I PE  +   L ++ +SGN 
Sbjct  471  TSMQKLLLNGNEFTGRIPPQIGMLQQLSKIDFSHNKFSGPIAPEISKCKLLTFIDLSGNE  530

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXD  580
            LSG IP++I ++  L  L +   N   G IP  + ++  L   D
Sbjct  531  LSGEIPNKITSMRILNYLNLSR-NHLDGSIPGNIASMQSLTSVD  573


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 64/127 (50%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             LSG L   +G    +  L +  N+ +G +PP+I  +  L  ++ S+N F      ++++
Sbjct  458  QLSGSLPSTIGNFTSMQKLLLNGNEFTGRIPPQIGMLQQLSKIDFSHNKFSGPIAPEISK  517

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  +DL  N L+G++P ++  M  L +L+L  N+  G IP       +L  +  S N
Sbjct  518  CKLLTFIDLSGNELSGEIPNKITSMRILNYLNLSRNHLDGSIPGNIASMQSLTSVDFSYN  577

Query  446  GLSGVIP  466
              SG++P
Sbjct  578  NFSGLVP  584



>ref|XP_010939309.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=1020

 Score =   243 bits (621),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 152/198 (77%), Gaps = 1/198 (1%)
 Frame = +2

Query  14   SHCTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEIS  190
             HC W  V CD+ L  V       LNLSG L   VG L  L+NLS A N LSGP+PPE+S
Sbjct  66   DHCAWHGVACDATLRRVVSLDLSGLNLSGSLPTAVGHLRHLLNLSAATNFLSGPIPPELS  125

Query  191  AISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGG  370
             +S LR LNLSNN+F  +FP  L +L NL+VLDLYNNNLTG LPVEV ++++LRHLHLGG
Sbjct  126  FLSDLRHLNLSNNLFNGSFPSALRRLKNLEVLDLYNNNLTGLLPVEVAELSNLRHLHLGG  185

Query  371  NYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            N+FSG IPPEYGR+ ++EYLAVSGN L G IP EIGNL++L++LY+GYFN + GGIPPE+
Sbjct  186  NFFSGVIPPEYGRWDHIEYLAVSGNELVGAIPPEIGNLSRLRQLYVGYFNSYDGGIPPEI  245

Query  551  GNLSQLIRXDAANCGLTG  604
            GNLS L+R DAANCGL+G
Sbjct  246  GNLSALVRFDAANCGLSG  263


 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 92/174 (53%), Gaps = 2/174 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            L G + P++G L  L  L +   N   G +PPEI  +S L   + +N     + P +L +
Sbjct  212  LVGAIPPEIGNLSRLRQLYVGYFNSYDGGIPPEIGNLSALVRFDAANCGLSGSIPPELGR  271

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L NL  L L  N L G+LP E+ ++ SL+ L L  N  +G IPP +    NL  L +  N
Sbjct  272  LENLDTLFLQVNGLAGELPPELGRLRSLKSLDLSNNALTGEIPPSFADLWNLTLLNLFRN  331

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
             L G +P  IG+L +L+ L + + N F+G IP  +G   +L   D ++  LTG+
Sbjct  332  KLDGTVPDFIGDLPELEVLQL-WDNNFTGIIPRGIGRSGKLQLLDLSSNKLTGD  384


 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 86/162 (53%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P++G+L  L  L +  N L+G +PPE+  + +L+ L+LSNN      P   A L
Sbjct  261  LSGSIPPELGRLENLDTLFLQVNGLAGELPPELGRLRSLKSLDLSNNALTGEIPPSFADL  320

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   GR   L+ L +S N 
Sbjct  321  WNLTLLNLFRNKLDGTVPDFIGDLPELEVLQLWDNNFTGIIPRGIGRSGKLQLLDLSSNK  380

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P ++ +  KL  L I   N   G IP  +G    L R
Sbjct  381  LTGDLPLDLCSGNKLHTL-IALGNALFGPIPESLGRCFSLSR  421


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 72/247 (29%), Positives = 107/247 (43%), Gaps = 75/247 (30%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G L P++G+L  L +L ++ N L+G +PP  + +  L  LNL  N    T P  +  L
Sbjct  285  LAGELPPELGRLRSLKSLDLSNNALTGEIPPSFADLWNLTLLNLFRNKLDGTVPDFIGDL  344

Query  269  ANLQVLDLYNNN------------------------LTGDLPVEVY--------------  334
              L+VL L++NN                        LTGDLP+++               
Sbjct  345  PELEVLQLWDNNFTGIIPRGIGRSGKLQLLDLSSNKLTGDLPLDLCSGNKLHTLIALGNA  404

Query  335  ----------KMTSLRHLHLGGNYFSGRIP-----------------------PEYGRFP  415
                      +  SL  + LG NY +G IP                       P+ G  P
Sbjct  405  LFGPIPESLGRCFSLSRVRLGQNYLNGSIPSGLFCLPNLAQVELQDNLLAGGFPDTGDAP  464

Query  416  ---NLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAA  586
               +L  +++S N LSG +P  IGN + L++L +   N FSG IPPE+G L QL + D +
Sbjct  465  ISSSLGQISLSNNRLSGPLPLSIGNFSGLQKLLLSQ-NQFSGRIPPEIGRLQQLSKVDFS  523

Query  587  NCGLTGE  607
                +GE
Sbjct  524  GNRFSGE  530


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 78/153 (51%), Gaps = 1/153 (1%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
             G + P++G L  LV    A   LSG +PPE+  +  L  L L  N      P +L +L 
Sbjct  238  DGGIPPEIGNLSALVRFDAANCGLSGSIPPELGRLENLDTLFLQVNGLAGELPPELGRLR  297

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
            +L+ LDL NN LTG++P     + +L  L+L  N   G +P   G  P LE L +  N  
Sbjct  298  SLKSLDLSNNALTGEIPPSFADLWNLTLLNLFRNKLDGTVPDFIGDLPELEVLQLWDNNF  357

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            +G+IP  IG   KL+ L +   N  +G +P ++
Sbjct  358  TGIIPRGIGRSGKLQLLDLSS-NKLTGDLPLDL  389


 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 71/148 (48%), Gaps = 4/148 (3%)
 Frame = +2

Query  107  PDVGQLPF---LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  277
            PD G  P    L  +S++ N+LSGP+P  I   S L+ L LS N F    P ++ +L  L
Sbjct  458  PDTGDAPISSSLGQISLSNNRLSGPLPLSIGNFSGLQKLLLSQNQFSGRIPPEIGRLQQL  517

Query  278  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSG  457
              +D   N  +G++  E+ K   L  + L  N  SG IP E      L YL VS N L G
Sbjct  518  SKVDFSGNRFSGEIAPEISKCKLLTFVDLSRNNLSGEIPAEIAGIRILNYLNVSRNHLEG  577

Query  458  VIPSEIGNLTKLKELYIGYFNGFSGGIP  541
             IP  I  +  L  +   Y N  SG +P
Sbjct  578  SIPPSIATMQSLTAVDFSY-NNLSGLVP  604


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 68/127 (54%), Gaps = 0/127 (0%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L   +G    L  L ++ NQ SG +PPEI  +  L  ++ S N F      ++++ 
Sbjct  479  LSGPLPLSIGNFSGLQKLLLSQNQFSGRIPPEIGRLQQLSKVDFSGNRFSGEIAPEISKC  538

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  +DL  NNL+G++P E+  +  L +L++  N+  G IPP      +L  +  S N 
Sbjct  539  KLLTFVDLSRNNLSGEIPAEIAGIRILNYLNVSRNHLEGSIPPSIATMQSLTAVDFSYNN  598

Query  449  LSGVIPS  469
            LSG++PS
Sbjct  599  LSGLVPS  605


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 60/180 (33%), Positives = 82/180 (46%), Gaps = 11/180 (6%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L  D+     L  L    N L GP+P  +    +L  + L  N    + P  L  
Sbjct  380  KLTGDLPLDLCSGNKLHTLIALGNALFGPIPESLGRCFSLSRVRLGQNYLNGSIPSGLFC  439

Query  266  LANLQVLDLYNNNL------TGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEY  427
            L NL  ++L +N L      TGD P+     +SL  + L  N  SG +P   G F  L+ 
Sbjct  440  LPNLAQVELQDNLLAGGFPDTGDAPIS----SSLGQISLSNNRLSGPLPLSIGNFSGLQK  495

Query  428  LAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            L +S N  SG IP EIG L +L ++     N FSG I PE+     L   D +   L+GE
Sbjct  496  LLLSQNQFSGRIPPEIGRLQQLSKVDFSG-NRFSGEIAPEISKCKLLTFVDLSRNNLSGE  554



>ref|XP_010683073.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Beta vulgaris subsp. vulgaris]
Length=1009

 Score =   243 bits (621),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 127/208 (61%), Positives = 152/208 (73%), Gaps = 6/208 (3%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsgl------NLSGVLSPDVGQLPFLVNLSIAANQL  163
            N ST HCTW  + C S   +              NL+G+LSPD+G L  L NLS+A N  
Sbjct  47   NTSTHHCTWDFIKCSSSSSLNHHQSVVSLNISGLNLTGILSPDIGFLTNLQNLSVAGNSF  106

Query  164  SGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMT  343
            SGP+P  +S +S L  LNLSNNIF STFP  L+ L NLQ+LD+YNNNLTG LP+ V  M+
Sbjct  107  SGPIPSSLSLLSNLYHLNLSNNIFNSTFPSSLSPLQNLQILDVYNNNLTGPLPLSVVNMS  166

Query  344  SLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNG  523
             LRHLHLGGNYFSG IP EYG++  +EYLAVSGN L G IP+EIGNL+ LKELYIGY+NG
Sbjct  167  ELRHLHLGGNYFSGEIPAEYGQWRKIEYLAVSGNELEGNIPAEIGNLSSLKELYIGYYNG  226

Query  524  FSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            +SGGIPPE+GNLS+L+R D ANCGL+GE
Sbjct  227  YSGGIPPEIGNLSELVRFDGANCGLSGE  254


 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 78/155 (50%), Gaps = 2/155 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L G +   +G    L  + +  N L+G +P  +  +  L  + L +N+    FP  +  +
Sbjct  395  LLGPIPESLGSCKSLSRVRMGENFLNGSIPKGLFGLPKLTQVELQDNLLTGGFPVTVDSI  454

Query  269  A-NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            A NL  + L NN LTG+LP  +   + ++ L L GN FSG IPPE GR   L  +  S N
Sbjct  455  AVNLGQISLSNNQLTGELPSSIGNFSGVQKLLLDGNKFSGSIPPEIGRLQQLSKIDFSSN  514

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
              SG IPSEI     L  + +   N FSG IP E+
Sbjct  515  KFSGEIPSEISKCKLLTFVDLSR-NQFSGEIPKEI  548


 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 62/199 (31%), Positives = 96/199 (48%), Gaps = 26/199 (13%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L G +   +G LP L  L +  N  +G +P ++     L+ L+LS+N    T P  L +
Sbjct  322  KLHGGIPEFIGDLPQLEVLQLWENNFTGSIPEKLGFNGRLQLLDLSSNKLTGTLPPSLCK  381

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP------PEY--------  403
               L+ L    N L G +P  +    SL  + +G N+ +G IP      P+         
Sbjct  382  GERLETLITLGNFLLGPIPESLGSCKSLSRVRMGENFLNGSIPKGLFGLPKLTQVELQDN  441

Query  404  ---GRFP--------NLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
               G FP        NL  +++S N L+G +PS IGN + +++L +   N FSG IPPE+
Sbjct  442  LLTGGFPVTVDSIAVNLGQISLSNNQLTGELPSSIGNFSGVQKLLLDG-NKFSGSIPPEI  500

Query  551  GNLSQLIRXDAANCGLTGE  607
            G L QL + D ++   +GE
Sbjct  501  GRLQQLSKIDFSSNKFSGE  519


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 82/175 (47%), Gaps = 2/175 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P + +   L  L    N L GP+P  + +  +L  + +  N    + P  L  
Sbjct  370  KLTGTLPPSLCKGERLETLITLGNFLLGPIPESLGSCKSLSRVRMGENFLNGSIPKGLFG  429

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMT-SLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            L  L  ++L +N LTG  PV V  +  +L  + L  N  +G +P   G F  ++ L + G
Sbjct  430  LPKLTQVELQDNLLTGGFPVTVDSIAVNLGQISLSNNQLTGELPSSIGNFSGVQKLLLDG  489

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            N  SG IP EIG L +L ++     N FSG IP E+     L   D +    +GE
Sbjct  490  NKFSGSIPPEIGRLQQLSKIDFSS-NKFSGEIPSEISKCKLLTFVDLSRNQFSGE  543


 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 91/196 (46%), Gaps = 25/196 (13%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA--  262
            LSG +  ++G+L  L  L +  N LSG +P E   +S+L+ ++LSNN+F    P   +  
Sbjct  251  LSGEIPAELGKLKKLDTLFLQVNTLSGYLPSEFGYLSSLKSMDLSNNLFSGEIPESFSLL  310

Query  263  ----------------------QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNY  376
                                   L  L+VL L+ NN TG +P ++     L+ L L  N 
Sbjct  311  KNLTLLNLFRNKLHGGIPEFIGDLPQLEVLQLWENNFTGSIPEKLGFNGRLQLLDLSSNK  370

Query  377  FSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  556
             +G +PP   +   LE L   GN L G IP  +G+   L  + +G  N  +G IP  +  
Sbjct  371  LTGTLPPSLCKGERLETLITLGNFLLGPIPESLGSCKSLSRVRMGE-NFLNGSIPKGLFG  429

Query  557  LSQLIRXDAANCGLTG  604
            L +L + +  +  LTG
Sbjct  430  LPKLTQVELQDNLLTG  445


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 85/161 (53%), Gaps = 2/161 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  265
             SG +  + GQ   +  L+++ N+L G +P EI  +S+L+ L +   N +    P ++  
Sbjct  178  FSGEIPAEYGQWRKIEYLAVSGNELEGNIPAEIGNLSSLKELYIGYYNGYSGGIPPEIGN  237

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L+ L   D  N  L+G++P E+ K+  L  L L  N  SG +P E+G   +L+ + +S N
Sbjct  238  LSELVRFDGANCGLSGEIPAELGKLKKLDTLFLQVNTLSGYLPSEFGYLSSLKSMDLSNN  297

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQL  568
              SG IP E  +L K   L   + N   GGIP  +G+L QL
Sbjct  298  LFSGEIP-ESFSLLKNLTLLNLFRNKLHGGIPEFIGDLPQL  337


 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 53/144 (37%), Positives = 75/144 (52%), Gaps = 2/144 (1%)
 Frame = +2

Query  131  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  310
            L  +S++ NQL+G +P  I   S ++ L L  N F  + P ++ +L  L  +D  +N  +
Sbjct  458  LGQISLSNNQLTGELPSSIGNFSGVQKLLLDGNKFSGSIPPEIGRLQQLSKIDFSSNKFS  517

Query  311  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTK  490
            G++P E+ K   L  + L  N FSG IP E      L YL +S N LSG IP  I ++  
Sbjct  518  GEIPSEISKCKLLTFVDLSRNQFSGEIPKEITGMRILNYLNISRNHLSGSIPGSISSMQS  577

Query  491  LKELYIGYFNGFSGGIPPEMGNLS  562
            L  +   Y N FSG I PE G  S
Sbjct  578  LTSVDFSY-NNFSGLI-PESGQFS  599


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 64/120 (53%), Gaps = 1/120 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
              SG + P++G+L  L  +  ++N+ SG +P EIS    L F++LS N F    P ++  
Sbjct  491  KFSGSIPPEIGRLQQLSKIDFSSNKFSGEIPSEISKCKLLTFVDLSRNQFSGEIPKEITG  550

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            +  L  L++  N+L+G +P  +  M SL  +    N FSG I PE G+F    Y +  GN
Sbjct  551  MRILNYLNISRNHLSGSIPGSISSMQSLTSVDFSYNNFSGLI-PESGQFSYFNYTSFLGN  609



>ref|NP_001237688.1| receptor-like protein kinase precursor [Glycine max]
 gb|ACM89563.1| receptor-like protein kinase [Glycine max]
Length=1010

 Score =   243 bits (620),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 157/202 (78%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPP  181
            N ST  C+W  VTCDS  HV  L+L+ L+LS  L   +  LPFL +LS+A NQ SGP+P 
Sbjct  45   NSSTPFCSWFGVTCDSRRHVTGLNLTSLSLSATLYDHLSHLPFLSHLSLADNQFSGPIPV  104

Query  182  EISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLH  361
              SA+S LRFLNLSNN+F  TFP QLA+L+NL+VLDLYNNN+TG LP+ V  M  LRHLH
Sbjct  105  SFSALSALRFLNLSNNVFNQTFPSQLARLSNLEVLDLYNNNMTGPLPLAVASMPLLRHLH  164

Query  362  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            LGGN+FSG+IPPEYG + +L YLA+SGN L+G I  E+GNL+ L+ELYIGY+N +SGGIP
Sbjct  165  LGGNFFSGQIPPEYGTWQHLRYLALSGNELAGYIAPELGNLSALRELYIGYYNTYSGGIP  224

Query  542  PEMGNLSQLIRXDAANCGLTGE  607
            PE+GNLS L+R DAA CGL+GE
Sbjct  225  PEIGNLSNLVRLDAAYCGLSGE  246


 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 93/197 (47%), Gaps = 25/197 (13%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L G +   VG+LP L  L +  N  +G +P  +     L  ++LS+N    T P  +  
Sbjct  314  KLHGAIPEFVGELPALEVLQLWENNFTGSIPQSLGKNGRLTLVDLSSNKITGTLPPYMCY  373

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP-----------------  394
               LQ L    N L G +P  + K  SL  + +G N+ +G IP                 
Sbjct  374  GNRLQTLITLGNYLFGPIPDSLGKCESLNRIRMGENFLNGSIPKGLFGLPKLTQVELQDN  433

Query  395  ------PEYGRFP-NLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
                  PEYG    +L  +++S N LSG +PS IGN T +++L +   N FSG IPP++G
Sbjct  434  LLTGQFPEYGSIATDLGQISLSNNKLSGPLPSTIGNFTSMQKLLLD-GNEFSGRIPPQIG  492

Query  554  NLSQLIRXDAANCGLTG  604
             L QL + D ++   +G
Sbjct  493  RLQQLSKIDFSHNKFSG  509


 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 86/174 (49%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            +LSG L+ ++G L  L ++ ++ N LSG VP   + +  L  LNL  N      P  + +
Sbjct  266  SLSGSLTSELGNLKSLKSMDLSNNMLSGEVPASFAELKNLTLLNLFRNKLHGAIPEFVGE  325

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L+VL L+ NN TG +P  + K   L  + L  N  +G +PP       L+ L   GN
Sbjct  326  LPALEVLQLWENNFTGSIPQSLGKNGRLTLVDLSSNKITGTLPPYMCYGNRLQTLITLGN  385

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
             L G IP  +G    L  + +G  N  +G IP  +  L +L + +  +  LTG+
Sbjct  386  YLFGPIPDSLGKCESLNRIRMGE-NFLNGSIPKGLFGLPKLTQVELQDNLLTGQ  438


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 53/162 (33%), Positives = 85/162 (52%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG +  ++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN+     P   A+L
Sbjct  243  LSGEIPAELGKLQNLDTLFLQVNSLSGSLTSELGNLKSLKSMDLSNNMLSGEVPASFAEL  302

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  V ++ +L  L L  N F+G IP   G+   L  + +S N 
Sbjct  303  KNLTLLNLFRNKLHGAIPEFVGELPALEVLQLWENNFTGSIPQSLGKNGRLTLVDLSSNK  362

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            ++G +P  +    +L+ L I   N   G IP  +G    L R
Sbjct  363  ITGTLPPYMCYGNRLQTL-ITLGNYLFGPIPDSLGKCESLNR  403


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 77/153 (50%), Gaps = 1/153 (1%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
            SG + P++G L  LV L  A   LSG +P E+  +  L  L L  N    +   +L  L 
Sbjct  220  SGGIPPEIGNLSNLVRLDAAYCGLSGEIPAELGKLQNLDTLFLQVNSLSGSLTSELGNLK  279

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
            +L+ +DL NN L+G++P    ++ +L  L+L  N   G IP   G  P LE L +  N  
Sbjct  280  SLKSMDLSNNMLSGEVPASFAELKNLTLLNLFRNKLHGAIPEFVGELPALEVLQLWENNF  339

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            +G IP  +G   +L  + +   N  +G +PP M
Sbjct  340  TGSIPQSLGKNGRLTLVDLSS-NKITGTLPPYM  371


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 80/174 (46%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             ++G L P +     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  362  KITGTLPPYMCYGNRLQTLITLGNYLFGPIPDSLGKCESLNRIRMGENFLNGSIPKGLFG  421

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N LTG  P      T L  + L  N  SG +P   G F +++ L + GN
Sbjct  422  LPKLTQVELQDNLLTGQFPEYGSIATDLGQISLSNNKLSGPLPSTIGNFTSMQKLLLDGN  481

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              SG IP +IG L +L ++   + N FSG I PE+     L   D +   L+GE
Sbjct  482  EFSGRIPPQIGRLQQLSKIDFSH-NKFSGPIAPEISRCKLLTFIDLSGNELSGE  534


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 51/160 (32%), Positives = 78/160 (49%), Gaps = 1/160 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N+    FP   +  
Sbjct  387  LFGPIPDSLGKCESLNRIRMGENFLNGSIPKGLFGLPKLTQVELQDNLLTGQFPEYGSIA  446

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             +L  + L NN L+G LP  +   TS++ L L GN FSGRIPP+ GR   L  +  S N 
Sbjct  447  TDLGQISLSNNKLSGPLPSTIGNFTSMQKLLLDGNEFSGRIPPQIGRLQQLSKIDFSHNK  506

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQL  568
             SG I  EI     L  + +   N  SG IP ++ ++  L
Sbjct  507  FSGPIAPEISRCKLLTFIDLS-GNELSGEIPNQITSMRIL  545


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 64/127 (50%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             LSG L   +G    +  L +  N+ SG +PP+I  +  L  ++ S+N F      ++++
Sbjct  458  KLSGPLPSTIGNFTSMQKLLLDGNEFSGRIPPQIGRLQQLSKIDFSHNKFSGPIAPEISR  517

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  +DL  N L+G++P ++  M  L +L+L  N+  G IP       +L  +  S N
Sbjct  518  CKLLTFIDLSGNELSGEIPNQITSMRILNYLNLSRNHLDGSIPGSIASMQSLTSVDFSYN  577

Query  446  GLSGVIP  466
              SG++P
Sbjct  578  NFSGLVP  584



>ref|XP_009397330.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1023

 Score =   241 bits (614),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 156/202 (77%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPP  181
            + +T HC+W  VTCD    VVSLDLSG NLSG+L P VG+L  L+ LS AAN  SGP+P 
Sbjct  52   DATTDHCSWPGVTCDDAGAVVSLDLSGRNLSGLLPPAVGRLRSLLRLSAAANSFSGPIPS  111

Query  182  EISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLH  361
            E++ +  LR LNLSNNIF  +FP  LA+LA+L+VLDLYNNNLTG LP E+  +  LRH+H
Sbjct  112  ELALLPALRHLNLSNNIFNGSFPAPLARLADLRVLDLYNNNLTGPLPRELAALPQLRHIH  171

Query  362  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            LGGN+FSG IPPEYG +  LEYLA+SGN L G IP EIGNL+ L+ELYIGY+N + GG+P
Sbjct  172  LGGNFFSGSIPPEYGSWQFLEYLAISGNELGGPIPPEIGNLSALRELYIGYYNSYDGGLP  231

Query  542  PEMGNLSQLIRXDAANCGLTGE  607
            PE+GNLS L+R DAANCGL+G 
Sbjct  232  PEIGNLSTLLRLDAANCGLSGR  253


 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 91/173 (53%), Gaps = 2/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            L G + P++G L  L  L I   N   G +PPEI  +STL  L+ +N       P ++  
Sbjct  201  LGGPIPPEIGNLSALRELYIGYYNSYDGGLPPEIGNLSTLLRLDAANCGLSGRIPPEMGN  260

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L NL  L L  N L G++P E+ ++ SL+ + L  N  +G IPP +    NL  L +  N
Sbjct  261  LRNLDTLFLQVNGLGGEIPPELSRLRSLKSMDLSNNALTGEIPPSFAALSNLTLLNLFRN  320

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             L G IP  +G+L +L+ L + + N F+G IP  +G   +L   D ++  LTG
Sbjct  321  KLFGAIPEFVGDLPELEVLQV-WENNFTGSIPRRLGTNGRLQLLDLSSNKLTG  372


 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 60/172 (35%), Positives = 88/172 (51%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P++G L  L  L +  N L G +PPE+S + +L+ ++LSNN      P   A L
Sbjct  250  LSGRIPPEMGNLRNLDTLFLQVNGLGGEIPPELSRLRSLKSMDLSNNALTGEIPPSFAAL  309

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
            +NL +L+L+ N L G +P  V  +  L  L +  N F+G IP   G    L+ L +S N 
Sbjct  310  SNLTLLNLFRNKLFGAIPEFVGDLPELEVLQVWENNFTGSIPRRLGTNGRLQLLDLSSNK  369

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            L+G +P ++    KL+ L I   N   G IP  +G    L R    +  L G
Sbjct  370  LTGSLPPDLCYGNKLQTL-IALGNFLFGQIPESLGRCESLSRIRMGDNYLNG  420


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 82/153 (54%), Gaps = 1/153 (1%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
             G L P++G L  L+ L  A   LSG +PPE+  +  L  L L  N  G   P +L++L 
Sbjct  227  DGGLPPEIGNLSTLLRLDAANCGLSGRIPPEMGNLRNLDTLFLQVNGLGGEIPPELSRLR  286

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
            +L+ +DL NN LTG++P     +++L  L+L  N   G IP   G  P LE L V  N  
Sbjct  287  SLKSMDLSNNALTGEIPPSFAALSNLTLLNLFRNKLFGAIPEFVGDLPELEVLQVWENNF  346

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            +G IP  +G   +L+ L +   N  +G +PP++
Sbjct  347  TGSIPRRLGTNGRLQLLDLSS-NKLTGSLPPDL  378


 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 61/199 (31%), Positives = 91/199 (46%), Gaps = 27/199 (14%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L G +   VG LP L  L +  N  +G +P  +     L+ L+LS+N    + P  L  
Sbjct  321  KLFGAIPEFVGDLPELEVLQVWENNFTGSIPRRLGTNGRLQLLDLSSNKLTGSLPPDLCY  380

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP-----------------  394
               LQ L    N L G +P  + +  SL  + +G NY +G IP                 
Sbjct  381  GNKLQTLIALGNFLFGQIPESLGRCESLSRIRMGDNYLNGTIPQGLLSLPNLSQVELQDN  440

Query  395  ------PEYGRF---PNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPE  547
                  P+ G     PNL  + +S N L+G +P  IGN + L++L +   N F+G IPPE
Sbjct  441  YLTGGFPDTGSSSISPNLGQVCLSNNRLAGPLPPSIGNYSGLQKLLLNQ-NSFTGKIPPE  499

Query  548  MGNLSQLIRXDAANCGLTG  604
            +G L QL + D ++   +G
Sbjct  500  VGRLQQLSKLDLSSNRFSG  518


 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 67/127 (53%), Gaps = 0/127 (0%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G L P +G    L  L +  N  +G +PPE+  +  L  L+LS+N F      ++++ 
Sbjct  468  LAGPLPPSIGNYSGLQKLLLNQNSFTGKIPPEVGRLQQLSKLDLSSNRFSGPITPEVSKC  527

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  +DL  N L+GD+P +V  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  528  KLLTFVDLSRNELSGDVPADVAAMRILNYLNLSRNHLEGPIPVAISTMQSLTAVDFSYNN  587

Query  449  LSGVIPS  469
            LSGV+PS
Sbjct  588  LSGVVPS  594


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 75/150 (50%), Gaps = 7/150 (5%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
            S  +SP++GQ+       ++ N+L+GP+PP I   S L+ L L+ N F    P ++ +L 
Sbjct  451  SSSISPNLGQV------CLSNNRLAGPLPPSIGNYSGLQKLLLNQNSFTGKIPPEVGRLQ  504

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
             L  LDL +N  +G +  EV K   L  + L  N  SG +P +      L YL +S N L
Sbjct  505  QLSKLDLSSNRFSGPITPEVSKCKLLTFVDLSRNELSGDVPADVAAMRILNYLNLSRNHL  564

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
             G IP  I  +  L  +   Y N  SG +P
Sbjct  565  EGPIPVAISTMQSLTAVDFSY-NNLSGVVP  593


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 82/176 (47%), Gaps = 3/176 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L PD+     L  L    N L G +P  +    +L  + + +N    T P  L  
Sbjct  369  KLTGSLPPDLCYGNKLQTLIALGNFLFGQIPESLGRCESLSRIRMGDNYLNGTIPQGLLS  428

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTS--LRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  439
            L NL  ++L +N LTG  P       S  L  + L  N  +G +PP  G +  L+ L ++
Sbjct  429  LPNLSQVELQDNYLTGGFPDTGSSSISPNLGQVCLSNNRLAGPLPPSIGNYSGLQKLLLN  488

Query  440  GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
             N  +G IP E+G L +L +L +   N FSG I PE+     L   D +   L+G+
Sbjct  489  QNSFTGKIPPEVGRLQQLSKLDLSS-NRFSGPITPEVSKCKLLTFVDLSRNELSGD  543


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 63/120 (53%), Gaps = 1/120 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            + +G + P+VG+L  L  L +++N+ SGP+ PE+S    L F++LS N      P  +A 
Sbjct  491  SFTGKIPPEVGRLQQLSKLDLSSNRFSGPITPEVSKCKLLTFVDLSRNELSGDVPADVAA  550

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            +  L  L+L  N+L G +PV +  M SL  +    N  SG + P  G+F      +  GN
Sbjct  551  MRILNYLNLSRNHLEGPIPVAISTMQSLTAVDFSYNNLSGVV-PSTGQFSYFNATSFVGN  609



>ref|XP_008790445.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Phoenix dactylifera]
Length=1019

 Score =   240 bits (612),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 130/200 (65%), Positives = 154/200 (77%), Gaps = 2/200 (1%)
 Frame = +2

Query  14   SHCTWRRVTCdsl--lhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEI  187
             HC+W  V CD+     V+SLDL+GLNLSG L P V  L  L+NLS AAN LSGP+PPE+
Sbjct  64   DHCSWPGVACDNAPLRRVISLDLTGLNLSGSLPPAVAHLRHLLNLSAAANLLSGPIPPEL  123

Query  188  SAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLG  367
            S +  LR LNLSNN+F  +FP  L +L +L+VLDLYNNNLTG LP E   + +LRHLHLG
Sbjct  124  SLLFDLRHLNLSNNVFNGSFPSALRRLKHLEVLDLYNNNLTGVLPAEAADLPNLRHLHLG  183

Query  368  GNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPE  547
            GN+FSG IPPEYGR+ +LEYLAVSGN L G IP EIGNLT+L++LYIGYFN + GGIPPE
Sbjct  184  GNFFSGVIPPEYGRWEHLEYLAVSGNELGGAIPPEIGNLTRLRQLYIGYFNSYDGGIPPE  243

Query  548  MGNLSQLIRXDAANCGLTGE  607
             G LS L+R DAANCGL+GE
Sbjct  244  FGKLSALVRFDAANCGLSGE  263


 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 89/162 (55%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P++G+L  L  L +  N LSG +PPE+  + +L+ ++LSNN F    P   A L
Sbjct  260  LSGEIPPELGRLENLDTLFLQVNGLSGELPPELGRLRSLKSMDLSNNAFTGEIPPTFADL  319

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   GR   L+ L +S N 
Sbjct  320  RNLTLLNLFRNKLYGTIPDFIGDLPELEVLQLWDNNFTGIIPRGIGRSGKLQLLDLSSNK  379

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P E+ +  KL+ L I   N   G IP  +G  S L R
Sbjct  380  LTGDLPPELCSGNKLQTL-IALGNALFGPIPESLGQCSSLSR  420


 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 92/174 (53%), Gaps = 2/174 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            L G + P++G L  L  L I   N   G +PPE   +S L   + +N       P +L +
Sbjct  211  LGGAIPPEIGNLTRLRQLYIGYFNSYDGGIPPEFGKLSALVRFDAANCGLSGEIPPELGR  270

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L NL  L L  N L+G+LP E+ ++ SL+ + L  N F+G IPP +    NL  L +  N
Sbjct  271  LENLDTLFLQVNGLSGELPPELGRLRSLKSMDLSNNAFTGEIPPTFADLRNLTLLNLFRN  330

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
             L G IP  IG+L +L+ L + + N F+G IP  +G   +L   D ++  LTG+
Sbjct  331  KLYGTIPDFIGDLPELEVLQL-WDNNFTGIIPRGIGRSGKLQLLDLSSNKLTGD  383


 Score = 89.7 bits (221),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 57/173 (33%), Positives = 90/173 (52%), Gaps = 1/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L P++G+L  L ++ ++ N  +G +PP  + +  L  LNL  N    T P  +  L
Sbjct  284  LSGELPPELGRLRSLKSMDLSNNAFTGEIPPTFADLRNLTLLNLFRNKLYGTIPDFIGDL  343

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L+VL L++NN TG +P  + +   L+ L L  N  +G +PPE      L+ L   GN 
Sbjct  344  PELEVLQLWDNNFTGIIPRGIGRSGKLQLLDLSSNKLTGDLPPELCSGNKLQTLIALGNA  403

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            L G IP  +G  + L  + +G  N  +G IP  + +L +L + +  +  L GE
Sbjct  404  LFGPIPESLGQCSSLSRVRLGE-NYLNGSIPSGLLSLPKLAQVELQDNLLAGE  455


 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 78/153 (51%), Gaps = 1/153 (1%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
             G + P+ G+L  LV    A   LSG +PPE+  +  L  L L  N      P +L +L 
Sbjct  237  DGGIPPEFGKLSALVRFDAANCGLSGEIPPELGRLENLDTLFLQVNGLSGELPPELGRLR  296

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
            +L+ +DL NN  TG++P     + +L  L+L  N   G IP   G  P LE L +  N  
Sbjct  297  SLKSMDLSNNAFTGEIPPTFADLRNLTLLNLFRNKLYGTIPDFIGDLPELEVLQLWDNNF  356

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            +G+IP  IG   KL+ L +   N  +G +PPE+
Sbjct  357  TGIIPRGIGRSGKLQLLDLSS-NKLTGDLPPEL  388


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 83/176 (47%), Gaps = 3/176 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P++     L  L    N L GP+P  +   S+L  + L  N    + P  L  
Sbjct  379  KLTGDLPPELCSGNKLQTLIALGNALFGPIPESLGQCSSLSRVRLGENYLNGSIPSGLLS  438

Query  266  LANLQVLDLYNNNLTGDLPV--EVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  439
            L  L  ++L +N L G+ P         SL  + L  N  SG +PP  G F  ++ L ++
Sbjct  439  LPKLAQVELQDNLLAGEFPDTGNASISPSLGQISLSNNRLSGPLPPCIGNFSGVQKLLLN  498

Query  440  GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
             N  SG IP+EIG L +L ++     N FSGGIPPEM     L   D     L+GE
Sbjct  499  QNQFSGRIPTEIGRLQQLSKVDFSS-NSFSGGIPPEMSKCKLLTFVDLGRNNLSGE  553


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 75/148 (51%), Gaps = 4/148 (3%)
 Frame = +2

Query  107  PDVGQL---PFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  277
            PD G     P L  +S++ N+LSGP+PP I   S ++ L L+ N F    P ++ +L  L
Sbjct  457  PDTGNASISPSLGQISLSNNRLSGPLPPCIGNFSGVQKLLLNQNQFSGRIPTEIGRLQQL  516

Query  278  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSG  457
              +D  +N+ +G +P E+ K   L  + LG N  SG IP E      L YL +S N L G
Sbjct  517  SKVDFSSNSFSGGIPPEMSKCKLLTFVDLGRNNLSGEIPGEIAGMRILNYLNLSRNHLEG  576

Query  458  VIPSEIGNLTKLKELYIGYFNGFSGGIP  541
             IP  I  +  L  +   Y N  SG +P
Sbjct  577  SIPPSIATMQSLTAVDFSY-NNLSGLVP  603


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 68/126 (54%), Gaps = 0/126 (0%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L P +G    +  L +  NQ SG +P EI  +  L  ++ S+N F    P ++++ 
Sbjct  478  LSGPLPPCIGNFSGVQKLLLNQNQFSGRIPTEIGRLQQLSKVDFSSNSFSGGIPPEMSKC  537

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  +DL  NNL+G++P E+  M  L +L+L  N+  G IPP      +L  +  S N 
Sbjct  538  KLLTFVDLGRNNLSGEIPGEIAGMRILNYLNLSRNHLEGSIPPSIATMQSLTAVDFSYNN  597

Query  449  LSGVIP  466
            LSG++P
Sbjct  598  LSGLVP  603


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            + SG + P++ +   L  + +  N LSG +P EI+ +  L +LNLS N    + P  +A 
Sbjct  525  SFSGGIPPEMSKCKLLTFVDLGRNNLSGEIPGEIAGMRILNYLNLSRNHLEGSIPPSIAT  584

Query  266  LANLQVLDLYNNNLTGDLP  322
            + +L  +D   NNL+G +P
Sbjct  585  MQSLTAVDFSYNNLSGLVP  603



>ref|XP_008787359.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1, partial [Phoenix 
dactylifera]
Length=1004

 Score =   237 bits (605),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 126/203 (62%), Positives = 156/203 (77%), Gaps = 1/203 (0%)
 Frame = +2

Query  2    NISTSHC-TWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVP  178
            + +  HC  W  V CD+   VVSL++S LNLSG L   V +L  L++LS AAN+LSGP+P
Sbjct  51   DATADHCQAWSGVACDAAGRVVSLNISXLNLSGPLPRAVSRLRSLLHLSAAANELSGPIP  110

Query  179  PEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHL  358
            PE+S +S LRFLNLSNN F  T P  L++L NL VLDLYNNNLTG LPV+V  + +LRHL
Sbjct  111  PELSLLSGLRFLNLSNNAFNRTLPSALSRLKNLHVLDLYNNNLTGVLPVQVADLPALRHL  170

Query  359  HLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGI  538
            HLGGN+FSG IPPEYGR+ +LEYLA+SGN L G IP E+GN+T L+ELYIGYFN F GG+
Sbjct  171  HLGGNFFSGAIPPEYGRWEHLEYLAISGNELGGPIPPELGNVTTLRELYIGYFNSFQGGL  230

Query  539  PPEMGNLSQLIRXDAANCGLTGE  607
            P  +GN++ L+R DAANCGL+GE
Sbjct  231  PAAIGNITALVRLDAANCGLSGE  253


 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 84/162 (52%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P++G L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P   A+L
Sbjct  250  LSGEIPPEIGNLQNLDTLFLQVNGLSGEITPELGKLRSLKSMDLSNNVLTGEIPRTFAEL  309

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   G    L+ L +S N 
Sbjct  310  KNLTLLNLFRNKLHGAIPDLIGDLPRLEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNK  369

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P  + +  +L+ L I   N   G IP   G    L R
Sbjct  370  LTGSLPPNLCSGDQLQVL-IALGNFLFGSIPESFGRCKSLSR  410


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/172 (31%), Positives = 85/172 (49%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG ++P++G+L  L ++ ++ N L+G +P   + +  L  LNL  N      P  +  L
Sbjct  274  LSGEITPELGKLRSLKSMDLSNNVLTGEIPRTFAELKNLTLLNLFRNKLHGAIPDLIGDL  333

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L+VL L+ NN TG++P  +     L+ L L  N  +G +PP       L+ L   GN 
Sbjct  334  PRLEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNKLTGSLPPNLCSGDQLQVLIALGNF  393

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            L G IP   G    L  + +G  N  +G +P  +  L +L + +  +  LTG
Sbjct  394  LFGSIPESFGRCKSLSRIRMGE-NYLNGSVPSGLFGLPKLAQVELQDNLLTG  444


 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 68/127 (54%), Gaps = 0/127 (0%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L P +G+   +  L +  NQ SG +PPEI  +  L  ++ S N F      ++++ 
Sbjct  468  LSGALPPSIGKFSGVQKLLLNQNQFSGRIPPEIGRLQQLSKMDFSGNRFSGPITPEISKC  527

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  +DL  NN +G++P E+  M  L +L+L  N+  G+IP       +L  +  S N 
Sbjct  528  KLLTFVDLSRNNFSGEIPAEITGMRILNYLNLSRNHLEGKIPASISTMQSLTAVDFSYNN  587

Query  449  LSGVIPS  469
            LSG++PS
Sbjct  588  LSGLVPS  594


 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 57/191 (30%), Positives = 85/191 (45%), Gaps = 27/191 (14%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L G +   +G LP L  L +  N  +G +P  +     L+ L+LS+N    + P  L  
Sbjct  321  KLHGAIPDLIGDLPRLEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNKLTGSLPPNLCS  380

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP------PEYGRF-----  412
               LQVL    N L G +P    +  SL  + +G NY +G +P      P+  +      
Sbjct  381  GDQLQVLIALGNFLFGSIPESFGRCKSLSRIRMGENYLNGSVPSGLFGLPKLAQVELQDN  440

Query  413  ---------------PNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPE  547
                           P L  + +S N LSG +P  IG  + +++L +   N FSG IPPE
Sbjct  441  LLTGGFPETAGSRISPTLGQIILSNNRLSGALPPSIGKFSGVQKLLLNQ-NQFSGRIPPE  499

Query  548  MGNLSQLIRXD  580
            +G L QL + D
Sbjct  500  IGRLQQLSKMD  510


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 80/161 (50%), Gaps = 1/161 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            +  G L   +G +  LV L  A   LSG +PPEI  +  L  L L  N        +L +
Sbjct  225  SFQGGLPAAIGNITALVRLDAANCGLSGEIPPEIGNLQNLDTLFLQVNGLSGEITPELGK  284

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L +L+ +DL NN LTG++P    ++ +L  L+L  N   G IP   G  P LE L +  N
Sbjct  285  LRSLKSMDLSNNVLTGEIPRTFAELKNLTLLNLFRNKLHGAIPDLIGDLPRLEVLQLWEN  344

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQL  568
              +G IP  +G   +L+ L +   N  +G +PP + +  QL
Sbjct  345  NFTGEIPRRLGTNGRLQLLDLSS-NKLTGSLPPNLCSGDQL  384


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 72/147 (49%), Gaps = 7/147 (5%)
 Frame = +2

Query  101  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  280
            +SP +GQ+       ++ N+LSG +PP I   S ++ L L+ N F    P ++ +L  L 
Sbjct  454  ISPTLGQI------ILSNNRLSGALPPSIGKFSGVQKLLLNQNQFSGRIPPEIGRLQQLS  507

Query  281  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  460
             +D   N  +G +  E+ K   L  + L  N FSG IP E      L YL +S N L G 
Sbjct  508  KMDFSGNRFSGPITPEISKCKLLTFVDLSRNNFSGEIPAEITGMRILNYLNLSRNHLEGK  567

Query  461  IPSEIGNLTKLKELYIGYFNGFSGGIP  541
            IP+ I  +  L  +   Y N  SG +P
Sbjct  568  IPASISTMQSLTAVDFSY-NNLSGLVP  593


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 81/179 (45%), Gaps = 9/179 (5%)
 Frame = +2

Query  86   NLSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  256
             L+G L P++    QL  L+ L    N L G +P       +L  + +  N    + P  
Sbjct  369  KLTGSLPPNLCSGDQLQVLIAL---GNFLFGSIPESFGRCKSLSRIRMGENYLNGSVPSG  425

Query  257  LAQLANLQVLDLYNNNLTGDLPVEVYKMTS--LRHLHLGGNYFSGRIPPEYGRFPNLEYL  430
            L  L  L  ++L +N LTG  P       S  L  + L  N  SG +PP  G+F  ++ L
Sbjct  426  LFGLPKLAQVELQDNLLTGGFPETAGSRISPTLGQIILSNNRLSGALPPSIGKFSGVQKL  485

Query  431  AVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
             ++ N  SG IP EIG L +L ++     N FSG I PE+     L   D +    +GE
Sbjct  486  LLNQNQFSGRIPPEIGRLQQLSKMDFSG-NRFSGPITPEISKCKLLTFVDLSRNNFSGE  543



>gb|AES94465.2| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1014

 Score =   237 bits (605),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 165/202 (82%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPP  181
            N +T+HCTW  VTC++  HV +++L+GL+LSG LS ++  LPFL NLS+A N+ SG +PP
Sbjct  50   NTNTTHCTWFGVTCNTRRHVTAVNLTGLDLSGTLSDELSHLPFLTNLSLADNKFSGQIPP  109

Query  182  EISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLH  361
             +SA++ LR LNLSNN+F  TFP +L+ L NL+VLDLYNNN+TG LP+ V ++ +LRHLH
Sbjct  110  SLSAVTNLRLLNLSNNVFNGTFPSELSLLKNLEVLDLYNNNMTGTLPLAVTELPNLRHLH  169

Query  362  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            LGGNY +G+IPPEYG + +L+YLAVSGN L G IP EIGNLT L+ELYIGYFN ++GGIP
Sbjct  170  LGGNYLTGQIPPEYGSWQHLQYLAVSGNELDGTIPPEIGNLTSLRELYIGYFNEYTGGIP  229

Query  542  PEMGNLSQLIRXDAANCGLTGE  607
            P++GNL++LIR DAA CGL+GE
Sbjct  230  PQIGNLTELIRLDAAYCGLSGE  251


 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 57/173 (33%), Positives = 90/173 (52%), Gaps = 2/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            L G + P++G L  L  L I   N+ +G +PP+I  ++ L  L+ +        PH++ +
Sbjct  199  LDGTIPPEIGNLTSLRELYIGYFNEYTGGIPPQIGNLTELIRLDAAYCGLSGEIPHEIGK  258

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L NL  L L  N L+G L  E+  + SL+ + L  N  +G IP  +G   NL  L +  N
Sbjct  259  LQNLDTLFLQVNALSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSFGELKNLTLLNLFRN  318

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             L G IP  IG++  L+ + + + N F+G IP  +G   +L   D ++  LTG
Sbjct  319  KLHGAIPEFIGDMPALEVIQL-WENNFTGNIPMSLGTNGKLSLLDISSNKLTG  370


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 81/173 (47%), Gaps = 1/173 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P +     L  L    N L GP+P  +    +L  + +  N F  + P  L  
Sbjct  367  KLTGTLPPYLCSGNMLQTLITLGNFLFGPIPESLGGCESLTRIRMGENFFNGSIPKGLFG  426

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N L+G+ P       +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  427  LPKLSQVELQDNYLSGNFPETHSVSVNLGQITLSNNQLSGPLPPSIGNFSGVQKLLLDGN  486

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
               G IPS+IG L +L ++   + N FSG I PE+     L   D +   L+G
Sbjct  487  MFEGKIPSQIGRLQQLSKIDFSH-NRFSGPIAPEISKCKLLTFVDLSRNELSG  538


 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 53/162 (33%), Positives = 82/162 (51%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG +  ++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN+     P    +L
Sbjct  248  LSGEIPHEIGKLQNLDTLFLQVNALSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSFGEL  307

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  +  M +L  + L  N F+G IP   G    L  L +S N 
Sbjct  308  KNLTLLNLFRNKLHGAIPEFIGDMPALEVIQLWENNFTGNIPMSLGTNGKLSLLDISSNK  367

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P  + +   L+ L I   N   G IP  +G    L R
Sbjct  368  LTGTLPPYLCSGNMLQTL-ITLGNFLFGPIPESLGGCESLTR  408


 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 55/162 (34%), Positives = 81/162 (50%), Gaps = 3/162 (2%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
            +G + P +G L  L+ L  A   LSG +P EI  +  L  L L  N    +   +L  L 
Sbjct  225  TGGIPPQIGNLTELIRLDAAYCGLSGEIPHEIGKLQNLDTLFLQVNALSGSLTWELGNLK  284

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
            +L+ +DL NN LTG++P    ++ +L  L+L  N   G IP   G  P LE + +  N  
Sbjct  285  SLKSMDLSNNMLTGEIPTSFGELKNLTLLNLFRNKLHGAIPEFIGDMPALEVIQLWENNF  344

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM--GNLSQLI  571
            +G IP  +G   KL  L I   N  +G +PP +  GN+ Q +
Sbjct  345  TGNIPMSLGTNGKLSLLDISS-NKLTGTLPPYLCSGNMLQTL  385


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 84/172 (49%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L+ ++G L  L ++ ++ N L+G +P     +  L  LNL  N      P  +  +
Sbjct  272  LSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSFGELKNLTLLNLFRNKLHGAIPEFIGDM  331

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L+V+ L+ NN TG++P+ +     L  L +  N  +G +PP       L+ L   GN 
Sbjct  332  PALEVIQLWENNFTGNIPMSLGTNGKLSLLDISSNKLTGTLPPYLCSGNMLQTLITLGNF  391

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            L G IP  +G    L  + +G  N F+G IP  +  L +L + +  +  L+G
Sbjct  392  LFGPIPESLGGCESLTRIRMGE-NFFNGSIPKGLFGLPKLSQVELQDNYLSG  442


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 68/137 (50%), Gaps = 1/137 (1%)
 Frame = +2

Query  131  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  310
            L  ++++ NQLSGP+PP I   S ++ L L  N+F    P Q+ +L  L  +D  +N  +
Sbjct  454  LGQITLSNNQLSGPLPPSIGNFSGVQKLLLDGNMFEGKIPSQIGRLQQLSKIDFSHNRFS  513

Query  311  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTK  490
            G +  E+ K   L  + L  N  SG IP E      L Y  +S N L G IP  I ++  
Sbjct  514  GPIAPEISKCKLLTFVDLSRNELSGIIPNEITHMKILNYFNISRNHLVGSIPGSIASMQS  573

Query  491  LKELYIGYFNGFSGGIP  541
            L  +   Y N  SG +P
Sbjct  574  LTSVDFSY-NNLSGLVP  589


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 52/174 (30%), Positives = 89/174 (51%), Gaps = 3/174 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +G +   +G    L  L I++N+L+G +PP + + + L+  + L N +FG   P  L 
Sbjct  343  NFTGNIPMSLGTNGKLSLLDISSNKLTGTLPPYLCSGNMLQTLITLGNFLFGP-IPESLG  401

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
               +L  + +  N   G +P  ++ +  L  + L  NY SG  P  +    NL  + +S 
Sbjct  402  GCESLTRIRMGENFFNGSIPKGLFGLPKLSQVELQDNYLSGNFPETHSVSVNLGQITLSN  461

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            N LSG +P  IGN + +++L +   N F G IP ++G L QL + D ++   +G
Sbjct  462  NQLSGPLPPSIGNFSGVQKLLLDG-NMFEGKIPSQIGRLQQLSKIDFSHNRFSG  514


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 74/161 (46%), Gaps = 1/161 (1%)
 Frame = +2

Query  122  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  301
            LP L  + +  N LSG  P   S    L  + LSNN      P  +   + +Q L L  N
Sbjct  427  LPKLSQVELQDNYLSGNFPETHSVSVNLGQITLSNNQLSGPLPPSIGNFSGVQKLLLDGN  486

Query  302  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGN  481
               G +P ++ ++  L  +    N FSG I PE  +   L ++ +S N LSG+IP+EI +
Sbjct  487  MFEGKIPSQIGRLQQLSKIDFSHNRFSGPIAPEISKCKLLTFVDLSRNELSGIIPNEITH  546

Query  482  LTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            +  L    I   N   G IP  + ++  L   D +   L+G
Sbjct  547  MKILNYFNISR-NHLVGSIPGSIASMQSLTSVDFSYNNLSG  586


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 57/119 (48%), Gaps = 1/119 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
              G +   +G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P+++  +
Sbjct  488  FEGKIPSQIGRLQQLSKIDFSHNRFSGPIAPEISKCKLLTFVDLSRNELSGIIPNEITHM  547

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
              L   ++  N+L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  548  KILNYFNISRNHLVGSIPGSIASMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  605



>ref|XP_003611507.1| Receptor-like protein kinase [Medicago truncatula]
Length=1109

 Score =   237 bits (605),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 165/202 (82%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPP  181
            N +T+HCTW  VTC++  HV +++L+GL+LSG LS ++  LPFL NLS+A N+ SG +PP
Sbjct  50   NTNTTHCTWFGVTCNTRRHVTAVNLTGLDLSGTLSDELSHLPFLTNLSLADNKFSGQIPP  109

Query  182  EISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLH  361
             +SA++ LR LNLSNN+F  TFP +L+ L NL+VLDLYNNN+TG LP+ V ++ +LRHLH
Sbjct  110  SLSAVTNLRLLNLSNNVFNGTFPSELSLLKNLEVLDLYNNNMTGTLPLAVTELPNLRHLH  169

Query  362  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            LGGNY +G+IPPEYG + +L+YLAVSGN L G IP EIGNLT L+ELYIGYFN ++GGIP
Sbjct  170  LGGNYLTGQIPPEYGSWQHLQYLAVSGNELDGTIPPEIGNLTSLRELYIGYFNEYTGGIP  229

Query  542  PEMGNLSQLIRXDAANCGLTGE  607
            P++GNL++LIR DAA CGL+GE
Sbjct  230  PQIGNLTELIRLDAAYCGLSGE  251


 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 57/173 (33%), Positives = 90/173 (52%), Gaps = 2/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            L G + P++G L  L  L I   N+ +G +PP+I  ++ L  L+ +        PH++ +
Sbjct  199  LDGTIPPEIGNLTSLRELYIGYFNEYTGGIPPQIGNLTELIRLDAAYCGLSGEIPHEIGK  258

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L NL  L L  N L+G L  E+  + SL+ + L  N  +G IP  +G   NL  L +  N
Sbjct  259  LQNLDTLFLQVNALSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSFGELKNLTLLNLFRN  318

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             L G IP  IG++  L+ + + + N F+G IP  +G   +L   D ++  LTG
Sbjct  319  KLHGAIPEFIGDMPALEVIQL-WENNFTGNIPMSLGTNGKLSLLDISSNKLTG  370


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 81/173 (47%), Gaps = 1/173 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P +     L  L    N L GP+P  +    +L  + +  N F  + P  L  
Sbjct  367  KLTGTLPPYLCSGNMLQTLITLGNFLFGPIPESLGGCESLTRIRMGENFFNGSIPKGLFG  426

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N L+G+ P       +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  427  LPKLSQVELQDNYLSGNFPETHSVSVNLGQITLSNNQLSGPLPPSIGNFSGVQKLLLDGN  486

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
               G IPS+IG L +L ++   + N FSG I PE+     L   D +   L+G
Sbjct  487  MFEGKIPSQIGRLQQLSKIDFSH-NRFSGPIAPEISKCKLLTFVDLSRNELSG  538


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/162 (33%), Positives = 82/162 (51%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG +  ++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN+     P    +L
Sbjct  248  LSGEIPHEIGKLQNLDTLFLQVNALSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSFGEL  307

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  +  M +L  + L  N F+G IP   G    L  L +S N 
Sbjct  308  KNLTLLNLFRNKLHGAIPEFIGDMPALEVIQLWENNFTGNIPMSLGTNGKLSLLDISSNK  367

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P  + +   L+ L I   N   G IP  +G    L R
Sbjct  368  LTGTLPPYLCSGNMLQTL-ITLGNFLFGPIPESLGGCESLTR  408


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/162 (34%), Positives = 81/162 (50%), Gaps = 3/162 (2%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
            +G + P +G L  L+ L  A   LSG +P EI  +  L  L L  N    +   +L  L 
Sbjct  225  TGGIPPQIGNLTELIRLDAAYCGLSGEIPHEIGKLQNLDTLFLQVNALSGSLTWELGNLK  284

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
            +L+ +DL NN LTG++P    ++ +L  L+L  N   G IP   G  P LE + +  N  
Sbjct  285  SLKSMDLSNNMLTGEIPTSFGELKNLTLLNLFRNKLHGAIPEFIGDMPALEVIQLWENNF  344

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM--GNLSQLI  571
            +G IP  +G   KL  L I   N  +G +PP +  GN+ Q +
Sbjct  345  TGNIPMSLGTNGKLSLLDISS-NKLTGTLPPYLCSGNMLQTL  385


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 68/137 (50%), Gaps = 1/137 (1%)
 Frame = +2

Query  131  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  310
            L  ++++ NQLSGP+PP I   S ++ L L  N+F    P Q+ +L  L  +D  +N  +
Sbjct  454  LGQITLSNNQLSGPLPPSIGNFSGVQKLLLDGNMFEGKIPSQIGRLQQLSKIDFSHNRFS  513

Query  311  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTK  490
            G +  E+ K   L  + L  N  SG IP E      L Y  +S N L G IP  I ++  
Sbjct  514  GPIAPEISKCKLLTFVDLSRNELSGIIPNEITHMKILNYFNISRNHLVGSIPGSIASMQS  573

Query  491  LKELYIGYFNGFSGGIP  541
            L  +   Y N  SG +P
Sbjct  574  LTSVDFSY-NNLSGLVP  589


 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 84/172 (49%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L+ ++G L  L ++ ++ N L+G +P     +  L  LNL  N      P  +  +
Sbjct  272  LSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSFGELKNLTLLNLFRNKLHGAIPEFIGDM  331

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L+V+ L+ NN TG++P+ +     L  L +  N  +G +PP       L+ L   GN 
Sbjct  332  PALEVIQLWENNFTGNIPMSLGTNGKLSLLDISSNKLTGTLPPYLCSGNMLQTLITLGNF  391

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            L G IP  +G    L  + +G  N F+G IP  +  L +L + +  +  L+G
Sbjct  392  LFGPIPESLGGCESLTRIRMGE-NFFNGSIPKGLFGLPKLSQVELQDNYLSG  442


 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 48/156 (31%), Positives = 82/156 (53%), Gaps = 3/156 (2%)
 Frame = +2

Query  140  LSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGD  316
            L I++N+L+G +PP + + + L+  + L N +FG   P  L    +L  + +  N   G 
Sbjct  361  LDISSNKLTGTLPPYLCSGNMLQTLITLGNFLFGP-IPESLGGCESLTRIRMGENFFNGS  419

Query  317  LPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLK  496
            +P  ++ +  L  + L  NY SG  P  +    NL  + +S N LSG +P  IGN + ++
Sbjct  420  IPKGLFGLPKLSQVELQDNYLSGNFPETHSVSVNLGQITLSNNQLSGPLPPSIGNFSGVQ  479

Query  497  ELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            +L +   N F G IP ++G L QL + D ++   +G
Sbjct  480  KLLLD-GNMFEGKIPSQIGRLQQLSKIDFSHNRFSG  514


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 74/161 (46%), Gaps = 1/161 (1%)
 Frame = +2

Query  122  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  301
            LP L  + +  N LSG  P   S    L  + LSNN      P  +   + +Q L L  N
Sbjct  427  LPKLSQVELQDNYLSGNFPETHSVSVNLGQITLSNNQLSGPLPPSIGNFSGVQKLLLDGN  486

Query  302  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGN  481
               G +P ++ ++  L  +    N FSG I PE  +   L ++ +S N LSG+IP+EI +
Sbjct  487  MFEGKIPSQIGRLQQLSKIDFSHNRFSGPIAPEISKCKLLTFVDLSRNELSGIIPNEITH  546

Query  482  LTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            +  L    I   N   G IP  + ++  L   D +   L+G
Sbjct  547  MKILNYFNISR-NHLVGSIPGSIASMQSLTSVDFSYNNLSG  586


 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 57/119 (48%), Gaps = 1/119 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
              G +   +G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P+++  +
Sbjct  488  FEGKIPSQIGRLQQLSKIDFSHNRFSGPIAPEISKCKLLTFVDLSRNELSGIIPNEITHM  547

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
              L   ++  N+L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  548  KILNYFNISRNHLVGSIPGSIASMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  605



>ref|XP_007156674.1| hypothetical protein PHAVU_002G007600g [Phaseolus vulgaris]
 gb|ESW28668.1| hypothetical protein PHAVU_002G007600g [Phaseolus vulgaris]
Length=1005

 Score =   235 bits (599),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 133/202 (66%), Positives = 167/202 (83%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPP  181
            N STS+C+W  VTCDS  HV++L+L+GL+LSG LS D+  LPFL NLS+A N+ SGP+PP
Sbjct  45   NASTSYCSWLGVTCDSHRHVIALNLTGLDLSGTLSADIAHLPFLSNLSLATNKFSGPIPP  104

Query  182  EISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLH  361
             +S++S+LR LNLSNN F  TFP +L++L +L+VLDLYNNN+TG LP+   +M +LRHLH
Sbjct  105  ALSSLSSLRLLNLSNNGFNQTFPPELSRLQSLEVLDLYNNNMTGALPLAAAQMLNLRHLH  164

Query  362  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            LGGN+FSGRIPPEYG++  LEYLAVSGN L G IP EIGNLT L+ELYIGY+N + GGIP
Sbjct  165  LGGNFFSGRIPPEYGQWQRLEYLAVSGNELEGKIPPEIGNLTSLRELYIGYYNTYEGGIP  224

Query  542  PEMGNLSQLIRXDAANCGLTGE  607
            PE+GNLS+L+R DAA CGL+GE
Sbjct  225  PEIGNLSELVRLDAAYCGLSGE  246


 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 88/162 (54%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG ++  +G+L  L  L +  N LSGP+ PE+  + +L+ ++LSNN+     P   ++L
Sbjct  243  LSGEITAALGKLQKLDTLFLQVNALSGPLTPELGNLKSLKSMDLSNNMLSGEIPATFSEL  302

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             N+ +L+L+ N L G +P  + ++ SL  + L  N F+G IP   G+   L  L +S N 
Sbjct  303  KNITLLNLFRNKLHGAIPEFIGELPSLEVVQLWENNFTGSIPEGLGKNGRLSVLDISSNK  362

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P  + +   L+ L I   N   G IP  +G+   L R
Sbjct  363  LTGALPPYLCSGNTLQTL-ITLENFLFGPIPEALGSCESLTR  403


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 92/175 (53%), Gaps = 3/175 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +G +   +G+   L  L I++N+L+G +PP + + +TL+  + L N +FG   P  L 
Sbjct  338  NFTGSIPEGLGKNGRLSVLDISSNKLTGALPPYLCSGNTLQTLITLENFLFG-PIPEALG  396

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
               +L  + +  N L G +P  ++ +  L  + L  NY SG  P       NL  + +S 
Sbjct  397  SCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLSGGFPEAGSVAVNLGQITLSN  456

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            N LSG +P  IGN + +++L +   N FSG IPP++G L QL + D +    +G 
Sbjct  457  NQLSGPLPPSIGNFSSVQKLLLDG-NMFSGPIPPQIGRLQQLSKIDFSGNKFSGR  510


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 53/172 (31%), Positives = 86/172 (50%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L+P++G L  L ++ ++ N LSG +P   S +  +  LNL  N      P  + +L
Sbjct  267  LSGPLTPELGNLKSLKSMDLSNNMLSGEIPATFSELKNITLLNLFRNKLHGAIPEFIGEL  326

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             +L+V+ L+ NN TG +P  + K   L  L +  N  +G +PP       L+ L    N 
Sbjct  327  PSLEVVQLWENNFTGSIPEGLGKNGRLSVLDISSNKLTGALPPYLCSGNTLQTLITLENF  386

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            L G IP  +G+   L  + +G  N  +G IP  +  L +L + +  +  L+G
Sbjct  387  LFGPIPEALGSCESLTRIRMGE-NFLNGSIPKGLFGLPKLTQVELQDNYLSG  437


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 81/174 (47%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P +     L  L    N L GP+P  + +  +L  + +  N    + P  L  
Sbjct  362  KLTGALPPYLCSGNTLQTLITLENFLFGPIPEALGSCESLTRIRMGENFLNGSIPKGLFG  421

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N L+G  P       +L  + L  N  SG +PP  G F +++ L + GN
Sbjct  422  LPKLTQVELQDNYLSGGFPEAGSVAVNLGQITLSNNQLSGPLPPSIGNFSSVQKLLLDGN  481

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              SG IP +IG L +L ++     N FSG I PE+     L   D +   L+GE
Sbjct  482  MFSGPIPPQIGRLQQLSKIDFSG-NKFSGRIEPEISQCKLLTFLDLSRNDLSGE  534


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 82/161 (51%), Gaps = 2/161 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  265
             SG + P+ GQ   L  L+++ N+L G +PPEI  +++LR L +   N +    P ++  
Sbjct  170  FSGRIPPEYGQWQRLEYLAVSGNELEGKIPPEIGNLTSLRELYIGYYNTYEGGIPPEIGN  229

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L+ L  LD     L+G++   + K+  L  L L  N  SG + PE G   +L+ + +S N
Sbjct  230  LSELVRLDAAYCGLSGEITAALGKLQKLDTLFLQVNALSGPLTPELGNLKSLKSMDLSNN  289

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQL  568
             LSG IP+    L  +  L + + N   G IP  +G L  L
Sbjct  290  MLSGEIPATFSELKNITLLNL-FRNKLHGAIPEFIGELPSL  329


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 65/127 (51%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             LSG L P +G    +  L +  N  SGP+PP+I  +  L  ++ S N F      +++Q
Sbjct  458  QLSGPLPPSIGNFSSVQKLLLDGNMFSGPIPPQIGRLQQLSKIDFSGNKFSGRIEPEISQ  517

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  LDL  N+L+G++P E+  M  L  L+L  N+  G IP       +L  +  S N
Sbjct  518  CKLLTFLDLSRNDLSGEIPNEITGMRILNCLNLSSNHLVGSIPSSISSMQSLTSVDFSYN  577

Query  446  GLSGVIP  466
             LSG++P
Sbjct  578  NLSGLVP  584


 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 73/146 (50%), Gaps = 2/146 (1%)
 Frame = +2

Query  107  PDVGQLPF-LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  283
            P+ G +   L  ++++ NQLSGP+PP I   S+++ L L  N+F    P Q+ +L  L  
Sbjct  440  PEAGSVAVNLGQITLSNNQLSGPLPPSIGNFSSVQKLLLDGNMFSGPIPPQIGRLQQLSK  499

Query  284  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  463
            +D   N  +G +  E+ +   L  L L  N  SG IP E      L  L +S N L G I
Sbjct  500  IDFSGNKFSGRIEPEISQCKLLTFLDLSRNDLSGEIPNEITGMRILNCLNLSSNHLVGSI  559

Query  464  PSEIGNLTKLKELYIGYFNGFSGGIP  541
            PS I ++  L  +   Y N  SG +P
Sbjct  560  PSSISSMQSLTSVDFSY-NNLSGLVP  584


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/154 (34%), Positives = 73/154 (47%), Gaps = 1/154 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L G +   +G    L  + +  N L+G +P  +  +  L  + L +N     FP   +  
Sbjct  387  LFGPIPEALGSCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLSGGFPEAGSVA  446

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL  + L NN L+G LP  +   +S++ L L GN FSG IPP+ GR   L  +  SGN 
Sbjct  447  VNLGQITLSNNQLSGPLPPSIGNFSSVQKLLLDGNMFSGPIPPQIGRLQQLSKIDFSGNK  506

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
             SG I  EI     L  L +   N  SG IP E+
Sbjct  507  FSGRIEPEISQCKLLTFLDLSR-NDLSGEIPNEI  539


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 73/150 (49%), Gaps = 1/150 (1%)
 Frame = +2

Query  95   GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  274
            G + P++G L  LV L  A   LSG +   +  +  L  L L  N        +L  L +
Sbjct  221  GGIPPEIGNLSELVRLDAAYCGLSGEITAALGKLQKLDTLFLQVNALSGPLTPELGNLKS  280

Query  275  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  454
            L+ +DL NN L+G++P    ++ ++  L+L  N   G IP   G  P+LE + +  N  +
Sbjct  281  LKSMDLSNNMLSGEIPATFSELKNITLLNLFRNKLHGAIPEFIGELPSLEVVQLWENNFT  340

Query  455  GVIPSEIGNLTKLKELYIGYFNGFSGGIPP  544
            G IP  +G   +L  L I   N  +G +PP
Sbjct  341  GSIPEGLGKNGRLSVLDISS-NKLTGALPP  369



>ref|XP_009394785.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1006

 Score =   234 bits (598),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 154/199 (77%), Gaps = 1/199 (1%)
 Frame = +2

Query  14   SHCTWRRVTCd-sllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEIS  190
             HC+W  V+CD     VVSLDL+GLNLSG LSP VG+L  L+NLS A+N LSGP+P E+S
Sbjct  60   DHCSWPGVSCDPLQGFVVSLDLTGLNLSGTLSPAVGRLRHLLNLSAASNSLSGPIPAELS  119

Query  191  AISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGG  370
             +S LR LNLSNN+F  +FP  LA+L NL VLDLYNNNLTG LP EV ++  LRHLHLGG
Sbjct  120  RLSDLRHLNLSNNLFNGSFPSALARLKNLLVLDLYNNNLTGPLPTEVAELPELRHLHLGG  179

Query  371  NYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            N+F+G IPPE+GR+  LEYLAVSGN L G IP E+G LT L++LY+GYFN F G IPPE+
Sbjct  180  NFFTGVIPPEFGRWEFLEYLAVSGNELGGPIPPELGKLTTLRQLYLGYFNSFEGRIPPEI  239

Query  551  GNLSQLIRXDAANCGLTGE  607
            G L+ L+R D ANCGL+GE
Sbjct  240  GGLAALVRLDMANCGLSGE  258


 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 98/197 (50%), Gaps = 26/197 (13%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR--------------------  208
             +GV+ P+ G+  FL  L+++ N+L GP+PPE+  ++TLR                    
Sbjct  182  FTGVIPPEFGRWEFLEYLAVSGNELGGPIPPELGKLTTLRQLYLGYFNSFEGRIPPEIGG  241

Query  209  -----FLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGN  373
                  L+++N       P +L  L NL  + L  N LTGDLP E+ ++ +L+ + L  N
Sbjct  242  LAALVRLDMANCGLSGEIPPELGNLQNLDTIFLQVNGLTGDLPPEMGRLRNLKSMDLSNN  301

Query  374  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
              +G IP  +    NL  L +  N L G IP  I +L  L+ L + + N F+GGIP  +G
Sbjct  302  ALAGEIPATFADLQNLTLLNLFRNKLHGSIPEFIADLPTLEVLQL-WENNFTGGIPRRLG  360

Query  554  NLSQLIRXDAANCGLTG  604
               QL   D ++  LTG
Sbjct  361  QSGQLELLDLSSNKLTG  377


 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/162 (34%), Positives = 86/162 (53%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P++G L  L  + +  N L+G +PPE+  +  L+ ++LSNN      P   A L
Sbjct  255  LSGEIPPELGNLQNLDTIFLQVNGLTGDLPPEMGRLRNLKSMDLSNNALAGEIPATFADL  314

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  +  + +L  L L  N F+G IP   G+   LE L +S N 
Sbjct  315  QNLTLLNLFRNKLHGSIPEFIADLPTLEVLQLWENNFTGGIPRRLGQSGQLELLDLSSNK  374

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P ++ +  +L+ L +   N   G IP  +G    L R
Sbjct  375  LTGNLPPDLCSGNRLQTLIV-LGNFLFGPIPDTLGRCESLSR  415


 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 56/172 (33%), Positives = 89/172 (52%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G L P++G+L  L ++ ++ N L+G +P   + +  L  LNL  N    + P  +A L
Sbjct  279  LTGDLPPEMGRLRNLKSMDLSNNALAGEIPATFADLQNLTLLNLFRNKLHGSIPEFIADL  338

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L+VL L+ NN TG +P  + +   L  L L  N  +G +PP+      L+ L V GN 
Sbjct  339  PTLEVLQLWENNFTGGIPRRLGQSGQLELLDLSSNKLTGNLPPDLCSGNRLQTLIVLGNF  398

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            L G IP  +G    L  + +G  N  +G IP  + +L +L + +  +  LTG
Sbjct  399  LFGPIPDTLGRCESLSRIRMGE-NYLNGSIPDGLLSLPRLSQIELQDNLLTG  449


 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 79/155 (51%), Gaps = 1/155 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            +  G + P++G L  LV L +A   LSG +PPE+  +  L  + L  N      P ++ +
Sbjct  230  SFEGRIPPEIGGLAALVRLDMANCGLSGEIPPELGNLQNLDTIFLQVNGLTGDLPPEMGR  289

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L NL+ +DL NN L G++P     + +L  L+L  N   G IP      P LE L +  N
Sbjct  290  LRNLKSMDLSNNALAGEIPATFADLQNLTLLNLFRNKLHGSIPEFIADLPTLEVLQLWEN  349

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
              +G IP  +G   +L+ L +   N  +G +PP++
Sbjct  350  NFTGGIPRRLGQSGQLELLDLSS-NKLTGNLPPDL  383


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 76/150 (51%), Gaps = 7/150 (5%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
            + ++SPD+GQ+      S++ N+LSGP+PP +   S ++ L L+ N F    P ++ +L 
Sbjct  456  AALISPDLGQI------SLSNNRLSGPLPPSVGNFSGVQKLLLNQNQFSGRIPPEIGRLQ  509

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
             L  +D   N  +G +  E+ +   L  + L  N  SG IP E      L YL +S N L
Sbjct  510  QLSKVDFSGNQFSGLISPEISQCKLLTFVDLSRNELSGEIPSEITGMRILNYLNLSRNQL  569

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
             G IPS I  +  L  +   Y N  SG +P
Sbjct  570  EGNIPSSIATMQSLTAIDFSY-NNLSGLVP  598


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 82/176 (47%), Gaps = 3/176 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L PD+     L  L +  N L GP+P  +    +L  + +  N    + P  L  
Sbjct  374  KLTGNLPPDLCSGNRLQTLIVLGNFLFGPIPDTLGRCESLSRIRMGENYLNGSIPDGLLS  433

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTS--LRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  439
            L  L  ++L +N LTG  P     + S  L  + L  N  SG +PP  G F  ++ L ++
Sbjct  434  LPRLSQIELQDNLLTGGFPDTGAALISPDLGQISLSNNRLSGPLPPSVGNFSGVQKLLLN  493

Query  440  GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
             N  SG IP EIG L +L ++     N FSG I PE+     L   D +   L+GE
Sbjct  494  QNQFSGRIPPEIGRLQQLSKVDFSG-NQFSGLISPEISQCKLLTFVDLSRNELSGE  548


 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 90/175 (51%), Gaps = 3/175 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            N +G +   +GQ   L  L +++N+L+G +PP++ + + L+ L +  N      P  L +
Sbjct  350  NFTGGIPRRLGQSGQLELLDLSSNKLTGNLPPDLCSGNRLQTLIVLGNFLFGPIPDTLGR  409

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRF--PNLEYLAVS  439
              +L  + +  N L G +P  +  +  L  + L  N  +G  P        P+L  +++S
Sbjct  410  CESLSRIRMGENYLNGSIPDGLLSLPRLSQIELQDNLLTGGFPDTGAALISPDLGQISLS  469

Query  440  GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             N LSG +P  +GN + +++L +   N FSG IPPE+G L QL + D +    +G
Sbjct  470  NNRLSGPLPPSVGNFSGVQKLLLNQ-NQFSGRIPPEIGRLQQLSKVDFSGNQFSG  523


 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L P VG    +  L +  NQ SG +PPEI  +  L  ++ S N F      +++Q 
Sbjct  473  LSGPLPPSVGNFSGVQKLLLNQNQFSGRIPPEIGRLQQLSKVDFSGNQFSGLISPEISQC  532

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  +DL  N L+G++P E+  M  L +L+L  N   G IP       +L  +  S N 
Sbjct  533  KLLTFVDLSRNELSGEIPSEITGMRILNYLNLSRNQLEGNIPSSIATMQSLTAIDFSYNN  592

Query  449  LSGVIP  466
            LSG++P
Sbjct  593  LSGLVP  598



>ref|XP_009395647.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1004

 Score =   234 bits (596),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 128/203 (63%), Positives = 157/203 (77%), Gaps = 1/203 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCd-sllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVP  178
            N +  HC+W  V CD   + V+SLDL+GLNLSG LSP VG+L  LVNLS A+N LSGP+P
Sbjct  55   NSADGHCSWPGVACDPIRVFVLSLDLTGLNLSGTLSPAVGRLHHLVNLSTASNSLSGPLP  114

Query  179  PEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHL  358
             E+S +S LR LNLSNN+F  +FP   ++L NL VLDLYNNNL G LP EV ++ +L HL
Sbjct  115  AELSHLSNLRHLNLSNNLFNGSFPSAFSRLKNLLVLDLYNNNLAGTLPPEVSELPNLLHL  174

Query  359  HLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGI  538
            HLGGN+FSG IPPE+G +  LEYLAVSGN L G IP E+GNLT+L++LY+GYFN F GGI
Sbjct  175  HLGGNFFSGVIPPEFGHWEFLEYLAVSGNELGGPIPPELGNLTRLRQLYVGYFNSFEGGI  234

Query  539  PPEMGNLSQLIRXDAANCGLTGE  607
            PPE+G LS+L+R D ANCGLTG+
Sbjct  235  PPEIGGLSELVRLDMANCGLTGD  257


 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 101/196 (52%), Gaps = 24/196 (12%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  265
             SGV+ P+ G   FL  L+++ N+L GP+PPE+  ++ LR L +   N F    P ++  
Sbjct  181  FSGVIPPEFGHWEFLEYLAVSGNELGGPIPPELGNLTRLRQLYVGYFNSFEGGIPPEIGG  240

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L+ L  LD+ N  LTGD+P E+ K+ +L  L L  N  SGR+PPE G   +L+ + +S N
Sbjct  241  LSELVRLDMANCGLTGDIPPELGKLQNLDTLFLQVNGLSGRLPPELGGLRSLKSMDLSNN  300

Query  446  GLSGVIPSEIGNLTKLKEL-------------YIG----------YFNGFSGGIPPEMGN  556
             L+G IP    +L  L  L             ++G          + N F+GGIP  +G 
Sbjct  301  ALTGEIPGSFADLQNLTLLNLFRNKLHGSIPEFVGDLPALEVLQLWENNFTGGIPRRLGQ  360

Query  557  LSQLIRXDAANCGLTG  604
              +L   D ++  LTG
Sbjct  361  SGRLQILDISSNKLTG  376


 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 86/162 (53%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G + P++G+L  L  L +  N LSG +PPE+  + +L+ ++LSNN      P   A L
Sbjct  254  LTGDIPPELGKLQNLDTLFLQVNGLSGRLPPELGGLRSLKSMDLSNNALTGEIPGSFADL  313

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  V  + +L  L L  N F+G IP   G+   L+ L +S N 
Sbjct  314  QNLTLLNLFRNKLHGSIPEFVGDLPALEVLQLWENNFTGGIPRRLGQSGRLQILDISSNK  373

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P  +    +L+ L I   N   G IP  +G    + R
Sbjct  374  LTGTLPPNLCFGNRLQTL-IALGNFLFGSIPETLGQCQSVSR  414


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 79/155 (51%), Gaps = 1/155 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            +  G + P++G L  LV L +A   L+G +PPE+  +  L  L L  N      P +L  
Sbjct  229  SFEGGIPPEIGGLSELVRLDMANCGLTGDIPPELGKLQNLDTLFLQVNGLSGRLPPELGG  288

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L +L+ +DL NN LTG++P     + +L  L+L  N   G IP   G  P LE L +  N
Sbjct  289  LRSLKSMDLSNNALTGEIPGSFADLQNLTLLNLFRNKLHGSIPEFVGDLPALEVLQLWEN  348

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
              +G IP  +G   +L+ L I   N  +G +PP +
Sbjct  349  NFTGGIPRRLGQSGRLQILDISS-NKLTGTLPPNL  382


 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 58/176 (33%), Positives = 91/176 (52%), Gaps = 5/176 (3%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +G +   +GQ   L  L I++N+L+G +PP +   + L+  + L N +FGS  P  L 
Sbjct  349  NFTGGIPRRLGQSGRLQILDISSNKLTGTLPPNLCFGNRLQTLIALGNFLFGS-IPETLG  407

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRF--PNLEYLAV  436
            Q  ++  + +  N L G +P   + +  L  L L  N  +G  P        P+L  + +
Sbjct  408  QCQSVSRIRMGENYLNGSIPDGFFSLPKLSQLELQDNLLAGVFPDTGAAAISPDLGQINL  467

Query  437  SGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            S N L G +P  IGN + L++L +   N FSGGIPPE+G L QL + D +    +G
Sbjct  468  SNNRLLGPLPPSIGNFSGLQKLLLNQ-NQFSGGIPPEIGRLQQLSKVDFSGNQFSG  522


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 74/150 (49%), Gaps = 7/150 (5%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
            +  +SPD+GQ    +NLS   N+L GP+PP I   S L+ L L+ N F    P ++ +L 
Sbjct  455  AAAISPDLGQ----INLS--NNRLLGPLPPSIGNFSGLQKLLLNQNQFSGGIPPEIGRLQ  508

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
             L  +D   N  +G +  E+ +   L  + L  N  SG I PE      L YL +S N L
Sbjct  509  QLSKVDFSGNQFSGPIAPEISRCKLLTFVDLSRNKLSGEILPEIAGMRILNYLNLSRNQL  568

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
             G IP  I  +  L  +   Y N FSG +P
Sbjct  569  EGSIPPSISTMQSLTAVDFSY-NNFSGLVP  597


 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 84/172 (49%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L P++G L  L ++ ++ N L+G +P   + +  L  LNL  N    + P  +  L
Sbjct  278  LSGRLPPELGGLRSLKSMDLSNNALTGEIPGSFADLQNLTLLNLFRNKLHGSIPEFVGDL  337

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L+VL L+ NN TG +P  + +   L+ L +  N  +G +PP       L+ L   GN 
Sbjct  338  PALEVLQLWENNFTGGIPRRLGQSGRLQILDISSNKLTGTLPPNLCFGNRLQTLIALGNF  397

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            L G IP  +G    +  + +G  N  +G IP    +L +L + +  +  L G
Sbjct  398  LFGSIPETLGQCQSVSRIRMGE-NYLNGSIPDGFFSLPKLSQLELQDNLLAG  448



>ref|XP_006852730.1| hypothetical protein AMTR_s00033p00083200 [Amborella trichopoda]
 gb|ERN14197.1| hypothetical protein AMTR_s00033p00083200 [Amborella trichopoda]
Length=1017

 Score =   233 bits (595),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 159/202 (79%), Gaps = 1/202 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsll-hvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVP  178
            N ST +C+W  V CD+   HVVSLDLS  NL+G L+P++G+L  LVN+++A NQ +G +P
Sbjct  50   NSSTDYCSWSGVACDASSNHVVSLDLSARNLNGTLAPEIGRLRSLVNITVAENQFAGGIP  109

Query  179  PEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHL  358
             EIS I+ L+ LNLSNN F + FP   + L NL+VLDLYNNNLTG LP+EV +M +LRHL
Sbjct  110  LEISQINGLKLLNLSNNYFSANFPANFSGLKNLEVLDLYNNNLTGPLPLEVTEMEALRHL  169

Query  359  HLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGI  538
            HLGGN+F+G IPPEYG++  +EYLAVSGN L+G IP E+GNLTKL++LY+GY+N + GGI
Sbjct  170  HLGGNFFTGTIPPEYGKWGFIEYLAVSGNELTGKIPGELGNLTKLQQLYLGYYNIYEGGI  229

Query  539  PPEMGNLSQLIRXDAANCGLTG  604
            PPE+GNLS L+R D ANC L+G
Sbjct  230  PPELGNLSALVRLDMANCALSG  251


 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 92/174 (53%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            N +G +   +G    L+ L I++N+L+G VPP++     L  L   +N      P  L +
Sbjct  344  NFTGSVPQQLGMNGNLILLDISSNKLTGSVPPQLCYGGKLTTLITLDNFLFGPIPESLGE  403

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
              +L  + +  N L G +P  +  + +L  + L  NY +G +P       NL  L++S N
Sbjct  404  CVSLARIRMGENYLNGSIPKGLLSLPNLVQVELQANYLTGNLPDSGKASENLGQLSLSNN  463

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
             LSG +P+ IG  + L++L +   NGFSG IPP++G L QL + D ++   +GE
Sbjct  464  RLSGQLPASIGKFSSLQKLLLD-GNGFSGQIPPDIGKLQQLSKLDFSDNKFSGE  516


 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 88/162 (54%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P+  +L  L  L +  N LSGP+ PE+ ++ +L+ ++LSNN+     P + ++L
Sbjct  249  LSGSIPPEFRKLQKLDTLFLQVNGLSGPITPELGSLKSLKSMDLSNNMLDGQIPVEFSEL  308

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  +  +  L+ L L  N F+G +P + G   NL  L +S N 
Sbjct  309  KNLTLLNLFRNRLHGSIPGFIGDLPELQVLQLWENNFTGSVPQQLGMNGNLILLDISSNK  368

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P ++    KL  L I   N   G IP  +G    L R
Sbjct  369  LTGSVPPQLCYGGKLTTL-ITLDNFLFGPIPESLGECVSLAR  409


 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 85/172 (49%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G +   +  LP LV + + AN L+G +P    A   L  L+LSNN      P  + + 
Sbjct  417  LNGSIPKGLLSLPNLVQVELQANYLTGNLPDSGKASENLGQLSLSNNRLSGQLPASIGKF  476

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
            ++LQ L L  N  +G +P ++ K+  L  L    N FSG I PE      L  + +SGN 
Sbjct  477  SSLQKLLLDGNGFSGQIPPDIGKLQQLSKLDFSDNKFSGEISPEITNCKLLTVVDLSGNE  536

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            L+G IPSEI  +  L  L +   N   GGIPP +  +  L   D +   L+G
Sbjct  537  LNGTIPSEITKMRILNYLNLSR-NHLMGGIPPSIQTMQSLTSVDFSYNNLSG  587


 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 61/176 (35%), Positives = 87/176 (49%), Gaps = 7/176 (4%)
 Frame = +2

Query  86   NLSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  256
             L+G + P +   G+L  L+ L    N L GP+P  +    +L  + +  N    + P  
Sbjct  368  KLTGSVPPQLCYGGKLTTLITLD---NFLFGPIPESLGECVSLARIRMGENYLNGSIPKG  424

Query  257  LAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  436
            L  L NL  ++L  N LTG+LP       +L  L L  N  SG++P   G+F +L+ L +
Sbjct  425  LLSLPNLVQVELQANYLTGNLPDSGKASENLGQLSLSNNRLSGQLPASIGKFSSLQKLLL  484

Query  437  SGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             GNG SG IP +IG L +L +L     N FSG I PE+ N   L   D +   L G
Sbjct  485  DGNGFSGQIPPDIGKLQQLSKLDFSD-NKFSGEISPEITNCKLLTVVDLSGNELNG  539


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 61/197 (31%), Positives = 98/197 (50%), Gaps = 26/197 (13%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  265
             +G + P+ G+  F+  L+++ N+L+G +P E+  ++ L+ L L   NI+    P +L  
Sbjct  176  FTGTIPPEYGKWGFIEYLAVSGNELTGKIPGELGNLTKLQQLYLGYYNIYEGGIPPELGN  235

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L+ L  LD+ N  L+G +P E  K+  L  L L  N  SG I PE G   +L+ + +S N
Sbjct  236  LSALVRLDMANCALSGSIPPEFRKLQKLDTLFLQVNGLSGPITPELGSLKSLKSMDLSNN  295

Query  446  GLSGVIPSE------------------------IGNLTKLKELYIGYFNGFSGGIPPEMG  553
             L G IP E                        IG+L +L+ L + + N F+G +P ++G
Sbjct  296  MLDGQIPVEFSELKNLTLLNLFRNRLHGSIPGFIGDLPELQVLQL-WENNFTGSVPQQLG  354

Query  554  NLSQLIRXDAANCGLTG  604
                LI  D ++  LTG
Sbjct  355  MNGNLILLDISSNKLTG  371


 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 83/166 (50%), Gaps = 4/166 (2%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
             G + P++G L  LV L +A   LSG +PPE   +  L  L L  N        +L  L 
Sbjct  226  EGGIPPELGNLSALVRLDMANCALSGSIPPEFRKLQKLDTLFLQVNGLSGPITPELGSLK  285

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
            +L+ +DL NN L G +PVE  ++ +L  L+L  N   G IP   G  P L+ L +  N  
Sbjct  286  SLKSMDLSNNMLDGQIPVEFSELKNLTLLNLFRNRLHGSIPGFIGDLPELQVLQLWENNF  345

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM---GNLSQLIRXD  580
            +G +P ++G    L  L I   N  +G +PP++   G L+ LI  D
Sbjct  346  TGSVPQQLGMNGNLILLDISS-NKLTGSVPPQLCYGGKLTTLITLD  390


 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L   +G+   L  L +  N  SG +PP+I  +  L  L+ S+N F      ++   
Sbjct  465  LSGQLPASIGKFSSLQKLLLDGNGFSGQIPPDIGKLQQLSKLDFSDNKFSGEISPEITNC  524

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L V+DL  N L G +P E+ KM  L +L+L  N+  G IPP      +L  +  S N 
Sbjct  525  KLLTVVDLSGNELNGTIPSEITKMRILNYLNLSRNHLMGGIPPSIQTMQSLTSVDFSYNN  584

Query  449  LSGVIP  466
            LSG++P
Sbjct  585  LSGLVP  590



>ref|XP_009408581.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1016

 Score =   233 bits (593),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 144/200 (72%), Gaps = 1/200 (1%)
 Frame = +2

Query  8    STSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEI  187
            +T HC W  VTCD    V        NLSG LSP  G L  L+ LS A N LSGP+PP +
Sbjct  54   ATDHCAWPGVTCDRAAVVELDLSGR-NLSGPLSPAFGSLRSLLRLSAAENSLSGPIPPAL  112

Query  188  SAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLG  367
            + ++ LR LNLSNN+F  +FP  LA LA+L+VLDLYNNNLTG LP EV  +  LRHLHLG
Sbjct  113  ALLTVLRHLNLSNNLFDGSFPPALAGLADLRVLDLYNNNLTGPLPREVAALHQLRHLHLG  172

Query  368  GNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPE  547
            GN+FSG IP EYGR+  LEYLAVSGN L G IP EIGNL+ L+ELYIGY+N + GG+PPE
Sbjct  173  GNFFSGSIPSEYGRWQFLEYLAVSGNELGGPIPPEIGNLSSLRELYIGYYNSYEGGLPPE  232

Query  548  MGNLSQLIRXDAANCGLTGE  607
            +GNLS L+R D ANCGL+G 
Sbjct  233  IGNLSTLLRLDVANCGLSGR  252


 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/174 (34%), Positives = 92/174 (53%), Gaps = 2/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA  262
             L G + P++G L  L  L I   N   G +PPEI  +STL  L+++N       P ++ 
Sbjct  199  ELGGPIPPEIGNLSSLRELYIGYYNSYEGGLPPEIGNLSTLLRLDVANCGLSGRIPPEIG  258

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
             L  L  L L  N L G++P+E+ ++ SL+ + L  N  +G IPP +    NL  L +  
Sbjct  259  NLRILDSLFLQVNGLVGEIPLELGRLRSLKSMDLSNNALTGEIPPSFADLGNLTLLNLFR  318

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            N L G IP  +G+L +L+ L + + N F+G +P  +G   +L   D ++  LTG
Sbjct  319  NKLFGAIPEFVGDLPELEVLQL-WENNFTGSVPRRLGKNGRLQSLDLSSNKLTG  371


 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 87/172 (51%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P++G L  L +L +  N L G +P E+  + +L+ ++LSNN      P   A L
Sbjct  249  LSGRIPPEIGNLRILDSLFLQVNGLVGEIPLELGRLRSLKSMDLSNNALTGEIPPSFADL  308

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  V  +  L  L L  N F+G +P   G+   L+ L +S N 
Sbjct  309  GNLTLLNLFRNKLFGAIPEFVGDLPELEVLQLWENNFTGSVPRRLGKNGRLQSLDLSSNK  368

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            L+G +P ++    KL+ L I   N   G IP  +G    L R   A   L G
Sbjct  369  LTGSLPPDLCYGNKLQTL-IALGNFLFGPIPESLGRCKSLSRIRMAENYLNG  419


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 80/153 (52%), Gaps = 1/153 (1%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
             G L P++G L  L+ L +A   LSG +PPEI  +  L  L L  N      P +L +L 
Sbjct  226  EGGLPPEIGNLSTLLRLDVANCGLSGRIPPEIGNLRILDSLFLQVNGLVGEIPLELGRLR  285

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
            +L+ +DL NN LTG++P     + +L  L+L  N   G IP   G  P LE L +  N  
Sbjct  286  SLKSMDLSNNALTGEIPPSFADLGNLTLLNLFRNKLFGAIPEFVGDLPELEVLQLWENNF  345

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            +G +P  +G   +L+ L +   N  +G +PP++
Sbjct  346  TGSVPRRLGKNGRLQSLDLSS-NKLTGSLPPDL  377


 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 63/214 (29%), Positives = 92/214 (43%), Gaps = 51/214 (24%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G + P    L  L  L++  N+L G +P  +  +  L  L L  N F  + P +L + 
Sbjct  297  LTGEIPPSFADLGNLTLLNLFRNKLFGAIPEFVGDLPELEVLQLWENNFTGSVPRRLGKN  356

Query  269  ANLQVLDLYNNNLTGDLPVEVY------------------------KMTSLRHLHLGGNY  376
              LQ LDL +N LTG LP ++                         +  SL  + +  NY
Sbjct  357  GRLQSLDLSSNKLTGSLPPDLCYGNKLQTLIALGNFLFGPIPESLGRCKSLSRIRMAENY  416

Query  377  FSGRIP-----------------------PEYGR---FPNLEYLAVSGNGLSGVIPSEIG  478
             +G IP                       P+ GR    PNL  + +S N L+G +P  I 
Sbjct  417  LNGSIPRGLFSLPNLSQVELQDNLLTGGFPDTGRSPISPNLGQICLSNNRLTGPLPPSIA  476

Query  479  NLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXD  580
            N   L++L +   N F+GGIPPE+G L QL + D
Sbjct  477  NFFGLQKLLLNQ-NSFTGGIPPEVGRLQQLSKLD  509


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 72/148 (49%), Gaps = 4/148 (3%)
 Frame = +2

Query  107  PDVGQLPFLVNL---SIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  277
            PD G+ P   NL    ++ N+L+GP+PP I+    L+ L L+ N F    P ++ +L  L
Sbjct  446  PDTGRSPISPNLGQICLSNNRLTGPLPPSIANFFGLQKLLLNQNSFTGGIPPEVGRLQQL  505

Query  278  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSG  457
              LD   N   G +  E+ K   L  + L  N  SG IP E      L YL +S N L G
Sbjct  506  SKLDFSGNRFAGPITPEISKCKLLTFVDLSRNELSGDIPEEIAAMRILNYLNLSRNHLEG  565

Query  458  VIPSEIGNLTKLKELYIGYFNGFSGGIP  541
             IP+ I  +  L ++   Y N  SG +P
Sbjct  566  QIPAAISTMQSLTQVDFSY-NNLSGVVP  592


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G L P +     L  L +  N  +G +PPE+  +  L  L+ S N F      ++++ 
Sbjct  467  LTGPLPPSIANFFGLQKLLLNQNSFTGGIPPEVGRLQQLSKLDFSGNRFAGPITPEISKC  526

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  +DL  N L+GD+P E+  M  L +L+L  N+  G+IP       +L  +  S N 
Sbjct  527  KLLTFVDLSRNELSGDIPEEIAAMRILNYLNLSRNHLEGQIPAAISTMQSLTQVDFSYNN  586

Query  449  LSGVIP  466
            LSGV+P
Sbjct  587  LSGVVP  592


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 54/176 (31%), Positives = 81/176 (46%), Gaps = 3/176 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L PD+     L  L    N L GP+P  +    +L  + ++ N    + P  L  
Sbjct  368  KLTGSLPPDLCYGNKLQTLIALGNFLFGPIPESLGRCKSLSRIRMAENYLNGSIPRGLFS  427

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTS--LRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  439
            L NL  ++L +N LTG  P       S  L  + L  N  +G +PP    F  L+ L ++
Sbjct  428  LPNLSQVELQDNLLTGGFPDTGRSPISPNLGQICLSNNRLTGPLPPSIANFFGLQKLLLN  487

Query  440  GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
             N  +G IP E+G L +L +L     N F+G I PE+     L   D +   L+G+
Sbjct  488  QNSFTGGIPPEVGRLQQLSKLDFSG-NRFAGPITPEISKCKLLTFVDLSRNELSGD  542


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 55/103 (53%), Gaps = 0/103 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            + +G + P+VG+L  L  L  + N+ +GP+ PEIS    L F++LS N      P ++A 
Sbjct  490  SFTGGIPPEVGRLQQLSKLDFSGNRFAGPITPEISKCKLLTFVDLSRNELSGDIPEEIAA  549

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  394
            +  L  L+L  N+L G +P  +  M SL  +    N  SG +P
Sbjct  550  MRILNYLNLSRNHLEGQIPAAISTMQSLTQVDFSYNNLSGVVP  592



>ref|XP_010936307.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=1007

 Score =   232 bits (592),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 129/200 (65%), Positives = 157/200 (79%), Gaps = 2/200 (1%)
 Frame = +2

Query  14   SHCTWRRVTCdsl--lhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEI  187
             HC+W  V CD      V++LDLSGLNLSG L P V  L  L+NLS AAN LSGP+P ++
Sbjct  61   DHCSWPGVACDDAPLRRVIALDLSGLNLSGSLPPAVAHLRHLLNLSTAANLLSGPIPLDL  120

Query  188  SAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLG  367
            S +S LR+LNLSNN+F  +FP  L +L NL+VLDLYNNNLTG LP EV  + +LRHLHLG
Sbjct  121  SLLSDLRYLNLSNNVFNGSFPSALRRLKNLEVLDLYNNNLTGILPAEVADLHNLRHLHLG  180

Query  368  GNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPE  547
            GN+FSG IP EYGR+ +LEYLAVSGN LSG IP EIGNLT+L++LY+GYFN + GGIPPE
Sbjct  181  GNFFSGVIPREYGRWEHLEYLAVSGNELSGAIPPEIGNLTRLRQLYVGYFNSYDGGIPPE  240

Query  548  MGNLSQLIRXDAANCGLTGE  607
            +G+LS L+R DAANCGL+G+
Sbjct  241  IGHLSALVRFDAANCGLSGQ  260


 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 86/162 (53%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P++G L  L  L +  N LSG +PPE+  + +L+ ++LSNN      P   A L
Sbjct  257  LSGQIPPELGHLEHLDTLFLQVNGLSGELPPELGRLRSLKSMDLSNNALTGEIPPTFADL  316

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   GR   L+ L +S N 
Sbjct  317  RNLTLLNLFRNKLYGTIPDFIGDLPELEVLQLWDNNFTGIIPRGIGRSGKLQLLDLSSNK  376

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P E+ +  KL+ L I   N   G IP  +G    L R
Sbjct  377  LTGDLPPELCSGNKLQTL-IALANALFGPIPQSLGECLSLSR  417


 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 92/174 (53%), Gaps = 2/174 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            LSG + P++G L  L  L +   N   G +PPEI  +S L   + +N       P +L  
Sbjct  208  LSGAIPPEIGNLTRLRQLYVGYFNSYDGGIPPEIGHLSALVRFDAANCGLSGQIPPELGH  267

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L +L  L L  N L+G+LP E+ ++ SL+ + L  N  +G IPP +    NL  L +  N
Sbjct  268  LEHLDTLFLQVNGLSGELPPELGRLRSLKSMDLSNNALTGEIPPTFADLRNLTLLNLFRN  327

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
             L G IP  IG+L +L+ L + + N F+G IP  +G   +L   D ++  LTG+
Sbjct  328  KLYGTIPDFIGDLPELEVLQL-WDNNFTGIIPRGIGRSGKLQLLDLSSNKLTGD  380


 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 57/173 (33%), Positives = 88/173 (51%), Gaps = 1/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L P++G+L  L ++ ++ N L+G +PP  + +  L  LNL  N    T P  +  L
Sbjct  281  LSGELPPELGRLRSLKSMDLSNNALTGEIPPTFADLRNLTLLNLFRNKLYGTIPDFIGDL  340

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L+VL L++NN TG +P  + +   L+ L L  N  +G +PPE      L+ L    N 
Sbjct  341  PELEVLQLWDNNFTGIIPRGIGRSGKLQLLDLSSNKLTGDLPPELCSGNKLQTLIALANA  400

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            L G IP  +G    L  + +G  N  +G IP  + +L  L + +  +  L GE
Sbjct  401  LFGPIPQSLGECLSLSRVRLGE-NYLNGSIPRGLFSLPNLAQVELQDNLLAGE  452


 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 79/153 (52%), Gaps = 1/153 (1%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
             G + P++G L  LV    A   LSG +PPE+  +  L  L L  N      P +L +L 
Sbjct  234  DGGIPPEIGHLSALVRFDAANCGLSGQIPPELGHLEHLDTLFLQVNGLSGELPPELGRLR  293

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
            +L+ +DL NN LTG++P     + +L  L+L  N   G IP   G  P LE L +  N  
Sbjct  294  SLKSMDLSNNALTGEIPPTFADLRNLTLLNLFRNKLYGTIPDFIGDLPELEVLQLWDNNF  353

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            +G+IP  IG   KL+ L +   N  +G +PPE+
Sbjct  354  TGIIPRGIGRSGKLQLLDLSS-NKLTGDLPPEL  385


 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 70/126 (56%), Gaps = 0/126 (0%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L P +G    +  L +  NQ SG +PPEI  +  L  ++ S+N F S  P ++++ 
Sbjct  475  LSGPLPPSIGNFSGVQKLLLNQNQFSGRIPPEIGRLQQLSKVDFSSNRFSSGIPPEISKC  534

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  +DL  NNL+GD+P E+  M  L +L+L  N+  G IPP      +L  +  S N 
Sbjct  535  KLLTFVDLSRNNLSGDIPAEIAGMRILNYLNLSRNHLEGSIPPSISTMQSLTAVDFSYNN  594

Query  449  LSGVIP  466
            LSG++P
Sbjct  595  LSGLVP  600


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 58/176 (33%), Positives = 84/176 (48%), Gaps = 3/176 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P++     L  L   AN L GP+P  +    +L  + L  N    + P  L  
Sbjct  376  KLTGDLPPELCSGNKLQTLIALANALFGPIPQSLGECLSLSRVRLGENYLNGSIPRGLFS  435

Query  266  LANLQVLDLYNNNLTGDLPV--EVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  439
            L NL  ++L +N L G+ P   +V     L  + L  N  SG +PP  G F  ++ L ++
Sbjct  436  LPNLAQVELQDNLLAGEFPDTGDVSISLGLGQISLSNNRLSGPLPPSIGNFSGVQKLLLN  495

Query  440  GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
             N  SG IP EIG L +L ++     N FS GIPPE+     L   D +   L+G+
Sbjct  496  QNQFSGRIPPEIGRLQQLSKVDFSS-NRFSSGIPPEISKCKLLTFVDLSRNNLSGD  550


 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 50/148 (34%), Positives = 72/148 (49%), Gaps = 4/148 (3%)
 Frame = +2

Query  107  PDVGQLPF---LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  277
            PD G +     L  +S++ N+LSGP+PP I   S ++ L L+ N F    P ++ +L  L
Sbjct  454  PDTGDVSISLGLGQISLSNNRLSGPLPPSIGNFSGVQKLLLNQNQFSGRIPPEIGRLQQL  513

Query  278  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSG  457
              +D  +N  +  +P E+ K   L  + L  N  SG IP E      L YL +S N L G
Sbjct  514  SKVDFSSNRFSSGIPPEISKCKLLTFVDLSRNNLSGDIPAEIAGMRILNYLNLSRNHLEG  573

Query  458  VIPSEIGNLTKLKELYIGYFNGFSGGIP  541
             IP  I  +  L  +   Y N  SG +P
Sbjct  574  SIPPSISTMQSLTAVDFSY-NNLSGLVP  600



>ref|XP_006650665.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Oryza brachyantha]
Length=1021

 Score =   232 bits (591),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 155/202 (77%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPP  181
            N STSHC+W  VTC S   VV LD+SG NLSG L  ++ +L  L+ L++ AN  SGP+P 
Sbjct  46   NTSTSHCSWAGVTCSSRGTVVGLDVSGFNLSGALPAELSRLRGLLRLAVGANAFSGPIPG  105

Query  182  EISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLH  361
             +  +  L +LNLSNN F  +FP  LA+L  L+VLDLYNNNLT  LP+EV +M  LRHLH
Sbjct  106  SLGRLQFLTYLNLSNNAFNGSFPAALARLRGLRVLDLYNNNLTSPLPMEVVQMPLLRHLH  165

Query  362  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            LGGN+FSG IPPEYGR+  ++YLAVSGN LSG IP E+GNLT L+ELYIGY+N +SGG+P
Sbjct  166  LGGNFFSGEIPPEYGRWGRMQYLAVSGNELSGRIPPELGNLTSLRELYIGYYNSYSGGLP  225

Query  542  PEMGNLSQLIRXDAANCGLTGE  607
            PE+GNL++LIR DAANCGL+GE
Sbjct  226  PELGNLTELIRLDAANCGLSGE  247


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 96/175 (55%), Gaps = 4/175 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +G +   +G+   L  L +++N+L+G +PPE+ A   +   + L N +FG+  P  L 
Sbjct  339  NFTGGVPRRLGRNGRLQLLDLSSNRLTGTLPPELCAGGKMHTLIALGNFLFGA-IPDSLG  397

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYG-RFPNLEYLAVS  439
            +  +L  + L  N L G +P  ++++  L  + L  N  +G  P   G   PNL  +++S
Sbjct  398  ECRSLSRVRLGENYLNGSIPKGLFELPKLTQVELQDNLLTGNFPAVSGVAAPNLGEISLS  457

Query  440  GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             N L+G +P+ IGN + +++L +   N FSG +PPE+G L QL + D ++    G
Sbjct  458  NNQLTGALPASIGNFSGVQKLLLDR-NSFSGVVPPEIGQLQQLSKADLSSNAFEG  511


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 87/162 (54%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P++G+L  L  L +  N L+G +P E+  + +L  L+LSNN+     P   ++L
Sbjct  244  LSGEIPPELGKLQNLDTLFLQVNGLTGGIPSELGYLKSLSSLDLSNNVLTGEIPASFSEL  303

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G +P   GR   L+ L +S N 
Sbjct  304  KNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVPRRLGRNGRLQLLDLSSNR  363

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P E+    K+  L I   N   G IP  +G    L R
Sbjct  364  LTGTLPPELCAGGKMHTL-IALGNFLFGAIPDSLGECRSLSR  404


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 76/151 (50%), Gaps = 7/151 (5%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            +SGV +P++G++      S++ NQL+G +P  I   S ++ L L  N F    P ++ QL
Sbjct  443  VSGVAAPNLGEI------SLSNNQLTGALPASIGNFSGVQKLLLDRNSFSGVVPPEIGQL  496

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L   DL +N   G +P E+ K   L +L L  N  SG+IPP       L YL +S N 
Sbjct  497  QQLSKADLSSNAFEGGVPPEIGKCRLLTYLDLSRNNISGKIPPAISGMRILNYLNLSRNH  556

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            L G IP  I  +  L  +   Y N  SG +P
Sbjct  557  LDGEIPPSIATMQSLTAVDFSY-NNLSGLVP  586


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/177 (31%), Positives = 87/177 (49%), Gaps = 8/177 (5%)
 Frame = +2

Query  89   LSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  259
            L+G L P++   G++  L+ L    N L G +P  +    +L  + L  N    + P  L
Sbjct  364  LTGTLPPELCAGGKMHTLIAL---GNFLFGAIPDSLGECRSLSRVRLGENYLNGSIPKGL  420

Query  260  AQLANLQVLDLYNNNLTGDLP-VEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  436
             +L  L  ++L +N LTG+ P V      +L  + L  N  +G +P   G F  ++ L +
Sbjct  421  FELPKLTQVELQDNLLTGNFPAVSGVAAPNLGEISLSNNQLTGALPASIGNFSGVQKLLL  480

Query  437  SGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              N  SGV+P EIG L +L +  +   N F GG+PPE+G    L   D +   ++G+
Sbjct  481  DRNSFSGVVPPEIGQLQQLSKADLSS-NAFEGGVPPEIGKCRLLTYLDLSRNNISGK  536


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 64/127 (50%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L   +G    +  L +  N  SG VPPEI  +  L   +LS+N F    P ++ +
Sbjct  460  QLTGALPASIGNFSGVQKLLLDRNSFSGVVPPEIGQLQQLSKADLSSNAFEGGVPPEIGK  519

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  LDL  NN++G +P  +  M  L +L+L  N+  G IPP      +L  +  S N
Sbjct  520  CRLLTYLDLSRNNISGKIPPAISGMRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYN  579

Query  446  GLSGVIP  466
             LSG++P
Sbjct  580  NLSGLVP  586


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 58/163 (36%), Positives = 84/163 (52%), Gaps = 4/163 (2%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
            SG L P++G L  L+ L  A   LSG +PPE+  +  L  L L  N      P +L  L 
Sbjct  221  SGGLPPELGNLTELIRLDAANCGLSGEIPPELGKLQNLDTLFLQVNGLTGGIPSELGYLK  280

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
            +L  LDL NN LTG++P    ++ +L  L+L  N   G IP   G  P+LE L +  N  
Sbjct  281  SLSSLDLSNNVLTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNF  340

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM---GNLSQLI  571
            +G +P  +G   +L+ L +   N  +G +PPE+   G +  LI
Sbjct  341  TGGVPRRLGRNGRLQLLDLSS-NRLTGTLPPELCAGGKMHTLI  382


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 63/125 (50%), Gaps = 2/125 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            + SGV+ P++GQL  L    +++N   G VPPEI     L +L+LS N      P  ++ 
Sbjct  484  SFSGVVPPEIGQLQQLSKADLSSNAFEGGVPPEIGKCRLLTYLDLSRNNISGKIPPAISG  543

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            +  L  L+L  N+L G++P  +  M SL  +    N  SG +P   G+F      +  GN
Sbjct  544  MRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLVPGT-GQFSYFNATSFIGN  602

Query  446  -GLSG  457
             GL G
Sbjct  603  PGLCG  607



>emb|CDY08759.1| BnaA06g24650D [Brassica napus]
Length=971

 Score =   231 bits (590),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 143/201 (71%), Gaps = 26/201 (13%)
 Frame = +2

Query  8    STSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEI  187
            +TS CTW  VTC                      DV +     NLS+A NQ+SGP+PPEI
Sbjct  51   TTSFCTWTGVTC----------------------DVSRRH---NLSLADNQISGPIPPEI  85

Query  188  SAISTLRFLNLSNNIFGSTFPHQLAQ-LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHL  364
            S +S LR LNLSNN+F  +FP +++  LANL+VLD+YNNN+TGDLP+ V  +T LRHLHL
Sbjct  86   SNLSGLRHLNLSNNVFNGSFPDKISSGLANLRVLDVYNNNMTGDLPLSVTNLTQLRHLHL  145

Query  365  GGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPP  544
            GGNYF+G IPP YG +P +EYLAVSGN L+G IP EIGNLT L+ELYIGYFN F  G+PP
Sbjct  146  GGNYFAGEIPPSYGTWPEIEYLAVSGNELTGKIPPEIGNLTTLRELYIGYFNAFEDGLPP  205

Query  545  EMGNLSQLIRXDAANCGLTGE  607
            E+GNLS+L+R DAANC L GE
Sbjct  206  EIGNLSELVRFDAANCALNGE  226


 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/162 (34%), Positives = 87/162 (54%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   + L
Sbjct  223  LNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLKSMDLSNNMFTGEIPASFSDL  282

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G++P  + ++  L  L L  N F+G IP + G    L  + +S N 
Sbjct  283  KNLTLLNLFRNKLHGEIPEFIGELPDLEVLQLWENNFTGSIPEKLGENGRLHLVDLSSNK  342

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P  +    KL+ L I   N   G IP  +G    L R
Sbjct  343  LTGTLPPNMCAGNKLETL-ITLGNFLFGSIPESLGRCESLTR  383


 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 85/174 (49%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P++     L  L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  342  KLTGTLPPNMCAGNKLETLITLGNFLFGSIPESLGRCESLTRIRMGENFLNGSIPKGLFG  401

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N LTG+LPV      +L  L L  N  SG++PP  G F  ++ L + GN
Sbjct  402  LPKLTQVELQDNYLTGELPVTGSVSVNLGQLSLSNNQLSGQLPPAIGNFTGVQKLLLDGN  461

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
               G IPSE+G L +L ++   + N FSGGI PE+     L   D +   L+GE
Sbjct  462  KFEGPIPSEVGKLQQLSKIDFSH-NLFSGGIAPEISRCKLLTFVDLSRNELSGE  514


 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 78/150 (52%), Gaps = 1/150 (1%)
 Frame = +2

Query  101  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  280
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N+F      +L +L++L+
Sbjct  203  LPPEIGNLSELVRFDAANCALNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLK  262

Query  281  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  460
             +DL NN  TG++P     + +L  L+L  N   G IP   G  P+LE L +  N  +G 
Sbjct  263  SMDLSNNMFTGEIPASFSDLKNLTLLNLFRNKLHGEIPEFIGELPDLEVLQLWENNFTGS  322

Query  461  IPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            IP ++G   +L  + +   N  +G +PP M
Sbjct  323  IPEKLGENGRLHLVDLSS-NKLTGTLPPNM  351


 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 94/197 (48%), Gaps = 26/197 (13%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  265
             +G + P  G  P +  L+++ N+L+G +PPEI  ++TLR L +   N F    P ++  
Sbjct  150  FAGEIPPSYGTWPEIEYLAVSGNELTGKIPPEIGNLTTLRELYIGYFNAFEDGLPPEIGN  209

Query  266  LANLQVLDLYNNNLTGDLPVEV------------------------YKMTSLRHLHLGGN  373
            L+ L   D  N  L G++P E+                         K++SL+ + L  N
Sbjct  210  LSELVRFDAANCALNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLKSMDLSNN  269

Query  374  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
             F+G IP  +    NL  L +  N L G IP  IG L  L+ L + + N F+G IP ++G
Sbjct  270  MFTGEIPASFSDLKNLTLLNLFRNKLHGEIPEFIGELPDLEVLQL-WENNFTGSIPEKLG  328

Query  554  NLSQLIRXDAANCGLTG  604
               +L   D ++  LTG
Sbjct  329  ENGRLHLVDLSSNKLTG  345


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 86/173 (50%), Gaps = 1/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
             SG L+ ++G+L  L ++ ++ N  +G +P   S +  L  LNL  N      P  + +L
Sbjct  247  FSGPLTWELGKLSSLKSMDLSNNMFTGEIPASFSDLKNLTLLNLFRNKLHGEIPEFIGEL  306

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             +L+VL L+ NN TG +P ++ +   L  + L  N  +G +PP       LE L   GN 
Sbjct  307  PDLEVLQLWENNFTGSIPEKLGENGRLHLVDLSSNKLTGTLPPNMCAGNKLETLITLGNF  366

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            L G IP  +G    L  + +G  N  +G IP  +  L +L + +  +  LTGE
Sbjct  367  LFGSIPESLGRCESLTRIRMGE-NFLNGSIPKGLFGLPKLTQVELQDNYLTGE  418


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 89/166 (54%), Gaps = 3/166 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +G +   +G+   L  + +++N+L+G +PP + A + L   + L N +FGS  P  L 
Sbjct  318  NFTGSIPEKLGENGRLHLVDLSSNKLTGTLPPNMCAGNKLETLITLGNFLFGS-IPESLG  376

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            +  +L  + +  N L G +P  ++ +  L  + L  NY +G +P       NL  L++S 
Sbjct  377  RCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLTGELPVTGSVSVNLGQLSLSN  436

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXD  580
            N LSG +P  IGN T +++L +   N F G IP E+G L QL + D
Sbjct  437  NQLSGQLPPAIGNFTGVQKLLLDG-NKFEGPIPSEVGKLQQLSKID  481


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 66/127 (52%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             LSG L P +G    +  L +  N+  GP+P E+  +  L  ++ S+N+F      ++++
Sbjct  438  QLSGQLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNLFSGGIAPEISR  497

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  +DL  N L+G++P E+  M  L +L+L  N+  G IP       +L  L  S N
Sbjct  498  CKLLTFVDLSRNELSGEIPKEITGMKILNYLNLSRNHLIGSIPGSISSMQSLTSLDFSYN  557

Query  446  GLSGVIP  466
             LSG++P
Sbjct  558  NLSGLVP  564


 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 78/172 (45%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G +   +  LP L  + +  N L+G +P   S    L  L+LSNN      P  +   
Sbjct  391  LNGSIPKGLFGLPKLTQVELQDNYLTGELPVTGSVSVNLGQLSLSNNQLSGQLPPAIGNF  450

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              +Q L L  N   G +P EV K+  L  +    N FSG I PE  R   L ++ +S N 
Sbjct  451  TGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNLFSGGIAPEISRCKLLTFVDLSRNE  510

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            LSG IP EI  +  L  L +   N   G IP  + ++  L   D +   L+G
Sbjct  511  LSGEIPKEITGMKILNYLNLSR-NHLIGSIPGSISSMQSLTSLDFSYNNLSG  561


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 75/151 (50%), Gaps = 7/151 (5%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            ++G +S ++GQL      S++ NQLSG +PP I   + ++ L L  N F    P ++ +L
Sbjct  421  VTGSVSVNLGQL------SLSNNQLSGQLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKL  474

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  +D  +N  +G +  E+ +   L  + L  N  SG IP E      L YL +S N 
Sbjct  475  QQLSKIDFSHNLFSGGIAPEISRCKLLTFVDLSRNELSGEIPKEITGMKILNYLNLSRNH  534

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            L G IP  I ++  L  L   Y N  SG +P
Sbjct  535  LIGSIPGSISSMQSLTSLDFSY-NNLSGLVP  564



>dbj|BAJ84911.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96166.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1020

 Score =   231 bits (590),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 147/203 (72%), Gaps = 1/203 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVP  178
            N ST  C W  V+CD     V        NLSG +     +LP+L  L++AAN LSGP+P
Sbjct  47   NASTGPCAWSGVSCDGRSGAVVGVDLSGRNLSGAVPRAFSRLPYLARLNLAANSLSGPIP  106

Query  179  PEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHL  358
            P +S +  L +LNLS+N+   +FP  LA+L  L+VLDLYNNN TG LP+EV  M  LRHL
Sbjct  107  PSLSRLGLLTYLNLSSNLLNGSFPPPLARLRALRVLDLYNNNFTGSLPLEVVGMAQLRHL  166

Query  359  HLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGI  538
            HLGGN+FSG IPPEYGR+  L+YLAVSGN LSG IP E+GNLT L++LYIGY+N +SGGI
Sbjct  167  HLGGNFFSGEIPPEYGRWGRLQYLAVSGNELSGKIPPELGNLTSLRQLYIGYYNNYSGGI  226

Query  539  PPEMGNLSQLIRXDAANCGLTGE  607
            P E+GN+++L+R DAANCGL+GE
Sbjct  227  PAELGNMTELVRLDAANCGLSGE  249


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 85/175 (49%), Gaps = 2/175 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-A  262
            +L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N+   +FP  + A
Sbjct  389  SLFGPIPDSLGKCKALTRVRLGENFLNGSIPEGLFELPNLTQVELQDNLLSGSFPAVVSA  448

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
               NL  + L NN LTG LP  +   + L+ L L  N F+G IPPE GR   L    +SG
Sbjct  449  GGPNLGGISLSNNQLTGSLPASIGSFSGLQKLLLDQNAFTGAIPPEIGRLQQLSKADLSG  508

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            N   G +PSEIG    L  L +   N  SG IPP +  +  L   + +   L GE
Sbjct  509  NSFDGGVPSEIGKCRLLTYLDVSQ-NKLSGDIPPAISGMRILNYLNLSRNQLDGE  562


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 56/189 (30%), Positives = 87/189 (46%), Gaps = 26/189 (14%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L G +   VG LP L  L +  N  +G +P  +      + L+LS+N    T P +L   
Sbjct  318  LRGDIPQFVGDLPGLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNRLTGTLPPELCAG  377

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEY-------  427
              L+ L    N+L G +P  + K  +L  + LG N+ +G IP      PNL         
Sbjct  378  GKLETLIALGNSLFGPIPDSLGKCKALTRVRLGENFLNGSIPEGLFELPNLTQVELQDNL  437

Query  428  ------------------LAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
                              +++S N L+G +P+ IG+ + L++L +   N F+G IPPE+G
Sbjct  438  LSGSFPAVVSAGGPNLGGISLSNNQLTGSLPASIGSFSGLQKLLLDQ-NAFTGAIPPEIG  496

Query  554  NLSQLIRXD  580
             L QL + D
Sbjct  497  RLQQLSKAD  505


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 81/162 (50%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P++G L  L  L +  N L+G +PP +  + +L  L+LSNN      P     L
Sbjct  246  LSGEIPPELGNLAKLDTLFLQVNGLTGGIPPVLGRLGSLSSLDLSNNALSGEIPATFVAL  305

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL + +L+ N L GD+P  V  +  L  L L  N F+G IP   GR    + L +S N 
Sbjct  306  KNLTLFNLFRNRLRGDIPQFVGDLPGLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNR  365

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P E+    KL+ L I   N   G IP  +G    L R
Sbjct  366  LTGTLPPELCAGGKLETL-IALGNSLFGPIPDSLGKCKALTR  406


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 56/167 (34%), Positives = 81/167 (49%), Gaps = 4/167 (2%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G + P +G+L  L +L ++ N LSG +P    A+  L   NL  N      P  +  L
Sbjct  270  LTGGIPPVLGRLGSLSSLDLSNNALSGEIPATFVALKNLTLFNLFRNRLRGDIPQFVGDL  329

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L+VL L+ NN TG +P  + +    + L L  N  +G +PPE      LE L   GN 
Sbjct  330  PGLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNRLTGTLPPELCAGGKLETLIALGNS  389

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPP---EMGNLSQLIRXD  580
            L G IP  +G    L  + +G  N  +G IP    E+ NL+Q+   D
Sbjct  390  LFGPIPDSLGKCKALTRVRLGE-NFLNGSIPEGLFELPNLTQVELQD  435


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            +  G +  ++G+   L  L ++ N+LSG +PP IS +  L +LNLS N      P  +A 
Sbjct  510  SFDGGVPSEIGKCRLLTYLDVSQNKLSGDIPPAISGMRILNYLNLSRNQLDGEIPVTIAA  569

Query  266  LANLQVLDLYNNNLTGDLPV  325
            + +L  +D   NNL+G +PV
Sbjct  570  MQSLTAVDFSYNNLSGLVPV  589



>ref|XP_010941985.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=1024

 Score =   231 bits (590),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 128/203 (63%), Positives = 157/203 (77%), Gaps = 1/203 (0%)
 Frame = +2

Query  2    NISTSHC-TWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVP  178
            + +  HC  W  V CD+   VVSL++S LNLSG L P V +L  L+ LS AANQLSGP+P
Sbjct  51   DAAADHCQAWVGVACDAAGRVVSLNISNLNLSGPLPPAVSRLRSLLRLSTAANQLSGPIP  110

Query  179  PEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHL  358
            PE+S +S LRFLNLSNN F  TFP  L++L NL VLDLYNNNLTG LP+EV ++ +LRHL
Sbjct  111  PELSLLSGLRFLNLSNNAFNETFPSALSRLKNLHVLDLYNNNLTGVLPLEVAELPALRHL  170

Query  359  HLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGI  538
            HLGGN+FSG IPPEYGR+ +LEYLAVSGN L G IP E+GN+T L+ELYIGYFN F G +
Sbjct  171  HLGGNFFSGAIPPEYGRWEHLEYLAVSGNELGGPIPPELGNVTTLRELYIGYFNSFQGSL  230

Query  539  PPEMGNLSQLIRXDAANCGLTGE  607
            P  +GN++ L+R DAANCGL+G+
Sbjct  231  PAAIGNITALVRLDAANCGLSGK  253


 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 83/162 (51%), Gaps = 2/162 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            NL+GVL  +V +LP L +L +  N  SG +PPE      L +L +S N  G   P +L  
Sbjct  152  NLTGVLPLEVAELPALRHLHLGGNFFSGAIPPEYGRWEHLEYLAVSGNELGGPIPPELGN  211

Query  266  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            +  L+ L + Y N+  G LP  +  +T+L  L       SG+IPPE G   NL+ L +  
Sbjct  212  VTTLRELYIGYFNSFQGSLPAAIGNITALVRLDAANCGLSGKIPPEIGNLQNLDTLFLQV  271

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQL  568
            NGLSG I  E+G L  LK + +   N  +G IP     L  L
Sbjct  272  NGLSGGITPELGMLRSLKSMDLSN-NALTGEIPRTFAELKNL  312


 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 83/162 (51%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P++G L  L  L +  N LSG + PE+  + +L+ ++LSNN      P   A+L
Sbjct  250  LSGKIPPEIGNLQNLDTLFLQVNGLSGGITPELGMLRSLKSMDLSNNALTGEIPRTFAEL  309

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   G    L+ L +S N 
Sbjct  310  KNLTLLNLFRNRLHGAIPDLIGDLPRLEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNK  369

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P  + +   L+ L I   N   G IP  +G    L R
Sbjct  370  LTGSLPPNLCSGNNLQVL-IALGNFLFGSIPESLGRCKSLSR  410


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 86/172 (50%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG ++P++G L  L ++ ++ N L+G +P   + +  L  LNL  N      P  +  L
Sbjct  274  LSGGITPELGMLRSLKSMDLSNNALTGEIPRTFAELKNLTLLNLFRNRLHGAIPDLIGDL  333

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L+VL L+ NN TG++P  +     L+ L L  N  +G +PP      NL+ L   GN 
Sbjct  334  PRLEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNKLTGSLPPNLCSGNNLQVLIALGNF  393

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            L G IP  +G    L  + +G  N  +G IP  + +L  L + +  +  LTG
Sbjct  394  LFGSIPESLGRCKSLSRIRMGE-NYLNGSIPSGLFSLPNLAQVELQDNLLTG  444


 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 58/190 (31%), Positives = 85/190 (45%), Gaps = 27/190 (14%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L G +   +G LP L  L +  N  +G +P  +     L+ L+LS+N    + P  L   
Sbjct  322  LHGAIPDLIGDLPRLEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNKLTGSLPPNLCSG  381

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLE--------  424
             NLQVL    N L G +P  + +  SL  + +G NY +G IP      PNL         
Sbjct  382  NNLQVLIALGNFLFGSIPESLGRCKSLSRIRMGENYLNGSIPSGLFSLPNLAQVELQDNL  441

Query  425  ------------------YLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
                               +++S N LSG +P  IG  + +++L +   N FSG IP E+
Sbjct  442  LTGGFPETAGSSISSTLGQISLSNNRLSGALPPSIGKFSGVQKLLLNQ-NQFSGRIPLEI  500

Query  551  GNLSQLIRXD  580
            G L QL + D
Sbjct  501  GRLQQLSKMD  510


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/155 (34%), Positives = 76/155 (49%), Gaps = 1/155 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            +  G L   +G +  LV L  A   LSG +PPEI  +  L  L L  N        +L  
Sbjct  225  SFQGSLPAAIGNITALVRLDAANCGLSGKIPPEIGNLQNLDTLFLQVNGLSGGITPELGM  284

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L +L+ +DL NN LTG++P    ++ +L  L+L  N   G IP   G  P LE L +  N
Sbjct  285  LRSLKSMDLSNNALTGEIPRTFAELKNLTLLNLFRNRLHGAIPDLIGDLPRLEVLQLWEN  344

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
              +G IP  +G   +L+ L +   N  +G +PP +
Sbjct  345  NFTGEIPRRLGTNGRLQLLDLSS-NKLTGSLPPNL  378


 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 65/126 (52%), Gaps = 0/126 (0%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L P +G+   +  L +  NQ SG +P EI  +  L  ++ S N F      ++ + 
Sbjct  468  LSGALPPSIGKFSGVQKLLLNQNQFSGRIPLEIGRLQQLSKMDFSGNRFSGPITPEIRKC  527

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  +DL  NNL+G++P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  528  KLLTFVDLSRNNLSGEIPAEITGMRILNYLNLSRNHLEGEIPASISTMQSLTAVDFSYNN  587

Query  449  LSGVIP  466
            LSG++P
Sbjct  588  LSGLVP  593


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 84/174 (48%), Gaps = 3/174 (2%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEI--SAISTLRFLNLSNNIFGSTFPHQLA  262
            L+G +   +  LP L  + +  N L+G  P     S  STL  ++LSNN      P  + 
Sbjct  418  LNGSIPSGLFSLPNLAQVELQDNLLTGGFPETAGSSISSTLGQISLSNNRLSGALPPSIG  477

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            + + +Q L L  N  +G +P+E+ ++  L  +   GN FSG I PE  +   L ++ +S 
Sbjct  478  KFSGVQKLLLNQNQFSGRIPLEIGRLQQLSKMDFSGNRFSGPITPEIRKCKLLTFVDLSR  537

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            N LSG IP+EI  +  L  L +   N   G IP  +  +  L   D +   L+G
Sbjct  538  NNLSGEIPAEITGMRILNYLNLSR-NHLEGEIPASISTMQSLTAVDFSYNNLSG  590


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 56/176 (32%), Positives = 81/176 (46%), Gaps = 3/176 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P++     L  L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  369  KLTGSLPPNLCSGNNLQVLIALGNFLFGSIPESLGRCKSLSRIRMGENYLNGSIPSGLFS  428

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTS--LRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  439
            L NL  ++L +N LTG  P       S  L  + L  N  SG +PP  G+F  ++ L ++
Sbjct  429  LPNLAQVELQDNLLTGGFPETAGSSISSTLGQISLSNNRLSGALPPSIGKFSGVQKLLLN  488

Query  440  GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
             N  SG IP EIG L +L ++     N FSG I PE+     L   D +   L+GE
Sbjct  489  QNQFSGRIPLEIGRLQQLSKMDFSG-NRFSGPITPEIRKCKLLTFVDLSRNNLSGE  543


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 67/137 (49%), Gaps = 1/137 (1%)
 Frame = +2

Query  131  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  310
            L  +S++ N+LSG +PP I   S ++ L L+ N F    P ++ +L  L  +D   N  +
Sbjct  458  LGQISLSNNRLSGALPPSIGKFSGVQKLLLNQNQFSGRIPLEIGRLQQLSKMDFSGNRFS  517

Query  311  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTK  490
            G +  E+ K   L  + L  N  SG IP E      L YL +S N L G IP+ I  +  
Sbjct  518  GPITPEIRKCKLLTFVDLSRNNLSGEIPAEITGMRILNYLNLSRNHLEGEIPASISTMQS  577

Query  491  LKELYIGYFNGFSGGIP  541
            L  +   Y N  SG +P
Sbjct  578  LTAVDFSY-NNLSGLVP  593



>ref|XP_009394620.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1003

 Score =   231 bits (589),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 154/199 (77%), Gaps = 1/199 (1%)
 Frame = +2

Query  11   TSHCTWRRVTCd-sllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEI  187
              HC+W  V CD     VVSLDLSGLNLSG LSP VG+L  L+NLS+A+N LSGP+P ++
Sbjct  57   VDHCSWPGVACDPLRGSVVSLDLSGLNLSGTLSPAVGRLRHLLNLSVASNSLSGPIPADL  116

Query  188  SAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLG  367
            S ++ LR LNLS+N+   +FP  LA L NL VLDLYNNNLTG LP EV ++ +LRHLHLG
Sbjct  117  SRLADLRHLNLSDNLLNGSFPSALAHLKNLLVLDLYNNNLTGPLPAEVAELPNLRHLHLG  176

Query  368  GNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPE  547
            GN+F+G IPPE+G +  LEYLAVSGN L G IP E+GNLT+L++LY+GYFN F GGIPPE
Sbjct  177  GNFFTGVIPPEFGGWEFLEYLAVSGNDLGGPIPPELGNLTRLRQLYVGYFNSFVGGIPPE  236

Query  548  MGNLSQLIRXDAANCGLTG  604
            +G L+ L+R D ANCGL+G
Sbjct  237  IGRLAALVRLDMANCGLSG  255


 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 85/162 (52%), Gaps = 2/162 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            NL+G L  +V +LP L +L +  N  +G +PPE      L +L +S N  G   P +L  
Sbjct  155  NLTGPLPAEVAELPNLRHLHLGGNFFTGVIPPEFGGWEFLEYLAVSGNDLGGPIPPELGN  214

Query  266  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            L  L+ L + Y N+  G +P E+ ++ +L  L +     SG IPPE G   NL+ L +  
Sbjct  215  LTRLRQLYVGYFNSFVGGIPPEIGRLAALVRLDMANCGLSGAIPPELGNLQNLDTLFLQV  274

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQL  568
            NGL+G IPS +G L  LK + I   N  +G IP    +L  L
Sbjct  275  NGLAGDIPSALGRLRSLKSMDISN-NALTGEIPSTFADLQNL  315


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 80/152 (53%), Gaps = 1/152 (1%)
 Frame = +2

Query  95   GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  274
            G + P++G+L  LV L +A   LSG +PPE+  +  L  L L  N      P  L +L +
Sbjct  231  GGIPPEIGRLAALVRLDMANCGLSGAIPPELGNLQNLDTLFLQVNGLAGDIPSALGRLRS  290

Query  275  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  454
            L+ +D+ NN LTG++P     + +L  L+L  N   G IP   G  P LE L +  N  +
Sbjct  291  LKSMDISNNALTGEIPSTFADLQNLTLLNLFRNKLQGSIPECVGDLPALEVLQLWENNFT  350

Query  455  GVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            G IP  +G   +L+ L +   N  +G +PP++
Sbjct  351  GGIPQRLGESARLQLLDVSS-NKLTGNLPPDL  381


 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 85/172 (49%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G +   +G+L  L ++ I+ N L+G +P   + +  L  LNL  N    + P  +  L
Sbjct  277  LAGDIPSALGRLRSLKSMDISNNALTGEIPSTFADLQNLTLLNLFRNKLQGSIPECVGDL  336

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L+VL L+ NN TG +P  + +   L+ L +  N  +G +PP+      L+ L V  N 
Sbjct  337  PALEVLQLWENNFTGGIPQRLGESARLQLLDVSSNKLTGNLPPDLCSGNRLQTLIVLRNF  396

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            L G IP  +G    L  + +G  N  +  IP  + +L +L + +  +  LTG
Sbjct  397  LFGPIPETLGRCESLGRIRMGQ-NYLNASIPDALFSLPKLSQIELEDNLLTG  447


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 57/199 (29%), Positives = 88/199 (44%), Gaps = 27/199 (14%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L G +   VG LP L  L +  N  +G +P  +   + L+ L++S+N      P  L  
Sbjct  324  KLQGSIPECVGDLPALEVLQLWENNFTGGIPQRLGESARLQLLDVSSNKLTGNLPPDLCS  383

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP-----------------  394
               LQ L +  N L G +P  + +  SL  + +G NY +  IP                 
Sbjct  384  GNRLQTLIVLRNFLFGPIPETLGRCESLGRIRMGQNYLNASIPDALFSLPKLSQIELEDN  443

Query  395  ------PEYGRF---PNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPE  547
                  P+ G     P+L  + +S N LSG +P  IG  + +++L +   N FSG IPPE
Sbjct  444  LLTGGFPDTGNAAISPDLGLINLSNNRLSGPLPRSIGKYSGVQKLLLNQ-NQFSGRIPPE  502

Query  548  MGNLSQLIRXDAANCGLTG  604
             G L +L + D +    +G
Sbjct  503  TGRLQELCKLDLSGNRFSG  521


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 69/142 (49%), Gaps = 6/142 (4%)
 Frame = +2

Query  95   GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  274
              +SPD+G    L+NLS   N+LSGP+P  I   S ++ L L+ N F    P +  +L  
Sbjct  455  AAISPDLG----LINLS--NNRLSGPLPRSIGKYSGVQKLLLNQNQFSGRIPPETGRLQE  508

Query  275  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  454
            L  LDL  N  +G +  E+ +   L  + L  N  SG IPP+      L YL +S N L 
Sbjct  509  LCKLDLSGNRFSGPIAPEISRCKLLAFVDLSRNEISGEIPPDIAGMRILNYLNLSRNHLE  568

Query  455  GVIPSEIGNLTKLKELYIGYFN  520
            G IP  +  +  L  +   Y N
Sbjct  569  GSIPQSLATIQSLTAVDFSYNN  590


 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 54/176 (31%), Positives = 83/176 (47%), Gaps = 3/176 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L PD+     L  L +  N L GP+P  +    +L  + +  N   ++ P  L  
Sbjct  372  KLTGNLPPDLCSGNRLQTLIVLRNFLFGPIPETLGRCESLGRIRMGQNYLNASIPDALFS  431

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTS--LRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  439
            L  L  ++L +N LTG  P       S  L  ++L  N  SG +P   G++  ++ L ++
Sbjct  432  LPKLSQIELEDNLLTGGFPDTGNAAISPDLGLINLSNNRLSGPLPRSIGKYSGVQKLLLN  491

Query  440  GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
             N  SG IP E G L +L +L +   N FSG I PE+     L   D +   ++GE
Sbjct  492  QNQFSGRIPPETGRLQELCKLDLSG-NRFSGPIAPEISRCKLLAFVDLSRNEISGE  546


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/162 (30%), Positives = 77/162 (48%), Gaps = 4/162 (2%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L   +G+   +  L +  NQ SG +PPE   +  L  L+LS N F      ++++ 
Sbjct  471  LSGPLPRSIGKYSGVQKLLLNQNQFSGRIPPETGRLQELCKLDLSGNRFSGPIAPEISRC  530

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  +DL  N ++G++P ++  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  531  KLLAFVDLSRNEISGEIPPDIAGMRILNYLNLSRNHLEGSIPQSLATIQSLTAVDFSYNN  590

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            LSG++ S  G  +      +  F G  G   P +G  S  I+
Sbjct  591  LSGLV-SGTGQFSYFN---VSSFVGNPGLCGPYLGPCSSAIK  628



>ref|XP_002466378.1| hypothetical protein SORBIDRAFT_01g006690 [Sorghum bicolor]
 gb|EER93376.1| hypothetical protein SORBIDRAFT_01g006690 [Sorghum bicolor]
Length=1030

 Score =   230 bits (587),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 153/204 (75%), Gaps = 4/204 (2%)
 Frame = +2

Query  8    STSHCTWRRVTCd---sllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVP  178
            S+ HC W  VTC    S   VV LD+SGLNLSG L P + +L  L  LS+AAN   GP+P
Sbjct  54   SSDHCAWAGVTCAPRGSGGVVVGLDVSGLNLSGALPPALSRLRGLQRLSVAANGFYGPIP  113

Query  179  PEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT-GDLPVEVYKMTSLRH  355
            P ++ +  L  LNLSNN F  +FP  LA+L  L+VLDLYNNNLT   LP+EV  M  LRH
Sbjct  114  PSLARLQLLVHLNLSNNAFNGSFPPALARLRALRVLDLYNNNLTSATLPLEVTHMPMLRH  173

Query  356  LHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGG  535
            LHLGGN+FSG IPPEYGR+P L+YLAVSGN LSG IP E+GNLT L+ELYIGY+N ++GG
Sbjct  174  LHLGGNFFSGEIPPEYGRWPRLQYLAVSGNELSGKIPPELGNLTSLRELYIGYYNSYTGG  233

Query  536  IPPEMGNLSQLIRXDAANCGLTGE  607
            +PPE+GNL++L+R DAANCGL+GE
Sbjct  234  LPPELGNLTELVRLDAANCGLSGE  257


 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 97/175 (55%), Gaps = 4/175 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +G +   +G+   L  L +++N+L+G +PPE+ A   L+  + L N +FG+  P  L 
Sbjct  349  NFTGGVPRSLGRNGRLQLLDLSSNKLTGTLPPELCAGGKLQTLIALGNFLFGA-IPDSLG  407

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRF-PNLEYLAVS  439
            Q  +L  + L  N L G +P  ++++  L  + L  N  +G  P   G   PNL  +++S
Sbjct  408  QCKSLSRVRLGENYLNGSIPKGLFELPKLTQVELQDNLLTGNFPAVIGAAAPNLGEISLS  467

Query  440  GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             N L+G +P+ +GN + +++L +   N FSG IPPE+G L QL + D ++    G
Sbjct  468  NNQLTGALPASLGNFSGVQKLLLDQ-NAFSGAIPPEIGRLQQLSKADLSSNKFEG  521


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 87/162 (54%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P++G+L  L  L +  N L+G +P E+  + +L  L+LSNN      P   ++L
Sbjct  254  LSGEIPPELGRLQNLDTLFLQVNGLTGSIPSELGYLKSLSSLDLSNNALTGEIPASFSEL  313

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G +P   GR   L+ L +S N 
Sbjct  314  KNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVPRSLGRNGRLQLLDLSSNK  373

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P E+    KL+ L I   N   G IP  +G    L R
Sbjct  374  LTGTLPPELCAGGKLQTL-IALGNFLFGAIPDSLGQCKSLSR  414


 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 55/178 (31%), Positives = 86/178 (48%), Gaps = 8/178 (4%)
 Frame = +2

Query  86   NLSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  256
             L+G L P++   G+L  L+ L    N L G +P  +    +L  + L  N    + P  
Sbjct  373  KLTGTLPPELCAGGKLQTLIAL---GNFLFGAIPDSLGQCKSLSRVRLGENYLNGSIPKG  429

Query  257  LAQLANLQVLDLYNNNLTGDLPVEVYKMT-SLRHLHLGGNYFSGRIPPEYGRFPNLEYLA  433
            L +L  L  ++L +N LTG+ P  +     +L  + L  N  +G +P   G F  ++ L 
Sbjct  430  LFELPKLTQVELQDNLLTGNFPAVIGAAAPNLGEISLSNNQLTGALPASLGNFSGVQKLL  489

Query  434  VSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            +  N  SG IP EIG L +L +  +   N F GG+PPE+G    L   D +   L+G+
Sbjct  490  LDQNAFSGAIPPEIGRLQQLSKADLSS-NKFEGGVPPEIGKCRLLTYLDMSQNNLSGK  546


 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 85/163 (52%), Gaps = 4/163 (2%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
            +G L P++G L  LV L  A   LSG +PPE+  +  L  L L  N    + P +L  L 
Sbjct  231  TGGLPPELGNLTELVRLDAANCGLSGEIPPELGRLQNLDTLFLQVNGLTGSIPSELGYLK  290

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
            +L  LDL NN LTG++P    ++ +L  L+L  N   G IP   G  P+LE L +  N  
Sbjct  291  SLSSLDLSNNALTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNF  350

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM---GNLSQLI  571
            +G +P  +G   +L+ L +   N  +G +PPE+   G L  LI
Sbjct  351  TGGVPRSLGRNGRLQLLDLSS-NKLTGTLPPELCAGGKLQTLI  392


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 85/172 (49%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G +  ++G L  L +L ++ N L+G +P   S +  L  LNL  N      P  +  L
Sbjct  278  LTGSIPSELGYLKSLSSLDLSNNALTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDL  337

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             +L+VL L+ NN TG +P  + +   L+ L L  N  +G +PPE      L+ L   GN 
Sbjct  338  PSLEVLQLWENNFTGGVPRSLGRNGRLQLLDLSSNKLTGTLPPELCAGGKLQTLIALGNF  397

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            L G IP  +G    L  + +G  N  +G IP  +  L +L + +  +  LTG
Sbjct  398  LFGAIPDSLGQCKSLSRVRLGE-NYLNGSIPKGLFELPKLTQVELQDNLLTG  448


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 73/149 (49%), Gaps = 7/149 (5%)
 Frame = +2

Query  95   GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  274
            G  +P++G++      S++ NQL+G +P  +   S ++ L L  N F    P ++ +L  
Sbjct  455  GAAAPNLGEI------SLSNNQLTGALPASLGNFSGVQKLLLDQNAFSGAIPPEIGRLQQ  508

Query  275  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  454
            L   DL +N   G +P E+ K   L +L +  N  SG+IPP       L YL +S N L 
Sbjct  509  LSKADLSSNKFEGGVPPEIGKCRLLTYLDMSQNNLSGKIPPAISGMRILNYLNLSRNHLD  568

Query  455  GVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            G IP  I  +  L  +   Y N  SG +P
Sbjct  569  GEIPPSIATMQSLTAVDFSY-NNLSGLVP  596


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 64/127 (50%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L   +G    +  L +  N  SG +PPEI  +  L   +LS+N F    P ++ +
Sbjct  470  QLTGALPASLGNFSGVQKLLLDQNAFSGAIPPEIGRLQQLSKADLSSNKFEGGVPPEIGK  529

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  LD+  NNL+G +P  +  M  L +L+L  N+  G IPP      +L  +  S N
Sbjct  530  CRLLTYLDMSQNNLSGKIPPAISGMRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYN  589

Query  446  GLSGVIP  466
             LSG++P
Sbjct  590  NLSGLVP  596



>ref|XP_008665503.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Zea mays]
 tpg|DAA51666.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1034

 Score =   229 bits (584),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 152/205 (74%), Gaps = 5/205 (2%)
 Frame = +2

Query  8    STSHCTWRRVTCd----sllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPV  175
            S+ HC W  VTC         VV LD+SGLNLSG L P + +L  L  LS+AAN   GP+
Sbjct  47   SSDHCAWVGVTCAPRGSGGGVVVGLDVSGLNLSGALPPALSRLRGLQRLSVAANGFYGPI  106

Query  176  PPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT-GDLPVEVYKMTSLR  352
            PP ++ +  L  LNLSNN F  +FP  LA+L  L+VLDLYNNNLT   LP+EV  M  LR
Sbjct  107  PPSLARLQLLVHLNLSNNAFNGSFPPALARLRALRVLDLYNNNLTSATLPLEVTHMPMLR  166

Query  353  HLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSG  532
            HLHLGGN+FSG IPPEYGR+P L+YLAVSGN LSG IP E+GNLT L+ELYIGY+N ++G
Sbjct  167  HLHLGGNFFSGEIPPEYGRWPRLQYLAVSGNELSGKIPPELGNLTSLRELYIGYYNSYTG  226

Query  533  GIPPEMGNLSQLIRXDAANCGLTGE  607
            G+PPE+GNL++L+R DAANCGL+GE
Sbjct  227  GLPPELGNLTELVRLDAANCGLSGE  251


 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 97/175 (55%), Gaps = 4/175 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +G +   +G+   L  L +++N+L+G +PPE+ A   L+  + L N +FG+  P  L 
Sbjct  343  NFTGGVPRRLGRNGRLQLLDLSSNKLTGTLPPELCAGGKLQTLIALGNFLFGA-IPDSLG  401

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRF-PNLEYLAVS  439
            Q  +L  + L  N L G +P  ++++  L  + L  N  +G  P   G   PNL  +++S
Sbjct  402  QCKSLSRVRLGENYLNGSIPKGLFELPKLTQVELQDNLLTGNFPAVIGAAAPNLGEISLS  461

Query  440  GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             N L+G +P+ +GN + +++L +   N FSG IPPE+G L QL + D ++    G
Sbjct  462  NNQLTGALPASLGNFSGVQKLLLDQ-NAFSGAIPPEIGRLQQLSKADLSSNKFEG  515


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 87/162 (54%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P++G+L  L  L +  N L+G +P E+  + +L  L+LSNN      P   ++L
Sbjct  248  LSGEIPPELGRLQNLDTLFLQVNGLTGSIPSELGYLRSLSSLDLSNNALTGEIPASFSEL  307

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G +P   GR   L+ L +S N 
Sbjct  308  KNLTLLNLFRNKLRGDIPGFVGDLPSLEVLQLWENNFTGGVPRRLGRNGRLQLLDLSSNK  367

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P E+    KL+ L I   N   G IP  +G    L R
Sbjct  368  LTGTLPPELCAGGKLQTL-IALGNFLFGAIPDSLGQCKSLSR  408


 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 55/178 (31%), Positives = 86/178 (48%), Gaps = 8/178 (4%)
 Frame = +2

Query  86   NLSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  256
             L+G L P++   G+L  L+ L    N L G +P  +    +L  + L  N    + P  
Sbjct  367  KLTGTLPPELCAGGKLQTLIAL---GNFLFGAIPDSLGQCKSLSRVRLGENYLNGSIPKG  423

Query  257  LAQLANLQVLDLYNNNLTGDLPVEV-YKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLA  433
            L +L  L  ++L +N LTG+ P  +     +L  + L  N  +G +P   G F  ++ L 
Sbjct  424  LFELPKLTQVELQDNLLTGNFPAVIGAAAPNLGEISLSNNQLTGALPASLGNFSGVQKLL  483

Query  434  VSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            +  N  SG IP EIG L +L +  +   N F GG+PPE+G    L   D +   L+G+
Sbjct  484  LDQNAFSGAIPPEIGRLQQLSKADLSS-NKFEGGVPPEVGKCRLLTYLDMSQNNLSGK  540


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/149 (33%), Positives = 73/149 (49%), Gaps = 7/149 (5%)
 Frame = +2

Query  95   GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  274
            G  +P++G++      S++ NQL+G +P  +   S ++ L L  N F    P ++ +L  
Sbjct  449  GAAAPNLGEI------SLSNNQLTGALPASLGNFSGVQKLLLDQNAFSGAIPPEIGRLQQ  502

Query  275  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  454
            L   DL +N   G +P EV K   L +L +  N  SG+IPP       L YL +S N L 
Sbjct  503  LSKADLSSNKFEGGVPPEVGKCRLLTYLDMSQNNLSGKIPPAISGMRILNYLNLSRNHLD  562

Query  455  GVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            G IP  I  +  L  +   Y N  SG +P
Sbjct  563  GEIPPSIATMQSLTAVDFSY-NNLSGLVP  590


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 85/163 (52%), Gaps = 4/163 (2%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
            +G L P++G L  LV L  A   LSG +PPE+  +  L  L L  N    + P +L  L 
Sbjct  225  TGGLPPELGNLTELVRLDAANCGLSGEIPPELGRLQNLDTLFLQVNGLTGSIPSELGYLR  284

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
            +L  LDL NN LTG++P    ++ +L  L+L  N   G IP   G  P+LE L +  N  
Sbjct  285  SLSSLDLSNNALTGEIPASFSELKNLTLLNLFRNKLRGDIPGFVGDLPSLEVLQLWENNF  344

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM---GNLSQLI  571
            +G +P  +G   +L+ L +   N  +G +PPE+   G L  LI
Sbjct  345  TGGVPRRLGRNGRLQLLDLSS-NKLTGTLPPELCAGGKLQTLI  386


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 85/172 (49%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G +  ++G L  L +L ++ N L+G +P   S +  L  LNL  N      P  +  L
Sbjct  272  LTGSIPSELGYLRSLSSLDLSNNALTGEIPASFSELKNLTLLNLFRNKLRGDIPGFVGDL  331

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             +L+VL L+ NN TG +P  + +   L+ L L  N  +G +PPE      L+ L   GN 
Sbjct  332  PSLEVLQLWENNFTGGVPRRLGRNGRLQLLDLSSNKLTGTLPPELCAGGKLQTLIALGNF  391

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            L G IP  +G    L  + +G  N  +G IP  +  L +L + +  +  LTG
Sbjct  392  LFGAIPDSLGQCKSLSRVRLGE-NYLNGSIPKGLFELPKLTQVELQDNLLTG  442


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 64/127 (50%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L   +G    +  L +  N  SG +PPEI  +  L   +LS+N F    P ++ +
Sbjct  464  QLTGALPASLGNFSGVQKLLLDQNAFSGAIPPEIGRLQQLSKADLSSNKFEGGVPPEVGK  523

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  LD+  NNL+G +P  +  M  L +L+L  N+  G IPP      +L  +  S N
Sbjct  524  CRLLTYLDMSQNNLSGKIPPAISGMRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYN  583

Query  446  GLSGVIP  466
             LSG++P
Sbjct  584  NLSGLVP  590



>ref|XP_009396449.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1006

 Score =   228 bits (581),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 126/201 (63%), Positives = 153/201 (76%), Gaps = 1/201 (0%)
 Frame = +2

Query  8    STSHCTWRRVTCd-sllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPE  184
            S  HC+W  V CD     VVSLDL+G NLSG LS  V +L  L+NLS A+N LSGP+P E
Sbjct  58   SGGHCSWPGVACDPLRGFVVSLDLTGFNLSGTLSLAVVRLRHLLNLSAASNSLSGPIPAE  117

Query  185  ISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHL  364
            +S +S LR LNLSNN+F  +FP  + +L NL VLD+YNNNLTG LP EV ++ +LRHLHL
Sbjct  118  LSRLSNLRHLNLSNNLFNGSFPSAIVRLKNLLVLDIYNNNLTGPLPAEVSELPNLRHLHL  177

Query  365  GGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPP  544
            GGN+FSG IPP +GR+  LEYLAVSGN L G IP E+GNLT+L++LY+GYFN F GGIPP
Sbjct  178  GGNFFSGVIPPVFGRWEFLEYLAVSGNELGGPIPPELGNLTRLRQLYLGYFNNFEGGIPP  237

Query  545  EMGNLSQLIRXDAANCGLTGE  607
            E+G L +L+R D ANCGLTGE
Sbjct  238  EIGGLPELVRLDMANCGLTGE  258


 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 100/196 (51%), Gaps = 24/196 (12%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  265
             SGV+ P  G+  FL  L+++ N+L GP+PPE+  ++ LR L L   N F    P ++  
Sbjct  182  FSGVIPPVFGRWEFLEYLAVSGNELGGPIPPELGNLTRLRQLYLGYFNNFEGGIPPEIGG  241

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  LD+ N  LTG++P E+  + +L  L L  N  SGR+P E GR  +L+ + +S N
Sbjct  242  LPELVRLDMANCGLTGEIPPELGNLQNLDTLFLQVNGLSGRLPVELGRLRSLKSMDLSNN  301

Query  446  GLSGVIPSEIGNLTKLKEL-------------YIG----------YFNGFSGGIPPEMGN  556
             L+G IPS   +L  L  L             ++G          + N F+GGIP  +G 
Sbjct  302  ALTGEIPSSFADLQNLTLLNLFRNKLHGSIPEFVGDLPALEVLQLWENNFTGGIPRRLGQ  361

Query  557  LSQLIRXDAANCGLTG  604
              +L   D ++  LTG
Sbjct  362  SGRLQIVDLSSNKLTG  377


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 82/155 (53%), Gaps = 1/155 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            N  G + P++G LP LV L +A   L+G +PPE+  +  L  L L  N      P +L +
Sbjct  230  NFEGGIPPEIGGLPELVRLDMANCGLTGEIPPELGNLQNLDTLFLQVNGLSGRLPVELGR  289

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L +L+ +DL NN LTG++P     + +L  L+L  N   G IP   G  P LE L +  N
Sbjct  290  LRSLKSMDLSNNALTGEIPSSFADLQNLTLLNLFRNKLHGSIPEFVGDLPALEVLQLWEN  349

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
              +G IP  +G   +L+ + +   N  +G +PP++
Sbjct  350  NFTGGIPRRLGQSGRLQIVDLSS-NKLTGTLPPDL  383


 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 85/162 (52%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G + P++G L  L  L +  N LSG +P E+  + +L+ ++LSNN      P   A L
Sbjct  255  LTGEIPPELGNLQNLDTLFLQVNGLSGRLPVELGRLRSLKSMDLSNNALTGEIPSSFADL  314

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  V  + +L  L L  N F+G IP   G+   L+ + +S N 
Sbjct  315  QNLTLLNLFRNKLHGSIPEFVGDLPALEVLQLWENNFTGGIPRRLGQSGRLQIVDLSSNK  374

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P ++    KL+ L I   N   G IP  +G    L R
Sbjct  375  LTGTLPPDLCFGNKLQTL-IALGNFLFGPIPETLGRCESLGR  415


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 77/150 (51%), Gaps = 7/150 (5%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
            +  +SPD+GQ+      S++ N+LSGP+PP I  ++ L+ L L+ N F    P ++ +L 
Sbjct  456  AAAISPDLGQI------SLSNNRLSGPLPPSIGNLTGLQKLLLNQNQFSGRIPPEMGRLQ  509

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
             L  LD   N  +G +  E+ +   L  + L  N  SG +PPE      L YL +S N L
Sbjct  510  QLSKLDFSGNRFSGPIAPEISRCKLLTFVDLSRNELSGELPPEIAGMRILNYLNLSRNQL  569

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
             G IP+ I  +  L  +   Y N  SG +P
Sbjct  570  EGSIPASIATMQSLTAVDFSY-NNLSGLVP  598


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/167 (33%), Positives = 87/167 (52%), Gaps = 3/167 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            N +G +   +GQ   L  + +++N+L+G +PP++   + L+ L    N      P  L +
Sbjct  350  NFTGGIPRRLGQSGRLQIVDLSSNKLTGTLPPDLCFGNKLQTLIALGNFLFGPIPETLGR  409

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRF--PNLEYLAVS  439
              +L  + +  N L G +P  ++ +  L  L L  N  +G  P        P+L  +++S
Sbjct  410  CESLGRIRMGENYLNGSIPHGLFSLPKLSQLELQDNLLTGGFPDTGAAAISPDLGQISLS  469

Query  440  GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXD  580
             N LSG +P  IGNLT L++L +   N FSG IPPEMG L QL + D
Sbjct  470  NNRLSGPLPPSIGNLTGLQKLLLNQ-NQFSGRIPPEMGRLQQLSKLD  515


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/172 (31%), Positives = 87/172 (51%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L  ++G+L  L ++ ++ N L+G +P   + +  L  LNL  N    + P  +  L
Sbjct  279  LSGRLPVELGRLRSLKSMDLSNNALTGEIPSSFADLQNLTLLNLFRNKLHGSIPEFVGDL  338

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L+VL L+ NN TG +P  + +   L+ + L  N  +G +PP+      L+ L   GN 
Sbjct  339  PALEVLQLWENNFTGGIPRRLGQSGRLQIVDLSSNKLTGTLPPDLCFGNKLQTLIALGNF  398

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            L G IP  +G    L  + +G  N  +G IP  + +L +L + +  +  LTG
Sbjct  399  LFGPIPETLGRCESLGRIRMGE-NYLNGSIPHGLFSLPKLSQLELQDNLLTG  449


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 80/176 (45%), Gaps = 3/176 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + PH L  
Sbjct  374  KLTGTLPPDLCFGNKLQTLIALGNFLFGPIPETLGRCESLGRIRMGENYLNGSIPHGLFS  433

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTS--LRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  439
            L  L  L+L +N LTG  P       S  L  + L  N  SG +PP  G    L+ L ++
Sbjct  434  LPKLSQLELQDNLLTGGFPDTGAAAISPDLGQISLSNNRLSGPLPPSIGNLTGLQKLLLN  493

Query  440  GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
             N  SG IP E+G L +L +L     N FSG I PE+     L   D +   L+GE
Sbjct  494  QNQFSGRIPPEMGRLQQLSKLDFSG-NRFSGPIAPEISRCKLLTFVDLSRNELSGE  548


 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 65/126 (52%), Gaps = 0/126 (0%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L P +G L  L  L +  NQ SG +PPE+  +  L  L+ S N F      ++++ 
Sbjct  473  LSGPLPPSIGNLTGLQKLLLNQNQFSGRIPPEMGRLQQLSKLDFSGNRFSGPIAPEISRC  532

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  +DL  N L+G+LP E+  M  L +L+L  N   G IP       +L  +  S N 
Sbjct  533  KLLTFVDLSRNELSGELPPEIAGMRILNYLNLSRNQLEGSIPASIATMQSLTAVDFSYNN  592

Query  449  LSGVIP  466
            LSG++P
Sbjct  593  LSGLVP  598



>ref|XP_004955422.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Setaria italica]
Length=1030

 Score =   228 bits (581),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 118/202 (58%), Positives = 151/202 (75%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPP  181
            N + S C W  VTC++   V+ +DLSG NLSG +   + +LP L  L +AAN  SGP+P 
Sbjct  55   NATASPCAWSGVTCNARGAVIGVDLSGRNLSGPVPAALSRLPHLARLDLAANAFSGPIPT  114

Query  182  EISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLH  361
             ++ +  L  LNLSNN+   TFP  LA+L  L+V+DLYNNNLTG LP+ V  + +LRHLH
Sbjct  115  PLARLRYLTHLNLSNNVLNGTFPPPLARLRALRVVDLYNNNLTGPLPLGVAALPALRHLH  174

Query  362  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            LGGN+FSG IPPEYG +  L+YLAVSGN LSG IP E+GNLT L+ELYIGY+N +SGGIP
Sbjct  175  LGGNFFSGEIPPEYGTWGRLQYLAVSGNELSGRIPPELGNLTSLRELYIGYYNSYSGGIP  234

Query  542  PEMGNLSQLIRXDAANCGLTGE  607
            PE+GN+++L+R DAANCGL+GE
Sbjct  235  PELGNMTELVRLDAANCGLSGE  256


 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 90/198 (45%), Gaps = 26/198 (13%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L G +   VG LP L  L +  N  +G +P  +     L+ ++LS+N    T P  L  
Sbjct  324  KLRGSIPELVGDLPSLEVLQLWENNFTGGIPRRLGRNGRLQLVDLSSNRLTGTLPPDLCA  383

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEY--------------  403
               L+ L    N L G +P  + K  +L  + LG NY +G IP                 
Sbjct  384  GGKLETLIALGNFLFGSIPESLGKCEALSRIRLGENYLNGSIPEGLFELPNLVQVELQDN  443

Query  404  ---GRFP--------NLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
               G FP        NL  + +S N L+G +P+ IGN + L++L +   N F+G +PPE+
Sbjct  444  LLSGGFPAVAGAAASNLGSITLSNNQLTGALPASIGNFSGLQKLLLDQ-NAFNGAVPPEI  502

Query  551  GNLSQLIRXDAANCGLTG  604
            G L QL + D +   L G
Sbjct  503  GRLQQLSKADLSGNSLDG  520


 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 85/162 (52%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P++G L  L  L +  N L+G +PPE+  + +L  L+LSNN      P   A L
Sbjct  253  LSGEIPPELGNLANLDTLFLQVNGLAGGIPPELGRLRSLSSLDLSNNALTGEIPATFAAL  312

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  V  + SL  L L  N F+G IP   GR   L+ + +S N 
Sbjct  313  KNLTLLNLFRNKLRGSIPELVGDLPSLEVLQLWENNFTGGIPRRLGRNGRLQLVDLSSNR  372

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P ++    KL+ L I   N   G IP  +G    L R
Sbjct  373  LTGTLPPDLCAGGKLETL-IALGNFLFGSIPESLGKCEALSR  413


 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 63/173 (36%), Positives = 90/173 (52%), Gaps = 2/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            LSG + P++G L  L  L I   N  SG +PPE+  ++ L  L+ +N       P +L  
Sbjct  204  LSGRIPPELGNLTSLRELYIGYYNSYSGGIPPELGNMTELVRLDAANCGLSGEIPPELGN  263

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            LANL  L L  N L G +P E+ ++ SL  L L  N  +G IP  +    NL  L +  N
Sbjct  264  LANLDTLFLQVNGLAGGIPPELGRLRSLSSLDLSNNALTGEIPATFAALKNLTLLNLFRN  323

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             L G IP  +G+L  L+ L + + N F+GGIP  +G   +L   D ++  LTG
Sbjct  324  KLRGSIPELVGDLPSLEVLQL-WENNFTGGIPRRLGRNGRLQLVDLSSNRLTG  375


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 85/177 (48%), Gaps = 8/177 (5%)
 Frame = +2

Query  89   LSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  259
            L+G L PD+   G+L  L+ L    N L G +P  +     L  + L  N    + P  L
Sbjct  373  LTGTLPPDLCAGGKLETLIAL---GNFLFGSIPESLGKCEALSRIRLGENYLNGSIPEGL  429

Query  260  AQLANLQVLDLYNNNLTGDLP-VEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  436
             +L NL  ++L +N L+G  P V     ++L  + L  N  +G +P   G F  L+ L +
Sbjct  430  FELPNLVQVELQDNLLSGGFPAVAGAAASNLGSITLSNNQLTGALPASIGNFSGLQKLLL  489

Query  437  SGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              N  +G +P EIG L +L +  +   N   GG+PPE+G    L   D +   L+GE
Sbjct  490  DQNAFNGAVPPEIGRLQQLSKADLS-GNSLDGGVPPEIGKCRLLTYLDLSRNNLSGE  545


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 89/172 (52%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G + P++G+L  L +L ++ N L+G +P   +A+  L  LNL  N    + P  +  L
Sbjct  277  LAGGIPPELGRLRSLSSLDLSNNALTGEIPATFAALKNLTLLNLFRNKLRGSIPELVGDL  336

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             +L+VL L+ NN TG +P  + +   L+ + L  N  +G +PP+      LE L   GN 
Sbjct  337  PSLEVLQLWENNFTGGIPRRLGRNGRLQLVDLSSNRLTGTLPPDLCAGGKLETLIALGNF  396

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            L G IP  +G    L  + +G  N  +G IP  +  L  L++ +  +  L+G
Sbjct  397  LFGSIPESLGKCEALSRIRLGE-NYLNGSIPEGLFELPNLVQVELQDNLLSG  447


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 57/173 (33%), Positives = 80/173 (46%), Gaps = 2/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEI-SAISTLRFLNLSNNIFGSTFPHQLAQ  265
            L+G +   + +LP LV + +  N LSG  P    +A S L  + LSNN      P  +  
Sbjct  421  LNGSIPEGLFELPNLVQVELQDNLLSGGFPAVAGAAASNLGSITLSNNQLTGALPASIGN  480

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
             + LQ L L  N   G +P E+ ++  L    L GN   G +PPE G+   L YL +S N
Sbjct  481  FSGLQKLLLDQNAFNGAVPPEIGRLQQLSKADLSGNSLDGGVPPEIGKCRLLTYLDLSRN  540

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             LSG IP  I  +  L  L +   N   G IP  +  +  L   D +   L+G
Sbjct  541  NLSGEIPPAISGMRILNYLNLSR-NHLDGEIPATIAAMQSLTAVDFSYNNLSG  592


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 69/137 (50%), Gaps = 1/137 (1%)
 Frame = +2

Query  131  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  310
            L +++++ NQL+G +P  I   S L+ L L  N F    P ++ +L  L   DL  N+L 
Sbjct  460  LGSITLSNNQLTGALPASIGNFSGLQKLLLDQNAFNGAVPPEIGRLQQLSKADLSGNSLD  519

Query  311  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTK  490
            G +P E+ K   L +L L  N  SG IPP       L YL +S N L G IP+ I  +  
Sbjct  520  GGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNHLDGEIPATIAAMQS  579

Query  491  LKELYIGYFNGFSGGIP  541
            L  +   Y N  SG +P
Sbjct  580  LTAVDFSY-NNLSGLVP  595


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 57/163 (35%), Positives = 85/163 (52%), Gaps = 4/163 (2%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
            SG + P++G +  LV L  A   LSG +PPE+  ++ L  L L  N      P +L +L 
Sbjct  230  SGGIPPELGNMTELVRLDAANCGLSGEIPPELGNLANLDTLFLQVNGLAGGIPPELGRLR  289

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
            +L  LDL NN LTG++P     + +L  L+L  N   G IP   G  P+LE L +  N  
Sbjct  290  SLSSLDLSNNALTGEIPATFAALKNLTLLNLFRNKLRGSIPELVGDLPSLEVLQLWENNF  349

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM---GNLSQLI  571
            +G IP  +G   +L+ + +   N  +G +PP++   G L  LI
Sbjct  350  TGGIPRRLGRNGRLQLVDLSS-NRLTGTLPPDLCAGGKLETLI  391


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 63/128 (49%), Gaps = 0/128 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L   +G    L  L +  N  +G VPPEI  +  L   +LS N      P ++ +
Sbjct  469  QLTGALPASIGNFSGLQKLLLDQNAFNGAVPPEIGRLQQLSKADLSGNSLDGGVPPEIGK  528

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  LDL  NNL+G++P  +  M  L +L+L  N+  G IP       +L  +  S N
Sbjct  529  CRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNHLDGEIPATIAAMQSLTAVDFSYN  588

Query  446  GLSGVIPS  469
             LSG++P+
Sbjct  589  NLSGLVPA  596



>ref|XP_004981595.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Setaria italica]
Length=1029

 Score =   228 bits (580),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 152/207 (73%), Gaps = 7/207 (3%)
 Frame = +2

Query  8    STSHCTWRRVTCd------sllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSG  169
            S  HC W  VTC           VV LD+SGLNLSG L   + +L  L  LS+AAN L G
Sbjct  49   SPDHCAWAGVTCAPPGGGRGGGIVVGLDVSGLNLSGALPQALSRLHGLQRLSVAANALYG  108

Query  170  PVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT-GDLPVEVYKMTS  346
            P+PP ++ +  L  LNLSNN F  +FP  LA+L  L+VLDLYNNNLT   LP+EV +M  
Sbjct  109  PIPPSLARLQQLVHLNLSNNAFNGSFPPALARLRGLRVLDLYNNNLTSATLPLEVTQMPM  168

Query  347  LRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGF  526
            LRHLHLGGN+FSG IPPEYGR+P L+YLAVSGN LSG IP E+GNLT L+ELYIGY+N +
Sbjct  169  LRHLHLGGNFFSGEIPPEYGRWPRLQYLAVSGNELSGRIPPELGNLTTLRELYIGYYNSY  228

Query  527  SGGIPPEMGNLSQLIRXDAANCGLTGE  607
            +GG+PPE+GNL++L+R DAANCGL+GE
Sbjct  229  TGGLPPELGNLTELVRLDAANCGLSGE  255


 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 87/162 (54%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P++G+L  L  L +  N L+G +P E+  + +L  L+LSNN      P   ++L
Sbjct  252  LSGEIPPELGRLQNLDTLFLQVNGLTGSIPSELGHLKSLSSLDLSNNALTGEIPESFSEL  311

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L GD+P  V  M SL  L L  N F+G +P   GR   L+ L +S N 
Sbjct  312  KNLTLLNLFRNKLRGDIPDFVGDMPSLEVLQLWENNFTGGVPRRLGRNGRLQLLDLSSNK  371

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P E+    KL+ L I   N   G IP  +G    L R
Sbjct  372  LTGTLPPELCAGGKLQTL-IALGNFLFGAIPDSLGQCKSLSR  412


 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 82/160 (51%), Gaps = 2/160 (1%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
            S  L  +V Q+P L +L +  N  SG +PPE      L++L +S N      P +L  L 
Sbjct  156  SATLPLEVTQMPMLRHLHLGGNFFSGEIPPEYGRWPRLQYLAVSGNELSGRIPPELGNLT  215

Query  272  NLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             L+ L + Y N+ TG LP E+  +T L  L       SG IPPE GR  NL+ L +  NG
Sbjct  216  TLRELYIGYYNSYTGGLPPELGNLTELVRLDAANCGLSGEIPPELGRLQNLDTLFLQVNG  275

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQL  568
            L+G IPSE+G+L  L  L +   N  +G IP     L  L
Sbjct  276  LTGSIPSELGHLKSLSSLDLSN-NALTGEIPESFSELKNL  314


 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 97/175 (55%), Gaps = 4/175 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +G +   +G+   L  L +++N+L+G +PPE+ A   L+  + L N +FG+  P  L 
Sbjct  347  NFTGGVPRRLGRNGRLQLLDLSSNKLTGTLPPELCAGGKLQTLIALGNFLFGA-IPDSLG  405

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYG-RFPNLEYLAVS  439
            Q  +L  + L  N L G +P  ++++  L  + L  N  +G  P   G   PNL  +++S
Sbjct  406  QCKSLSRVRLGENYLNGSIPKGLFELPKLTQVELQDNLLTGNFPAVIGVAAPNLGEISLS  465

Query  440  GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             N L+G +P+ +G+ + +++L +   N FSG +PPE+G L QL + D ++    G
Sbjct  466  NNQLTGALPASLGSFSGIQKLLLDR-NSFSGAVPPEIGRLQQLSKADLSSNKFEG  519


 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 86/178 (48%), Gaps = 8/178 (4%)
 Frame = +2

Query  86   NLSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  256
             L+G L P++   G+L  L+ L    N L G +P  +    +L  + L  N    + P  
Sbjct  371  KLTGTLPPELCAGGKLQTLIAL---GNFLFGAIPDSLGQCKSLSRVRLGENYLNGSIPKG  427

Query  257  LAQLANLQVLDLYNNNLTGDLPVEV-YKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLA  433
            L +L  L  ++L +N LTG+ P  +     +L  + L  N  +G +P   G F  ++ L 
Sbjct  428  LFELPKLTQVELQDNLLTGNFPAVIGVAAPNLGEISLSNNQLTGALPASLGSFSGIQKLL  487

Query  434  VSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            +  N  SG +P EIG L +L +  +   N F GG+PPE+G    L   D +   L+G+
Sbjct  488  LDRNSFSGAVPPEIGRLQQLSKADLSS-NKFEGGVPPEIGKCRLLTYLDMSQNNLSGK  544


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 49/149 (33%), Positives = 75/149 (50%), Gaps = 7/149 (5%)
 Frame = +2

Query  95   GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  274
            GV +P++G++      S++ NQL+G +P  + + S ++ L L  N F    P ++ +L  
Sbjct  453  GVAAPNLGEI------SLSNNQLTGALPASLGSFSGIQKLLLDRNSFSGAVPPEIGRLQQ  506

Query  275  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  454
            L   DL +N   G +P E+ K   L +L +  N  SG+IPP       L YL +S N L 
Sbjct  507  LSKADLSSNKFEGGVPPEIGKCRLLTYLDMSQNNLSGKIPPAISGMWILNYLNLSRNHLD  566

Query  455  GVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            G IP  I  +  L  +   Y N  SG +P
Sbjct  567  GEIPPSIATMQSLTAVDFSY-NNLSGLVP  594


 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 85/163 (52%), Gaps = 4/163 (2%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
            +G L P++G L  LV L  A   LSG +PPE+  +  L  L L  N    + P +L  L 
Sbjct  229  TGGLPPELGNLTELVRLDAANCGLSGEIPPELGRLQNLDTLFLQVNGLTGSIPSELGHLK  288

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
            +L  LDL NN LTG++P    ++ +L  L+L  N   G IP   G  P+LE L +  N  
Sbjct  289  SLSSLDLSNNALTGEIPESFSELKNLTLLNLFRNKLRGDIPDFVGDMPSLEVLQLWENNF  348

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM---GNLSQLI  571
            +G +P  +G   +L+ L +   N  +G +PPE+   G L  LI
Sbjct  349  TGGVPRRLGRNGRLQLLDLSS-NKLTGTLPPELCAGGKLQTLI  390


 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 85/172 (49%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G +  ++G L  L +L ++ N L+G +P   S +  L  LNL  N      P  +  +
Sbjct  276  LTGSIPSELGHLKSLSSLDLSNNALTGEIPESFSELKNLTLLNLFRNKLRGDIPDFVGDM  335

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             +L+VL L+ NN TG +P  + +   L+ L L  N  +G +PPE      L+ L   GN 
Sbjct  336  PSLEVLQLWENNFTGGVPRRLGRNGRLQLLDLSSNKLTGTLPPELCAGGKLQTLIALGNF  395

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            L G IP  +G    L  + +G  N  +G IP  +  L +L + +  +  LTG
Sbjct  396  LFGAIPDSLGQCKSLSRVRLGE-NYLNGSIPKGLFELPKLTQVELQDNLLTG  446


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 64/127 (50%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L   +G    +  L +  N  SG VPPEI  +  L   +LS+N F    P ++ +
Sbjct  468  QLTGALPASLGSFSGIQKLLLDRNSFSGAVPPEIGRLQQLSKADLSSNKFEGGVPPEIGK  527

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  LD+  NNL+G +P  +  M  L +L+L  N+  G IPP      +L  +  S N
Sbjct  528  CRLLTYLDMSQNNLSGKIPPAISGMWILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYN  587

Query  446  GLSGVIP  466
             LSG++P
Sbjct  588  NLSGLVP  594


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 63/125 (50%), Gaps = 2/125 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            + SG + P++G+L  L    +++N+  G VPPEI     L +L++S N      P  ++ 
Sbjct  492  SFSGAVPPEIGRLQQLSKADLSSNKFEGGVPPEIGKCRLLTYLDMSQNNLSGKIPPAISG  551

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            +  L  L+L  N+L G++P  +  M SL  +    N  SG + P  G+F      +  GN
Sbjct  552  MWILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLV-PGTGQFTYFNATSFVGN  610

Query  446  -GLSG  457
             GL G
Sbjct  611  PGLCG  615



>emb|CDY02112.1| BnaA03g40550D [Brassica napus]
Length=969

 Score =   224 bits (572),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 142/203 (70%), Gaps = 24/203 (12%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPP  181
            ++STS C W  VTCD                         L  +++L ++   LSG +P 
Sbjct  52   DLSTSFCLWTGVTCD-----------------------ASLRHVISLDLSGLNLSGTLPS  88

Query  182  EISAISTLRFLNLSNNIFGSTFPHQL-AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHL  358
             ++++S LR LNLSNN+F  +FP +L A L NL+VLDLYNNNLTGDLPV +  +T LRHL
Sbjct  89   SMASLSELRRLNLSNNVFNGSFPDELSAGLVNLRVLDLYNNNLTGDLPVSITNLTELRHL  148

Query  359  HLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGI  538
            HLGGNYF+GRIPP YG +P LEYLAVSGN L+G IP EIGNLT L+ELYIGYFN F GG+
Sbjct  149  HLGGNYFAGRIPPAYGSWPTLEYLAVSGNELAGKIPPEIGNLTTLRELYIGYFNAFDGGL  208

Query  539  PPEMGNLSQLIRXDAANCGLTGE  607
            PPE+GNLS+L+R DAANCGL GE
Sbjct  209  PPEIGNLSELLRLDAANCGLRGE  231


 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 84/162 (52%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L G + P++G+L  L  L +  N  SG +PPE+  IS+L+ ++LSNN+F    P    QL
Sbjct  228  LRGEIPPEIGRLRRLDTLFLQVNAFSGTLPPELGTISSLKSMDLSNNMFTGEIPPSFEQL  287

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  +  M  L  L L  N F+G IP + G    L  L +S N 
Sbjct  288  RNLTLLNLFRNKLYGAIPEFIGDMPGLEVLQLWENNFTGSIPRKLGENGRLVILDLSSNK  347

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P  +    +L  L I   N   G IP  +G    L R
Sbjct  348  LTGTLPPNMCFGNRLVTL-ITLGNFLFGSIPDSLGKCESLTR  388


 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 60/173 (35%), Positives = 93/173 (54%), Gaps = 2/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            L+G + P++G L  L  L I   N   G +PPEI  +S L  L+ +N       P ++ +
Sbjct  179  LAGKIPPEIGNLTTLRELYIGYFNAFDGGLPPEIGNLSELLRLDAANCGLRGEIPPEIGR  238

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  L L  N  +G LP E+  ++SL+ + L  N F+G IPP + +  NL  L +  N
Sbjct  239  LRRLDTLFLQVNAFSGTLPPELGTISSLKSMDLSNNMFTGEIPPSFEQLRNLTLLNLFRN  298

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             L G IP  IG++  L+ L + + N F+G IP ++G   +L+  D ++  LTG
Sbjct  299  KLYGAIPEFIGDMPGLEVLQL-WENNFTGSIPRKLGENGRLVILDLSSNKLTG  350


 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 61/176 (35%), Positives = 89/176 (51%), Gaps = 3/176 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P++     LV L    N L G +P  +    +L  + +  N    + P+ L  
Sbjct  347  KLTGTLPPNMCFGNRLVTLITLGNFLFGSIPDSLGKCESLTRIRMGQNFLNGSIPNVLFG  406

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTS--LRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  439
            L  L  ++L +N LTG+LP+ +    S  L  + L  N  SG +PP  G F  ++ L + 
Sbjct  407  LPELSQVELQDNYLTGELPLPISGGVSVNLGQISLSNNQLSGPLPPAIGSFSGVQKLLLD  466

Query  440  GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            GN  SG IPSEIG L +L +L   + N FSGGIPPE+     L   D +   L+G+
Sbjct  467  GNKFSGAIPSEIGRLQQLSKLDFSH-NLFSGGIPPEISRCKLLTYVDLSRNELSGD  521


 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 79/154 (51%), Gaps = 1/154 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
              G L P++G L  L+ L  A   L G +PPEI  +  L  L L  N F  T P +L  +
Sbjct  204  FDGGLPPEIGNLSELLRLDAANCGLRGEIPPEIGRLRRLDTLFLQVNAFSGTLPPELGTI  263

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
            ++L+ +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N 
Sbjct  264  SSLKSMDLSNNMFTGEIPPSFEQLRNLTLLNLFRNKLYGAIPEFIGDMPGLEVLQLWENN  323

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
             +G IP ++G   +L  L +   N  +G +PP M
Sbjct  324  FTGSIPRKLGENGRLVILDLSS-NKLTGTLPPNM  356


 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 79/151 (52%), Gaps = 7/151 (5%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            +SG +S ++GQ+      S++ NQLSGP+PP I + S ++ L L  N F    P ++ +L
Sbjct  428  ISGGVSVNLGQI------SLSNNQLSGPLPPAIGSFSGVQKLLLDGNKFSGAIPSEIGRL  481

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  LD  +N  +G +P E+ +   L ++ L  N  SG IP E      L YL VS N 
Sbjct  482  QQLSKLDFSHNLFSGGIPPEISRCKLLTYVDLSRNELSGDIPNEITSMRILNYLNVSRNH  541

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            L G IP  I ++  L  +   Y N  SG +P
Sbjct  542  LVGSIPVTISSMQSLTSIDFSY-NNLSGLVP  571


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 68/128 (53%), Gaps = 0/128 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             LSG L P +G    +  L +  N+ SG +P EI  +  L  L+ S+N+F    P ++++
Sbjct  445  QLSGPLPPAIGSFSGVQKLLLDGNKFSGAIPSEIGRLQQLSKLDFSHNLFSGGIPPEISR  504

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  +DL  N L+GD+P E+  M  L +L++  N+  G IP       +L  +  S N
Sbjct  505  CKLLTYVDLSRNELSGDIPNEITSMRILNYLNVSRNHLVGSIPVTISSMQSLTSIDFSYN  564

Query  446  GLSGVIPS  469
             LSG++PS
Sbjct  565  NLSGLVPS  572


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/163 (33%), Positives = 80/163 (49%), Gaps = 3/163 (2%)
 Frame = +2

Query  122  LPFLVNLSIAANQLSGPVPPEISAISTLRF--LNLSNNIFGSTFPHQLAQLANLQVLDLY  295
            LP L  + +  N L+G +P  IS   ++    ++LSNN      P  +   + +Q L L 
Sbjct  407  LPELSQVELQDNYLTGELPLPISGGVSVNLGQISLSNNQLSGPLPPAIGSFSGVQKLLLD  466

Query  296  NNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEI  475
             N  +G +P E+ ++  L  L    N FSG IPPE  R   L Y+ +S N LSG IP+EI
Sbjct  467  GNKFSGAIPSEIGRLQQLSKLDFSHNLFSGGIPPEISRCKLLTYVDLSRNELSGDIPNEI  526

Query  476  GNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             ++  L  L +   N   G IP  + ++  L   D +   L+G
Sbjct  527  TSMRILNYLNVSR-NHLVGSIPVTISSMQSLTSIDFSYNNLSG  568



>ref|XP_003608587.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES90784.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1005

 Score =   224 bits (572),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 160/202 (79%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPP  181
            N  T +C+W  + C    HV+SL+L+ L+L+G LS  +  LPFL NLS+A N+ SGP+P 
Sbjct  50   NPKTPYCSWYGIKCSQHRHVISLNLTSLSLTGTLS--LSNLPFLTNLSLADNKFSGPIPS  107

Query  182  EISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLH  361
             +S++S+LRFLNLSNNIF  T P +L+ L NLQVLDLYNNN+TG LPV V  ++ LRHLH
Sbjct  108  SLSSLSSLRFLNLSNNIFNGTLPQELSNLFNLQVLDLYNNNMTGSLPVSVTHLSFLRHLH  167

Query  362  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            LGGN+F+G+IPPEYG + +LEYLAVSGN LSG IP EIGN+T LKELYIGY+N + GGIP
Sbjct  168  LGGNFFTGKIPPEYGSWTHLEYLAVSGNELSGHIPPEIGNITSLKELYIGYYNTYDGGIP  227

Query  542  PEMGNLSQLIRXDAANCGLTGE  607
            PE+GNLS+++R DAA CGLTGE
Sbjct  228  PEIGNLSEMVRFDAAYCGLTGE  249


 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 86/162 (53%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G + P++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN F    P   A+L
Sbjct  246  LTGEVPPELGKLQKLDTLFLQVNALSGSLTSELGNLKSLKSMDLSNNAFTGEVPVSFAEL  305

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  + +M SL  L +  N F+G IP   G+   L  + VS N 
Sbjct  306  KNLTLLNLFRNKLHGAIPEFIGEMPSLEVLQIWENNFTGSIPQSLGKNGKLTLVDVSSNK  365

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P  +    KL+ L I   N   G IP  +G    L R
Sbjct  366  LTGSLPPFMCFGNKLQTL-IALGNFLFGPIPDSLGKCKSLNR  406


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 77/153 (50%), Gaps = 1/153 (1%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
             G + P++G L  +V    A   L+G VPPE+  +  L  L L  N    +   +L  L 
Sbjct  223  DGGIPPEIGNLSEMVRFDAAYCGLTGEVPPELGKLQKLDTLFLQVNALSGSLTSELGNLK  282

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
            +L+ +DL NN  TG++PV   ++ +L  L+L  N   G IP   G  P+LE L +  N  
Sbjct  283  SLKSMDLSNNAFTGEVPVSFAELKNLTLLNLFRNKLHGAIPEFIGEMPSLEVLQIWENNF  342

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            +G IP  +G   KL  + +   N  +G +PP M
Sbjct  343  TGSIPQSLGKNGKLTLVDVSS-NKLTGSLPPFM  374


 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 85/174 (49%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P +     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  365  KLTGSLPPFMCFGNKLQTLIALGNFLFGPIPDSLGKCKSLNRIRMGENFLNGSIPKGLFG  424

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N L+G+ P  V    +L  + L  N  SG +PP  G F +++ L + GN
Sbjct  425  LPELTQVELQDNLLSGNFPQPVSMSINLGQVTLSNNKLSGPLPPSIGNFTSVQKLILDGN  484

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              SG IP+EIG L +L ++   + N FSG I PE+ +   L   D +   L+GE
Sbjct  485  QFSGKIPAEIGKLHQLSKIDFSH-NKFSGPIAPEISHCKLLTFVDLSRNELSGE  537


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 91/197 (46%), Gaps = 25/197 (13%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L G +   +G++P L  L I  N  +G +P  +     L  +++S+N    + P  +  
Sbjct  317  KLHGAIPEFIGEMPSLEVLQIWENNFTGSIPQSLGKNGKLTLVDVSSNKLTGSLPPFMCF  376

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP------PEY--------  403
               LQ L    N L G +P  + K  SL  + +G N+ +G IP      PE         
Sbjct  377  GNKLQTLIALGNFLFGPIPDSLGKCKSLNRIRMGENFLNGSIPKGLFGLPELTQVELQDN  436

Query  404  ---GRFP-------NLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
               G FP       NL  + +S N LSG +P  IGN T +++L +   N FSG IP E+G
Sbjct  437  LLSGNFPQPVSMSINLGQVTLSNNKLSGPLPPSIGNFTSVQKLILDG-NQFSGKIPAEIG  495

Query  554  NLSQLIRXDAANCGLTG  604
             L QL + D ++   +G
Sbjct  496  KLHQLSKIDFSHNKFSG  512


 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 84/172 (49%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L+ ++G L  L ++ ++ N  +G VP   + +  L  LNL  N      P  + ++
Sbjct  270  LSGSLTSELGNLKSLKSMDLSNNAFTGEVPVSFAELKNLTLLNLFRNKLHGAIPEFIGEM  329

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             +L+VL ++ NN TG +P  + K   L  + +  N  +G +PP       L+ L   GN 
Sbjct  330  PSLEVLQIWENNFTGSIPQSLGKNGKLTLVDVSSNKLTGSLPPFMCFGNKLQTLIALGNF  389

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            L G IP  +G    L  + +G  N  +G IP  +  L +L + +  +  L+G
Sbjct  390  LFGPIPDSLGKCKSLNRIRMGE-NFLNGSIPKGLFGLPELTQVELQDNLLSG  440


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/160 (32%), Positives = 78/160 (49%), Gaps = 1/160 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N+    FP  ++  
Sbjct  390  LFGPIPDSLGKCKSLNRIRMGENFLNGSIPKGLFGLPELTQVELQDNLLSGNFPQPVSMS  449

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL  + L NN L+G LP  +   TS++ L L GN FSG+IP E G+   L  +  S N 
Sbjct  450  INLGQVTLSNNKLSGPLPPSIGNFTSVQKLILDGNQFSGKIPAEIGKLHQLSKIDFSHNK  509

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQL  568
             SG I  EI +   L  + +   N  SG IP E+  +  L
Sbjct  510  FSGPIAPEISHCKLLTFVDLSR-NELSGEIPKEITKMKIL  548


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 78/172 (45%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G +   +  LP L  + +  N LSG  P  +S    L  + LSNN      P  +   
Sbjct  414  LNGSIPKGLFGLPELTQVELQDNLLSGNFPQPVSMSINLGQVTLSNNKLSGPLPPSIGNF  473

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             ++Q L L  N  +G +P E+ K+  L  +    N FSG I PE      L ++ +S N 
Sbjct  474  TSVQKLILDGNQFSGKIPAEIGKLHQLSKIDFSHNKFSGPIAPEISHCKLLTFVDLSRNE  533

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            LSG IP EI  +  L  L +   N   G IP  + ++  L   D +   LTG
Sbjct  534  LSGEIPKEITKMKILNYLNLSR-NHLVGTIPGSIASMQSLTSVDFSYNNLTG  584


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 69/137 (50%), Gaps = 1/137 (1%)
 Frame = +2

Query  131  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  310
            L  ++++ N+LSGP+PP I   ++++ L L  N F    P ++ +L  L  +D  +N  +
Sbjct  452  LGQVTLSNNKLSGPLPPSIGNFTSVQKLILDGNQFSGKIPAEIGKLHQLSKIDFSHNKFS  511

Query  311  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTK  490
            G +  E+     L  + L  N  SG IP E  +   L YL +S N L G IP  I ++  
Sbjct  512  GPIAPEISHCKLLTFVDLSRNELSGEIPKEITKMKILNYLNLSRNHLVGTIPGSIASMQS  571

Query  491  LKELYIGYFNGFSGGIP  541
            L  +   Y N  +G +P
Sbjct  572  LTSVDFSY-NNLTGLVP  587



>ref|NP_001058840.2| Os07g0134200 [Oryza sativa Japonica Group]
 dbj|BAF20754.2| Os07g0134200 [Oryza sativa Japonica Group]
Length=883

 Score =   224 bits (571),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 124/204 (61%), Positives = 151/204 (74%), Gaps = 2/204 (1%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsglNLSGVL-SPDVGQLPFLVNLSIAANQLSGPVP  178
            N ++S C W  V C++   VV LD+SG NL+G L    +  L  L  L +AAN LSGP+P
Sbjct  51   NTTSSPCAWSGVACNARGAVVGLDVSGRNLTGGLPGAALSGLQHLARLDLAANALSGPIP  110

Query  179  PEISAIST-LRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRH  355
              +S ++  L  LNLSNN    TFP QL++L  L+VLDLYNNNLTG LP+EV  M  LRH
Sbjct  111  AALSRLAPFLTHLNLSNNGLNGTFPPQLSRLRALRVLDLYNNNLTGALPLEVVSMAQLRH  170

Query  356  LHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGG  535
            LHLGGN+FSG IPPEYGR+  L+YLAVSGN LSG IP E+GNLT L+ELYIGYFN +SGG
Sbjct  171  LHLGGNFFSGGIPPEYGRWGRLQYLAVSGNELSGKIPPELGNLTSLRELYIGYFNSYSGG  230

Query  536  IPPEMGNLSQLIRXDAANCGLTGE  607
            IPPE+GN++ L+R DAANCGL+GE
Sbjct  231  IPPELGNMTDLVRLDAANCGLSGE  254


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 86/162 (53%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P++G L  L  L +  N L+G +P E+  +++L  L+LSNN      P   A L
Sbjct  251  LSGEIPPELGNLANLDTLFLQVNGLAGGIPRELGKLASLSSLDLSNNALAGEIPATFADL  310

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G IP   GR    + L +S N 
Sbjct  311  KNLTLLNLFRNKLRGDIPEFVGDLPSLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNR  370

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P ++    KL+ L I   N   G IP  +G  + L R
Sbjct  371  LTGTLPPDLCAGGKLETL-IALGNSLFGAIPASLGKCTSLTR  411


 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 88/190 (46%), Gaps = 26/190 (14%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L G +   VG LP L  L +  N  +G +P  +      + L+LS+N    T P  L  
Sbjct  322  KLRGDIPEFVGDLPSLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNRLTGTLPPDLCA  381

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYL-----  430
               L+ L    N+L G +P  + K TSL  + LG NY +G IP      PNL  +     
Sbjct  382  GGKLETLIALGNSLFGAIPASLGKCTSLTRVRLGDNYLNGSIPEGLFELPNLTQVELQDN  441

Query  431  -------AVSGNG-------------LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
                   AVSG G             L+G +P+ IG+ + +++L +   N F+G IPPE+
Sbjct  442  LISGGFPAVSGTGAPNLGQISLSNNQLTGALPAFIGSFSGVQKLLLDQ-NAFTGEIPPEI  500

Query  551  GNLSQLIRXD  580
            G L QL + D
Sbjct  501  GRLQQLSKAD  510


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 63/173 (36%), Positives = 89/173 (51%), Gaps = 2/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            LSG + P++G L  L  L I   N  SG +PPE+  ++ L  L+ +N       P +L  
Sbjct  202  LSGKIPPELGNLTSLRELYIGYFNSYSGGIPPELGNMTDLVRLDAANCGLSGEIPPELGN  261

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            LANL  L L  N L G +P E+ K+ SL  L L  N  +G IP  +    NL  L +  N
Sbjct  262  LANLDTLFLQVNGLAGGIPRELGKLASLSSLDLSNNALAGEIPATFADLKNLTLLNLFRN  321

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             L G IP  +G+L  L+ L + + N F+GGIP  +G   +    D ++  LTG
Sbjct  322  KLRGDIPEFVGDLPSLEVLQL-WENNFTGGIPRRLGRNGRFQLLDLSSNRLTG  373


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 88/177 (50%), Gaps = 8/177 (5%)
 Frame = +2

Query  89   LSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  259
            L+G L PD+   G+L  L+ L    N L G +P  +   ++L  + L +N    + P  L
Sbjct  371  LTGTLPPDLCAGGKLETLIAL---GNSLFGAIPASLGKCTSLTRVRLGDNYLNGSIPEGL  427

Query  260  AQLANLQVLDLYNNNLTGDLP-VEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  436
             +L NL  ++L +N ++G  P V      +L  + L  N  +G +P   G F  ++ L +
Sbjct  428  FELPNLTQVELQDNLISGGFPAVSGTGAPNLGQISLSNNQLTGALPAFIGSFSGVQKLLL  487

Query  437  SGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              N  +G IP EIG L +L +  +   N F GG+PPE+G    L   D +   L+GE
Sbjct  488  DQNAFTGEIPPEIGRLQQLSKADLSG-NSFDGGVPPEIGKCRLLTYLDLSRNNLSGE  543


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 76/151 (50%), Gaps = 7/151 (5%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            +SG  +P++GQ+      S++ NQL+G +P  I + S ++ L L  N F    P ++ +L
Sbjct  450  VSGTGAPNLGQI------SLSNNQLTGALPAFIGSFSGVQKLLLDQNAFTGEIPPEIGRL  503

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L   DL  N+  G +P E+ K   L +L L  N  SG IPP       L YL +S N 
Sbjct  504  QQLSKADLSGNSFDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQ  563

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            L G IP+ I  +  L  +   Y N  SG +P
Sbjct  564  LDGEIPATIAAMQSLTAVDFSY-NNLSGLVP  593


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 63/128 (49%), Gaps = 0/128 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L   +G    +  L +  N  +G +PPEI  +  L   +LS N F    P ++ +
Sbjct  467  QLTGALPAFIGSFSGVQKLLLDQNAFTGEIPPEIGRLQQLSKADLSGNSFDGGVPPEIGK  526

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  LDL  NNL+G++P  +  M  L +L+L  N   G IP       +L  +  S N
Sbjct  527  CRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQLDGEIPATIAAMQSLTAVDFSYN  586

Query  446  GLSGVIPS  469
             LSG++P+
Sbjct  587  NLSGLVPA  594



>gb|EAZ02682.1| hypothetical protein OsI_24796 [Oryza sativa Indica Group]
Length=1023

 Score =   224 bits (572),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 124/204 (61%), Positives = 151/204 (74%), Gaps = 2/204 (1%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsglNLSGVL-SPDVGQLPFLVNLSIAANQLSGPVP  178
            N ++S C W  V C++   VV LD+SG NL+G L    +  L  L  L +AAN LSGP+P
Sbjct  51   NTTSSPCAWSGVACNARGAVVGLDVSGRNLTGGLPGAALSGLQHLARLDLAANALSGPIP  110

Query  179  PEISAIST-LRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRH  355
              +S ++  L  LNLSNN    TFP QL++L  L+VLDLYNNNLTG LP+EV  M  LRH
Sbjct  111  AALSRLAPFLTHLNLSNNGLNGTFPPQLSRLRALRVLDLYNNNLTGALPLEVVSMAQLRH  170

Query  356  LHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGG  535
            LHLGGN+FSG IPPEYGR+  L+YLAVSGN LSG IP E+GNLT L+ELYIGYFN +SGG
Sbjct  171  LHLGGNFFSGGIPPEYGRWGRLQYLAVSGNELSGKIPPELGNLTSLRELYIGYFNSYSGG  230

Query  536  IPPEMGNLSQLIRXDAANCGLTGE  607
            IPPE+GN++ L+R DAANCGL+GE
Sbjct  231  IPPELGNMTDLVRLDAANCGLSGE  254


 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 86/162 (53%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P++G L  L  L +  N L+G +P E+  +++L  L+LSNN      P   A L
Sbjct  251  LSGEIPPELGNLANLDTLFLQVNGLAGGIPRELGKLASLSSLDLSNNALAGEIPATFADL  310

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G IP   GR    + L +S N 
Sbjct  311  KNLTLLNLFRNKLRGDIPEFVGDLPSLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNR  370

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P ++    KL+ L I   N   G IP  +G  + L R
Sbjct  371  LTGTLPPDLCAGGKLETL-IALGNSLFGAIPASLGKCTSLTR  411


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 88/190 (46%), Gaps = 26/190 (14%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L G +   VG LP L  L +  N  +G +P  +      + L+LS+N    T P  L  
Sbjct  322  KLRGDIPEFVGDLPSLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNRLTGTLPPDLCA  381

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYL-----  430
               L+ L    N+L G +P  + K TSL  + LG NY +G IP      PNL  +     
Sbjct  382  GGKLETLIALGNSLFGAIPASLGKCTSLTRVRLGDNYLNGSIPEGLFELPNLTQVELQDN  441

Query  431  -------AVSGNG-------------LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
                   AVSG G             L+G +P+ IG+ + +++L +   N F+G IPPE+
Sbjct  442  LISGGFPAVSGTGAPNLGQISLSNNQLTGALPAFIGSFSGVQKLLLDQ-NAFTGEIPPEI  500

Query  551  GNLSQLIRXD  580
            G L QL + D
Sbjct  501  GRLQQLSKAD  510


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 63/173 (36%), Positives = 89/173 (51%), Gaps = 2/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            LSG + P++G L  L  L I   N  SG +PPE+  ++ L  L+ +N       P +L  
Sbjct  202  LSGKIPPELGNLTSLRELYIGYFNSYSGGIPPELGNMTDLVRLDAANCGLSGEIPPELGN  261

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            LANL  L L  N L G +P E+ K+ SL  L L  N  +G IP  +    NL  L +  N
Sbjct  262  LANLDTLFLQVNGLAGGIPRELGKLASLSSLDLSNNALAGEIPATFADLKNLTLLNLFRN  321

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             L G IP  +G+L  L+ L + + N F+GGIP  +G   +    D ++  LTG
Sbjct  322  KLRGDIPEFVGDLPSLEVLQL-WENNFTGGIPRRLGRNGRFQLLDLSSNRLTG  373


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 88/177 (50%), Gaps = 8/177 (5%)
 Frame = +2

Query  89   LSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  259
            L+G L PD+   G+L  L+ L    N L G +P  +   ++L  + L +N    + P  L
Sbjct  371  LTGTLPPDLCAGGKLETLIAL---GNSLFGAIPASLGKCTSLTRVRLGDNYLNGSIPEGL  427

Query  260  AQLANLQVLDLYNNNLTGDLP-VEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  436
             +L NL  ++L +N ++G  P V      +L  + L  N  +G +P   G F  ++ L +
Sbjct  428  FELPNLTQVELQDNLISGGFPAVSGTGAPNLGQISLSNNQLTGALPAFIGSFSGVQKLLL  487

Query  437  SGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              N  +G IP EIG L +L +  +   N F GG+PPE+G    L   D +   L+GE
Sbjct  488  DQNAFTGEIPPEIGRLQQLSKADLSG-NSFDGGVPPEIGKCRLLTYLDLSRNNLSGE  543


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 76/151 (50%), Gaps = 7/151 (5%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            +SG  +P++GQ+      S++ NQL+G +P  I + S ++ L L  N F    P ++ +L
Sbjct  450  VSGTGAPNLGQI------SLSNNQLTGALPAFIGSFSGVQKLLLDQNAFTGEIPPEIGRL  503

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L   DL  N+  G +P E+ K   L +L L  N  SG IPP       L YL +S N 
Sbjct  504  QQLSKADLSGNSFDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQ  563

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            L G IP+ I  +  L  +   Y N  SG +P
Sbjct  564  LDGEIPATIAAMQSLTAVDFSY-NNLSGLVP  593


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 63/128 (49%), Gaps = 0/128 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L   +G    +  L +  N  +G +PPEI  +  L   +LS N F    P ++ +
Sbjct  467  QLTGALPAFIGSFSGVQKLLLDQNAFTGEIPPEIGRLQQLSKADLSGNSFDGGVPPEIGK  526

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  LDL  NNL+G++P  +  M  L +L+L  N   G IP       +L  +  S N
Sbjct  527  CRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQLDGEIPATIAAMQSLTAVDFSYN  586

Query  446  GLSGVIPS  469
             LSG++P+
Sbjct  587  NLSGLVPA  594



>dbj|BAC82955.1| putative OsLRK1(receptor-type protein kinase) [Oryza sativa Japonica 
Group]
 dbj|BAD30615.1| putative OsLRK1(receptor-type protein kinase) [Oryza sativa Japonica 
Group]
 gb|EAZ38608.1| hypothetical protein OsJ_22997 [Oryza sativa Japonica Group]
 dbj|BAH01666.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1023

 Score =   224 bits (571),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 124/204 (61%), Positives = 151/204 (74%), Gaps = 2/204 (1%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsglNLSGVL-SPDVGQLPFLVNLSIAANQLSGPVP  178
            N ++S C W  V C++   VV LD+SG NL+G L    +  L  L  L +AAN LSGP+P
Sbjct  51   NTTSSPCAWSGVACNARGAVVGLDVSGRNLTGGLPGAALSGLQHLARLDLAANALSGPIP  110

Query  179  PEISAIST-LRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRH  355
              +S ++  L  LNLSNN    TFP QL++L  L+VLDLYNNNLTG LP+EV  M  LRH
Sbjct  111  AALSRLAPFLTHLNLSNNGLNGTFPPQLSRLRALRVLDLYNNNLTGALPLEVVSMAQLRH  170

Query  356  LHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGG  535
            LHLGGN+FSG IPPEYGR+  L+YLAVSGN LSG IP E+GNLT L+ELYIGYFN +SGG
Sbjct  171  LHLGGNFFSGGIPPEYGRWGRLQYLAVSGNELSGKIPPELGNLTSLRELYIGYFNSYSGG  230

Query  536  IPPEMGNLSQLIRXDAANCGLTGE  607
            IPPE+GN++ L+R DAANCGL+GE
Sbjct  231  IPPELGNMTDLVRLDAANCGLSGE  254


 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 86/162 (53%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P++G L  L  L +  N L+G +P E+  +++L  L+LSNN      P   A L
Sbjct  251  LSGEIPPELGNLANLDTLFLQVNGLAGGIPRELGKLASLSSLDLSNNALAGEIPATFADL  310

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G IP   GR    + L +S N 
Sbjct  311  KNLTLLNLFRNKLRGDIPEFVGDLPSLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNR  370

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P ++    KL+ L I   N   G IP  +G  + L R
Sbjct  371  LTGTLPPDLCAGGKLETL-IALGNSLFGAIPASLGKCTSLTR  411


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 88/190 (46%), Gaps = 26/190 (14%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L G +   VG LP L  L +  N  +G +P  +      + L+LS+N    T P  L  
Sbjct  322  KLRGDIPEFVGDLPSLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNRLTGTLPPDLCA  381

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYL-----  430
               L+ L    N+L G +P  + K TSL  + LG NY +G IP      PNL  +     
Sbjct  382  GGKLETLIALGNSLFGAIPASLGKCTSLTRVRLGDNYLNGSIPEGLFELPNLTQVELQDN  441

Query  431  -------AVSGNG-------------LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
                   AVSG G             L+G +P+ IG+ + +++L +   N F+G IPPE+
Sbjct  442  LISGGFPAVSGTGAPNLGQISLSNNQLTGALPAFIGSFSGVQKLLLDQ-NAFTGEIPPEI  500

Query  551  GNLSQLIRXD  580
            G L QL + D
Sbjct  501  GRLQQLSKAD  510


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 63/173 (36%), Positives = 89/173 (51%), Gaps = 2/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            LSG + P++G L  L  L I   N  SG +PPE+  ++ L  L+ +N       P +L  
Sbjct  202  LSGKIPPELGNLTSLRELYIGYFNSYSGGIPPELGNMTDLVRLDAANCGLSGEIPPELGN  261

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            LANL  L L  N L G +P E+ K+ SL  L L  N  +G IP  +    NL  L +  N
Sbjct  262  LANLDTLFLQVNGLAGGIPRELGKLASLSSLDLSNNALAGEIPATFADLKNLTLLNLFRN  321

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             L G IP  +G+L  L+ L + + N F+GGIP  +G   +    D ++  LTG
Sbjct  322  KLRGDIPEFVGDLPSLEVLQL-WENNFTGGIPRRLGRNGRFQLLDLSSNRLTG  373


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 88/177 (50%), Gaps = 8/177 (5%)
 Frame = +2

Query  89   LSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  259
            L+G L PD+   G+L  L+ L    N L G +P  +   ++L  + L +N    + P  L
Sbjct  371  LTGTLPPDLCAGGKLETLIAL---GNSLFGAIPASLGKCTSLTRVRLGDNYLNGSIPEGL  427

Query  260  AQLANLQVLDLYNNNLTGDLP-VEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  436
             +L NL  ++L +N ++G  P V      +L  + L  N  +G +P   G F  ++ L +
Sbjct  428  FELPNLTQVELQDNLISGGFPAVSGTGAPNLGQISLSNNQLTGALPAFIGSFSGVQKLLL  487

Query  437  SGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              N  +G IP EIG L +L +  +   N F GG+PPE+G    L   D +   L+GE
Sbjct  488  DQNAFTGEIPPEIGRLQQLSKADLSG-NSFDGGVPPEIGKCRLLTYLDLSRNNLSGE  543


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 76/151 (50%), Gaps = 7/151 (5%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            +SG  +P++GQ+      S++ NQL+G +P  I + S ++ L L  N F    P ++ +L
Sbjct  450  VSGTGAPNLGQI------SLSNNQLTGALPAFIGSFSGVQKLLLDQNAFTGEIPPEIGRL  503

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L   DL  N+  G +P E+ K   L +L L  N  SG IPP       L YL +S N 
Sbjct  504  QQLSKADLSGNSFDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQ  563

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            L G IP+ I  +  L  +   Y N  SG +P
Sbjct  564  LDGEIPATIAAMQSLTAVDFSY-NNLSGLVP  593


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 63/128 (49%), Gaps = 0/128 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L   +G    +  L +  N  +G +PPEI  +  L   +LS N F    P ++ +
Sbjct  467  QLTGALPAFIGSFSGVQKLLLDQNAFTGEIPPEIGRLQQLSKADLSGNSFDGGVPPEIGK  526

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  LDL  NNL+G++P  +  M  L +L+L  N   G IP       +L  +  S N
Sbjct  527  CRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQLDGEIPATIAAMQSLTAVDFSYN  586

Query  446  GLSGVIPS  469
             LSG++P+
Sbjct  587  NLSGLVPA  594



>tpg|DAA59489.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1037

 Score =   224 bits (570),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 118/200 (59%), Positives = 147/200 (74%), Gaps = 0/200 (0%)
 Frame = +2

Query  8    STSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEI  187
            ST  C W  VTC++   V+ LDLSG NLSG +   + +L  L  L +AAN L GP+P  +
Sbjct  59   STGACAWSGVTCNARAAVIGLDLSGRNLSGPVPTALSRLAHLARLDLAANALCGPIPAPL  118

Query  188  SAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLG  367
            S + +L  LNLSNN+   TFP  LA+L  L+VLDLYNNNLTG LP+ V  +  LRHLHLG
Sbjct  119  SRLQSLTHLNLSNNVLNGTFPPPLARLRALRVLDLYNNNLTGPLPLAVVGLPVLRHLHLG  178

Query  368  GNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPE  547
            GN+FSG IPPEYGR+  L+YLAVSGN LSG IP E+G LT L+ELYIGY+N +S G+PPE
Sbjct  179  GNFFSGEIPPEYGRWRRLQYLAVSGNELSGRIPPELGGLTTLRELYIGYYNSYSSGLPPE  238

Query  548  MGNLSQLIRXDAANCGLTGE  607
            +GN++ L+R DAANCGL+GE
Sbjct  239  LGNMTDLVRLDAANCGLSGE  258


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 90/198 (45%), Gaps = 26/198 (13%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L G +   VG LP L  L +  N  +G +P  +     L+ ++LS+N    T P +L  
Sbjct  326  KLRGSIPELVGDLPSLEVLQLWENNFTGGIPRRLGRNGRLQLVDLSSNRLTGTLPPELCA  385

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYL-----  430
               L+ L    N L G +P  + K  +L  + LG NY +G IP      PNL  +     
Sbjct  386  GGKLETLIALGNFLFGSIPEPLGKCEALSRIRLGENYLNGSIPDGLFELPNLTQVELQDN  445

Query  431  -------AVSGNG-------------LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
                   AVSG G             L+G +P+ IG  + L++L +   N F+G +PPE+
Sbjct  446  LLSGGFPAVSGTGAPNLGAITLSNNQLTGALPASIGKFSGLQKLLLDQ-NAFTGAVPPEI  504

Query  551  GNLSQLIRXDAANCGLTG  604
            G L QL + D +   L G
Sbjct  505  GRLQQLSKADLSGNTLDG  522


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 85/162 (52%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P++G L  L  L +  N L+G +PPE+  + +L  L+LSNN      P   A L
Sbjct  255  LSGEIPPELGNLANLDTLFLQVNGLAGAIPPELGRLKSLSSLDLSNNALTGEIPASFAAL  314

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  V  + SL  L L  N F+G IP   GR   L+ + +S N 
Sbjct  315  RNLTLLNLFRNKLRGSIPELVGDLPSLEVLQLWENNFTGGIPRRLGRNGRLQLVDLSSNR  374

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P E+    KL+ L I   N   G IP  +G    L R
Sbjct  375  LTGTLPPELCAGGKLETL-IALGNFLFGSIPEPLGKCEALSR  415


 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 56/167 (34%), Positives = 87/167 (52%), Gaps = 4/167 (2%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G + P++G+L  L +L ++ N L+G +P   +A+  L  LNL  N    + P  +  L
Sbjct  279  LAGAIPPELGRLKSLSSLDLSNNALTGEIPASFAALRNLTLLNLFRNKLRGSIPELVGDL  338

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             +L+VL L+ NN TG +P  + +   L+ + L  N  +G +PPE      LE L   GN 
Sbjct  339  PSLEVLQLWENNFTGGIPRRLGRNGRLQLVDLSSNRLTGTLPPELCAGGKLETLIALGNF  398

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPP---EMGNLSQLIRXD  580
            L G IP  +G    L  + +G  N  +G IP    E+ NL+Q+   D
Sbjct  399  LFGSIPEPLGKCEALSRIRLGE-NYLNGSIPDGLFELPNLTQVELQD  444


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 89/174 (51%), Gaps = 2/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA  262
             LSG + P++G L  L  L I   N  S  +PPE+  ++ L  L+ +N       P +L 
Sbjct  205  ELSGRIPPELGGLTTLRELYIGYYNSYSSGLPPELGNMTDLVRLDAANCGLSGEIPPELG  264

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
             LANL  L L  N L G +P E+ ++ SL  L L  N  +G IP  +    NL  L +  
Sbjct  265  NLANLDTLFLQVNGLAGAIPPELGRLKSLSSLDLSNNALTGEIPASFAALRNLTLLNLFR  324

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            N L G IP  +G+L  L+ L + + N F+GGIP  +G   +L   D ++  LTG
Sbjct  325  NKLRGSIPELVGDLPSLEVLQL-WENNFTGGIPRRLGRNGRLQLVDLSSNRLTG  377


 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 74/151 (49%), Gaps = 7/151 (5%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            +SG  +P++G +      +++ NQL+G +P  I   S L+ L L  N F    P ++ +L
Sbjct  454  VSGTGAPNLGAI------TLSNNQLTGALPASIGKFSGLQKLLLDQNAFTGAVPPEIGRL  507

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L   DL  N L G +P E+ K   L +L L  N  SG IPP       L YL +S N 
Sbjct  508  QQLSKADLSGNTLDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNH  567

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            L G IP+ I  +  L  +   Y N  SG +P
Sbjct  568  LGGEIPATIAAMQSLTAVDFSY-NNLSGLVP  597


 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 85/177 (48%), Gaps = 8/177 (5%)
 Frame = +2

Query  89   LSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  259
            L+G L P++   G+L  L+ L    N L G +P  +     L  + L  N    + P  L
Sbjct  375  LTGTLPPELCAGGKLETLIAL---GNFLFGSIPEPLGKCEALSRIRLGENYLNGSIPDGL  431

Query  260  AQLANLQVLDLYNNNLTGDLP-VEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  436
             +L NL  ++L +N L+G  P V      +L  + L  N  +G +P   G+F  L+ L +
Sbjct  432  FELPNLTQVELQDNLLSGGFPAVSGTGAPNLGAITLSNNQLTGALPASIGKFSGLQKLLL  491

Query  437  SGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              N  +G +P EIG L +L +  +   N   GG+PPE+G    L   D +   L+GE
Sbjct  492  DQNAFTGAVPPEIGRLQQLSKADLSG-NTLDGGVPPEIGKCRLLTYLDLSRNNLSGE  547


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 83/160 (52%), Gaps = 4/160 (3%)
 Frame = +2

Query  101  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  280
            L P++G +  LV L  A   LSG +PPE+  ++ L  L L  N      P +L +L +L 
Sbjct  235  LPPELGNMTDLVRLDAANCGLSGEIPPELGNLANLDTLFLQVNGLAGAIPPELGRLKSLS  294

Query  281  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  460
             LDL NN LTG++P     + +L  L+L  N   G IP   G  P+LE L +  N  +G 
Sbjct  295  SLDLSNNALTGEIPASFAALRNLTLLNLFRNKLRGSIPELVGDLPSLEVLQLWENNFTGG  354

Query  461  IPSEIGNLTKLKELYIGYFNGFSGGIPPEM---GNLSQLI  571
            IP  +G   +L+ + +   N  +G +PPE+   G L  LI
Sbjct  355  IPRRLGRNGRLQLVDLSS-NRLTGTLPPELCAGGKLETLI  393


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 64/128 (50%), Gaps = 0/128 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L   +G+   L  L +  N  +G VPPEI  +  L   +LS N      P ++ +
Sbjct  471  QLTGALPASIGKFSGLQKLLLDQNAFTGAVPPEIGRLQQLSKADLSGNTLDGGVPPEIGK  530

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  LDL  NNL+G++P  +  M  L +L+L  N+  G IP       +L  +  S N
Sbjct  531  CRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNHLGGEIPATIAAMQSLTAVDFSYN  590

Query  446  GLSGVIPS  469
             LSG++P+
Sbjct  591  NLSGLVPA  598



>gb|ABF99108.1| Receptor protein kinase CLAVATA1 precursor, putative, expressed 
[Oryza sativa Japonica Group]
Length=792

 Score =   221 bits (564),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 147/191 (77%), Gaps = 0/191 (0%)
 Frame = +2

Query  35   VTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFL  214
            VTC S   VV LD+SGLNLSG L  ++  L  L+ LS+ AN  SGP+P  +  +  L +L
Sbjct  65   VTCSSRGAVVGLDVSGLNLSGALPAELTGLRGLMRLSVGANAFSGPIPASLGRLQFLTYL  124

Query  215  NLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  394
            NLSNN F  +FP  LA+L  L+VLDLYNNNLT  LP+EV +M  LRHLHLGGN+FSG IP
Sbjct  125  NLSNNAFNGSFPAALARLRGLRVLDLYNNNLTSPLPMEVVQMPLLRHLHLGGNFFSGEIP  184

Query  395  PEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            PEYGR+  ++YLAVSGN LSG IP E+GNLT L+ELYIGY+N +SGG+PPE+GNL++L+R
Sbjct  185  PEYGRWGRMQYLAVSGNELSGKIPPELGNLTSLRELYIGYYNSYSGGLPPELGNLTELVR  244

Query  575  XDAANCGLTGE  607
             DAANCGL+GE
Sbjct  245  LDAANCGLSGE  255


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 87/162 (54%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P++G+L  L  L +  N L+G +P E+  + +L  L+LSNN+     P   ++L
Sbjct  252  LSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLKSLSSLDLSNNVLTGEIPASFSEL  311

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G +P   GR   L+ L +S N 
Sbjct  312  KNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVPRRLGRNGRLQLLDLSSNR  371

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P E+    K+  L I   N   G IP  +G    L R
Sbjct  372  LTGTLPPELCAGGKMHTL-IALGNFLFGAIPDSLGECKSLSR  412


 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 97/175 (55%), Gaps = 4/175 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +G +   +G+   L  L +++N+L+G +PPE+ A   +   + L N +FG+  P  L 
Sbjct  347  NFTGGVPRRLGRNGRLQLLDLSSNRLTGTLPPELCAGGKMHTLIALGNFLFGA-IPDSLG  405

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRF-PNLEYLAVS  439
            +  +L  + L  N L G +P  ++++  L  + L  N  +G  P   G   PNL  +++S
Sbjct  406  ECKSLSRVRLGENYLNGSIPKGLFELPKLTQVELQDNLLTGNFPAVSGAAAPNLGEISLS  465

Query  440  GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             N L+G +P+ IGN + +++L +   N FSG +PPE+G L +L + D ++  L G
Sbjct  466  NNQLTGALPASIGNFSGVQKLLLDR-NSFSGVVPPEIGRLQKLSKADLSSNALEG  519


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 76/151 (50%), Gaps = 7/151 (5%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            +SG  +P++G++      S++ NQL+G +P  I   S ++ L L  N F    P ++ +L
Sbjct  451  VSGAAAPNLGEI------SLSNNQLTGALPASIGNFSGVQKLLLDRNSFSGVVPPEIGRL  504

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L   DL +N L G +P E+ K   L +L L  N  SG+IPP       L YL +S N 
Sbjct  505  QKLSKADLSSNALEGGVPPEIGKCRLLTYLDLSRNNISGKIPPAISGMRILNYLNLSRNH  564

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            L G IP  I  +  L  +   Y N  SG +P
Sbjct  565  LDGEIPPSIATMQSLTAVDFSY-NNLSGLVP  594


 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/174 (30%), Positives = 82/174 (47%), Gaps = 2/174 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G L P++     +  L    N L G +P  +    +L  + L  N    + P  L +L
Sbjct  372  LTGTLPPELCAGGKMHTLIALGNFLFGAIPDSLGECKSLSRVRLGENYLNGSIPKGLFEL  431

Query  269  ANLQVLDLYNNNLTGDLP-VEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
              L  ++L +N LTG+ P V      +L  + L  N  +G +P   G F  ++ L +  N
Sbjct  432  PKLTQVELQDNLLTGNFPAVSGAAAPNLGEISLSNNQLTGALPASIGNFSGVQKLLLDRN  491

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              SGV+P EIG L KL +  +   N   GG+PPE+G    L   D +   ++G+
Sbjct  492  SFSGVVPPEIGRLQKLSKADLSS-NALEGGVPPEIGKCRLLTYLDLSRNNISGK  544


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 80/153 (52%), Gaps = 1/153 (1%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
            SG L P++G L  LV L  A   LSG +PPE+  +  L  L L  N      P +L  L 
Sbjct  229  SGGLPPELGNLTELVRLDAANCGLSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLK  288

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
            +L  LDL NN LTG++P    ++ +L  L+L  N   G IP   G  P+LE L +  N  
Sbjct  289  SLSSLDLSNNVLTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNF  348

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            +G +P  +G   +L+ L +   N  +G +PPE+
Sbjct  349  TGGVPRRLGRNGRLQLLDLSS-NRLTGTLPPEL  380


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 64/125 (51%), Gaps = 2/125 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            + SGV+ P++G+L  L    +++N L G VPPEI     L +L+LS N      P  ++ 
Sbjct  492  SFSGVVPPEIGRLQKLSKADLSSNALEGGVPPEIGKCRLLTYLDLSRNNISGKIPPAISG  551

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            +  L  L+L  N+L G++P  +  M SL  +    N  SG + P  G+F      +  GN
Sbjct  552  MRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLV-PGTGQFSYFNATSFVGN  610

Query  446  -GLSG  457
             GL G
Sbjct  611  PGLCG  615



>gb|AAP68887.1| putative receptor-like protein kinase 1 [Oryza sativa Japonica 
Group]
 gb|ABF99107.1| Receptor protein kinase CLAVATA1 precursor, putative, expressed 
[Oryza sativa Japonica Group]
Length=1029

 Score =   223 bits (567),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 147/191 (77%), Gaps = 0/191 (0%)
 Frame = +2

Query  35   VTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFL  214
            VTC S   VV LD+SGLNLSG L  ++  L  L+ LS+ AN  SGP+P  +  +  L +L
Sbjct  65   VTCSSRGAVVGLDVSGLNLSGALPAELTGLRGLMRLSVGANAFSGPIPASLGRLQFLTYL  124

Query  215  NLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  394
            NLSNN F  +FP  LA+L  L+VLDLYNNNLT  LP+EV +M  LRHLHLGGN+FSG IP
Sbjct  125  NLSNNAFNGSFPAALARLRGLRVLDLYNNNLTSPLPMEVVQMPLLRHLHLGGNFFSGEIP  184

Query  395  PEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            PEYGR+  ++YLAVSGN LSG IP E+GNLT L+ELYIGY+N +SGG+PPE+GNL++L+R
Sbjct  185  PEYGRWGRMQYLAVSGNELSGKIPPELGNLTSLRELYIGYYNSYSGGLPPELGNLTELVR  244

Query  575  XDAANCGLTGE  607
             DAANCGL+GE
Sbjct  245  LDAANCGLSGE  255


 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 87/162 (54%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P++G+L  L  L +  N L+G +P E+  + +L  L+LSNN+     P   ++L
Sbjct  252  LSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLKSLSSLDLSNNVLTGEIPASFSEL  311

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G +P   GR   L+ L +S N 
Sbjct  312  KNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVPRRLGRNGRLQLLDLSSNR  371

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P E+    K+  L I   N   G IP  +G    L R
Sbjct  372  LTGTLPPELCAGGKMHTL-IALGNFLFGAIPDSLGECKSLSR  412


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 97/175 (55%), Gaps = 4/175 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +G +   +G+   L  L +++N+L+G +PPE+ A   +   + L N +FG+  P  L 
Sbjct  347  NFTGGVPRRLGRNGRLQLLDLSSNRLTGTLPPELCAGGKMHTLIALGNFLFGA-IPDSLG  405

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRF-PNLEYLAVS  439
            +  +L  + L  N L G +P  ++++  L  + L  N  +G  P   G   PNL  +++S
Sbjct  406  ECKSLSRVRLGENYLNGSIPKGLFELPKLTQVELQDNLLTGNFPAVSGAAAPNLGEISLS  465

Query  440  GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             N L+G +P+ IGN + +++L +   N FSG +PPE+G L +L + D ++  L G
Sbjct  466  NNQLTGALPASIGNFSGVQKLLLDR-NSFSGVVPPEIGRLQKLSKADLSSNALEG  519


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 76/151 (50%), Gaps = 7/151 (5%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            +SG  +P++G++      S++ NQL+G +P  I   S ++ L L  N F    P ++ +L
Sbjct  451  VSGAAAPNLGEI------SLSNNQLTGALPASIGNFSGVQKLLLDRNSFSGVVPPEIGRL  504

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L   DL +N L G +P E+ K   L +L L  N  SG+IPP       L YL +S N 
Sbjct  505  QKLSKADLSSNALEGGVPPEIGKCRLLTYLDLSRNNISGKIPPAISGMRILNYLNLSRNH  564

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            L G IP  I  +  L  +   Y N  SG +P
Sbjct  565  LDGEIPPSIATMQSLTAVDFSY-NNLSGLVP  594


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/177 (31%), Positives = 86/177 (49%), Gaps = 8/177 (5%)
 Frame = +2

Query  89   LSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  259
            L+G L P++   G++  L+ L    N L G +P  +    +L  + L  N    + P  L
Sbjct  372  LTGTLPPELCAGGKMHTLIAL---GNFLFGAIPDSLGECKSLSRVRLGENYLNGSIPKGL  428

Query  260  AQLANLQVLDLYNNNLTGDLP-VEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  436
             +L  L  ++L +N LTG+ P V      +L  + L  N  +G +P   G F  ++ L +
Sbjct  429  FELPKLTQVELQDNLLTGNFPAVSGAAAPNLGEISLSNNQLTGALPASIGNFSGVQKLLL  488

Query  437  SGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              N  SGV+P EIG L KL +  +   N   GG+PPE+G    L   D +   ++G+
Sbjct  489  DRNSFSGVVPPEIGRLQKLSKADLSS-NALEGGVPPEIGKCRLLTYLDLSRNNISGK  544


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 84/163 (52%), Gaps = 4/163 (2%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
            SG L P++G L  LV L  A   LSG +PPE+  +  L  L L  N      P +L  L 
Sbjct  229  SGGLPPELGNLTELVRLDAANCGLSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLK  288

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
            +L  LDL NN LTG++P    ++ +L  L+L  N   G IP   G  P+LE L +  N  
Sbjct  289  SLSSLDLSNNVLTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNF  348

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM---GNLSQLI  571
            +G +P  +G   +L+ L +   N  +G +PPE+   G +  LI
Sbjct  349  TGGVPRRLGRNGRLQLLDLSS-NRLTGTLPPELCAGGKMHTLI  390


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 64/125 (51%), Gaps = 2/125 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            + SGV+ P++G+L  L    +++N L G VPPEI     L +L+LS N      P  ++ 
Sbjct  492  SFSGVVPPEIGRLQKLSKADLSSNALEGGVPPEIGKCRLLTYLDLSRNNISGKIPPAISG  551

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            +  L  L+L  N+L G++P  +  M SL  +    N  SG + P  G+F      +  GN
Sbjct  552  MRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLV-PGTGQFSYFNATSFVGN  610

Query  446  -GLSG  457
             GL G
Sbjct  611  PGLCG  615



>gb|EAY92008.1| hypothetical protein OsI_13698 [Oryza sativa Indica Group]
Length=1029

 Score =   222 bits (566),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 147/191 (77%), Gaps = 0/191 (0%)
 Frame = +2

Query  35   VTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFL  214
            VTC S   VV LD+SGLNLSG L  ++  L  L+ LS+ AN  SGP+P  +  +  L +L
Sbjct  65   VTCSSRGAVVGLDVSGLNLSGALPAELTGLRGLMRLSVGANAFSGPIPASLGRLQFLTYL  124

Query  215  NLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  394
            NLSNN F  +FP  LA+L  L+VLDLYNNNLT  LP+EV +M  LRHLHLGGN+FSG IP
Sbjct  125  NLSNNAFNGSFPAALARLRGLRVLDLYNNNLTSPLPMEVVQMPLLRHLHLGGNFFSGEIP  184

Query  395  PEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            PEYGR+  ++YLAVSGN LSG IP E+GNLT L+ELYIGY+N +SGG+PPE+GNL++L+R
Sbjct  185  PEYGRWGRMQYLAVSGNELSGKIPPELGNLTSLRELYIGYYNSYSGGLPPELGNLTELVR  244

Query  575  XDAANCGLTGE  607
             DAANCGL+GE
Sbjct  245  LDAANCGLSGE  255


 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 87/162 (54%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P++G+L  L  L +  N L+G +P E+  + +L  L+LSNN+     P   ++L
Sbjct  252  LSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLKSLSSLDLSNNVLTGEIPASFSEL  311

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G +P   GR   L+ L +S N 
Sbjct  312  KNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVPRRLGRNGRLQLLDLSSNR  371

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P E+    K+  L I   N   G IP  +G    L R
Sbjct  372  LTGTLPPELCAGGKMHTL-IALGNFLFGAIPDSLGECKSLSR  412


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 97/175 (55%), Gaps = 4/175 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +G +   +G+   L  L +++N+L+G +PPE+ A   +   + L N +FG+  P  L 
Sbjct  347  NFTGGVPRRLGRNGRLQLLDLSSNRLTGTLPPELCAGGKMHTLIALGNFLFGA-IPDSLG  405

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRF-PNLEYLAVS  439
            +  +L  + L  N L G +P  ++++  L  + L  N  +G  P   G   PNL  +++S
Sbjct  406  ECKSLSRVRLGENYLNGSIPKGLFELPKLTQVELQDNLLTGNFPAVSGAAAPNLGEISLS  465

Query  440  GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             N L+G +P+ IGN + +++L +   N FSG +PPE+G L +L + D ++  L G
Sbjct  466  NNQLTGALPASIGNFSGVQKLLLDR-NSFSGVVPPEIGRLQKLSKADLSSNALEG  519


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 76/151 (50%), Gaps = 7/151 (5%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            +SG  +P++G++      S++ NQL+G +P  I   S ++ L L  N F    P ++ +L
Sbjct  451  VSGAAAPNLGEI------SLSNNQLTGALPASIGNFSGVQKLLLDRNSFSGVVPPEIGRL  504

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L   DL +N L G +P E+ K   L +L L  N  SG+IPP       L YL +S N 
Sbjct  505  QKLSKADLSSNALEGGVPPEIGKCRLLTYLDLSRNNISGKIPPAISGMRILNYLNLSRNH  564

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            L G IP  I  +  L  +   Y N  SG +P
Sbjct  565  LDGEIPPSIATMQSLTAVDFSY-NNLSGLVP  594


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/177 (31%), Positives = 86/177 (49%), Gaps = 8/177 (5%)
 Frame = +2

Query  89   LSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  259
            L+G L P++   G++  L+ L    N L G +P  +    +L  + L  N    + P  L
Sbjct  372  LTGTLPPELCAGGKMHTLIAL---GNFLFGAIPDSLGECKSLSRVRLGENYLNGSIPKGL  428

Query  260  AQLANLQVLDLYNNNLTGDLP-VEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  436
             +L  L  ++L +N LTG+ P V      +L  + L  N  +G +P   G F  ++ L +
Sbjct  429  FELPKLTQVELQDNLLTGNFPAVSGAAAPNLGEISLSNNQLTGALPASIGNFSGVQKLLL  488

Query  437  SGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              N  SGV+P EIG L KL +  +   N   GG+PPE+G    L   D +   ++G+
Sbjct  489  DRNSFSGVVPPEIGRLQKLSKADLSS-NALEGGVPPEIGKCRLLTYLDLSRNNISGK  544


 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 84/163 (52%), Gaps = 4/163 (2%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
            SG L P++G L  LV L  A   LSG +PPE+  +  L  L L  N      P +L  L 
Sbjct  229  SGGLPPELGNLTELVRLDAANCGLSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLK  288

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
            +L  LDL NN LTG++P    ++ +L  L+L  N   G IP   G  P+LE L +  N  
Sbjct  289  SLSSLDLSNNVLTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNF  348

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM---GNLSQLI  571
            +G +P  +G   +L+ L +   N  +G +PPE+   G +  LI
Sbjct  349  TGGVPRRLGRNGRLQLLDLSS-NRLTGTLPPELCAGGKMHTLI  390


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 64/125 (51%), Gaps = 2/125 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            + SGV+ P++G+L  L    +++N L G VPPEI     L +L+LS N      P  ++ 
Sbjct  492  SFSGVVPPEIGRLQKLSKADLSSNALEGGVPPEIGKCRLLTYLDLSRNNISGKIPPAISG  551

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            +  L  L+L  N+L G++P  +  M SL  +    N  SG + P  G+F      +  GN
Sbjct  552  MRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLV-PGTGQFSYFNATSFVGN  610

Query  446  -GLSG  457
             GL G
Sbjct  611  PGLCG  615



>dbj|BAJ89729.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1030

 Score =   222 bits (566),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 146/198 (74%), Gaps = 0/198 (0%)
 Frame = +2

Query  14   SHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISA  193
            +HC W  V+C +   V  L L GLNLSG L P + +L  L+ L + AN LSGPVP  +  
Sbjct  57   AHCAWAGVSCGARGAVAGLALGGLNLSGALPPALSRLRGLLRLDVGANALSGPVPAALGH  116

Query  194  ISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGN  373
            +  L  LNLSNN F  + P  LA+L  L+VLDLYNNNLT  LP+EV +M  LRHLHLGGN
Sbjct  117  LRFLTHLNLSNNAFNGSLPPALARLRGLRVLDLYNNNLTSPLPIEVAQMPMLRHLHLGGN  176

Query  374  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
            +FSG IPPEYGR+  L+YLA+SGN LSG IP E+GNLT L+ELYIGY+N +SGG+PPE+G
Sbjct  177  FFSGEIPPEYGRWTRLQYLALSGNELSGKIPPELGNLTSLRELYIGYYNAYSGGVPPELG  236

Query  554  NLSQLIRXDAANCGLTGE  607
            NL+ L+R DAANCGL+G+
Sbjct  237  NLTDLVRLDAANCGLSGK  254


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 87/177 (49%), Gaps = 8/177 (5%)
 Frame = +2

Query  89   LSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  259
            L+G L PD+   G+L  L+ L    N L G +P  +    +L  + L  N    + P  L
Sbjct  371  LTGTLPPDLCAGGKLHTLIAL---GNSLFGAIPDSLGQCKSLSRIRLGENYLNGSIPEGL  427

Query  260  AQLANLQVLDLYNNNLTGDLPVEV-YKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  436
             +L  L  ++L +N LTGD P  V     +L  ++L  N  +G +P   G F  ++ L +
Sbjct  428  FELQKLTQVELQDNLLTGDFPAVVGAAAPNLGEINLSNNQLTGVLPASIGNFSGVQKLLL  487

Query  437  SGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              N  SG +P+E+G L +L +  +   N   GG+PPE+G    L   D +   L+G+
Sbjct  488  DRNSFSGALPAEVGRLQQLSKADLS-GNAIEGGVPPEVGKCRLLTYLDLSRNNLSGK  543


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 86/162 (53%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P++G+L  L  L +  N L+G +P ++ ++ +L  L+LSNN      P   +QL
Sbjct  251  LSGKIPPELGRLQKLDTLFLQVNGLTGAIPSDLGSLKSLSSLDLSNNALAGEIPPSFSQL  310

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             N+ +L+L+ N L GD+P  V  + SL  L L  N F+G +P   G    L+ + +S N 
Sbjct  311  KNMTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGSVPRRLGGNNRLQLVDLSSNR  370

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P ++    KL  L I   N   G IP  +G    L R
Sbjct  371  LTGTLPPDLCAGGKLHTL-IALGNSLFGAIPDSLGQCKSLSR  411


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 60/173 (35%), Positives = 91/173 (53%), Gaps = 2/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            LSG + P++G L  L  L I   N  SG VPPE+  ++ L  L+ +N       P +L +
Sbjct  202  LSGKIPPELGNLTSLRELYIGYYNAYSGGVPPELGNLTDLVRLDAANCGLSGKIPPELGR  261

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  L L  N LTG +P ++  + SL  L L  N  +G IPP + +  N+  L +  N
Sbjct  262  LQKLDTLFLQVNGLTGAIPSDLGSLKSLSSLDLSNNALAGEIPPSFSQLKNMTLLNLFRN  321

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             L G IP  +G+L  L+ L + + N F+G +P  +G  ++L   D ++  LTG
Sbjct  322  KLRGDIPDFVGDLPSLEVLQL-WENNFTGSVPRRLGGNNRLQLVDLSSNRLTG  373


 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 72/151 (48%), Gaps = 1/151 (1%)
 Frame = +2

Query  155  NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVY  334
            N L+G +PP  S +  +  LNL  N      P  +  L +L+VL L+ NN TG +P  + 
Sbjct  297  NALAGEIPPSFSQLKNMTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGSVPRRLG  356

Query  335  KMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGY  514
                L+ + L  N  +G +PP+      L  L   GN L G IP  +G    L  + +G 
Sbjct  357  GNNRLQLVDLSSNRLTGTLPPDLCAGGKLHTLIALGNSLFGAIPDSLGQCKSLSRIRLGE  416

Query  515  FNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
             N  +G IP  +  L +L + +  +  LTG+
Sbjct  417  -NYLNGSIPEGLFELQKLTQVELQDNLLTGD  446


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 73/149 (49%), Gaps = 7/149 (5%)
 Frame = +2

Query  95   GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  274
            G  +P++G+    +NLS   NQL+G +P  I   S ++ L L  N F    P ++ +L  
Sbjct  452  GAAAPNLGE----INLS--NNQLTGVLPASIGNFSGVQKLLLDRNSFSGALPAEVGRLQQ  505

Query  275  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  454
            L   DL  N + G +P EV K   L +L L  N  SG+IPP       L YL +S N L 
Sbjct  506  LSKADLSGNAIEGGVPPEVGKCRLLTYLDLSRNNLSGKIPPAISGMRILNYLNLSRNHLD  565

Query  455  GVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            G IP  I  +  L  +   Y N  SG +P
Sbjct  566  GEIPPSISTMQSLTAVDFSY-NNLSGLVP  593


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 62/127 (49%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+GVL   +G    +  L +  N  SG +P E+  +  L   +LS N      P ++ +
Sbjct  467  QLTGVLPASIGNFSGVQKLLLDRNSFSGALPAEVGRLQQLSKADLSGNAIEGGVPPEVGK  526

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  LDL  NNL+G +P  +  M  L +L+L  N+  G IPP      +L  +  S N
Sbjct  527  CRLLTYLDLSRNNLSGKIPPAISGMRILNYLNLSRNHLDGEIPPSISTMQSLTAVDFSYN  586

Query  446  GLSGVIP  466
             LSG++P
Sbjct  587  NLSGLVP  593



>gb|EEE60014.1| hypothetical protein OsJ_12761 [Oryza sativa Japonica Group]
Length=979

 Score =   221 bits (562),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 135/174 (78%), Gaps = 0/174 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            NLSG L  ++  L  L+ LS+ AN  SGP+P  +  +  L +LNLSNN F  +FP  LA+
Sbjct  56   NLSGALPAELTGLRGLMRLSVGANAFSGPIPASLGRLQFLTYLNLSNNAFNGSFPAALAR  115

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L+VLDLYNNNLT  LP+EV +M  LRHLHLGGN+FSG IPPEYGR+  ++YLAVSGN
Sbjct  116  LRGLRVLDLYNNNLTSPLPMEVVQMPLLRHLHLGGNFFSGEIPPEYGRWGRMQYLAVSGN  175

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
             LSG IP E+GNLT L+ELYIGY+N +SGG+PPE+GNL++L+R DAANCGL+GE
Sbjct  176  ELSGKIPPELGNLTSLRELYIGYYNSYSGGLPPELGNLTELVRLDAANCGLSGE  229


 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 96/169 (57%), Gaps = 5/169 (3%)
 Frame = +2

Query  107  PD-VGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLAQLANLQ  280
            PD VG LP L  L +++N+L+G +PPE+ A   +   + L N +FG+  P  L +  +L 
Sbjct  303  PDFVGDLPSLELLDLSSNRLTGTLPPELCAGGKMHTLIALGNFLFGA-IPDSLGECKSLS  361

Query  281  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRF-PNLEYLAVSGNGLSG  457
             + L  N L G +P  ++++  L  + L  N  +G  P   G   PNL  +++S N L+G
Sbjct  362  RVRLGENYLNGSIPKGLFELPKLTQVELQDNLLTGNFPAVSGAAAPNLGEISLSNNQLTG  421

Query  458  VIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             +P+ IGN + +++L +   N FSG +PPE+G L +L + D ++  L G
Sbjct  422  ALPASIGNFSGVQKLLLDR-NSFSGVVPPEIGRLQKLSKADLSSNALEG  469


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 90/172 (52%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P++G+L  L  L +  N L+G +P E+  + +L  L+LSNN+     P   ++L
Sbjct  226  LSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLKSLSSLDLSNNVLTGEIPASFSEL  285

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L GD+P  V  + SL  L L  N  +G +PPE      +  L   GN 
Sbjct  286  KNLTLLNLFRNKLRGDIPDFVGDLPSLELLDLSSNRLTGTLPPELCAGGKMHTLIALGNF  345

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            L G IP  +G    L  + +G  N  +G IP  +  L +L + +  +  LTG
Sbjct  346  LFGAIPDSLGECKSLSRVRLGE-NYLNGSIPKGLFELPKLTQVELQDNLLTG  396


 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 61/161 (38%), Positives = 81/161 (50%), Gaps = 1/161 (1%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
            SG L P++G L  LV L  A   LSG +PPE+  +  L  L L  N      P +L  L 
Sbjct  203  SGGLPPELGNLTELVRLDAANCGLSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLK  262

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
            +L  LDL NN LTG++P    ++ +L  L+L  N   G IP   G  P+LE L +S N L
Sbjct  263  SLSSLDLSNNVLTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDLPSLELLDLSSNRL  322

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            +G +P E+    K+  L I   N   G IP  +G    L R
Sbjct  323  TGTLPPELCAGGKMHTL-IALGNFLFGAIPDSLGECKSLSR  362


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 76/151 (50%), Gaps = 7/151 (5%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            +SG  +P++G++      S++ NQL+G +P  I   S ++ L L  N F    P ++ +L
Sbjct  401  VSGAAAPNLGEI------SLSNNQLTGALPASIGNFSGVQKLLLDRNSFSGVVPPEIGRL  454

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L   DL +N L G +P E+ K   L +L L  N  SG+IPP       L YL +S N 
Sbjct  455  QKLSKADLSSNALEGGVPPEIGKCRLLTYLDLSRNNISGKIPPAISGMRILNYLNLSRNH  514

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            L G IP  I  +  L  +   Y N  SG +P
Sbjct  515  LDGEIPPSIATMQSLTAVDFSY-NNLSGLVP  544


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 64/125 (51%), Gaps = 2/125 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            + SGV+ P++G+L  L    +++N L G VPPEI     L +L+LS N      P  ++ 
Sbjct  442  SFSGVVPPEIGRLQKLSKADLSSNALEGGVPPEIGKCRLLTYLDLSRNNISGKIPPAISG  501

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            +  L  L+L  N+L G++P  +  M SL  +    N  SG + P  G+F      +  GN
Sbjct  502  MRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLV-PGTGQFSYFNATSFVGN  560

Query  446  -GLSG  457
             GL G
Sbjct  561  PGLCG  565



>ref|XP_009411355.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1009

 Score =   221 bits (562),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 155/198 (78%), Gaps = 1/198 (1%)
 Frame = +2

Query  17   HCTWRRVTCd-sllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISA  193
            HC+W  V CD     VVSLDL+G NLSG L P VG+L  L+NLS A+N LSGP+P EIS 
Sbjct  59   HCSWPGVGCDPIQGSVVSLDLTGFNLSGSLFPAVGRLRHLLNLSAASNSLSGPIPAEISR  118

Query  194  ISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGN  373
            +++LR LNLSNN+   +FP  LA+L NL VLDLYNNNLTG LPVEV ++ +LRHLHLGGN
Sbjct  119  LASLRHLNLSNNLLNGSFPSALARLKNLLVLDLYNNNLTGPLPVEVAQLPNLRHLHLGGN  178

Query  374  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
            +F+G IPPE+GR+  LEYLAVSGN L G IP E+GNLT+L++LY+GYFN F GGIPPE+G
Sbjct  179  FFTGVIPPEFGRWEFLEYLAVSGNELGGPIPPELGNLTRLRQLYVGYFNSFEGGIPPEIG  238

Query  554  NLSQLIRXDAANCGLTGE  607
            +L  L+R D ANCGL GE
Sbjct  239  SLPALVRLDMANCGLNGE  256


 Score = 98.6 bits (244),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 65/196 (33%), Positives = 103/196 (53%), Gaps = 24/196 (12%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  265
             +GV+ P+ G+  FL  L+++ N+L GP+PPE+  ++ LR L +   N F    P ++  
Sbjct  180  FTGVIPPEFGRWEFLEYLAVSGNELGGPIPPELGNLTRLRQLYVGYFNSFEGGIPPEIGS  239

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  LD+ N  L G++P E++K+ +L  L L  N  +G IPPE GR  +L+ + +S N
Sbjct  240  LPALVRLDMANCGLNGEIPPELWKLQNLDTLFLQVNGLAGDIPPELGRLRSLKSMDLSNN  299

Query  446  GLSGVIPSEIGNLTKLKEL-------------YIG----------YFNGFSGGIPPEMGN  556
             L+G IP+   +L  L  L             +IG          + N F+GGIP ++G 
Sbjct  300  ALTGEIPATFADLENLTLLNLFRNKLRGLIPEFIGELPALEVLQLWENNFTGGIPRQLGR  359

Query  557  LSQLIRXDAANCGLTG  604
              +L   D ++  LTG
Sbjct  360  SGRLQLLDLSSNKLTG  375


 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/162 (34%), Positives = 87/162 (54%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G + P++ +L  L  L +  N L+G +PPE+  + +L+ ++LSNN      P   A L
Sbjct  253  LNGEIPPELWKLQNLDTLFLQVNGLAGDIPPELGRLRSLKSMDLSNNALTGEIPATFADL  312

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  + ++ +L  L L  N F+G IP + GR   L+ L +S N 
Sbjct  313  ENLTLLNLFRNKLRGLIPEFIGELPALEVLQLWENNFTGGIPRQLGRSGRLQLLDLSSNK  372

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P+ + +   L E  I   N   G IP  +G    L R
Sbjct  373  LTGTLPTGLCSENTL-ETVIALGNFLFGPIPETLGRCKSLSR  413


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 80/152 (53%), Gaps = 1/152 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            +  G + P++G LP LV L +A   L+G +PPE+  +  L  L L  N      P +L +
Sbjct  228  SFEGGIPPEIGSLPALVRLDMANCGLNGEIPPELWKLQNLDTLFLQVNGLAGDIPPELGR  287

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L +L+ +DL NN LTG++P     + +L  L+L  N   G IP   G  P LE L +  N
Sbjct  288  LRSLKSMDLSNNALTGEIPATFADLENLTLLNLFRNKLRGLIPEFIGELPALEVLQLWEN  347

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
              +G IP ++G   +L+ L +   N  +G +P
Sbjct  348  NFTGGIPRQLGRSGRLQLLDLSS-NKLTGTLP  378


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 75/150 (50%), Gaps = 7/150 (5%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
            +  +SPD+G+    +NLS   N+LSG +PP I   S ++ L L+ N F    P ++ +L 
Sbjct  454  AAAISPDLGE----INLS--NNRLSGSIPPSIGNYSGVQKLLLNQNQFSDRIPPEIGRLQ  507

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
             L  +D   N  +G +  E+ +   L  + L  N  SG IPPE  R   L YL +S N L
Sbjct  508  ELSKVDFSGNRFSGPITPEISRCKLLTFVDLSRNELSGEIPPEIARMRILNYLNLSRNQL  567

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
             G IP  I  +  L  +   Y N  SG +P
Sbjct  568  EGGIPPSIATMQSLTAVDFSY-NKLSGHVP  596


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 84/174 (48%), Gaps = 3/174 (2%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPE-ISAIS-TLRFLNLSNNIFGSTFPHQLA  262
            L+G +   +  LP L  + +  N L+G  P    +AIS  L  +NLSNN    + P  + 
Sbjct  421  LNGSIPDGLFSLPMLSQIELQDNLLTGGFPDTGAAAISPDLGEINLSNNRLSGSIPPSIG  480

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
              + +Q L L  N  +  +P E+ ++  L  +   GN FSG I PE  R   L ++ +S 
Sbjct  481  NYSGVQKLLLNQNQFSDRIPPEIGRLQELSKVDFSGNRFSGPITPEISRCKLLTFVDLSR  540

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            N LSG IP EI  +  L  L +   N   GGIPP +  +  L   D +   L+G
Sbjct  541  NELSGEIPPEIARMRILNYLNLSR-NQLEGGIPPSIATMQSLTAVDFSYNKLSG  593


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 86/172 (50%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G + P++G+L  L ++ ++ N L+G +P   + +  L  LNL  N      P  + +L
Sbjct  277  LAGDIPPELGRLRSLKSMDLSNNALTGEIPATFADLENLTLLNLFRNKLRGLIPEFIGEL  336

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L+VL L+ NN TG +P ++ +   L+ L L  N  +G +P        LE +   GN 
Sbjct  337  PALEVLQLWENNFTGGIPRQLGRSGRLQLLDLSSNKLTGTLPTGLCSENTLETVIALGNF  396

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            L G IP  +G    L  + +G  N  +G IP  + +L  L + +  +  LTG
Sbjct  397  LFGPIPETLGRCKSLSRIRMGE-NYLNGSIPDGLFSLPMLSQIELQDNLLTG  447


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 57/191 (30%), Positives = 89/191 (47%), Gaps = 27/191 (14%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L G++   +G+LP L  L +  N  +G +P ++     L+ L+LS+N    T P  L  
Sbjct  324  KLRGLIPEFIGELPALEVLQLWENNFTGGIPRQLGRSGRLQLLDLSSNKLTGTLPTGLCS  383

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP-----------------  394
               L+ +    N L G +P  + +  SL  + +G NY +G IP                 
Sbjct  384  ENTLETVIALGNFLFGPIPETLGRCKSLSRIRMGENYLNGSIPDGLFSLPMLSQIELQDN  443

Query  395  ------PEYGRF---PNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPE  547
                  P+ G     P+L  + +S N LSG IP  IGN + +++L +   N FS  IPPE
Sbjct  444  LLTGGFPDTGAAAISPDLGEINLSNNRLSGSIPPSIGNYSGVQKLLLNQ-NQFSDRIPPE  502

Query  548  MGNLSQLIRXD  580
            +G L +L + D
Sbjct  503  IGRLQELSKVD  513


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P +G    +  L +  NQ S  +PPEI  +  L  ++ S N F      ++++ 
Sbjct  471  LSGSIPPSIGNYSGVQKLLLNQNQFSDRIPPEIGRLQELSKVDFSGNRFSGPITPEISRC  530

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  +DL  N L+G++P E+ +M  L +L+L  N   G IPP      +L  +  S N 
Sbjct  531  KLLTFVDLSRNELSGEIPPEIARMRILNYLNLSRNQLEGGIPPSIATMQSLTAVDFSYNK  590

Query  449  LSGVIP  466
            LSG +P
Sbjct  591  LSGHVP  596


 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 71/153 (46%), Gaps = 3/153 (2%)
 Frame = +2

Query  155  NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVY  334
            N L GP+P  +    +L  + +  N    + P  L  L  L  ++L +N LTG  P    
Sbjct  395  NFLFGPIPETLGRCKSLSRIRMGENYLNGSIPDGLFSLPMLSQIELQDNLLTGGFPDTGA  454

Query  335  KMTS--LRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYI  508
               S  L  ++L  N  SG IPP  G +  ++ L ++ N  S  IP EIG L +L ++  
Sbjct  455  AAISPDLGEINLSNNRLSGSIPPSIGNYSGVQKLLLNQNQFSDRIPPEIGRLQELSKVDF  514

Query  509  GYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
               N FSG I PE+     L   D +   L+GE
Sbjct  515  SG-NRFSGPITPEISRCKLLTFVDLSRNELSGE  546



>emb|CDY23037.1| BnaC07g31500D [Brassica napus]
Length=967

 Score =   219 bits (559),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 139/203 (68%), Gaps = 24/203 (12%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPP  181
            N+STS C W  VTCD                         L  + +L ++   LSG +  
Sbjct  51   NLSTSFCLWTGVTCD-----------------------ASLRHVTSLYLSGLNLSGTLSS  87

Query  182  EISAISTLRFLNLSNNIFGSTFPHQL-AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHL  358
             ++++S LR LNLSNN+F  +FP +L A L NL+VLDLYNNNLTGDLPV +  +T LRHL
Sbjct  88   SMASLSELRLLNLSNNVFNGSFPDELSAGLVNLRVLDLYNNNLTGDLPVSLTNLTELRHL  147

Query  359  HLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGI  538
            HLGGNYF+GRIPP YG +P LEYLAVSGN L+G IP EIGNLT L+ELYIGYFN F GG+
Sbjct  148  HLGGNYFAGRIPPAYGSWPALEYLAVSGNELAGKIPPEIGNLTALRELYIGYFNAFDGGL  207

Query  539  PPEMGNLSQLIRXDAANCGLTGE  607
            PPE+GNLS L+R DAANCGL GE
Sbjct  208  PPEIGNLSDLLRLDAANCGLRGE  230


 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 60/173 (35%), Positives = 93/173 (54%), Gaps = 2/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            L+G + P++G L  L  L I   N   G +PPEI  +S L  L+ +N       P ++ +
Sbjct  178  LAGKIPPEIGNLTALRELYIGYFNAFDGGLPPEIGNLSDLLRLDAANCGLRGEIPPEIGR  237

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  L L  N  +G LP E+  ++SL+ + L  N F+G IPP + +  NL  L +  N
Sbjct  238  LRRLDTLFLQVNAFSGTLPPELGTISSLKSMDLSNNMFTGEIPPSFEQLRNLTLLNLFRN  297

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             L G IP  IG++  L+ L + + N F+G IP ++G   +L+  D ++  LTG
Sbjct  298  KLYGAIPEFIGDMPGLEVLQL-WENNFTGSIPRKLGGNGRLVILDLSSNKLTG  349


 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 84/162 (52%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L G + P++G+L  L  L +  N  SG +PPE+  IS+L+ ++LSNN+F    P    QL
Sbjct  227  LRGEIPPEIGRLRRLDTLFLQVNAFSGTLPPELGTISSLKSMDLSNNMFTGEIPPSFEQL  286

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  +  M  L  L L  N F+G IP + G    L  L +S N 
Sbjct  287  RNLTLLNLFRNKLYGAIPEFIGDMPGLEVLQLWENNFTGSIPRKLGGNGRLVILDLSSNK  346

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P  +    +L  + I   N   G IP  +G    L R
Sbjct  347  LTGTLPPNMCFGNRLVTV-ITLGNFLFGSIPDSLGKCESLTR  387


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 88/176 (50%), Gaps = 3/176 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P++     LV +    N L G +P  +    +L  + +  N    + P+ L  
Sbjct  346  KLTGTLPPNMCFGNRLVTVITLGNFLFGSIPDSLGKCESLTRIRMGQNFLNGSIPNGLFG  405

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTS--LRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  439
            L  L  ++L +N LTG+LP+ +    S  L  + L  N  SG +PP  G F  ++ L + 
Sbjct  406  LPELSQVELQDNYLTGELPLPISGGVSVNLGQISLSNNQLSGPLPPAIGNFSGVQKLLLD  465

Query  440  GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            GN  SG IPSEIG L +L +L   + N FSGGI PE+     L   D +   L+GE
Sbjct  466  GNKFSGPIPSEIGRLQQLSKLDFSH-NLFSGGIAPEISRCKLLTYVDLSRNELSGE  520


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 79/154 (51%), Gaps = 1/154 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
              G L P++G L  L+ L  A   L G +PPEI  +  L  L L  N F  T P +L  +
Sbjct  203  FDGGLPPEIGNLSDLLRLDAANCGLRGEIPPEIGRLRRLDTLFLQVNAFSGTLPPELGTI  262

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
            ++L+ +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N 
Sbjct  263  SSLKSMDLSNNMFTGEIPPSFEQLRNLTLLNLFRNKLYGAIPEFIGDMPGLEVLQLWENN  322

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
             +G IP ++G   +L  L +   N  +G +PP M
Sbjct  323  FTGSIPRKLGGNGRLVILDLSS-NKLTGTLPPNM  355


 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 78/151 (52%), Gaps = 7/151 (5%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            +SG +S ++GQ+      S++ NQLSGP+PP I   S ++ L L  N F    P ++ +L
Sbjct  427  ISGGVSVNLGQI------SLSNNQLSGPLPPAIGNFSGVQKLLLDGNKFSGPIPSEIGRL  480

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  LD  +N  +G +  E+ +   L ++ L  N  SG IP E      L YL VS N 
Sbjct  481  QQLSKLDFSHNLFSGGIAPEISRCKLLTYVDLSRNELSGEIPNEITSMRILNYLNVSRNH  540

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            L G IP+ I ++  L  +   Y N  SG +P
Sbjct  541  LVGSIPATISSMQSLTSVDFSY-NNLSGLVP  570


 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 68/128 (53%), Gaps = 0/128 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             LSG L P +G    +  L +  N+ SGP+P EI  +  L  L+ S+N+F      ++++
Sbjct  444  QLSGPLPPAIGNFSGVQKLLLDGNKFSGPIPSEIGRLQQLSKLDFSHNLFSGGIAPEISR  503

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  +DL  N L+G++P E+  M  L +L++  N+  G IP       +L  +  S N
Sbjct  504  CKLLTYVDLSRNELSGEIPNEITSMRILNYLNVSRNHLVGSIPATISSMQSLTSVDFSYN  563

Query  446  GLSGVIPS  469
             LSG++PS
Sbjct  564  NLSGLVPS  571


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 52/163 (32%), Positives = 79/163 (48%), Gaps = 3/163 (2%)
 Frame = +2

Query  122  LPFLVNLSIAANQLSGPVPPEISAISTLRF--LNLSNNIFGSTFPHQLAQLANLQVLDLY  295
            LP L  + +  N L+G +P  IS   ++    ++LSNN      P  +   + +Q L L 
Sbjct  406  LPELSQVELQDNYLTGELPLPISGGVSVNLGQISLSNNQLSGPLPPAIGNFSGVQKLLLD  465

Query  296  NNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEI  475
             N  +G +P E+ ++  L  L    N FSG I PE  R   L Y+ +S N LSG IP+EI
Sbjct  466  GNKFSGPIPSEIGRLQQLSKLDFSHNLFSGGIAPEISRCKLLTYVDLSRNELSGEIPNEI  525

Query  476  GNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             ++  L  L +   N   G IP  + ++  L   D +   L+G
Sbjct  526  TSMRILNYLNVSR-NHLVGSIPATISSMQSLTSVDFSYNNLSG  567



>ref|XP_002461427.1| hypothetical protein SORBIDRAFT_02g002450 [Sorghum bicolor]
 gb|EER97948.1| hypothetical protein SORBIDRAFT_02g002450 [Sorghum bicolor]
Length=1031

 Score =   219 bits (559),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 147/201 (73%), Gaps = 1/201 (0%)
 Frame = +2

Query  8    STSHCTWRRVTCdsllhvvsldlsglNLSGVL-SPDVGQLPFLVNLSIAANQLSGPVPPE  184
            ST  C W  VTC++   V+ LDLSG NLSG + +  + +L  L  L +AAN LSGP+P  
Sbjct  56   STGPCAWSGVTCNARGAVIGLDLSGRNLSGAVPAAALSRLAHLARLDLAANALSGPIPAP  115

Query  185  ISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHL  364
            +S + +L  LNLSNN+   TFP   A+L  L+VLDLYNNNLTG LP+ V  +  LRHLHL
Sbjct  116  LSRLQSLTHLNLSNNVLNGTFPPPFARLRALRVLDLYNNNLTGPLPLVVVALPMLRHLHL  175

Query  365  GGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPP  544
            GGN+FSG IPPEYG++  L+YLAVSGN LSG IP E+G LT L+ELYIGY+N +S GIPP
Sbjct  176  GGNFFSGEIPPEYGQWRRLQYLAVSGNELSGKIPPELGGLTSLRELYIGYYNSYSSGIPP  235

Query  545  EMGNLSQLIRXDAANCGLTGE  607
            E GN++ L+R DAANCGL+GE
Sbjct  236  EFGNMTDLVRLDAANCGLSGE  256


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 91/198 (46%), Gaps = 26/198 (13%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L G +   VG LP L  L +  N  +G +P  +     L+ ++LS+N    T P +L  
Sbjct  324  KLRGSIPELVGDLPNLEVLQLWENNFTGGIPRRLGRNGRLQLVDLSSNRLTGTLPPELCA  383

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYL-----  430
               L+ L    N L G +P  + K  +L  + LG NY +G IP      PNL  +     
Sbjct  384  GGKLETLIALGNFLFGSIPESLGKCEALSRIRLGENYLNGSIPEGLFELPNLTQVELQDN  443

Query  431  -------AVSGNG-------------LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
                   AV+G G             L+G +P+ IGN + L++L +   N F+G +PPE+
Sbjct  444  LLSGGFPAVAGTGAPNLGAITLSNNQLTGALPASIGNFSGLQKLLLDQ-NAFTGAVPPEI  502

Query  551  GNLSQLIRXDAANCGLTG  604
            G L QL + D +   L G
Sbjct  503  GRLQQLSKADLSGNALDG  520


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 96/197 (49%), Gaps = 26/197 (13%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  265
             SG + P+ GQ   L  L+++ N+LSG +PPE+  +++LR L +   N + S  P +   
Sbjct  180  FSGEIPPEYGQWRRLQYLAVSGNELSGKIPPELGGLTSLRELYIGYYNSYSSGIPPEFGN  239

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYG-------------  406
            + +L  LD  N  L+G++P E+  + +L  L L  N  +G IPPE G             
Sbjct  240  MTDLVRLDAANCGLSGEIPPELGNLENLDTLFLQVNGLTGAIPPELGRLRSLSSLDLSNN  299

Query  407  -----------RFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
                          NL  L +  N L G IP  +G+L  L+ L + + N F+GGIP  +G
Sbjct  300  GLTGEIPASFAALKNLTLLNLFRNKLRGSIPELVGDLPNLEVLQL-WENNFTGGIPRRLG  358

Query  554  NLSQLIRXDAANCGLTG  604
               +L   D ++  LTG
Sbjct  359  RNGRLQLVDLSSNRLTG  375


 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 85/162 (52%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P++G L  L  L +  N L+G +PPE+  + +L  L+LSNN      P   A L
Sbjct  253  LSGEIPPELGNLENLDTLFLQVNGLTGAIPPELGRLRSLSSLDLSNNGLTGEIPASFAAL  312

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  V  + +L  L L  N F+G IP   GR   L+ + +S N 
Sbjct  313  KNLTLLNLFRNKLRGSIPELVGDLPNLEVLQLWENNFTGGIPRRLGRNGRLQLVDLSSNR  372

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P E+    KL+ L I   N   G IP  +G    L R
Sbjct  373  LTGTLPPELCAGGKLETL-IALGNFLFGSIPESLGKCEALSR  413


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/167 (34%), Positives = 87/167 (52%), Gaps = 4/167 (2%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G + P++G+L  L +L ++ N L+G +P   +A+  L  LNL  N    + P  +  L
Sbjct  277  LTGAIPPELGRLRSLSSLDLSNNGLTGEIPASFAALKNLTLLNLFRNKLRGSIPELVGDL  336

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL+VL L+ NN TG +P  + +   L+ + L  N  +G +PPE      LE L   GN 
Sbjct  337  PNLEVLQLWENNFTGGIPRRLGRNGRLQLVDLSSNRLTGTLPPELCAGGKLETLIALGNF  396

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPP---EMGNLSQLIRXD  580
            L G IP  +G    L  + +G  N  +G IP    E+ NL+Q+   D
Sbjct  397  LFGSIPESLGKCEALSRIRLGE-NYLNGSIPEGLFELPNLTQVELQD  442


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/139 (36%), Positives = 68/139 (49%), Gaps = 1/139 (1%)
 Frame = +2

Query  125  PFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNN  304
            P L  ++++ NQL+G +P  I   S L+ L L  N F    P ++ +L  L   DL  N 
Sbjct  458  PNLGAITLSNNQLTGALPASIGNFSGLQKLLLDQNAFTGAVPPEIGRLQQLSKADLSGNA  517

Query  305  LTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNL  484
            L G +P E+ K   L +L L  N  SG IPP       L YL +S N L G IP+ I  +
Sbjct  518  LDGGMPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNHLDGEIPATIAAM  577

Query  485  TKLKELYIGYFNGFSGGIP  541
              L  +   Y N  SG +P
Sbjct  578  QSLTAVDFSY-NNLSGLVP  595


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 84/177 (47%), Gaps = 8/177 (5%)
 Frame = +2

Query  89   LSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  259
            L+G L P++   G+L  L+ L    N L G +P  +     L  + L  N    + P  L
Sbjct  373  LTGTLPPELCAGGKLETLIAL---GNFLFGSIPESLGKCEALSRIRLGENYLNGSIPEGL  429

Query  260  AQLANLQVLDLYNNNLTGDLP-VEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  436
             +L NL  ++L +N L+G  P V      +L  + L  N  +G +P   G F  L+ L +
Sbjct  430  FELPNLTQVELQDNLLSGGFPAVAGTGAPNLGAITLSNNQLTGALPASIGNFSGLQKLLL  489

Query  437  SGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              N  +G +P EIG L +L +  +   N   GG+PPE+G    L   D +   L+GE
Sbjct  490  DQNAFTGAVPPEIGRLQQLSKADLSG-NALDGGMPPEIGKCRLLTYLDLSRNNLSGE  545


 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 63/128 (49%), Gaps = 0/128 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L   +G    L  L +  N  +G VPPEI  +  L   +LS N      P ++ +
Sbjct  469  QLTGALPASIGNFSGLQKLLLDQNAFTGAVPPEIGRLQQLSKADLSGNALDGGMPPEIGK  528

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  LDL  NNL+G++P  +  M  L +L+L  N+  G IP       +L  +  S N
Sbjct  529  CRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNHLDGEIPATIAAMQSLTAVDFSYN  588

Query  446  GLSGVIPS  469
             LSG++P+
Sbjct  589  NLSGLVPA  596


 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 81/160 (51%), Gaps = 4/160 (3%)
 Frame = +2

Query  101  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  280
            + P+ G +  LV L  A   LSG +PPE+  +  L  L L  N      P +L +L +L 
Sbjct  233  IPPEFGNMTDLVRLDAANCGLSGEIPPELGNLENLDTLFLQVNGLTGAIPPELGRLRSLS  292

Query  281  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  460
             LDL NN LTG++P     + +L  L+L  N   G IP   G  PNLE L +  N  +G 
Sbjct  293  SLDLSNNGLTGEIPASFAALKNLTLLNLFRNKLRGSIPELVGDLPNLEVLQLWENNFTGG  352

Query  461  IPSEIGNLTKLKELYIGYFNGFSGGIPPEM---GNLSQLI  571
            IP  +G   +L+ + +   N  +G +PPE+   G L  LI
Sbjct  353  IPRRLGRNGRLQLVDLSS-NRLTGTLPPELCAGGKLETLI  391



>ref|XP_003558681.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Brachypodium distachyon]
Length=1027

 Score =   218 bits (556),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 147/202 (73%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPP  181
            N S +HC W  VTC     VV LD+ GLNLSG L P + +L  L+ L + AN   GPVP 
Sbjct  53   NESAAHCAWAGVTCGPRGTVVGLDVGGLNLSGALPPALSRLRGLLRLDVGANAFFGPVPA  112

Query  182  EISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLH  361
             +  +  L  LNLSNN F  + P  LA L  L+VLDLYNNNLT  LP+EV +M  LRHLH
Sbjct  113  ALGHLQFLTHLNLSNNAFNGSLPPALACLRALRVLDLYNNNLTSPLPLEVAQMPLLRHLH  172

Query  362  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            LGGN+FSG+IPPEYGR+  L+YLAVSGN LSG IP E+GNLT L+ELY+GY+N +SGG+P
Sbjct  173  LGGNFFSGQIPPEYGRWARLQYLAVSGNELSGTIPPELGNLTSLRELYLGYYNSYSGGLP  232

Query  542  PEMGNLSQLIRXDAANCGLTGE  607
             E+GNL++L+R DAANCGL+GE
Sbjct  233  AELGNLTELVRLDAANCGLSGE  254


 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 74/132 (56%), Gaps = 1/132 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            NL+  L  +V Q+P L +L +  N  SG +PPE    + L++L +S N    T P +L  
Sbjct  153  NLTSPLPLEVAQMPLLRHLHLGGNFFSGQIPPEYGRWARLQYLAVSGNELSGTIPPELGN  212

Query  266  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            L +L+ L L Y N+ +G LP E+  +T L  L       SG IPPE G+   L+ L +  
Sbjct  213  LTSLRELYLGYYNSYSGGLPAELGNLTELVRLDAANCGLSGEIPPELGKLQKLDTLFLQV  272

Query  443  NGLSGVIPSEIG  478
            NGLSG IP+E+G
Sbjct  273  NGLSGSIPTELG  284


 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 87/162 (54%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P++G+L  L  L +  N LSG +P E+  + +L  L+LSNN+     P   ++L
Sbjct  251  LSGEIPPELGKLQKLDTLFLQVNGLSGSIPTELGYLKSLSSLDLSNNVLTGVIPASFSEL  310

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             N+ +L+L+ N L GD+P  V  + SL  L L  N F+G +P   GR   L+ + +S N 
Sbjct  311  KNMTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVPRRLGRNGRLQLVDLSSNK  370

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+  +P+E+    KL  L I   N   G IP  +G    L R
Sbjct  371  LTSTLPAELCAGGKLHTL-IALGNSLFGSIPDSLGQCKSLSR  411


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/165 (31%), Positives = 81/165 (49%), Gaps = 5/165 (3%)
 Frame = +2

Query  116  GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLY  295
            G+L  L+ L    N L G +P  +    +L  + L  N    + P  L +L  L  ++L 
Sbjct  383  GKLHTLIAL---GNSLFGSIPDSLGQCKSLSRIRLGENYLNGSIPKGLFELQKLTQVELQ  439

Query  296  NNNLTGDLPVEV-YKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSE  472
            +N LTG+ P  V     +L  ++L  N  +G +P   G F  ++ L +  N  SGV+P+E
Sbjct  440  DNLLTGNFPAVVGVAAPNLGEINLSNNQLTGTLPASIGNFSGVQKLLLDRNSFSGVMPAE  499

Query  473  IGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            IG L +L +  +   N   GG+PPE+G    L   D +   L+G+
Sbjct  500  IGRLQQLSKADLSS-NSIEGGVPPEIGKCRLLTYLDLSRNNLSGD  543


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 81/173 (47%), Gaps = 2/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEIS-AISTLRFLNLSNNIFGSTFPHQLAQ  265
            L+G +   + +L  L  + +  N L+G  P  +  A   L  +NLSNN    T P  +  
Sbjct  419  LNGSIPKGLFELQKLTQVELQDNLLTGNFPAVVGVAAPNLGEINLSNNQLTGTLPASIGN  478

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
             + +Q L L  N+ +G +P E+ ++  L    L  N   G +PPE G+   L YL +S N
Sbjct  479  FSGVQKLLLDRNSFSGVMPAEIGRLQQLSKADLSSNSIEGGVPPEIGKCRLLTYLDLSRN  538

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             LSG IP  I  +  L  L +   N   G IPP +  +  L   D +   L+G
Sbjct  539  NLSGDIPPAISGMRILNYLNLSR-NHLDGEIPPSIATMQSLTAVDFSYNNLSG  590


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 63/127 (50%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L   +G    +  L +  N  SG +P EI  +  L   +LS+N      P ++ +
Sbjct  467  QLTGTLPASIGNFSGVQKLLLDRNSFSGVMPAEIGRLQQLSKADLSSNSIEGGVPPEIGK  526

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  LDL  NNL+GD+P  +  M  L +L+L  N+  G IPP      +L  +  S N
Sbjct  527  CRLLTYLDLSRNNLSGDIPPAISGMRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYN  586

Query  446  GLSGVIP  466
             LSG++P
Sbjct  587  NLSGLVP  593



>ref|XP_006853709.1| hypothetical protein AMTR_s00056p00150470 [Amborella trichopoda]
 gb|ERN15176.1| hypothetical protein AMTR_s00056p00150470 [Amborella trichopoda]
Length=918

 Score =   212 bits (540),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 118/200 (59%), Positives = 152/200 (76%), Gaps = 0/200 (0%)
 Frame = +2

Query  8    STSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEI  187
            S+++C+W  + CD   +V  LD+S + LSG +SP++G L  L  LS+A N+ SG +P EI
Sbjct  49   SSNYCSWIGIQCDDSGYVSVLDISDMGLSGQISPEIGNLQRLTTLSLAVNEFSGQIPAEI  108

Query  188  SAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLG  367
            + IS L  LNLSNN+F  TFP  L+ L NL+VLDLYNNNLTG LP  V +++ ++HLHLG
Sbjct  109  ARISGLNLLNLSNNLFNGTFPVSLSGLKNLEVLDLYNNNLTGPLPKGVAEISGIKHLHLG  168

Query  368  GNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPE  547
            GNYF+G IPPEYG+   +EYLA+SGN LSG IP E+GNLTKL++LY+GYFN FSGGIPPE
Sbjct  169  GNYFNGEIPPEYGKLKEIEYLALSGNELSGNIPKELGNLTKLEQLYLGYFNWFSGGIPPE  228

Query  548  MGNLSQLIRXDAANCGLTGE  607
             GNL +L R D A+CGL+GE
Sbjct  229  FGNLRRLFRLDMASCGLSGE  248


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 91/162 (56%), Gaps = 3/162 (2%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG +  ++G L  L  L +  N+L+G +PPE+  +  L+ L+LSNN      P   A+L
Sbjct  245  LSGEIPAEIGNLTLLGTLFLQVNELTGKIPPEMGNLRVLKSLDLSNNKLSGEIPANFAEL  304

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL++L+L+ N+L G +P  V ++  L  L L  N FSG +  ++GR  NL+ L +S N 
Sbjct  305  KNLKLLNLFINSLKGTIPPFVAELPELEVLQLWDNEFSGELDGKFGR--NLKLLDLSSNK  362

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G IP EI +   L+ L +   N FSG +P  +     L R
Sbjct  363  LAGKIPPEICSGGLLQTLIL-LNNSFSGQVPGSLTTCQSLKR  403


 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 56/161 (35%), Positives = 86/161 (53%), Gaps = 2/161 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  265
             +G + P+ G+L  +  L+++ N+LSG +P E+  ++ L  L L   N F    P +   
Sbjct  172  FNGEIPPEYGKLKEIEYLALSGNELSGNIPKELGNLTKLEQLYLGYFNWFSGGIPPEFGN  231

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  LD+ +  L+G++P E+  +T L  L L  N  +G+IPPE G    L+ L +S N
Sbjct  232  LRRLFRLDMASCGLSGEIPAEIGNLTLLGTLFLQVNELTGKIPPEMGNLRVLKSLDLSNN  291

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQL  568
             LSG IP+    L  LK L + + N   G IPP +  L +L
Sbjct  292  KLSGEIPANFAELKNLKLLNL-FINSLKGTIPPFVAELPEL  331


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 86/161 (53%), Gaps = 10/161 (6%)
 Frame = +2

Query  140  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  319
            L +++N+L+G +PPEI +   L+ L L NN F    P  L    +L+ + L +N L G L
Sbjct  356  LDLSSNKLAGKIPPEICSGGLLQTLILLNNSFSGQVPGSLTTCQSLKRVRLGDNLLNGSL  415

Query  320  PVEVYKMTSLRHLHLG-----GNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNL  484
            P  +  + +L  L L      G +FSG +         L  L++S N L+G IP+ IG+ 
Sbjct  416  PYGLLSLQNLTQLELKNNKLTGKFFSGNLSVS----ETLLELSLSNNQLNGEIPAIIGDF  471

Query  485  TKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              L++L++   N FSG IPP++ +L+ L   D +    +GE
Sbjct  472  GSLQKLFLAG-NQFSGEIPPKICSLNDLSVLDLSRNNFSGE  511


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 78/154 (51%), Gaps = 3/154 (2%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
             SG + P+ G L  L  L +A+  LSG +P EI  ++ L  L L  N      P ++  L
Sbjct  221  FSGGIPPEFGNLRRLFRLDMASCGLSGEIPAEIGNLTLLGTLFLQVNELTGKIPPEMGNL  280

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L+ LDL NN L+G++P    ++ +L+ L+L  N   G IPP     P LE L +  N 
Sbjct  281  RVLKSLDLSNNKLSGEIPANFAELKNLKLLNLFINSLKGTIPPFVAELPELEVLQLWDNE  340

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
             SG +  + G   KL +L     N  +G IPPE+
Sbjct  341  FSGELDGKFGRNLKLLDL---SSNKLAGKIPPEI  371


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 53/177 (30%), Positives = 79/177 (45%), Gaps = 26/177 (15%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G + P++     L  L +  N  SG VP  ++   +L+ + L +N+   + P+ L  
Sbjct  362  KLAGKIPPEICSGGLLQTLILLNNSFSGQVPGSLTTCQSLKRVRLGDNLLNGSLPYGLLS  421

Query  266  LANLQVLDLYNNNLTG-------------------------DLPVEVYKMTSLRHLHLGG  370
            L NL  L+L NN LTG                         ++P  +    SL+ L L G
Sbjct  422  LQNLTQLELKNNKLTGKFFSGNLSVSETLLELSLSNNQLNGEIPAIIGDFGSLQKLFLAG  481

Query  371  NYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            N FSG IPP+     +L  L +S N  SG IP++I  +  L  L +   N   G IP
Sbjct  482  NQFSGEIPPKICSLNDLSVLDLSRNNFSGEIPAKIAGMRSLTYLNLSK-NHLVGQIP  537


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 69/127 (54%), Gaps = 2/127 (2%)
 Frame = +2

Query  131  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  310
            L+ LS++ NQL+G +P  I    +L+ L L+ N F    P ++  L +L VLDL  NN +
Sbjct  450  LLELSLSNNQLNGEIPAIIGDFGSLQKLFLAGNQFSGEIPPKICSLNDLSVLDLSRNNFS  509

Query  311  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSG--VIPSEIGNL  484
            G++P ++  M SL +L+L  N+  G+IP  +        +  S N L+   V  S  G +
Sbjct  510  GEIPAKIAGMRSLTYLNLSKNHLVGQIPAAFQAMKGSASMDFSYNDLTEPLVGSSGFGEM  569

Query  485  TKLKELY  505
            ++++  +
Sbjct  570  SRVRAWW  576


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 60/126 (48%), Gaps = 8/126 (6%)
 Frame = +2

Query  116  GQLPF-------LVNLSIAANQLSGPV-PPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
            G LP+       L  L +  N+L+G      +S   TL  L+LSNN      P  +    
Sbjct  413  GSLPYGLLSLQNLTQLELKNNKLTGKFFSGNLSVSETLLELSLSNNQLNGEIPAIIGDFG  472

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
            +LQ L L  N  +G++P ++  +  L  L L  N FSG IP +     +L YL +S N L
Sbjct  473  SLQKLFLAGNQFSGEIPPKICSLNDLSVLDLSRNNFSGEIPAKIAGMRSLTYLNLSKNHL  532

Query  452  SGVIPS  469
             G IP+
Sbjct  533  VGQIPA  538



>ref|XP_010943209.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1 [Elaeis guineensis]
Length=995

 Score =   213 bits (541),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 127/159 (80%), Gaps = 0/159 (0%)
 Frame = +2

Query  131  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  310
            +V+L I+   LSGP+PPE+S +S LR+LNLSNN+F  TFP  L++L NL+ LDLYNNNLT
Sbjct  71   VVSLDISNLNLSGPIPPELSLLSGLRYLNLSNNVFNGTFPSDLSRLKNLRALDLYNNNLT  130

Query  311  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTK  490
              LPV V  +  LRHLHLGGN+FSG IPPEYGR+ ++EYLA+SGN LSG IP E+GNLT 
Sbjct  131  DVLPVVVADLPVLRHLHLGGNFFSGAIPPEYGRWEHIEYLAISGNELSGPIPPELGNLTT  190

Query  491  LKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            L+ELYIGYFN + GG+P   GNL+ L+R DAANCGL+GE
Sbjct  191  LRELYIGYFNSYQGGLPAAFGNLTSLVRLDAANCGLSGE  229


 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 86/172 (50%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P++G L  L  L +  N LSG + PE+  +  L+ ++LSNN      P   A L
Sbjct  226  LSGEIPPEMGDLQNLDTLFLQVNGLSGEITPELGKLWGLKSMDLSNNALTGEIPPTFADL  285

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  V  +  L  L L  N F+G IP   G    L+ L +S N 
Sbjct  286  KNLTLLNLFRNKLHGAIPDFVGDLPELEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNK  345

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            L+G +P ++ +  KL+ L I   N   G IP  +G    L R       LTG
Sbjct  346  LTGSLPPDLCSGDKLETL-IALGNFLFGSIPESLGRCKSLTRIRLGENYLTG  396


 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 88/172 (51%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG ++P++G+L  L ++ ++ N L+G +PP  + +  L  LNL  N      P  +  L
Sbjct  250  LSGEITPELGKLWGLKSMDLSNNALTGEIPPTFADLKNLTLLNLFRNKLHGAIPDFVGDL  309

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L+VL L+ NN TG++P  +     L+ L L  N  +G +PP+      LE L   GN 
Sbjct  310  PELEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNKLTGSLPPDLCSGDKLETLIALGNF  369

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            L G IP  +G    L  + +G  N  +G IP  + +L +L + +  +  L G
Sbjct  370  LFGSIPESLGRCKSLTRIRLGE-NYLTGSIPSGLFSLRKLAQVELQDNLLNG  420


 Score = 83.2 bits (204),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 69/126 (55%), Gaps = 0/126 (0%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L   +G  P L  L +  NQ SG +PPEI  +  L  ++ S N F    P ++++ 
Sbjct  441  LSGALPSSIGNFPGLQKLLLNQNQFSGCIPPEIGRLQQLSKMDFSGNRFSCPIPPEISKC  500

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              +  +DL  NNL+G++PVE+ +M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  501  RLVTFIDLSRNNLSGEIPVEITEMRILNYLNLSRNHLEGEIPTSISTMQSLTAVDFSYNN  560

Query  449  LSGVIP  466
            LSG++P
Sbjct  561  LSGLVP  566


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 79/174 (45%), Gaps = 2/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L PD+     L  L    N L G +P  +    +L  + L  N    + P  L  
Sbjct  345  KLTGSLPPDLCSGDKLETLIALGNFLFGSIPESLGRCKSLTRIRLGENYLTGSIPSGLFS  404

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N L G  P +    T L  + L  N  SG +P   G FP L+ L ++ N
Sbjct  405  LRKLAQVELQDNLLNGSFPAKASSPT-LGQISLSNNRLSGALPSSIGNFPGLQKLLLNQN  463

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              SG IP EIG L +L ++     N FS  IPPE+     +   D +   L+GE
Sbjct  464  QFSGCIPPEIGRLQQLSKMDFSG-NRFSCPIPPEISKCRLVTFIDLSRNNLSGE  516


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 74/152 (49%), Gaps = 1/152 (1%)
 Frame = +2

Query  95   GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  274
            G L    G L  LV L  A   LSG +PPE+  +  L  L L  N        +L +L  
Sbjct  204  GGLPAAFGNLTSLVRLDAANCGLSGEIPPEMGDLQNLDTLFLQVNGLSGEITPELGKLWG  263

Query  275  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  454
            L+ +DL NN LTG++P     + +L  L+L  N   G IP   G  P LE L +  N  +
Sbjct  264  LKSMDLSNNALTGEIPPTFADLKNLTLLNLFRNKLHGAIPDFVGDLPELEVLQLWENNFT  323

Query  455  GVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            G IP  +G   +L+ L +   N  +G +PP++
Sbjct  324  GEIPRRLGTNGRLQLLDLSS-NKLTGSLPPDL  354


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 80/172 (47%), Gaps = 2/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G +   +  L  L  + +  N L+G  P + S+  TL  ++LSNN      P  +   
Sbjct  394  LTGSIPSGLFSLRKLAQVELQDNLLNGSFPAKASS-PTLGQISLSNNRLSGALPSSIGNF  452

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              LQ L L  N  +G +P E+ ++  L  +   GN FS  IPPE  +   + ++ +S N 
Sbjct  453  PGLQKLLLNQNQFSGCIPPEIGRLQQLSKMDFSGNRFSCPIPPEISKCRLVTFIDLSRNN  512

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            LSG IP EI  +  L  L +   N   G IP  +  +  L   D +   L+G
Sbjct  513  LSGEIPVEITEMRILNYLNLSR-NHLEGEIPTSISTMQSLTAVDFSYNNLSG  563



>ref|XP_009399076.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1021

 Score =   213 bits (541),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 157/198 (79%), Gaps = 0/198 (0%)
 Frame = +2

Query  11   TSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEIS  190
            T HC+W  VTC S   VV+LDLSG NLSG L P VG+L  L+ LS+AAN LSGP+PPE++
Sbjct  53   TDHCSWPGVTCGSSGAVVALDLSGRNLSGPLPPAVGRLRSLLRLSVAANFLSGPIPPELA  112

Query  191  AISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGG  370
             +  LR LNLSNN+   +FP  LA+LA+L++LDLYNNNLTG LP EV  MT LRHLHLGG
Sbjct  113  LLPDLRHLNLSNNLLNGSFPVALARLADLRLLDLYNNNLTGPLPQEVAAMTLLRHLHLGG  172

Query  371  NYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            N+FSG IPPEYG +  LEYLA+SGN LSG IP EIGNL+ L+ELYIGYFN + GG+PPE+
Sbjct  173  NFFSGSIPPEYGHWQFLEYLAISGNELSGPIPREIGNLSALRELYIGYFNSYDGGVPPEI  232

Query  551  GNLSQLIRXDAANCGLTG  604
            GNLS L+R DAANCGL+G
Sbjct  233  GNLSALLRLDAANCGLSG  250


 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 58/172 (34%), Positives = 88/172 (51%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P++G+L  L ++ ++ N L+G +PP  S +S L  LNL  N    T P  +  L
Sbjct  272  LSGEIPPELGRLRSLKSMDLSNNALTGQIPPSFSGLSNLTLLNLFRNKLFGTIPEFVGDL  331

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L+VL ++ NN TG +P  +     L+ L L  N  +G +PP+      LE L   GN 
Sbjct  332  PELEVLQMWENNFTGSIPRRLGTNGQLQLLDLSSNKLTGSLPPDLCYGNKLETLIALGNF  391

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            L G IP  +G    L  + +G  N  +G IP  + +L  L + +  +  LTG
Sbjct  392  LFGSIPESLGRCESLSRIRMGD-NYLNGSIPHGLFSLPNLSQVEFQDNLLTG  442


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/172 (34%), Positives = 87/172 (51%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG +  ++G L  L  L +  N LSG +PPE+  + +L+ ++LSNN      P   + L
Sbjct  248  LSGGIPSEMGNLRNLDTLFLQVNGLSGEIPPELGRLRSLKSMDLSNNALTGQIPPSFSGL  307

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
            +NL +L+L+ N L G +P  V  +  L  L +  N F+G IP   G    L+ L +S N 
Sbjct  308  SNLTLLNLFRNKLFGTIPEFVGDLPELEVLQMWENNFTGSIPRRLGTNGQLQLLDLSSNK  367

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            L+G +P ++    KL+ L I   N   G IP  +G    L R    +  L G
Sbjct  368  LTGSLPPDLCYGNKLETL-IALGNFLFGSIPESLGRCESLSRIRMGDNYLNG  418


 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 78/153 (51%), Gaps = 1/153 (1%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
             G + P++G L  L+ L  A   LSG +P E+  +  L  L L  N      P +L +L 
Sbjct  225  DGGVPPEIGNLSALLRLDAANCGLSGGIPSEMGNLRNLDTLFLQVNGLSGEIPPELGRLR  284

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
            +L+ +DL NN LTG +P     +++L  L+L  N   G IP   G  P LE L +  N  
Sbjct  285  SLKSMDLSNNALTGQIPPSFSGLSNLTLLNLFRNKLFGTIPEFVGDLPELEVLQMWENNF  344

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            +G IP  +G   +L+ L +   N  +G +PP++
Sbjct  345  TGSIPRRLGTNGQLQLLDLSS-NKLTGSLPPDL  376


 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 71/148 (48%), Gaps = 4/148 (3%)
 Frame = +2

Query  107  PDVGQL---PFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  277
            PD G     P L  + ++ N+L GP+PP I   S L+ L LS N F  + P ++ +L  L
Sbjct  445  PDTGDSSISPSLGQICLSNNRLVGPLPPSIGNFSGLQKLLLSQNSFSGSIPPEVRRLQQL  504

Query  278  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSG  457
              LD   N  +G +  E+ K   L  + L  N  SG +P +      L YL +S N L G
Sbjct  505  SKLDFSGNRFSGPITPEISKCKLLTFVDLSRNEISGNVPSDIAALRILNYLNLSRNHLEG  564

Query  458  VIPSEIGNLTKLKELYIGYFNGFSGGIP  541
             IPS I  +  L  +   Y N  SG +P
Sbjct  565  QIPSAISTMQSLTAVDFSY-NNLSGLVP  591


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 79/175 (45%), Gaps = 3/175 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L PD+     L  L    N L G +P  +    +L  + + +N    + PH L  
Sbjct  367  KLTGSLPPDLCYGNKLETLIALGNFLFGSIPESLGRCESLSRIRMGDNYLNGSIPHGLFS  426

Query  266  LANLQVLDLYNNNLTGDLPV--EVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  439
            L NL  ++  +N LTG  P   +     SL  + L  N   G +PP  G F  L+ L +S
Sbjct  427  LPNLSQVEFQDNLLTGGFPDTGDSSISPSLGQICLSNNRLVGPLPPSIGNFSGLQKLLLS  486

Query  440  GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             N  SG IP E+  L +L +L     N FSG I PE+     L   D +   ++G
Sbjct  487  QNSFSGSIPPEVRRLQQLSKLDFSG-NRFSGPITPEISKCKLLTFVDLSRNEISG  540


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 66/127 (52%), Gaps = 0/127 (0%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L G L P +G    L  L ++ N  SG +PPE+  +  L  L+ S N F      ++++ 
Sbjct  466  LVGPLPPSIGNFSGLQKLLLSQNSFSGSIPPEVRRLQQLSKLDFSGNRFSGPITPEISKC  525

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  +DL  N ++G++P ++  +  L +L+L  N+  G+IP       +L  +  S N 
Sbjct  526  KLLTFVDLSRNEISGNVPSDIAALRILNYLNLSRNHLEGQIPSAISTMQSLTAVDFSYNN  585

Query  449  LSGVIPS  469
            LSG++PS
Sbjct  586  LSGLVPS  592


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 59/120 (49%), Gaps = 1/120 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            + SG + P+V +L  L  L  + N+ SGP+ PEIS    L F++LS N      P  +A 
Sbjct  489  SFSGSIPPEVRRLQQLSKLDFSGNRFSGPITPEISKCKLLTFVDLSRNEISGNVPSDIAA  548

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  L+L  N+L G +P  +  M SL  +    N  SG + P  G+F      +  GN
Sbjct  549  LRILNYLNLSRNHLEGQIPSAISTMQSLTAVDFSYNNLSGLV-PSTGQFSYFNATSFVGN  607



>ref|XP_008787754.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Phoenix dactylifera]
Length=990

 Score =   211 bits (537),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 128/159 (81%), Gaps = 0/159 (0%)
 Frame = +2

Query  131  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  310
            +V+L I+   LSGP+PPE+S +S LR+LNLSNN+F  TFP  L+ L NL+VLD+YNNNLT
Sbjct  71   VVSLDISNLNLSGPIPPELSLLSGLRYLNLSNNVFNGTFPSALSSLKNLRVLDIYNNNLT  130

Query  311  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTK  490
            G LPV+V  + +LRHLHLGGN+FSG IPPEYGR+ ++EYLA+SGN L G I  E+GNLT 
Sbjct  131  GVLPVDVADLPALRHLHLGGNFFSGAIPPEYGRWEHIEYLAISGNELGGPITPELGNLTS  190

Query  491  LKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            L+ELYIGYFN + G +P  +GNL+ L+R DAANCGL+GE
Sbjct  191  LRELYIGYFNSYQGSLPAAIGNLTSLVRLDAANCGLSGE  229


 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 82/162 (51%), Gaps = 2/162 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            NL+GVL  DV  LP L +L +  N  SG +PPE      + +L +S N  G     +L  
Sbjct  128  NLTGVLPVDVADLPALRHLHLGGNFFSGAIPPEYGRWEHIEYLAISGNELGGPITPELGN  187

Query  266  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            L +L+ L + Y N+  G LP  +  +TSL  L       SG IPPE G   NL+ L +  
Sbjct  188  LTSLRELYIGYFNSYQGSLPAAIGNLTSLVRLDAANCGLSGEIPPEMGNLQNLDTLFLQV  247

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQL  568
            NGL G I  E+G L  LK + +   N  +G IPP   +L  L
Sbjct  248  NGLFGEITPELGKLRSLKSMDLSN-NALAGEIPPTFADLKNL  288


 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 59/166 (36%), Positives = 94/166 (57%), Gaps = 4/166 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +G +   +G    L  L +++N+L+G +PP++ +   L+  + L N +FGS  P  L 
Sbjct  321  NFTGEIPRRLGTNGRLQLLDLSSNKLTGSLPPDLCSGDKLQTLIALGNFLFGS-IPESLG  379

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            +  +L  + L  N LTG +P+ ++ + +L  + L  N  +G   PE    P L  +++S 
Sbjct  380  RCKSLSRIRLGENYLTGSIPIGLFSLRNLVQVELQDNLLNGSF-PEKASSPTLGQISLSN  438

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXD  580
            N LSG +PS IGN   L++L +G  N FSG IPPE+G L QL + D
Sbjct  439  NRLSGALPSSIGNFPGLQKLLLGQ-NQFSGCIPPEIGKLQQLSKMD  483


 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 60/172 (35%), Positives = 86/172 (50%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG + P++G L  L  L +  N L G + PE+  + +L+ ++LSNN      P   A L
Sbjct  226  LSGEIPPEMGNLQNLDTLFLQVNGLFGEITPELGKLRSLKSMDLSNNALAGEIPPTFADL  285

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G +P  V  +  L  L L  N F+G IP   G    L+ L +S N 
Sbjct  286  KNLTLLNLFRNKLYGAIPDFVGDLPQLEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNK  345

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            L+G +P ++ +  KL+ L I   N   G IP  +G    L R       LTG
Sbjct  346  LTGSLPPDLCSGDKLQTL-IALGNFLFGSIPESLGRCKSLSRIRLGENYLTG  396


 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 68/126 (54%), Gaps = 0/126 (0%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L   +G  P L  L +  NQ SG +PPEI  +  L  ++ S N F    P + ++ 
Sbjct  441  LSGALPSSIGNFPGLQKLLLGQNQFSGCIPPEIGKLQQLSKMDFSGNRFSCPIPAETSKC  500

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  +DL  NNL+G++PVE+ +M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  501  KLLTFIDLSRNNLSGEIPVEITEMRILNYLNLSRNHLEGEIPTSISTMQSLTAVDFSYNN  560

Query  449  LSGVIP  466
            LSG++P
Sbjct  561  LSGLVP  566


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 79/153 (52%), Gaps = 3/153 (2%)
 Frame = +2

Query  95   GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQLA  271
            G L   +G L  LV L  A   LSG +PPE+  +  L  L L  N +FG   P +L +L 
Sbjct  204  GSLPAAIGNLTSLVRLDAANCGLSGEIPPEMGNLQNLDTLFLQVNGLFGEITP-ELGKLR  262

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
            +L+ +DL NN L G++P     + +L  L+L  N   G IP   G  P LE L +  N  
Sbjct  263  SLKSMDLSNNALAGEIPPTFADLKNLTLLNLFRNKLYGAIPDFVGDLPQLEVLQLWENNF  322

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            +G IP  +G   +L+ L +   N  +G +PP++
Sbjct  323  TGEIPRRLGTNGRLQLLDLSS-NKLTGSLPPDL  354


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 74/158 (47%), Gaps = 2/158 (1%)
 Frame = +2

Query  131  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  310
            LV + +  N L+G  P + S+  TL  ++LSNN      P  +     LQ L L  N  +
Sbjct  408  LVQVELQDNLLNGSFPEKASS-PTLGQISLSNNRLSGALPSSIGNFPGLQKLLLGQNQFS  466

Query  311  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTK  490
            G +P E+ K+  L  +   GN FS  IP E  +   L ++ +S N LSG IP EI  +  
Sbjct  467  GCIPPEIGKLQQLSKMDFSGNRFSCPIPAETSKCKLLTFIDLSRNNLSGEIPVEITEMRI  526

Query  491  LKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            L  L +   N   G IP  +  +  L   D +   L+G
Sbjct  527  LNYLNLSR-NHLEGEIPTSISTMQSLTAVDFSYNNLSG  563



>emb|CDY45620.1| BnaCnng13280D [Brassica napus]
Length=973

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 140/201 (70%), Gaps = 24/201 (12%)
 Frame = +2

Query  8    STSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEI  187
            +TS CTW  VTC                      DV +   + +L +++  LSG +  +I
Sbjct  51   TTSFCTWTGVTC----------------------DVSR-RHVTSLDLSSLNLSGTLSRDI  87

Query  188  SAISTLRFLNLSNNIFGSTFPHQLAQ-LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHL  364
            S +S LR LNLSNN+F  +FP +++  LANL+VLD+YNNN+TGDLP+ V  +T LRHLHL
Sbjct  88   SNLSGLRHLNLSNNVFNGSFPDEISSGLANLRVLDVYNNNMTGDLPLSVTNLTQLRHLHL  147

Query  365  GGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPP  544
            GGNYF+G IPP YG +P +EYLAVSGN L+G IP EIGNLT L+ELYIGYFN F  G+PP
Sbjct  148  GGNYFAGEIPPSYGTWPEIEYLAVSGNELTGKIPPEIGNLTTLRELYIGYFNAFEDGLPP  207

Query  545  EMGNLSQLIRXDAANCGLTGE  607
            E+GNLS+L+R DAANCGL GE
Sbjct  208  EIGNLSELVRFDAANCGLNGE  228


 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 55/162 (34%), Positives = 87/162 (54%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   + L
Sbjct  225  LNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLKSMDLSNNMFTGEIPSSFSDL  284

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             NL +L+L+ N L G++P  + ++  L  L L  N F+G IP + G    L  + +S N 
Sbjct  285  KNLTLLNLFRNKLHGEIPEFIGELPDLEVLQLWENNFTGSIPEKLGENGRLHLVDLSSNK  344

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  574
            L+G +P  +    KL+ L I   N   G IP  +G    L R
Sbjct  345  LTGTLPPNMCAGNKLETL-ITLGNFLFGSIPESLGKCESLTR  385


 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 84/174 (48%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L P++     L  L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  344  KLTGTLPPNMCAGNKLETLITLGNFLFGSIPESLGKCESLTRIRMGENFLNGSIPKGLFG  403

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L  ++L +N LTG+LPV      +L  L L  N  SG++PP  G F  ++ L + GN
Sbjct  404  LPKLTQVELQDNYLTGELPVTGSVSVNLGQLSLSNNQLSGQLPPAIGNFTGVQKLLLDGN  463

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
               G IPSE+G L +L ++   + N FSG I PE+     L   D +   L+GE
Sbjct  464  KFEGPIPSEVGKLQQLSKIDFSH-NLFSGRIAPEISRCKLLTFVDLSRNELSGE  516


 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 94/197 (48%), Gaps = 26/197 (13%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  265
             +G + P  G  P +  L+++ N+L+G +PPEI  ++TLR L +   N F    P ++  
Sbjct  152  FAGEIPPSYGTWPEIEYLAVSGNELTGKIPPEIGNLTTLRELYIGYFNAFEDGLPPEIGN  211

Query  266  LANLQVLDLYNNNLTGDLPVEV------------------------YKMTSLRHLHLGGN  373
            L+ L   D  N  L G++P E+                         K++SL+ + L  N
Sbjct  212  LSELVRFDAANCGLNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLKSMDLSNN  271

Query  374  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
             F+G IP  +    NL  L +  N L G IP  IG L  L+ L + + N F+G IP ++G
Sbjct  272  MFTGEIPSSFSDLKNLTLLNLFRNKLHGEIPEFIGELPDLEVLQL-WENNFTGSIPEKLG  330

Query  554  NLSQLIRXDAANCGLTG  604
               +L   D ++  LTG
Sbjct  331  ENGRLHLVDLSSNKLTG  347


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 78/150 (52%), Gaps = 1/150 (1%)
 Frame = +2

Query  101  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  280
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N+F      +L +L++L+
Sbjct  205  LPPEIGNLSELVRFDAANCGLNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLK  264

Query  281  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  460
             +DL NN  TG++P     + +L  L+L  N   G IP   G  P+LE L +  N  +G 
Sbjct  265  SMDLSNNMFTGEIPSSFSDLKNLTLLNLFRNKLHGEIPEFIGELPDLEVLQLWENNFTGS  324

Query  461  IPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            IP ++G   +L  + +   N  +G +PP M
Sbjct  325  IPEKLGENGRLHLVDLSS-NKLTGTLPPNM  353


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 86/173 (50%), Gaps = 1/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
             SG L+ ++G+L  L ++ ++ N  +G +P   S +  L  LNL  N      P  + +L
Sbjct  249  FSGPLTWELGKLSSLKSMDLSNNMFTGEIPSSFSDLKNLTLLNLFRNKLHGEIPEFIGEL  308

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             +L+VL L+ NN TG +P ++ +   L  + L  N  +G +PP       LE L   GN 
Sbjct  309  PDLEVLQLWENNFTGSIPEKLGENGRLHLVDLSSNKLTGTLPPNMCAGNKLETLITLGNF  368

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            L G IP  +G    L  + +G  N  +G IP  +  L +L + +  +  LTGE
Sbjct  369  LFGSIPESLGKCESLTRIRMGE-NFLNGSIPKGLFGLPKLTQVELQDNYLTGE  420


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 89/166 (54%), Gaps = 3/166 (2%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  262
            N +G +   +G+   L  + +++N+L+G +PP + A + L   + L N +FGS  P  L 
Sbjct  320  NFTGSIPEKLGENGRLHLVDLSSNKLTGTLPPNMCAGNKLETLITLGNFLFGS-IPESLG  378

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            +  +L  + +  N L G +P  ++ +  L  + L  NY +G +P       NL  L++S 
Sbjct  379  KCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLTGELPVTGSVSVNLGQLSLSN  438

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXD  580
            N LSG +P  IGN T +++L +   N F G IP E+G L QL + D
Sbjct  439  NQLSGQLPPAIGNFTGVQKLLLDG-NKFEGPIPSEVGKLQQLSKID  483


 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 56/172 (33%), Positives = 79/172 (46%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G +   +  LP L  + +  N L+G +P   S    L  L+LSNN      P  +   
Sbjct  393  LNGSIPKGLFGLPKLTQVELQDNYLTGELPVTGSVSVNLGQLSLSNNQLSGQLPPAIGNF  452

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              +Q L L  N   G +P EV K+  L  +    N FSGRI PE  R   L ++ +S N 
Sbjct  453  TGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNE  512

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            LSG IP EI  +  L  L +   N   G IP  + ++  L   D +   L+G
Sbjct  513  LSGEIPKEITGMRILNYLNLSR-NHLIGSIPGSISSMQSLTSLDFSYNNLSG  563


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 66/127 (52%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             LSG L P +G    +  L +  N+  GP+P E+  +  L  ++ S+N+F      ++++
Sbjct  440  QLSGQLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISR  499

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  +DL  N L+G++P E+  M  L +L+L  N+  G IP       +L  L  S N
Sbjct  500  CKLLTFVDLSRNELSGEIPKEITGMRILNYLNLSRNHLIGSIPGSISSMQSLTSLDFSYN  559

Query  446  GLSGVIP  466
             LSG++P
Sbjct  560  NLSGLVP  566



>ref|XP_008440463.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Cucumis melo]
Length=973

 Score =   206 bits (524),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 153/199 (77%), Gaps = 0/199 (0%)
 Frame = +2

Query  11   TSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEIS  190
             +HC+W  VTCDS  HVV+LDLS L+L+  LSP +  L FL N+S   N+ SG +PPEI+
Sbjct  67   ATHCSWLGVTCDSHRHVVALDLSSLDLTATLSPHIASLRFLTNVSFGLNKFSGGIPPEIA  126

Query  191  AISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGG  370
            ++S+L+ LNLS+N+   + P + ++L NLQVLD+YNNNLTG+ P  V +M +LR+LHLGG
Sbjct  127  SLSSLQLLNLSSNVLNGSIPSEFSRLKNLQVLDVYNNNLTGEFPRVVTEMPNLRYLHLGG  186

Query  371  NYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            N+F+GRIPPE GR   LE+LA+ GN L G IP  IGNLTKL+EL+IGY+N F GGIP  +
Sbjct  187  NFFTGRIPPEVGRLQFLEFLAIHGNDLEGPIPQTIGNLTKLRELFIGYYNTFVGGIPATI  246

Query  551  GNLSQLIRXDAANCGLTGE  607
            GNLS+L+R DAA+CGL+G+
Sbjct  247  GNLSELVRLDAASCGLSGK  265


 Score = 98.2 bits (243),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 59/166 (36%), Positives = 86/166 (52%), Gaps = 1/166 (1%)
 Frame = +2

Query  110  DVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLD  289
            ++G L  +  L I+ N L G +P   +    LR L+L +N      P  +A L  L++L 
Sbjct  292  ELGGLKSIEALDISCNMLVGEIPISFAVFKNLRLLHLFDNKLSGEIPGFMADLPKLEILQ  351

Query  290  LYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPS  469
            L+NNN TG +P  + K   LR L L  N+ +G IPPE      LE L   GN LSG+IP 
Sbjct  352  LWNNNFTGSIPRNLGKNGMLRTLDLAFNHLTGTIPPEVCHGNKLEVLIAMGNSLSGLIPE  411

Query  470  EIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
             +GN   LK + + + N  +G IP  +  L  + + D  +  L+GE
Sbjct  412  SLGNCISLKRILL-WGNALNGSIPKRLLGLPNITQIDLHDNFLSGE  456


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 85/174 (49%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            +L+G + P+V     L  L    N LSG +P  +    +L+ + L  N    + P +L  
Sbjct  380  HLTGTIPPEVCHGNKLEVLIAMGNSLSGLIPESLGNCISLKRILLWGNALNGSIPKRLLG  439

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L N+  +DL++N L+G+LP+      +L  + L  N  SG +PP  G    ++ L +  N
Sbjct  440  LPNITQIDLHDNFLSGELPITNSVSANLLQISLSNNMLSGSLPPTIGSLVAVQKLLLDRN  499

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              SG IPS IG L +L  +     N FSG I  E+     LI  D +   L+GE
Sbjct  500  KFSGQIPSSIGRLQQLSRINFSQ-NKFSGSIVAEISECKHLIFLDLSGNELSGE  552


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 84/172 (49%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G +   +  LP +  + +  N LSG +P   S  + L  ++LSNN+   + P  +  L
Sbjct  429  LNGSIPKRLLGLPNITQIDLHDNFLSGELPITNSVSANLLQISLSNNMLSGSLPPTIGSL  488

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              +Q L L  N  +G +P  + ++  L  ++   N FSG I  E     +L +L +SGN 
Sbjct  489  VAVQKLLLDRNKFSGQIPSSIGRLQQLSRINFSQNKFSGSIVAEISECKHLIFLDLSGNE  548

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            LSG IP+ I N+  L  + +   N   G IP  + N+  L   D +   L+G
Sbjct  549  LSGEIPNHITNMKLLNYMNLSR-NHLVGPIPASIVNMQSLTSVDFSYNNLSG  599


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 89/197 (45%), Gaps = 25/197 (13%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             LSG +   +  LP L  L +  N  +G +P  +     LR L+L+ N    T P ++  
Sbjct  332  KLSGEIPGFMADLPKLEILQLWNNNFTGSIPRNLGKNGMLRTLDLAFNHLTGTIPPEVCH  391

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEY--------------  403
               L+VL    N+L+G +P  +    SL+ + L GN  +G IP                 
Sbjct  392  GNKLEVLIAMGNSLSGLIPESLGNCISLKRILLWGNALNGSIPKRLLGLPNITQIDLHDN  451

Query  404  ---GRFP-------NLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
               G  P       NL  +++S N LSG +P  IG+L  +++L +   N FSG IP  +G
Sbjct  452  FLSGELPITNSVSANLLQISLSNNMLSGSLPPTIGSLVAVQKLLLDR-NKFSGQIPSSIG  510

Query  554  NLSQLIRXDAANCGLTG  604
             L QL R + +    +G
Sbjct  511  RLQQLSRINFSQNKFSG  527



>ref|XP_003557615.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Brachypodium distachyon]
Length=1019

 Score =   205 bits (521),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 140/201 (70%), Gaps = 5/201 (2%)
 Frame = +2

Query  20   CTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAI  196
            C W  V+C +  + V        NLSG + P +  LP L+ L +AAN LSGP+P ++S +
Sbjct  51   CAWSGVSCAAGSNSVVSLDLSGRNLSGRIPPSLSSLPALILLDLAANALSGPIPAQLSRL  110

Query  197  STLRFLNLSNNIFGSTFPHQLAQ-LANLQVLDLYNNNLTGDLPVEVYK--MTSLRHLHLG  367
              L  LNLS+N    +FP QL++ L  L+VLDLYNNNLTG LPVE+    M  L H+HLG
Sbjct  111  RRLASLNLSSNALSGSFPPQLSRRLRALKVLDLYNNNLTGPLPVEIAAGTMPELSHVHLG  170

Query  368  GNYFSGRIPPEYGRF-PNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPP  544
            GN+FSG IP  YGR   NL YLAVSGN LSG +P E+GNLT L+ELYIGY+N +SGGIP 
Sbjct  171  GNFFSGAIPAAYGRLGKNLRYLAVSGNELSGNLPPELGNLTSLRELYIGYYNSYSGGIPK  230

Query  545  EMGNLSQLIRXDAANCGLTGE  607
            E GN+++L+R DAANCGL+GE
Sbjct  231  EFGNMTELVRFDAANCGLSGE  251


 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 58/188 (31%), Positives = 86/188 (46%), Gaps = 24/188 (13%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L G +   VG LP L  L +  N  +G +P  +      + L+LS+N    T P +L  
Sbjct  319  KLRGNIPEFVGDLPGLEVLQLWENNFTGGIPRHLGRNGRFQLLDLSSNRLTGTLPPELCA  378

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  L    N+L G +P  + +  SL  + LG N+ +G IP    + PNL  + + GN
Sbjct  379  GGKLHTLIALGNSLFGAIPESLGECRSLARVRLGENFLNGSIPEGLFQLPNLTQVELQGN  438

Query  446  GLS-----------------------GVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  556
             LS                       G +P+ IG+ + L++L +   N FSG IPPE+G 
Sbjct  439  LLSGGFPAMAGASNLGGIILSNNQLTGALPASIGSFSGLQKLLLDQ-NAFSGPIPPEIGR  497

Query  557  LSQLIRXD  580
            L QL + D
Sbjct  498  LQQLSKAD  505


 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 85/176 (48%), Gaps = 8/176 (5%)
 Frame = +2

Query  89   LSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  259
            L+G L P++   G+L  L+ L    N L G +P  +    +L  + L  N    + P  L
Sbjct  368  LTGTLPPELCAGGKLHTLIAL---GNSLFGAIPESLGECRSLARVRLGENFLNGSIPEGL  424

Query  260  AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  439
             QL NL  ++L  N L+G  P  +   ++L  + L  N  +G +P   G F  L+ L + 
Sbjct  425  FQLPNLTQVELQGNLLSGGFPA-MAGASNLGGIILSNNQLTGALPASIGSFSGLQKLLLD  483

Query  440  GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
             N  SG IP EIG L +L +  +   N F GG+PPE+G    L   D +   L+ E
Sbjct  484  QNAFSGPIPPEIGRLQQLSKADLSG-NSFDGGVPPEIGKCRLLTYLDVSRNNLSAE  538


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 80/172 (47%), Gaps = 2/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G +   + QLP L  + +  N LSG  P  ++  S L  + LSNN      P  +   
Sbjct  416  LNGSIPEGLFQLPNLTQVELQGNLLSGGFP-AMAGASNLGGIILSNNQLTGALPASIGSF  474

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
            + LQ L L  N  +G +P E+ ++  L    L GN F G +PPE G+   L YL VS N 
Sbjct  475  SGLQKLLLDQNAFSGPIPPEIGRLQQLSKADLSGNSFDGGVPPEIGKCRLLTYLDVSRNN  534

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            LS  IP  I  +  L  L +   N   G IP  +  +  L   D +   L+G
Sbjct  535  LSAEIPPAISGMRILNYLNLSR-NHLEGEIPATIAAMQSLTAVDFSYNNLSG  585


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 64/128 (50%), Gaps = 0/128 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             L+G L   +G    L  L +  N  SGP+PPEI  +  L   +LS N F    P ++ +
Sbjct  462  QLTGALPASIGSFSGLQKLLLDQNAFSGPIPPEIGRLQQLSKADLSGNSFDGGVPPEIGK  521

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L  LD+  NNL+ ++P  +  M  L +L+L  N+  G IP       +L  +  S N
Sbjct  522  CRLLTYLDVSRNNLSAEIPPAISGMRILNYLNLSRNHLEGEIPATIAAMQSLTAVDFSYN  581

Query  446  GLSGVIPS  469
             LSG++P+
Sbjct  582  NLSGLVPA  589


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 86/174 (49%), Gaps = 2/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA  262
             LSG L P++G L  L  L I   N  SG +P E   ++ L   + +N       P +L 
Sbjct  198  ELSGNLPPELGNLTSLRELYIGYYNSYSGGIPKEFGNMTELVRFDAANCGLSGEIPPELG  257

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            +LA L  L L  N LT  +P+E+  + SL  L L  N  SG IPP +    NL    +  
Sbjct  258  RLAKLDTLFLQVNGLTDAIPMELGNLGSLSSLDLSNNELSGEIPPSFAELKNLTLFNLFR  317

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            N L G IP  +G+L  L+ L + + N F+GGIP  +G   +    D ++  LTG
Sbjct  318  NKLRGNIPEFVGDLPGLEVLQL-WENNFTGGIPRHLGRNGRFQLLDLSSNRLTG  370


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 54/187 (29%), Positives = 80/187 (43%), Gaps = 28/187 (15%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAAN------------------------QLSGPVPPEISAI  196
            LSG + P++G+L  L  L +  N                        +LSG +PP  + +
Sbjct  248  LSGEIPPELGRLAKLDTLFLQVNGLTDAIPMELGNLGSLSSLDLSNNELSGEIPPSFAEL  307

Query  197  STLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNY  376
              L   NL  N      P  +  L  L+VL L+ NN TG +P  + +    + L L  N 
Sbjct  308  KNLTLFNLFRNKLRGNIPEFVGDLPGLEVLQLWENNFTGGIPRHLGRNGRFQLLDLSSNR  367

Query  377  FSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPP---E  547
             +G +PPE      L  L   GN L G IP  +G    L  + +G  N  +G IP    +
Sbjct  368  LTGTLPPELCAGGKLHTLIALGNSLFGAIPESLGECRSLARVRLGE-NFLNGSIPEGLFQ  426

Query  548  MGNLSQL  568
            + NL+Q+
Sbjct  427  LPNLTQV  433


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 64/132 (48%), Gaps = 1/132 (1%)
 Frame = +2

Query  146  IAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPV  325
            ++ NQL+G +P  I + S L+ L L  N F    P ++ +L  L   DL  N+  G +P 
Sbjct  458  LSNNQLTGALPASIGSFSGLQKLLLDQNAFSGPIPPEIGRLQQLSKADLSGNSFDGGVPP  517

Query  326  EVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELY  505
            E+ K   L +L +  N  S  IPP       L YL +S N L G IP+ I  +  L  + 
Sbjct  518  EIGKCRLLTYLDVSRNNLSAEIPPAISGMRILNYLNLSRNHLEGEIPATIAAMQSLTAVD  577

Query  506  IGYFNGFSGGIP  541
              Y N  SG +P
Sbjct  578  FSY-NNLSGLVP  588


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 79/163 (48%), Gaps = 4/163 (2%)
 Frame = +2

Query  92   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  271
            SG +  + G +  LV    A   LSG +PPE+  ++ L  L L  N      P +L  L 
Sbjct  225  SGGIPKEFGNMTELVRFDAANCGLSGEIPPELGRLAKLDTLFLQVNGLTDAIPMELGNLG  284

Query  272  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  451
            +L  LDL NN L+G++P    ++ +L   +L  N   G IP   G  P LE L +  N  
Sbjct  285  SLSSLDLSNNELSGEIPPSFAELKNLTLFNLFRNKLRGNIPEFVGDLPGLEVLQLWENNF  344

Query  452  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM---GNLSQLI  571
            +G IP  +G   + + L +   N  +G +PPE+   G L  LI
Sbjct  345  TGGIPRHLGRNGRFQLLDLSS-NRLTGTLPPELCAGGKLHTLI  386



>ref|XP_004143533.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cucumis sativus]
 gb|KGN48656.1| Receptor-like protein kinase 3 [Cucumis sativus]
Length=984

 Score =   204 bits (518),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 153/198 (77%), Gaps = 0/198 (0%)
 Frame = +2

Query  14   SHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISA  193
            +HC+W  VTCDS  HVV+LDLS L+L+  +SP +  L FL N+S   N++ G +PPEI++
Sbjct  70   AHCSWLGVTCDSRRHVVALDLSSLDLTATISPHISSLRFLTNVSFGLNKIFGGIPPEIAS  129

Query  194  ISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGN  373
            +S+L+ LNLS+N+   + P + ++L NLQVLD+YNNNLTGD P  V +M +LR+LHLGGN
Sbjct  130  LSSLQLLNLSSNVLNGSIPSEFSRLKNLQVLDVYNNNLTGDFPRVVTEMPNLRYLHLGGN  189

Query  374  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
            +F+GRIPPE GR   LE+LA+ GN L G IP  IGNLTKL+EL+IGY+N F GGIP  +G
Sbjct  190  FFTGRIPPEVGRLQFLEFLAIHGNDLEGPIPPAIGNLTKLRELFIGYYNTFVGGIPATIG  249

Query  554  NLSQLIRXDAANCGLTGE  607
            NLS+L+R DAA+CGL+G+
Sbjct  250  NLSELVRLDAASCGLSGK  267


 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/173 (36%), Positives = 88/173 (51%), Gaps = 2/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L  ++G L  +  L I+ N L G +P   +    LR L L +N      P  +A L
Sbjct  288  LSGSLM-ELGGLKSIEELDISCNMLVGEIPISFAVFKNLRLLQLFDNKLSGEIPEFMADL  346

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L++L L+NNN TG +P  + K   LR L L  N+ +G IPPE      LE L    N 
Sbjct  347  PKLEILQLWNNNFTGSIPRNLGKNGMLRTLDLAFNHLTGTIPPEICHGNKLEVLIAMDNS  406

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            LSG+IP  +GN   LK + + + N  +G IP  +  L  + + D  +  L+GE
Sbjct  407  LSGLIPESLGNCLSLKRILL-WGNALNGSIPRRLLGLPNITQIDLHDNFLSGE  458


 Score = 83.2 bits (204),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 86/174 (49%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            +L+G + P++     L  L    N LSG +P  +    +L+ + L  N    + P +L  
Sbjct  382  HLTGTIPPEICHGNKLEVLIAMDNSLSGLIPESLGNCLSLKRILLWGNALNGSIPRRLLG  441

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L N+  +DL++N L+G+LP+      +L  + L  N  SG +PP  G    ++ L +  N
Sbjct  442  LPNITQIDLHDNFLSGELPIINSVSVNLLQISLSNNMLSGSLPPTIGSLVAVQKLLLDRN  501

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              SG IPS IG L +L  +     N FSG I PE+     LI  D +   L+GE
Sbjct  502  KFSGQIPSNIGRLQQLSRINFSQ-NKFSGSIVPEISECKHLIFLDLSGNELSGE  554


 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 51/161 (32%), Positives = 79/161 (49%), Gaps = 1/161 (1%)
 Frame = +2

Query  122  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  301
            LP +  + +  N LSG +P   S    L  ++LSNN+   + P  +  L  +Q L L  N
Sbjct  442  LPNITQIDLHDNFLSGELPIINSVSVNLLQISLSNNMLSGSLPPTIGSLVAVQKLLLDRN  501

Query  302  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGN  481
              +G +P  + ++  L  ++   N FSG I PE     +L +L +SGN LSG IP+ I N
Sbjct  502  KFSGQIPSNIGRLQQLSRINFSQNKFSGSIVPEISECKHLIFLDLSGNELSGEIPNHITN  561

Query  482  LTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            +  L  + +   N   G IP  + N+  L   D +   L+G
Sbjct  562  MKLLNYMNLSR-NHLVGPIPASIVNMQSLTSVDFSYNNLSG  601


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 90/197 (46%), Gaps = 25/197 (13%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             LSG +   +  LP L  L +  N  +G +P  +     LR L+L+ N    T P ++  
Sbjct  334  KLSGEIPEFMADLPKLEILQLWNNNFTGSIPRNLGKNGMLRTLDLAFNHLTGTIPPEICH  393

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEY--------------  403
               L+VL   +N+L+G +P  +    SL+ + L GN  +G IP                 
Sbjct  394  GNKLEVLIAMDNSLSGLIPESLGNCLSLKRILLWGNALNGSIPRRLLGLPNITQIDLHDN  453

Query  404  ---GRFP-------NLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
               G  P       NL  +++S N LSG +P  IG+L  +++L +   N FSG IP  +G
Sbjct  454  FLSGELPIINSVSVNLLQISLSNNMLSGSLPPTIGSLVAVQKLLLDR-NKFSGQIPSNIG  512

Query  554  NLSQLIRXDAANCGLTG  604
             L QL R + +    +G
Sbjct  513  RLQQLSRINFSQNKFSG  529



>ref|XP_004160944.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1-like [Cucumis sativus]
Length=984

 Score =   204 bits (518),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 153/198 (77%), Gaps = 0/198 (0%)
 Frame = +2

Query  14   SHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISA  193
            +HC+W  VTCDS  HVV+LDLS L+L+  +SP +  L FL N+S   N++ G +PPEI++
Sbjct  70   AHCSWLGVTCDSRRHVVALDLSSLDLTATISPHISSLRFLTNVSFGLNKIFGGIPPEIAS  129

Query  194  ISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGN  373
            +S+L+ LNLS+N+   + P + ++L NLQVLD+YNNNLTGD P  V +M +LR+LHLGGN
Sbjct  130  LSSLQLLNLSSNVLNGSIPSEFSRLKNLQVLDVYNNNLTGDFPRVVTEMPNLRYLHLGGN  189

Query  374  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
            +F+GRIPPE GR   LE+LA+ GN L G IP  IGNLTKL+EL+IGY+N F GGIP  +G
Sbjct  190  FFTGRIPPEVGRLQFLEFLAIHGNDLEGPIPPAIGNLTKLRELFIGYYNTFVGGIPATIG  249

Query  554  NLSQLIRXDAANCGLTGE  607
            NLS+L+R DAA+CGL+G+
Sbjct  250  NLSELVRLDAASCGLSGK  267


 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/173 (36%), Positives = 88/173 (51%), Gaps = 2/173 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            LSG L  ++G L  +  L I+ N L G +P   +    LR L L +N      P  +A L
Sbjct  288  LSGSLM-ELGGLKSIEELDISCNMLVGEIPISFAVFKNLRLLQLFDNKLSGEIPEFMADL  346

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L++L L+NNN TG +P  + K   LR L L  N+ +G IPPE      LE L    N 
Sbjct  347  PKLEILQLWNNNFTGSIPRNLGKNGMLRTLDLAFNHLTGTIPPEICHGNKLEVLIAMDNS  406

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            LSG+IP  +GN   LK + + + N  +G IP  +  L  + + D  +  L+GE
Sbjct  407  LSGLIPESLGNCLSLKRILL-WGNALNGSIPRRLLGLPNITQIDLHDNFLSGE  458


 Score = 83.2 bits (204),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 86/174 (49%), Gaps = 1/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            +L+G + P++     L  L    N LSG +P  +    +L+ + L  N    + P +L  
Sbjct  382  HLTGTIPPEICHGNKLEVLIAMDNSLSGLIPESLGNCLSLKRILLWGNALNGSIPRRLLG  441

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L N+  +DL++N L+G+LP+      +L  + L  N  SG +PP  G    ++ L +  N
Sbjct  442  LPNITQIDLHDNFLSGELPIINSVSVNLLQISLSNNMLSGSLPPTIGSLVAVQKLLLDRN  501

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              SG IPS IG L +L  +     N FSG I PE+     LI  D +   L+GE
Sbjct  502  KFSGQIPSNIGRLQQLSRINFSQ-NKFSGSIVPEISECKHLIFLDLSGNELSGE  554


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/161 (32%), Positives = 79/161 (49%), Gaps = 1/161 (1%)
 Frame = +2

Query  122  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  301
            LP +  + +  N LSG +P   S    L  ++LSNN+   + P  +  L  +Q L L  N
Sbjct  442  LPNITQIDLHDNFLSGELPIINSVSVNLLQISLSNNMLSGSLPPTIGSLVAVQKLLLDRN  501

Query  302  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGN  481
              +G +P  + ++  L  ++   N FSG I PE     +L +L +SGN LSG IP+ I N
Sbjct  502  KFSGQIPSNIGRLQQLSRINFSQNKFSGSIVPEISECKHLIFLDLSGNELSGEIPNHITN  561

Query  482  LTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            +  L  + +   N   G IP  + N+  L   D +   L+G
Sbjct  562  MKLLNYMNLSR-NHLVGPIPASIVNMQSLTSVDFSYNNLSG  601


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 90/197 (46%), Gaps = 25/197 (13%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
             LSG +   +  LP L  L +  N  +G +P  +     LR L+L+ N    T P ++  
Sbjct  334  KLSGEIPEFMADLPKLEILQLWNNNFTGSIPRNLGKNGMLRTLDLAFNHLTGTIPPEICH  393

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEY--------------  403
               L+VL   +N+L+G +P  +    SL+ + L GN  +G IP                 
Sbjct  394  GNKLEVLIAMDNSLSGLIPESLGNCLSLKRILLWGNALNGSIPRRLLGLPNITQIDLHDN  453

Query  404  ---GRFP-------NLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
               G  P       NL  +++S N LSG +P  IG+L  +++L +   N FSG IP  +G
Sbjct  454  FLSGELPIINSVSVNLLQISLSNNMLSGSLPPTIGSLVAVQKLLLDR-NKFSGQIPSNIG  512

Query  554  NLSQLIRXDAANCGLTG  604
             L QL R + +    +G
Sbjct  513  RLQQLSRINFSQNKFSG  529



>gb|AAF73373.1|AF193835_1 LRK1 protein [Oryza sativa]
Length=970

 Score =   201 bits (512),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 114/204 (56%), Positives = 142/204 (70%), Gaps = 2/204 (1%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsglNLSGVL-SPDVGQLPFLVNLSIAANQLSGPVP  178
            N ++S C W  V C++   VV LD+SG NL+G L    +  L  L  L +AAN LSGP+P
Sbjct  51   NTTSSPCAWSGVACNARGAVVGLDVSGRNLTGGLPGAALSGLQHLARLDLAANALSGPIP  110

Query  179  PEISAIST-LRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRH  355
              +S ++  L  LNLSNN    TFP QL++L  L+VLDLYNNNLTG LP+EV  +  LRH
Sbjct  111  AALSRLAPFLTHLNLSNNGLNGTFPPQLSRLRALRVLDLYNNNLTGALPLEVVSLRKLRH  170

Query  356  LHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGG  535
            LHLGGN FSG IPPEYG   + +YLA+    LSG  P  +GNLT L+E YIGYFN +SGG
Sbjct  171  LHLGGNIFSGGIPPEYGHGGSFKYLALRQTSLSGYPPGGLGNLTSLREFYIGYFNSYSGG  230

Query  536  IPPEMGNLSQLIRXDAANCGLTGE  607
            IPPE+GN++ L+R DAANCGL+GE
Sbjct  231  IPPELGNMTDLVRLDAANCGLSGE  254


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/181 (33%), Positives = 85/181 (47%), Gaps = 26/181 (14%)
 Frame = +2

Query  113  VGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDL  292
            VG LP L  L +  N  +G +P  +      + L+LS+N    T P  L     L+ L  
Sbjct  334  VGDLPSLEVLQLWENNFTGGMPRRLGRNGRFQLLDLSSNRLTGTLPPDLCAGGKLETLIA  393

Query  293  YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYL------------AV  436
              N+L G +P  + K TSL  + LG NY +G IP      PNL  +            AV
Sbjct  394  LGNSLFGAIPASLGKCTSLTRVRLGDNYLNGSIPEGLFELPNLTQVELQDNLISGGFPAV  453

Query  437  SGNG-------------LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRX  577
            SG G             L+G +P+ IG+ + +++L +   N F+G IPPE+G L QL + 
Sbjct  454  SGTGAPNLGQISLSNNQLTGALPAFIGSFSGVQKLLLDQ-NAFTGEIPPEIGRLQQLSKA  512

Query  578  D  580
            D
Sbjct  513  D  513


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/177 (31%), Positives = 88/177 (50%), Gaps = 7/177 (4%)
 Frame = +2

Query  89   LSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  259
            L+G L PD+   G+L  L+ L    N L G +P  +   ++L  + L +N    + P  L
Sbjct  374  LTGTLPPDLCAGGKLETLIAL---GNSLFGAIPASLGKCTSLTRVRLGDNYLNGSIPEGL  430

Query  260  AQLANLQVLDLYNNNLTGDLP-VEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  436
             +L NL  ++L +N ++G  P V      +L  + L  N  +G +P   G F  ++ L +
Sbjct  431  FELPNLTQVELQDNLISGGFPAVSGTGAPNLGQISLSNNQLTGALPAFIGSFSGVQKLLL  490

Query  437  SGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
              N  +G IP EIG L +L +  +   +  +GG+PPE+G    L   D +   L+GE
Sbjct  491  DQNAFTGEIPPEIGRLQQLSKADLSGNSLPTGGVPPEIGKCRLLTYLDLSRNNLSGE  547


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 54/152 (36%), Positives = 78/152 (51%), Gaps = 8/152 (5%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            +SG  +P++GQ+      S++ NQL+G +P  I + S ++ L L  N F    P ++ +L
Sbjct  453  VSGTGAPNLGQI------SLSNNQLTGALPAFIGSFSGVQKLLLDQNAFTGEIPPEIGRL  506

Query  269  ANLQVLDLYNNNL-TGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
              L   DL  N+L TG +P E+ K   L +L L  N  SG IPP       L YL +S N
Sbjct  507  QQLSKADLSGNSLPTGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRN  566

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
             L G IP+ I  +  L  +   Y N  SG +P
Sbjct  567  QLDGEIPATIAAMQSLTAVDFSY-NNLSGLVP  597


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 77/161 (48%), Gaps = 1/161 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            NL+G L  +V  L  L +L +  N  SG +PPE     + ++L L         P  L  
Sbjct  153  NLTGALPLEVVSLRKLRHLHLGGNIFSGGIPPEYGHGGSFKYLALRQTSLSGYPPGGLGN  212

Query  266  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            L +L+   + Y N+ +G +P E+  MT L  L       SG IPPE G   NL+ L +  
Sbjct  213  LTSLREFYIGYFNSYSGGIPPELGNMTDLVRLDAANCGLSGEIPPELGNLANLDTLFLRV  272

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQ  565
            NGL+G IP E+G L  L+        G +G  P ++  L +
Sbjct  273  NGLAGGIPRELGKLASLQPKVDLSKKGLAGEDPAKVRRLQR  313


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 63/129 (49%), Gaps = 1/129 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGST-FPHQLA  262
             L+G L   +G    +  L +  N  +G +PPEI  +  L   +LS N   +   P ++ 
Sbjct  470  QLTGALPAFIGSFSGVQKLLLDQNAFTGEIPPEIGRLQQLSKADLSGNSLPTGGVPPEIG  529

Query  263  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            +   L  LDL  NNL+G++P  +  M  L +L+L  N   G IP       +L  +  S 
Sbjct  530  KCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQLDGEIPATIAAMQSLTAVDFSY  589

Query  443  NGLSGVIPS  469
            N LSG++P+
Sbjct  590  NNLSGLVPA  598



>ref|XP_010260843.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nelumbo nucifera]
 ref|XP_010260847.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nelumbo nucifera]
Length=1006

 Score =   197 bits (502),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 105/198 (53%), Positives = 138/198 (70%), Gaps = 1/198 (1%)
 Frame = +2

Query  14   SHCTWRRVTCdsl-lhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEIS  190
            S C+W  + CD +   VVSLD+S  N+SGV+SP +G+L  L+NLSIA N  SG  PPE+ 
Sbjct  81   SLCSWTGIQCDDMGSSVVSLDISNFNISGVISPAIGELQSLLNLSIAGNSFSGLFPPELH  140

Query  191  AISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGG  370
             +++LRFLN+SNN F  +     + L  L+VLD+YNNN  G LP+ V ++  L+HL LGG
Sbjct  141  KLTSLRFLNISNNQFNGSLSWNFSSLRELEVLDVYNNNFFGSLPLGVTELPKLKHLDLGG  200

Query  371  NYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            NY SG+IPP YG    L YL+++GN L G+IP E+GNLT LK+LY+GYFN F GGIPPE 
Sbjct  201  NYISGKIPPSYGAMEELNYLSLAGNDLGGLIPGELGNLTNLKQLYLGYFNEFDGGIPPEF  260

Query  551  GNLSQLIRXDAANCGLTG  604
            G L  L+  D ++CGL G
Sbjct  261  GKLVNLVHLDLSSCGLEG  278


 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 87/175 (50%), Gaps = 2/175 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            N +G + P +GQ   L  L ++ N+L+G VP  +     LR L L NN      P  L  
Sbjct  371  NFTGTIPPKLGQNGKLTELDLSTNKLTGLVPRSLCLGRKLRILILLNNFLFGPLPDDLGD  430

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPN-LEYLAVSG  442
               L  + L  N L+G +P     +  L  + L  NY +G    +  + P+ L  L +S 
Sbjct  431  CVTLLRVRLGQNYLSGSIPYGFLYLPELSLMELQNNYLTGWFAEDPNKVPSKLGQLNLSN  490

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            N LSG IPS IGN + L+ L +G  N F+G IP E+G L  L++ D +   LTG 
Sbjct  491  NRLSGSIPSSIGNFSSLQALLLGG-NQFTGEIPSELGRLKNLLKLDMSRNNLTGR  544


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/151 (38%), Positives = 83/151 (55%), Gaps = 1/151 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
              G + P+ G+L  LV+L +++  L GP+PPE+  ++ L  L L  N    + PHQ   L
Sbjct  252  FDGGIPPEFGKLVNLVHLDLSSCGLEGPIPPELGNLNKLDTLFLQTNQLSGSIPHQFGNL  311

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
            ++L+ LDL NN LTG++PVE  ++  L  LHL  N   G IP      P LE L +  N 
Sbjct  312  SSLKSLDLSNNGLTGEIPVEFSELRELSLLHLFINKLHGEIPRFIAELPKLEVLKLWQNN  371

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
             +G IP ++G   KL EL +   N  +G +P
Sbjct  372  FTGTIPPKLGQNGKLTELDLST-NKLTGLVP  401


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/152 (37%), Positives = 81/152 (53%), Gaps = 2/152 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPF-LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            L+G  + D  ++P  L  L+++ N+LSG +P  I   S+L+ L L  N F    P +L +
Sbjct  468  LTGWFAEDPNKVPSKLGQLNLSNNRLSGSIPSSIGNFSSLQALLLGGNQFTGEIPSELGR  527

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L NL  LD+  NNLTG +P ++     L +L L  N  SG IP +  +   L YL +S N
Sbjct  528  LKNLLKLDMSRNNLTGRIPPDIGNCLLLTYLDLSQNQLSGPIPVQISQIHILNYLNISWN  587

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
             L+  +P EIG +  L      + N FSG IP
Sbjct  588  HLNQSLPKEIGAIKSLTSADFSH-NDFSGRIP  618


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            NL+G + PD+G    L  L ++ NQLSGP+P +IS I  L +LN+S N    + P ++  
Sbjct  540  NLTGRIPPDIGNCLLLTYLDLSQNQLSGPIPVQISQIHILNYLNISWNHLNQSLPKEIGA  599

Query  266  LANLQVLDLYNNNLTGDLP  322
            + +L   D  +N+ +G +P
Sbjct  600  IKSLTSADFSHNDFSGRIP  618



>ref|XP_001754727.1| CLL1A clavata1-like receptor S/T protein kinase protein [Physcomitrella 
patens]
 gb|EDQ80697.1| CLL1A clavata1-like receptor S/T protein kinase protein [Physcomitrella 
patens]
Length=1017

 Score =   195 bits (496),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 141/201 (70%), Gaps = 0/201 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPP  181
            N ++S C W  V C++   VV L LSG+NLSG +S ++G L  LVNLS+  N  +  +P 
Sbjct  58   NGTSSPCLWTGVDCNNSSSVVGLYLSGMNLSGTISSELGNLKNLVNLSLDRNNFTEDLPA  117

Query  182  EISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLH  361
            +I  ++ L++LN+S N FG   P   +QL  LQVLD +NN  +G LP +++K+++L H+ 
Sbjct  118  DIVTLTQLKYLNVSTNSFGGALPSNFSQLQLLQVLDCFNNFFSGPLPPDLWKISTLEHVS  177

Query  362  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            LGGNYF G IPPEYG+FPNL+Y  ++GN L+G IP+E+GNLT L+ELY+GY+N FS  IP
Sbjct  178  LGGNYFEGSIPPEYGKFPNLKYFGLNGNSLTGPIPAELGNLTGLQELYMGYYNNFSSSIP  237

Query  542  PEMGNLSQLIRXDAANCGLTG  604
               GNL+ L+R D A+CGL G
Sbjct  238  ATFGNLTNLVRLDMASCGLVG  258


 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 51/155 (33%), Positives = 80/155 (52%), Gaps = 1/155 (1%)
 Frame = +2

Query  140  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  319
            + I  NQ++GP+P EI     L +L+ S N   S+ P  +  L ++    + +N+ TG +
Sbjct  441  VEIQDNQVNGPIPSEIINAPLLSYLDFSKNNLSSSIPESIGNLPSIMSFFISDNHFTGPI  500

Query  320  PVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKE  499
            P ++  M +L  L + GN  SG IP E      L  L VS N L+GVIP ++  +  L  
Sbjct  501  PPQICDMPNLNKLDMSGNNLSGSIPAEMSNCKKLGLLDVSHNSLTGVIPVQMQFIPDLYY  560

Query  500  LYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            L + + N  SG IP ++ +L  L   D +   L+G
Sbjct  561  LNLSH-NELSGAIPSKLADLPTLSIFDFSYNNLSG  594


 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 71/127 (56%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            NLS  +   +G LP +++  I+ N  +GP+PP+I  +  L  L++S N    + P +++ 
Sbjct  471  NLSSSIPESIGNLPSIMSFFISDNHFTGPIPPQICDMPNLNKLDMSGNNLSGSIPAEMSN  530

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
               L +LD+ +N+LTG +PV++  +  L +L+L  N  SG IP +    P L     S N
Sbjct  531  CKKLGLLDVSHNSLTGVIPVQMQFIPDLYYLNLSHNELSGAIPSKLADLPTLSIFDFSYN  590

Query  446  GLSGVIP  466
             LSG IP
Sbjct  591  NLSGPIP  597


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 82/151 (54%), Gaps = 1/151 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            +L G +   +G L  L +L ++ N+L+G +P  +  +  L  ++L NN    T P  LA 
Sbjct  279  SLEGPIPASLGNLVNLRSLDLSYNRLTGILPNTLIYLQKLELMSLMNNHLEGTVPDFLAD  338

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L NL+VL L+ N LTG +P  + +  +L  L L  N+ +G IPP+      L+++ +  N
Sbjct  339  LPNLEVLYLWKNQLTGPIPENLGQNMNLTLLDLSSNHLNGSIPPDLCAGQKLQWVILLEN  398

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGI  538
             L+G IP  +G+   L +L +G  N  +G I
Sbjct  399  QLTGSIPESLGHCQSLTKLRLG-INSLNGSI  428


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 85/172 (49%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G +   +G    L  L +  N L+G +P  +  +  L  + + +N      P ++   
Sbjct  400  LTGSIPESLGHCQSLTKLRLGINSLNGSIPQGLLGLPLLAMVEIQDNQVNGPIPSEIINA  459

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L  LD   NNL+  +P  +  + S+    +  N+F+G IPP+    PNL  L +SGN 
Sbjct  460  PLLSYLDFSKNNLSSSIPESIGNLPSIMSFFISDNHFTGPIPPQICDMPNLNKLDMSGNN  519

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            LSG IP+E+ N  KL  L + + N  +G IP +M  +  L   + ++  L+G
Sbjct  520  LSGSIPAEMSNCKKLGLLDVSH-NSLTGVIPVQMQFIPDLYYLNLSHNELSG  570


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 88/172 (51%), Gaps = 1/172 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G +  ++GQ   L  L +++N L+G +PP++ A   L+++ L  N    + P  L   
Sbjct  352  LTGPIPENLGQNMNLTLLDLSSNHLNGSIPPDLCAGQKLQWVILLENQLTGSIPESLGHC  411

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
             +L  L L  N+L G +P  +  +  L  + +  N  +G IP E    P L YL  S N 
Sbjct  412  QSLTKLRLGINSLNGSIPQGLLGLPLLAMVEIQDNQVNGPIPSEIINAPLLSYLDFSKNN  471

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            LS  IP  IGNL  +   +I   N F+G IPP++ ++  L + D +   L+G
Sbjct  472  LSSSIPESIGNLPSIMSFFISD-NHFTGPIPPQICDMPNLNKLDMSGNNLSG  522


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 72/155 (46%), Gaps = 1/155 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            N S  +    G L  LV L +A+  L G +P E+  +  L  L L  N      P  L  
Sbjct  231  NFSSSIPATFGNLTNLVRLDMASCGLVGAIPHELGNLGQLDTLFLMLNSLEGPIPASLGN  290

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L NL+ LDL  N LTG LP  +  +  L  + L  N+  G +P      PNLE L +  N
Sbjct  291  LVNLRSLDLSYNRLTGILPNTLIYLQKLELMSLMNNHLEGTVPDFLADLPNLEVLYLWKN  350

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
             L+G IP  +G    L  L +   N  +G IPP++
Sbjct  351  QLTGPIPENLGQNMNLTLLDLSS-NHLNGSIPPDL  384


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 48/90 (53%), Gaps = 1/90 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            NLSG +  ++     L  L ++ N L+G +P ++  I  L +LNLS+N      P +LA 
Sbjct  519  NLSGSIPAEMSNCKKLGLLDVSHNSLTGVIPVQMQFIPDLYYLNLSHNELSGAIPSKLAD  578

Query  266  LANLQVLDLYNNNLTGDLPV-EVYKMTSLR  352
            L  L + D   NNL+G +P+ + Y  T+  
Sbjct  579  LPTLSIFDFSYNNLSGPIPLFDSYNATAFE  608



>ref|XP_011004295.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 isoform X2 [Populus euphratica]
Length=893

 Score =   189 bits (481),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 99/204 (49%), Positives = 128/204 (63%), Gaps = 3/204 (1%)
 Frame = +2

Query  2    NISTSH--CTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGP  172
            N+S  H  C+W  + CD +   V        N+SG LSP + +L  LVNLSI  N  S  
Sbjct  58   NVSNYHLLCSWTGIQCDDMNRSVVALDISNSNISGTLSPAITELRSLVNLSIQGNSFSDE  117

Query  173  VPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLR  352
             P EI  +  L+FLN+SNN+F      + +QL  LQVLD+YNNNL G LP+ V ++  L+
Sbjct  118  FPREIHKLIRLQFLNISNNLFSGELAWEFSQLKELQVLDVYNNNLNGTLPLGVTQLGKLK  177

Query  353  HLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSG  532
            +L  GGNYF G IPP YG    L YL++ GN L G+IP E+GNLT L++LY+GY+N F G
Sbjct  178  YLDFGGNYFQGTIPPSYGSMQQLNYLSLKGNDLRGLIPGELGNLTSLEQLYLGYYNEFDG  237

Query  533  GIPPEMGNLSQLIRXDAANCGLTG  604
            GIPPE G L  L+  D ANC L+G
Sbjct  238  GIPPEFGKLINLVHIDLANCSLSG  261


 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 86/159 (54%), Gaps = 3/159 (2%)
 Frame = +2

Query  89   LSGVLSPDVGQLPF-LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            LSG +   + + P  L  +++A N+LSGP+P  I   S L+ L LS N F    P Q+ Q
Sbjct  451  LSGQVPQQISKTPSKLAQMNLADNRLSGPLPASIGNFSNLQILLLSGNRFTGEIPSQIGQ  510

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L N+  LD+  NNL+G++P E+    +L +L L  N  SG IP    +   L YL +S N
Sbjct  511  LKNVFTLDMSRNNLSGNIPPEIGDCRTLTYLDLSQNQLSGPIPVHITQIHILNYLNISWN  570

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLS  562
             L+  +P EIG++  L      + N FSG I PE G  S
Sbjct  571  HLNQSLPKEIGSMKSLTSADFSH-NNFSGSI-PEFGQYS  607


 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/173 (34%), Positives = 94/173 (54%), Gaps = 1/173 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            +LSG + P++G L  L  L +  N+L+GP+PPE+  +S++  L+LSNN      P + + 
Sbjct  258  SLSGPIPPELGGLNKLDTLFLQTNELTGPIPPELGNLSSIISLDLSNNALTGDIPLEFSG  317

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L +L+L+ N L G++P  + ++  L  L L  N F+G IP + G    L  L +S N
Sbjct  318  LRRLTLLNLFLNKLHGEIPYFIAELPELEVLKLWHNNFTGAIPAKLGENGRLTELDLSSN  377

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             L+G++P  +    KL ++ I   N   G +P ++G+   L R       LTG
Sbjct  378  KLTGLVPKSLCLGRKL-QILILRINFLFGPLPDDLGHCDTLWRVRLGQNYLTG  429


 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 82/154 (53%), Gaps = 1/154 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
              G + P+ G+L  LV++ +A   LSGP+PPE+  ++ L  L L  N      P +L  L
Sbjct  235  FDGGIPPEFGKLINLVHIDLANCSLSGPIPPELGGLNKLDTLFLQTNELTGPIPPELGNL  294

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
            +++  LDL NN LTGD+P+E   +  L  L+L  N   G IP      P LE L +  N 
Sbjct  295  SSIISLDLSNNALTGDIPLEFSGLRRLTLLNLFLNKLHGEIPYFIAELPELEVLKLWHNN  354

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
             +G IP+++G   +L EL +   N  +G +P  +
Sbjct  355  FTGAIPAKLGENGRLTELDLSS-NKLTGLVPKSL  387


 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 81/156 (52%), Gaps = 2/156 (1%)
 Frame = +2

Query  140  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  319
            L +  N L GP+P ++    TL  + L  N    + P     L  L +++L NN L+G +
Sbjct  396  LILRINFLFGPLPDDLGHCDTLWRVRLGQNYLTGSIPSGFLYLPELSLMELQNNYLSGQV  455

Query  320  PVEVYKMTS-LRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLK  496
            P ++ K  S L  ++L  N  SG +P   G F NL+ L +SGN  +G IPS+IG L  + 
Sbjct  456  PQQISKTPSKLAQMNLADNRLSGPLPASIGNFSNLQILLLSGNRFTGEIPSQIGQLKNVF  515

Query  497  ELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             L +   N  SG IPPE+G+   L   D +   L+G
Sbjct  516  TLDMSR-NNLSGNIPPEIGDCRTLTYLDLSQNQLSG  550


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/174 (30%), Positives = 86/174 (49%), Gaps = 2/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            N +G +   +G+   L  L +++N+L+G VP  +     L+ L L  N      P  L  
Sbjct  354  NFTGAIPAKLGENGRLTELDLSSNKLTGLVPKSLCLGRKLQILILRINFLFGPLPDDLGH  413

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPN-LEYLAVSG  442
               L  + L  N LTG +P     +  L  + L  NY SG++P +  + P+ L  + ++ 
Sbjct  414  CDTLWRVRLGQNYLTGSIPSGFLYLPELSLMELQNNYLSGQVPQQISKTPSKLAQMNLAD  473

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            N LSG +P+ IGN + L+ L +   N F+G IP ++G L  +   D +   L+G
Sbjct  474  NRLSGPLPASIGNFSNLQILLLSG-NRFTGEIPSQIGQLKNVFTLDMSRNNLSG  526


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 62/196 (32%), Positives = 90/196 (46%), Gaps = 24/196 (12%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  265
              G + P  G +  L  LS+  N L G +P E+  +++L  L L   N F    P +  +
Sbjct  186  FQGTIPPSYGSMQQLNYLSLKGNDLRGLIPGELGNLTSLEQLYLGYYNEFDGGIPPEFGK  245

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L NL  +DL N +L+G +P E+  +  L  L L  N  +G IPPE G   ++  L +S N
Sbjct  246  LINLVHIDLANCSLSGPIPPELGGLNKLDTLFLQTNELTGPIPPELGNLSSIISLDLSNN  305

Query  446  GLSGVIPSEIGNLTKLKEL---------YIGYF--------------NGFSGGIPPEMGN  556
             L+G IP E   L +L  L          I YF              N F+G IP ++G 
Sbjct  306  ALTGDIPLEFSGLRRLTLLNLFLNKLHGEIPYFIAELPELEVLKLWHNNFTGAIPAKLGE  365

Query  557  LSQLIRXDAANCGLTG  604
              +L   D ++  LTG
Sbjct  366  NGRLTELDLSSNKLTG  381


 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 57/209 (27%), Positives = 93/209 (44%), Gaps = 50/209 (24%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G + P++G L  +++L ++ N L+G +P E S +  L  LNL  N      P+ +A+L
Sbjct  283  LTGPIPPELGNLSSIISLDLSNNALTGDIPLEFSGLRRLTLLNLFLNKLHGEIPYFIAEL  342

Query  269  ANLQVLDLYNNNLTGDLPVEV-------------YKMT----------------------  343
              L+VL L++NN TG +P ++              K+T                      
Sbjct  343  PELEVLKLWHNNFTGAIPAKLGENGRLTELDLSSNKLTGLVPKSLCLGRKLQILILRINF  402

Query  344  -------------SLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNL  484
                         +L  + LG NY +G IP  +   P L  + +  N LSG +P +I   
Sbjct  403  LFGPLPDDLGHCDTLWRVRLGQNYLTGSIPSGFLYLPELSLMELQNNYLSGQVPQQISKT  462

Query  485  -TKLKELYIGYFNGFSGGIPPEMGNLSQL  568
             +KL ++ +   N  SG +P  +GN S L
Sbjct  463  PSKLAQMNLAD-NRLSGPLPASIGNFSNL  490


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            NLSG + P++G    L  L ++ NQLSGP+P  I+ I  L +LN+S N    + P ++  
Sbjct  523  NLSGNIPPEIGDCRTLTYLDLSQNQLSGPIPVHITQIHILNYLNISWNHLNQSLPKEIGS  582

Query  266  LANLQVLDLYNNNLTGDLP  322
            + +L   D  +NN +G +P
Sbjct  583  MKSLTSADFSHNNFSGSIP  601



>ref|XP_004295533.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Fragaria vesca subsp. vesca]
Length=982

 Score =   190 bits (482),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 127/196 (65%), Gaps = 1/196 (1%)
 Frame = +2

Query  20   CTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAI  196
            C+W  + CD+L   V        NLSG LSPD+ +L  LVNLS++ N  SG  P  I  +
Sbjct  59   CSWAGIMCDNLSRSVISLDVSNYNLSGSLSPDITELRTLVNLSVSGNDFSGSFPAGIHKL  118

Query  197  STLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNY  376
              L++LN+SNN FG +   + AQL  L +LD YNN+  G LP+ V ++  L+ L  GGNY
Sbjct  119  PRLQYLNISNNGFGGSMDWEFAQLKELILLDAYNNDFNGSLPLGVTQLPKLKRLDFGGNY  178

Query  377  FSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  556
            FSG IPP YG    L YL+V+GN LSG IPSE+GNLT L +L++GY+N F GGIPPE+G 
Sbjct  179  FSGSIPPSYGNMSQLNYLSVAGNDLSGFIPSELGNLTNLTQLFLGYYNDFDGGIPPEIGK  238

Query  557  LSQLIRXDAANCGLTG  604
            L+ L   D ANCGL G
Sbjct  239  LTNLFHLDLANCGLEG  254


 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 85/155 (55%), Gaps = 1/155 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            +  G + P++G+L  L +L +A   L G +PPE+  +  L  L L  N    + P QL  
Sbjct  227  DFDGGIPPEIGKLTNLFHLDLANCGLEGSIPPELGNLKKLDTLFLQTNQLSGSIPAQLGN  286

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L++L+ LDL NN LTGD+PVE   +  L  L+L  N F G IP E    PNLE L +  N
Sbjct  287  LSSLRSLDLSNNALTGDIPVEFSALRELTLLNLFINKFHGEIPHEIAELPNLEVLKLWQN  346

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
              +G IPS++G   KL EL +   N  +G +P  +
Sbjct  347  NFTGAIPSKLGQNGKLVELDLST-NKLTGEVPKSL  380


 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 68/222 (31%), Positives = 97/222 (44%), Gaps = 48/222 (22%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            + +G L   V QLP L  L    N  SG +PP    +S L +L+++ N      P +L  
Sbjct  154  DFNGSLPLGVTQLPKLKRLDFGGNYFSGSIPPSYGNMSQLNYLSVAGNDLSGFIPSELGN  213

Query  266  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            L NL  L L Y N+  G +P E+ K+T+L HL L      G IPPE G    L+ L +  
Sbjct  214  LTNLTQLFLGYYNDFDGGIPPEIGKLTNLFHLDLANCGLEGSIPPELGNLKKLDTLFLQT  273

Query  443  NGLSGVIPSEIGN---------------------LTKLKE-----LYIGYFNG-------  523
            N LSG IP+++GN                      + L+E     L+I  F+G       
Sbjct  274  NQLSGSIPAQLGNLSSLRSLDLSNNALTGDIPVEFSALRELTLLNLFINKFHGEIPHEIA  333

Query  524  --------------FSGGIPPEMGNLSQLIRXDAANCGLTGE  607
                          F+G IP ++G   +L+  D +   LTGE
Sbjct  334  ELPNLEVLKLWQNNFTGAIPSKLGQNGKLVELDLSTNKLTGE  375


 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 93/199 (47%), Gaps = 27/199 (14%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            N +G +   +GQ   LV L ++ N+L+G VP  +     L+ L L NN      P  L +
Sbjct  347  NFTGAIPSKLGQNGKLVELDLSTNKLTGEVPKSLCFGRKLKILILLNNFLFGPLPDDLGE  406

Query  266  ------------------------LANLQVLDLYNNNLTGDLPVEVYKM--TSLRHLHLG  367
                                    L  L +++L NN LTG L ++      + L  L+L 
Sbjct  407  CDTLVRVRLGQNYLSGSIPRGFLYLPELTLMELQNNYLTGQLDMQEKSQVPSKLSQLNLS  466

Query  368  GNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPE  547
             N  SG  P   G F +L+ L +SGN  +G IPS+IG L  + +L +   N FSG IPPE
Sbjct  467  SNRLSGSPPASIGNFSSLQILLLSGNRFTGEIPSDIGRLRNVLKLDMSR-NNFSGSIPPE  525

Query  548  MGNLSQLIRXDAANCGLTG  604
            +GN + L   D +   L+G
Sbjct  526  IGNCTLLTYLDLSQNQLSG  544


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 74/137 (54%), Gaps = 1/137 (1%)
 Frame = +2

Query  131  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  310
            L  L++++N+LSG  P  I   S+L+ L LS N F    P  + +L N+  LD+  NN +
Sbjct  460  LSQLNLSSNRLSGSPPASIGNFSSLQILLLSGNRFTGEIPSDIGRLRNVLKLDMSRNNFS  519

Query  311  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTK  490
            G +P E+   T L +L L  N  SG IPP+  +   L Y  VS N L+  +P E+G+L  
Sbjct  520  GSIPPEIGNCTLLTYLDLSQNQLSGPIPPQVVQIHILNYFNVSWNHLNQSLPKELGSLKS  579

Query  491  LKELYIGYFNGFSGGIP  541
            L      + N FSG +P
Sbjct  580  LTSADFSH-NSFSGSVP  595


 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 92/199 (46%), Gaps = 29/199 (15%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPP------------------------EISAI  196
            L G + P++G L  L  L +  NQLSG +P                         E SA+
Sbjct  252  LEGSIPPELGNLKKLDTLFLQTNQLSGSIPAQLGNLSSLRSLDLSNNALTGDIPVEFSAL  311

Query  197  STLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNY  376
              L  LNL  N F    PH++A+L NL+VL L+ NN TG +P ++ +   L  L L  N 
Sbjct  312  RELTLLNLFINKFHGEIPHEIAELPNLEVLKLWQNNFTGAIPSKLGQNGKLVELDLSTNK  371

Query  377  FSGRIPPE--YGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
             +G +P    +GR   L+ L +  N L G +P ++G    L  + +G  N  SG IP   
Sbjct  372  LTGEVPKSLCFGR--KLKILILLNNFLFGPLPDDLGECDTLVRVRLGQ-NYLSGSIPRGF  428

Query  551  GNLSQLIRXDAANCGLTGE  607
              L +L   +  N  LTG+
Sbjct  429  LYLPELTLMELQNNYLTGQ  447


 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 59/198 (30%), Positives = 95/198 (48%), Gaps = 27/198 (14%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVP------PEISAI------------------  196
            L G L  D+G+   LV + +  N LSG +P      PE++ +                  
Sbjct  396  LFGPLPDDLGECDTLVRVRLGQNYLSGSIPRGFLYLPELTLMELQNNYLTGQLDMQEKSQ  455

Query  197  --STLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGG  370
              S L  LNLS+N    + P  +   ++LQ+L L  N  TG++P ++ ++ ++  L +  
Sbjct  456  VPSKLSQLNLSSNRLSGSPPASIGNFSSLQILLLSGNRFTGEIPSDIGRLRNVLKLDMSR  515

Query  371  NYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            N FSG IPPE G    L YL +S N LSG IP ++  +  L    + + N  +  +P E+
Sbjct  516  NNFSGSIPPEIGNCTLLTYLDLSQNQLSGPIPPQVVQIHILNYFNVSW-NHLNQSLPKEL  574

Query  551  GNLSQLIRXDAANCGLTG  604
            G+L  L   D ++   +G
Sbjct  575  GSLKSLTSADFSHNSFSG  592


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            N SG + P++G    L  L ++ NQLSGP+PP++  I  L + N+S N    + P +L  
Sbjct  517  NFSGSIPPEIGNCTLLTYLDLSQNQLSGPIPPQVVQIHILNYFNVSWNHLNQSLPKELGS  576

Query  266  LANLQVLDLYNNNLTGDLP  322
            L +L   D  +N+ +G +P
Sbjct  577  LKSLTSADFSHNSFSGSVP  595


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 61/119 (51%), Gaps = 1/119 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
             +G +  D+G+L  ++ L ++ N  SG +PPEI   + L +L+LS N      P Q+ Q+
Sbjct  494  FTGEIPSDIGRLRNVLKLDMSRNNFSGSIPPEIGNCTLLTYLDLSQNQLSGPIPPQVVQI  553

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
              L   ++  N+L   LP E+  + SL       N FSG + P+ G++    + +  GN
Sbjct  554  HILNYFNVSWNHLNQSLPKELGSLKSLTSADFSHNSFSGSV-PQTGQYLFFNHTSFIGN  611



>ref|XP_011004294.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 isoform X1 [Populus euphratica]
Length=988

 Score =   190 bits (482),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 99/204 (49%), Positives = 128/204 (63%), Gaps = 3/204 (1%)
 Frame = +2

Query  2    NISTSH--CTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGP  172
            N+S  H  C+W  + CD +   V        N+SG LSP + +L  LVNLSI  N  S  
Sbjct  58   NVSNYHLLCSWTGIQCDDMNRSVVALDISNSNISGTLSPAITELRSLVNLSIQGNSFSDE  117

Query  173  VPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLR  352
             P EI  +  L+FLN+SNN+F      + +QL  LQVLD+YNNNL G LP+ V ++  L+
Sbjct  118  FPREIHKLIRLQFLNISNNLFSGELAWEFSQLKELQVLDVYNNNLNGTLPLGVTQLGKLK  177

Query  353  HLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSG  532
            +L  GGNYF G IPP YG    L YL++ GN L G+IP E+GNLT L++LY+GY+N F G
Sbjct  178  YLDFGGNYFQGTIPPSYGSMQQLNYLSLKGNDLRGLIPGELGNLTSLEQLYLGYYNEFDG  237

Query  533  GIPPEMGNLSQLIRXDAANCGLTG  604
            GIPPE G L  L+  D ANC L+G
Sbjct  238  GIPPEFGKLINLVHIDLANCSLSG  261


 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 86/159 (54%), Gaps = 3/159 (2%)
 Frame = +2

Query  89   LSGVLSPDVGQLPF-LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            LSG +   + + P  L  +++A N+LSGP+P  I   S L+ L LS N F    P Q+ Q
Sbjct  451  LSGQVPQQISKTPSKLAQMNLADNRLSGPLPASIGNFSNLQILLLSGNRFTGEIPSQIGQ  510

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L N+  LD+  NNL+G++P E+    +L +L L  N  SG IP    +   L YL +S N
Sbjct  511  LKNVFTLDMSRNNLSGNIPPEIGDCRTLTYLDLSQNQLSGPIPVHITQIHILNYLNISWN  570

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLS  562
             L+  +P EIG++  L      + N FSG I PE G  S
Sbjct  571  HLNQSLPKEIGSMKSLTSADFSH-NNFSGSI-PEFGQYS  607


 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/173 (34%), Positives = 94/173 (54%), Gaps = 1/173 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            +LSG + P++G L  L  L +  N+L+GP+PPE+  +S++  L+LSNN      P + + 
Sbjct  258  SLSGPIPPELGGLNKLDTLFLQTNELTGPIPPELGNLSSIISLDLSNNALTGDIPLEFSG  317

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L +L+L+ N L G++P  + ++  L  L L  N F+G IP + G    L  L +S N
Sbjct  318  LRRLTLLNLFLNKLHGEIPYFIAELPELEVLKLWHNNFTGAIPAKLGENGRLTELDLSSN  377

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             L+G++P  +    KL ++ I   N   G +P ++G+   L R       LTG
Sbjct  378  KLTGLVPKSLCLGRKL-QILILRINFLFGPLPDDLGHCDTLWRVRLGQNYLTG  429


 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 82/154 (53%), Gaps = 1/154 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
              G + P+ G+L  LV++ +A   LSGP+PPE+  ++ L  L L  N      P +L  L
Sbjct  235  FDGGIPPEFGKLINLVHIDLANCSLSGPIPPELGGLNKLDTLFLQTNELTGPIPPELGNL  294

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
            +++  LDL NN LTGD+P+E   +  L  L+L  N   G IP      P LE L +  N 
Sbjct  295  SSIISLDLSNNALTGDIPLEFSGLRRLTLLNLFLNKLHGEIPYFIAELPELEVLKLWHNN  354

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
             +G IP+++G   +L EL +   N  +G +P  +
Sbjct  355  FTGAIPAKLGENGRLTELDLSS-NKLTGLVPKSL  387


 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 81/156 (52%), Gaps = 2/156 (1%)
 Frame = +2

Query  140  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  319
            L +  N L GP+P ++    TL  + L  N    + P     L  L +++L NN L+G +
Sbjct  396  LILRINFLFGPLPDDLGHCDTLWRVRLGQNYLTGSIPSGFLYLPELSLMELQNNYLSGQV  455

Query  320  PVEVYKMTS-LRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLK  496
            P ++ K  S L  ++L  N  SG +P   G F NL+ L +SGN  +G IPS+IG L  + 
Sbjct  456  PQQISKTPSKLAQMNLADNRLSGPLPASIGNFSNLQILLLSGNRFTGEIPSQIGQLKNVF  515

Query  497  ELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             L +   N  SG IPPE+G+   L   D +   L+G
Sbjct  516  TLDMSR-NNLSGNIPPEIGDCRTLTYLDLSQNQLSG  550


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/174 (30%), Positives = 86/174 (49%), Gaps = 2/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            N +G +   +G+   L  L +++N+L+G VP  +     L+ L L  N      P  L  
Sbjct  354  NFTGAIPAKLGENGRLTELDLSSNKLTGLVPKSLCLGRKLQILILRINFLFGPLPDDLGH  413

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPN-LEYLAVSG  442
               L  + L  N LTG +P     +  L  + L  NY SG++P +  + P+ L  + ++ 
Sbjct  414  CDTLWRVRLGQNYLTGSIPSGFLYLPELSLMELQNNYLSGQVPQQISKTPSKLAQMNLAD  473

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            N LSG +P+ IGN + L+ L +   N F+G IP ++G L  +   D +   L+G
Sbjct  474  NRLSGPLPASIGNFSNLQILLLSG-NRFTGEIPSQIGQLKNVFTLDMSRNNLSG  526


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 62/196 (32%), Positives = 90/196 (46%), Gaps = 24/196 (12%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  265
              G + P  G +  L  LS+  N L G +P E+  +++L  L L   N F    P +  +
Sbjct  186  FQGTIPPSYGSMQQLNYLSLKGNDLRGLIPGELGNLTSLEQLYLGYYNEFDGGIPPEFGK  245

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L NL  +DL N +L+G +P E+  +  L  L L  N  +G IPPE G   ++  L +S N
Sbjct  246  LINLVHIDLANCSLSGPIPPELGGLNKLDTLFLQTNELTGPIPPELGNLSSIISLDLSNN  305

Query  446  GLSGVIPSEIGNLTKLKEL---------YIGYF--------------NGFSGGIPPEMGN  556
             L+G IP E   L +L  L          I YF              N F+G IP ++G 
Sbjct  306  ALTGDIPLEFSGLRRLTLLNLFLNKLHGEIPYFIAELPELEVLKLWHNNFTGAIPAKLGE  365

Query  557  LSQLIRXDAANCGLTG  604
              +L   D ++  LTG
Sbjct  366  NGRLTELDLSSNKLTG  381


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 57/209 (27%), Positives = 93/209 (44%), Gaps = 50/209 (24%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G + P++G L  +++L ++ N L+G +P E S +  L  LNL  N      P+ +A+L
Sbjct  283  LTGPIPPELGNLSSIISLDLSNNALTGDIPLEFSGLRRLTLLNLFLNKLHGEIPYFIAEL  342

Query  269  ANLQVLDLYNNNLTGDLPVEV-------------YKMT----------------------  343
              L+VL L++NN TG +P ++              K+T                      
Sbjct  343  PELEVLKLWHNNFTGAIPAKLGENGRLTELDLSSNKLTGLVPKSLCLGRKLQILILRINF  402

Query  344  -------------SLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNL  484
                         +L  + LG NY +G IP  +   P L  + +  N LSG +P +I   
Sbjct  403  LFGPLPDDLGHCDTLWRVRLGQNYLTGSIPSGFLYLPELSLMELQNNYLSGQVPQQISKT  462

Query  485  -TKLKELYIGYFNGFSGGIPPEMGNLSQL  568
             +KL ++ +   N  SG +P  +GN S L
Sbjct  463  PSKLAQMNLAD-NRLSGPLPASIGNFSNL  490


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            NLSG + P++G    L  L ++ NQLSGP+P  I+ I  L +LN+S N    + P ++  
Sbjct  523  NLSGNIPPEIGDCRTLTYLDLSQNQLSGPIPVHITQIHILNYLNISWNHLNQSLPKEIGS  582

Query  266  LANLQVLDLYNNNLTGDLP  322
            + +L   D  +NN +G +P
Sbjct  583  MKSLTSADFSHNNFSGSIP  601



>ref|XP_007214567.1| hypothetical protein PRUPE_ppa000837mg [Prunus persica]
 gb|EMJ15766.1| hypothetical protein PRUPE_ppa000837mg [Prunus persica]
Length=986

 Score =   189 bits (480),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 127/196 (65%), Gaps = 1/196 (1%)
 Frame = +2

Query  20   CTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAI  196
            C+W  + CD++   V        NLSG LSP + +L  LVNLS++ N  SG  PPEI  +
Sbjct  64   CSWAGIHCDNMNISVVSLDISNYNLSGSLSPAITELRTLVNLSVSGNGFSGIFPPEIHKL  123

Query  197  STLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNY  376
            + L++LN+SNN F      + AQL  L +LD YNN+  G LP+ V ++  L+ L  GGNY
Sbjct  124  ARLQYLNISNNGFSGNLSWEFAQLKELILLDAYNNDFNGSLPLGVTQIPKLKRLDFGGNY  183

Query  377  FSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  556
            FSG IPP YG    L YL+V+GN LSG IPSE+GNLT LK+L++GY+N F GGIPPE+G 
Sbjct  184  FSGNIPPSYGNMVQLNYLSVAGNDLSGFIPSELGNLTNLKQLFLGYYNEFEGGIPPEIGK  243

Query  557  LSQLIRXDAANCGLTG  604
            L  L   D ANCGL G
Sbjct  244  LINLFHLDLANCGLEG  259


 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 66/198 (33%), Positives = 94/198 (47%), Gaps = 26/198 (13%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            N +G +   +GQ   L++L +++N+L+G VP  +     L+ L L NN      P  L +
Sbjct  352  NFTGAIPSKLGQNGKLIDLDLSSNKLTGVVPKSLCFGRRLKILILLNNFLFGALPDDLGK  411

Query  266  ------------------------LANLQVLDLYNNNLTGDLPVEVYKMTS-LRHLHLGG  370
                                    L  L +++L NN LTG L  E  K+ S L  L+L  
Sbjct  412  CDTLVRVRMGQNYLTGSIPQGFLYLPELSLVELQNNYLTGQLLEEASKVPSKLSQLNLSS  471

Query  371  NYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            N  SG +P   G F +L+ L +SGN  +G IPS+IG L  + +L     N FSG IP E+
Sbjct  472  NRLSGPLPTSIGNFSSLQNLLLSGNQFTGEIPSDIGRLVNVLKLDFSR-NNFSGRIPLEV  530

Query  551  GNLSQLIRXDAANCGLTG  604
            GN   L   D +   LTG
Sbjct  531  GNCLSLTYLDLSQNQLTG  548


 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 83/152 (55%), Gaps = 2/152 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPF-LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            L+G L  +  ++P  L  L++++N+LSGP+P  I   S+L+ L LS N F    P  + +
Sbjct  449  LTGQLLEEASKVPSKLSQLNLSSNRLSGPLPTSIGNFSSLQNLLLSGNQFTGEIPSDIGR  508

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L N+  LD   NN +G +P+EV    SL +L L  N  +G IP +  +   L Y  VS N
Sbjct  509  LVNVLKLDFSRNNFSGRIPLEVGNCLSLTYLDLSQNQLTGPIPVQIVQIHILNYFNVSWN  568

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
             L+  +P E+G++  L      + N FSG IP
Sbjct  569  HLNQSLPKELGSMKSLTSADFSH-NSFSGSIP  599


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 82/154 (53%), Gaps = 1/154 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
              G + P++G+L  L +L +A   L GP+PPE+  +  L  L L  N    + P QL  L
Sbjct  233  FEGGIPPEIGKLINLFHLDLANCGLEGPIPPELGNLKQLDTLFLQTNQLSGSIPAQLGNL  292

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
            ++L+ LDL NN LTGD+P E   +  L  L+L  N F G IP      P LE L +  N 
Sbjct  293  SSLRSLDLSNNALTGDIPAEFSALRKLTLLNLFINKFHGEIPHAIAELPKLEVLKLWHNN  352

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
             +G IPS++G   KL +L +   N  +G +P  +
Sbjct  353  FTGAIPSKLGQNGKLIDLDLSS-NKLTGVVPKSL  385


 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 83/162 (51%), Gaps = 2/162 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            + +G L   V Q+P L  L    N  SG +PP    +  L +L+++ N      P +L  
Sbjct  159  DFNGSLPLGVTQIPKLKRLDFGGNYFSGNIPPSYGNMVQLNYLSVAGNDLSGFIPSELGN  218

Query  266  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  442
            L NL+ L L Y N   G +P E+ K+ +L HL L      G IPPE G    L+ L +  
Sbjct  219  LTNLKQLFLGYYNEFEGGIPPEIGKLINLFHLDLANCGLEGPIPPELGNLKQLDTLFLQT  278

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQL  568
            N LSG IP+++GNL+ L+ L +   N  +G IP E   L +L
Sbjct  279  NQLSGSIPAQLGNLSSLRSLDLSN-NALTGDIPAEFSALRKL  319


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 59/173 (34%), Positives = 92/173 (53%), Gaps = 3/173 (2%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L G + P++G L  L  L +  NQLSG +P ++  +S+LR L+LSNN      P + + L
Sbjct  257  LEGPIPPELGNLKQLDTLFLQTNQLSGSIPAQLGNLSSLRSLDLSNNALTGDIPAEFSAL  316

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
              L +L+L+ N   G++P  + ++  L  L L  N F+G IP + G+   L  L +S N 
Sbjct  317  RKLTLLNLFINKFHGEIPHAIAELPKLEVLKLWHNNFTGAIPSKLGQNGKLIDLDLSSNK  376

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGF-SGGIPPEMGNLSQLIRXDAANCGLTG  604
            L+GV+P  +    +LK L +   N F  G +P ++G    L+R       LTG
Sbjct  377  LTGVVPKSLCFGRRLKILIL--LNNFLFGALPDDLGKCDTLVRVRMGQNYLTG  427


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 58/222 (26%), Positives = 91/222 (41%), Gaps = 50/222 (23%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G +  +   L  L  L++  N+  G +P  I+ +  L  L L +N F    P +L Q 
Sbjct  305  LTGDIPAEFSALRKLTLLNLFINKFHGEIPHAIAELPKLEVLKLWHNNFTGAIPSKLGQN  364

Query  269  ANLQVLDLYNNNLT------------------------GDLPVEVYKMTSLRHLHLGGNY  376
              L  LDL +N LT                        G LP ++ K  +L  + +G NY
Sbjct  365  GKLIDLDLSSNKLTGVVPKSLCFGRRLKILILLNNFLFGALPDDLGKCDTLVRVRMGQNY  424

Query  377  FSGRIPPEYGRFP-------------------------NLEYLAVSGNGLSGVIPSEIGN  481
             +G IP  +   P                          L  L +S N LSG +P+ IGN
Sbjct  425  LTGSIPQGFLYLPELSLVELQNNYLTGQLLEEASKVPSKLSQLNLSSNRLSGPLPTSIGN  484

Query  482  LTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
             + L+ L +   N F+G IP ++G L  +++ D +    +G 
Sbjct  485  FSSLQNLLLSG-NQFTGEIPSDIGRLVNVLKLDFSRNNFSGR  525


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 43/79 (54%), Gaps = 0/79 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            N SG +  +VG    L  L ++ NQL+GP+P +I  I  L + N+S N    + P +L  
Sbjct  521  NFSGRIPLEVGNCLSLTYLDLSQNQLTGPIPVQIVQIHILNYFNVSWNHLNQSLPKELGS  580

Query  266  LANLQVLDLYNNNLTGDLP  322
            + +L   D  +N+ +G +P
Sbjct  581  MKSLTSADFSHNSFSGSIP  599



>ref|XP_008808401.1| PREDICTED: leucine-rich repeat receptor-like kinase protein FLORAL 
ORGAN NUMBER1 [Phoenix dactylifera]
Length=989

 Score =   188 bits (478),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 137/198 (69%), Gaps = 0/198 (0%)
 Frame = +2

Query  14   SHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISA  193
            +HC++  VTCD+   VV+L++S +     L P++ +L  LVNL++A + L+G +PPEI+A
Sbjct  56   THCSFSGVTCDADARVVALNVSHIRFHRPLPPEISRLDRLVNLTVACDSLAGRLPPEIAA  115

Query  194  ISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGN  373
            +  LRFLN+SNN F   FP        L+VLD YNNN +G LP+ + K+  LR++HLGGN
Sbjct  116  LPALRFLNISNNNFTGHFPDVDGGFLALEVLDAYNNNFSGPLPLGLAKLPHLRYIHLGGN  175

Query  374  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  553
            +FSG IP  YG   +LEYL ++GNGLSG +P  +  LT L+E+YIGY++ + GGIPPE G
Sbjct  176  FFSGEIPESYGGIGSLEYLGLNGNGLSGRVPVSLSRLTNLREMYIGYYSMYEGGIPPEFG  235

Query  554  NLSQLIRXDAANCGLTGE  607
             L+ L+R D ANC LTG 
Sbjct  236  MLTSLVRLDMANCNLTGR  253


 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 73/129 (57%), Gaps = 1/129 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            +SG + P +G    L  LS+ +N++SG +PP+I  +  L  LNLS N      P  LA+ 
Sbjct  465  ISGPIPPAIGNFRGLQTLSLQSNRISGEIPPQIGDLKQLSNLNLSGNNLTGEIPSDLARC  524

Query  269  A-NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            A  L+ +DL  N LTG++P  + K+ +L  L+L  N  SG IP +  R  +L  L +S N
Sbjct  525  AGTLEAVDLSRNRLTGEIPEAITKLQNLNTLNLSRNQLSGEIPADIQRMLSLTTLDLSYN  584

Query  446  GLSGVIPSE  472
             LSG IP E
Sbjct  585  NLSGEIPVE  593


 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 74/137 (54%), Gaps = 2/137 (1%)
 Frame = +2

Query  140  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  319
            L +A N++SGP+PP I     L+ L+L +N      P Q+  L  L  L+L  NNLTG++
Sbjct  458  LLLANNRISGPIPPAIGNFRGLQTLSLQSNRISGEIPPQIGDLKQLSNLNLSGNNLTGEI  517

Query  320  PVEVYKMT-SLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLK  496
            P ++ +   +L  + L  N  +G IP    +  NL  L +S N LSG IP++I  +  L 
Sbjct  518  PSDLARCAGTLEAVDLSRNRLTGEIPEAITKLQNLNTLNLSRNQLSGEIPADIQRMLSLT  577

Query  497  ELYIGYFNGFSGGIPPE  547
             L + Y N  SG IP E
Sbjct  578  TLDLSY-NNLSGEIPVE  593


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 57/173 (33%), Positives = 90/173 (52%), Gaps = 1/173 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            NL+G +   +GQL  L +L +  N L+G +PPE+  +  L  L+LS N      P   A+
Sbjct  249  NLTGRIPASLGQLKLLDSLFLQWNHLAGSIPPELGGLDLLESLDLSINELTGELPESFAE  308

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L++L+L+ N+  G +P  +  + +L  L +  N F+  +P   GR   L  L V+ N
Sbjct  309  LKQLKLLNLFRNHFRGHIPPFIADLPNLEVLQVWENNFTFELPEGLGRNGRLIKLDVATN  368

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             L+G IPS++    +L EL +   N F G IP ++G+   L+    A   L G
Sbjct  369  RLTGTIPSDLCASGRL-ELLVLMENAFFGPIPEKLGDCKSLLHVRLAKNFLDG  420


 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 90/177 (51%), Gaps = 9/177 (5%)
 Frame = +2

Query  89   LSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  259
            L+G +  D+   G+L  LV   +  N   GP+P ++    +L  + L+ N    T P  L
Sbjct  370  LTGTIPSDLCASGRLELLV---LMENAFFGPIPEKLGDCKSLLHVRLAKNFLDGTIPAGL  426

Query  260  AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  439
              L ++ +L+L +N L+G+LP  +     L  L L  N  SG IPP  G F  L+ L++ 
Sbjct  427  FDLPSVDMLELSDNYLSGELPARIAG-DKLGMLLLANNRISGPIPPAIGNFRGLQTLSLQ  485

Query  440  GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLS-QLIRXDAANCGLTGE  607
             N +SG IP +IG+L +L  L +   N  +G IP ++   +  L   D +   LTGE
Sbjct  486  SNRISGEIPPQIGDLKQLSNLNLSG-NNLTGEIPSDLARCAGTLEAVDLSRNRLTGE  541


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 51/171 (30%), Positives = 81/171 (47%), Gaps = 1/171 (1%)
 Frame = +2

Query  95   GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  274
            G +   +G    L+++ +A N L G +P  +  + ++  L LS+N      P ++A    
Sbjct  396  GPIPEKLGDCKSLLHVRLAKNFLDGTIPAGLFDLPSVDMLELSDNYLSGELPARIAG-DK  454

Query  275  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  454
            L +L L NN ++G +P  +     L+ L L  N  SG IPP+ G    L  L +SGN L+
Sbjct  455  LGMLLLANNRISGPIPPAIGNFRGLQTLSLQSNRISGEIPPQIGDLKQLSNLNLSGNNLT  514

Query  455  GVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTGE  607
            G IPS++       E      N  +G IP  +  L  L   + +   L+GE
Sbjct  515  GEIPSDLARCAGTLEAVDLSRNRLTGEIPEAITKLQNLNTLNLSRNQLSGE  565


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 59/186 (32%), Positives = 85/186 (46%), Gaps = 26/186 (14%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            N SG L   + +LP L  + +  N  SG +P     I +L +L L+ N      P  L++
Sbjct  152  NFSGPLPLGLAKLPHLRYIHLGGNFFSGEIPESYGGIGSLEYLGLNGNGLSGRVPVSLSR  211

Query  266  LANLQ-------------------------VLDLYNNNLTGDLPVEVYKMTSLRHLHLGG  370
            L NL+                          LD+ N NLTG +P  + ++  L  L L  
Sbjct  212  LTNLREMYIGYYSMYEGGIPPEFGMLTSLVRLDMANCNLTGRIPASLGQLKLLDSLFLQW  271

Query  371  NYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
            N+ +G IPPE G    LE L +S N L+G +P     L +LK L + + N F G IPP +
Sbjct  272  NHLAGSIPPELGGLDLLESLDLSINELTGELPESFAELKQLKLLNL-FRNHFRGHIPPFI  330

Query  551  GNLSQL  568
             +L  L
Sbjct  331  ADLPNL  336



>ref|XP_002297907.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE82712.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=988

 Score =   187 bits (476),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/196 (48%), Positives = 123/196 (63%), Gaps = 1/196 (1%)
 Frame = +2

Query  20   CTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAI  196
            C+W  + CD +   V        N+SG LSP + +L  LVNLSI  N  S   P EI  +
Sbjct  66   CSWTGIQCDDMNRSVVALDISNSNISGTLSPAITELRSLVNLSIQGNSFSDEFPREIHKL  125

Query  197  STLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNY  376
              L+FLN+SNN+F      + +QL  LQVLD+YNNN  G LP+ V ++  L++L  GGNY
Sbjct  126  IRLQFLNISNNLFSGELAWEFSQLKELQVLDVYNNNFNGTLPLGVTQLAKLKYLDFGGNY  185

Query  377  FSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  556
            F G IPP YG    L YL++ GN L G+IP E+GNLT L++LY+GY+N F GGIPPE G 
Sbjct  186  FQGTIPPSYGSMQQLNYLSLKGNDLRGLIPGELGNLTSLEQLYLGYYNEFDGGIPPEFGK  245

Query  557  LSQLIRXDAANCGLTG  604
            L  L+  D ANC L+G
Sbjct  246  LINLVHIDLANCSLSG  261


 Score = 92.0 bits (227),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 87/159 (55%), Gaps = 3/159 (2%)
 Frame = +2

Query  89   LSGVLSPDVGQLPF-LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            LSG +   + + P  L  +++A N+LSGP+P  I   S L+ L LS N F    P Q+ Q
Sbjct  451  LSGQVPQQISKTPSKLAQMNLADNRLSGPLPASIGNFSNLQILLLSGNRFTGEIPSQIGQ  510

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L N+  LD+  NNL+G++P E+    +L +L L  N  SG IP +  +   L YL +S N
Sbjct  511  LNNVFTLDMSRNNLSGNIPPEIGDCRTLTYLDLSQNQLSGPIPVQITQIHILNYLNISWN  570

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLS  562
             L+  +P EIG++  L      + N FSG I PE G  S
Sbjct  571  HLNQSLPKEIGSMKSLTSADFSH-NNFSGSI-PEFGQYS  607


 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 83/154 (54%), Gaps = 1/154 (1%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
              G + P+ G+L  LV++ +A   LSGP+PPE+  +S L  L L  N      P +L  L
Sbjct  235  FDGGIPPEFGKLINLVHIDLANCSLSGPIPPELGGLSKLDTLFLQTNELTGPIPPELGNL  294

Query  269  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  448
            +++  LDL NN LTGD+P+E Y +  L  L+L  N   G IP      P LE L +  N 
Sbjct  295  SSIISLDLSNNALTGDIPLEFYGLRRLTLLNLFLNKLHGEIPYFIAELPELEVLKLWHNN  354

Query  449  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  550
             +G IP+++G   +L EL +   N  +G +P  +
Sbjct  355  FTGAIPAKLGENGRLTELDLSS-NKLTGLVPKSL  387


 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 58/173 (34%), Positives = 93/173 (54%), Gaps = 1/173 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            +LSG + P++G L  L  L +  N+L+GP+PPE+  +S++  L+LSNN      P +   
Sbjct  258  SLSGPIPPELGGLSKLDTLFLQTNELTGPIPPELGNLSSIISLDLSNNALTGDIPLEFYG  317

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L  L +L+L+ N L G++P  + ++  L  L L  N F+G IP + G    L  L +S N
Sbjct  318  LRRLTLLNLFLNKLHGEIPYFIAELPELEVLKLWHNNFTGAIPAKLGENGRLTELDLSSN  377

Query  446  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             L+G++P  +    KL ++ I   N   G +P ++G+   L R       LTG
Sbjct  378  KLTGLVPKSLCLGRKL-QILILRINFLFGPLPDDLGHCDTLWRVRLGQNYLTG  429


 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 81/156 (52%), Gaps = 2/156 (1%)
 Frame = +2

Query  140  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  319
            L +  N L GP+P ++    TL  + L  N    + P     L  L +++L NN L+G +
Sbjct  396  LILRINFLFGPLPDDLGHCDTLWRVRLGQNYLTGSIPSGFLYLPELSLMELQNNYLSGQV  455

Query  320  PVEVYKMTS-LRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLK  496
            P ++ K  S L  ++L  N  SG +P   G F NL+ L +SGN  +G IPS+IG L  + 
Sbjct  456  PQQISKTPSKLAQMNLADNRLSGPLPASIGNFSNLQILLLSGNRFTGEIPSQIGQLNNVF  515

Query  497  ELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
             L +   N  SG IPPE+G+   L   D +   L+G
Sbjct  516  TLDMSR-NNLSGNIPPEIGDCRTLTYLDLSQNQLSG  550


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/174 (30%), Positives = 87/174 (50%), Gaps = 2/174 (1%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            N +G +   +G+   L  L +++N+L+G VP  +     L+ L L  N      P  L  
Sbjct  354  NFTGAIPAKLGENGRLTELDLSSNKLTGLVPKSLCLGRKLQILILRINFLFGPLPDDLGH  413

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPN-LEYLAVSG  442
               L  + L  N LTG +P     +  L  + L  NY SG++P +  + P+ L  + ++ 
Sbjct  414  CDTLWRVRLGQNYLTGSIPSGFLYLPELSLMELQNNYLSGQVPQQISKTPSKLAQMNLAD  473

Query  443  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRXDAANCGLTG  604
            N LSG +P+ IGN + L+ L +   N F+G IP ++G L+ +   D +   L+G
Sbjct  474  NRLSGPLPASIGNFSNLQILLLSG-NRFTGEIPSQIGQLNNVFTLDMSRNNLSG  526


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 62/196 (32%), Positives = 91/196 (46%), Gaps = 24/196 (12%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  265
              G + P  G +  L  LS+  N L G +P E+  +++L  L L   N F    P +  +
Sbjct  186  FQGTIPPSYGSMQQLNYLSLKGNDLRGLIPGELGNLTSLEQLYLGYYNEFDGGIPPEFGK  245

Query  266  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  445
            L NL  +DL N +L+G +P E+  ++ L  L L  N  +G IPPE G   ++  L +S N
Sbjct  246  LINLVHIDLANCSLSGPIPPELGGLSKLDTLFLQTNELTGPIPPELGNLSSIISLDLSNN  305

Query  446  GLSGVIPSEIGNLTKLKEL---------YIGYF--------------NGFSGGIPPEMGN  556
             L+G IP E   L +L  L          I YF              N F+G IP ++G 
Sbjct  306  ALTGDIPLEFYGLRRLTLLNLFLNKLHGEIPYFIAELPELEVLKLWHNNFTGAIPAKLGE  365

Query  557  LSQLIRXDAANCGLTG  604
              +L   D ++  LTG
Sbjct  366  NGRLTELDLSSNKLTG  381


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 56/209 (27%), Positives = 92/209 (44%), Gaps = 50/209 (24%)
 Frame = +2

Query  89   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  268
            L+G + P++G L  +++L ++ N L+G +P E   +  L  LNL  N      P+ +A+L
Sbjct  283  LTGPIPPELGNLSSIISLDLSNNALTGDIPLEFYGLRRLTLLNLFLNKLHGEIPYFIAEL  342

Query  269  ANLQVLDLYNNNLTGDLPVEV-------------YKMT----------------------  343
              L+VL L++NN TG +P ++              K+T                      
Sbjct  343  PELEVLKLWHNNFTGAIPAKLGENGRLTELDLSSNKLTGLVPKSLCLGRKLQILILRINF  402

Query  344  -------------SLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNL  484
                         +L  + LG NY +G IP  +   P L  + +  N LSG +P +I   
Sbjct  403  LFGPLPDDLGHCDTLWRVRLGQNYLTGSIPSGFLYLPELSLMELQNNYLSGQVPQQISKT  462

Query  485  -TKLKELYIGYFNGFSGGIPPEMGNLSQL  568
             +KL ++ +   N  SG +P  +GN S L
Sbjct  463  PSKLAQMNLAD-NRLSGPLPASIGNFSNL  490


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +2

Query  86   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  265
            NLSG + P++G    L  L ++ NQLSGP+P +I+ I  L +LN+S N    + P ++  
Sbjct  523  NLSGNIPPEIGDCRTLTYLDLSQNQLSGPIPVQITQIHILNYLNISWNHLNQSLPKEIGS  582

Query  266  LANLQVLDLYNNNLTGDLP  322
            + +L   D  +NN +G +P
Sbjct  583  MKSLTSADFSHNNFSGSIP  601



>ref|XP_001752668.1| CLL1B clavata1-like receptor S/T protein kinase protein [Physcomitrella 
patens]
 gb|EDQ82539.1| CLL1B clavata1-like receptor S/T protein kinase protein [Physcomitrella 
patens]
Length=992

 Score =   187 bits (476),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 137/201 (68%), Gaps = 0/201 (0%)
 Frame = +2

Query  2    NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPP  181
            N + + C W  +TC +   VV L+LS +NL+G L  D+G+L  LVN+S+  N  +G +P 
Sbjct  36   NGTATPCLWTGITCSNASSVVGLNLSNMNLTGTLPADLGRLKNLVNISLDLNNFTGVLPA  95

Query  182  EISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLH  361
            EI  +  L+++N+SNN F   FP  +++L +L+VLD +NN+ +G LP +++ + +L HL 
Sbjct  96   EIVTLLMLQYVNISNNRFNGAFPANVSRLQSLKVLDCFNNDFSGSLPDDLWIIATLEHLS  155

Query  362  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  541
            LGGNYF G IP +YG FP L+Y