BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS063F02

Length=582
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009592687.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    212   2e-60   Nicotiana tomentosiformis
ref|XP_009592686.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    212   2e-60   Nicotiana tomentosiformis
gb|AIM41270.1|  chloroplast ATP-dependent Clp protease chaperone ...    209   3e-59   Nicotiana benthamiana
gb|AIM41271.1|  chloroplast ATP-dependent Clp protease chaperone ...    209   4e-59   Nicotiana benthamiana
ref|XP_009769540.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    207   9e-59   Nicotiana sylvestris
ref|XP_009615664.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    207   9e-59   Nicotiana tomentosiformis
ref|XP_009798134.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    207   1e-58   Nicotiana sylvestris
gb|AIM41268.1|  chloroplast ATP-dependent Clp protease chaperone ...    206   3e-58   Nicotiana benthamiana
ref|XP_004252280.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    204   2e-57   
ref|XP_006346636.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    204   2e-57   Solanum tuberosum [potatoes]
sp|P31542.1|CLPAB_SOLLC  RecName: Full=ATP-dependent Clp protease...    202   6e-57   Solanum lycopersicum
ref|XP_004297496.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    197   4e-55   Fragaria vesca subsp. vesca
ref|XP_004171086.1|  PREDICTED: chaperone protein ClpC, chloropla...    192   7e-55   
gb|AIM41269.1|  chloroplast ATP-dependent Clp protease chaperone ...    197   9e-55   Nicotiana benthamiana
ref|XP_008464372.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    195   3e-54   Cucumis melo [Oriental melon]
gb|ADN33858.1|  ATP-dependent clp protease                              195   3e-54   Cucumis melo subsp. melo
ref|XP_010099042.1|  Chaperone protein ClpC                             191   9e-54   
ref|XP_004138021.1|  PREDICTED: chaperone protein ClpC, chloropla...    192   4e-53   
emb|CBI15747.3|  unnamed protein product                                190   8e-53   Vitis vinifera
ref|XP_008239551.1|  PREDICTED: chaperone protein ClpC, chloropla...    191   8e-53   Prunus mume [ume]
emb|CDO98310.1|  unnamed protein product                                190   2e-52   Coffea canephora [robusta coffee]
ref|XP_007210385.1|  hypothetical protein PRUPE_ppa001062mg             190   3e-52   Prunus persica
ref|XP_004235839.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    189   8e-52   
sp|P31541.1|CLPAA_SOLLC  RecName: Full=ATP-dependent Clp protease...    188   9e-52   Solanum lycopersicum
ref|XP_010663794.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    188   1e-51   Vitis vinifera
ref|XP_006341485.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    187   2e-51   Solanum tuberosum [potatoes]
gb|KDP22549.1|  hypothetical protein JCGZ_26380                         186   8e-51   Jatropha curcas
gb|KHG07735.1|  Chaperone ClpC, chloroplastic                           185   2e-50   Gossypium arboreum [tree cotton]
gb|KJB19711.1|  hypothetical protein B456_003G116200                    183   3e-50   Gossypium raimondii
ref|XP_008457503.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    183   6e-50   Cucumis melo [Oriental melon]
gb|KJB19712.1|  hypothetical protein B456_003G116200                    183   1e-49   Gossypium raimondii
gb|KJB19710.1|  hypothetical protein B456_003G116200                    182   1e-49   Gossypium raimondii
ref|XP_007038115.1|  CLPC                                               182   1e-49   
gb|EPS63111.1|  hypothetical protein M569_11677                         171   1e-49   Genlisea aurea
ref|XP_004152900.1|  PREDICTED: chaperone protein ClpC, chloropla...    182   2e-49   Cucumis sativus [cucumbers]
ref|XP_002511102.1|  ATP-dependent clp protease, putative               182   2e-49   Ricinus communis
gb|AAD02267.1|  ClpC protease                                           181   3e-49   Spinacia oleracea
ref|XP_006367832.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    179   2e-48   Solanum tuberosum [potatoes]
ref|XP_010678345.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    179   3e-48   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB07945.1|  hypothetical protein B456_001G054700                    179   3e-48   Gossypium raimondii
gb|KCW48520.1|  hypothetical protein EUGRSUZ_K02198                     175   5e-48   Eucalyptus grandis [rose gum]
gb|KEH35688.1|  ATP-dependent Clp protease ATP-binding subunit          177   7e-48   Medicago truncatula
ref|XP_010036860.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    175   7e-47   Eucalyptus grandis [rose gum]
ref|XP_010036862.1|  PREDICTED: chaperone protein ClpC, chloropla...    175   8e-47   Eucalyptus grandis [rose gum]
gb|EYU24516.1|  hypothetical protein MIMGU_mgv1a0010411mg               169   1e-46   Erythranthe guttata [common monkey flower]
ref|XP_003526929.1|  PREDICTED: chaperone protein ClpC, chloropla...    173   2e-46   Glycine max [soybeans]
ref|XP_007159971.1|  hypothetical protein PHAVU_002G282500g             173   3e-46   Phaseolus vulgaris [French bean]
ref|XP_004501745.1|  PREDICTED: chaperone protein ClpC, chloropla...    173   3e-46   Cicer arietinum [garbanzo]
ref|XP_010249192.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    173   3e-46   Nelumbo nucifera [Indian lotus]
sp|P35100.1|CLPC_PEA  RecName: Full=Chaperone protein ClpC, chlor...    172   6e-46   Pisum sativum [garden pea]
gb|KHN31263.1|  Chaperone protein ClpC, chloroplastic                   172   6e-46   Glycine soja [wild soybean]
ref|XP_002322299.1|  ATP-dependent clp protease ATP-binding subun...    172   7e-46   
ref|XP_003523172.1|  PREDICTED: chaperone protein ClpC, chloropla...    172   8e-46   Glycine max [soybeans]
ref|XP_009368798.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    171   2e-45   Pyrus x bretschneideri [bai li]
ref|XP_008778670.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    160   2e-45   Phoenix dactylifera
ref|XP_008374277.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    171   2e-45   
ref|XP_009337515.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    170   3e-45   Pyrus x bretschneideri [bai li]
ref|XP_006376920.1|  hypothetical protein POPTR_0012s10770g             170   3e-45   
ref|XP_003630582.1|  ATP-dependent Clp protease ATP-binding subun...    170   4e-45   Medicago truncatula
ref|XP_011042955.1|  PREDICTED: chaperone protein ClpC, chloropla...    170   4e-45   Populus euphratica
ref|XP_010519480.1|  PREDICTED: chaperone protein ClpC1, chloropl...    168   1e-44   Tarenaya hassleriana [spider flower]
ref|XP_007137864.1|  hypothetical protein PHAVU_009G162100g             168   2e-44   Phaseolus vulgaris [French bean]
ref|XP_010250552.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    168   2e-44   Nelumbo nucifera [Indian lotus]
ref|XP_006402040.1|  hypothetical protein EUTSA_v10012603mg             167   3e-44   Eutrema salsugineum [saltwater cress]
ref|NP_568746.1|  ATP-dependent Clp protease ATP-binding subunit ...    167   4e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008392716.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    167   4e-44   Malus domestica [apple tree]
ref|XP_010250553.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    166   9e-44   Nelumbo nucifera [Indian lotus]
ref|XP_002865831.1|  heat shock protein 93-V                            166   1e-43   
gb|KEH35794.1|  ATP-dependent Clp protease ATP-binding subunit          166   2e-43   Medicago truncatula
ref|XP_011040255.1|  PREDICTED: chaperone protein ClpC, chloropla...    165   2e-43   Populus euphratica
ref|XP_003525431.1|  PREDICTED: chaperone protein ClpC, chloropla...    165   2e-43   Glycine max [soybeans]
ref|XP_006279971.1|  hypothetical protein CARUB_v10025837mg             164   6e-43   Capsella rubella
ref|XP_010942381.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    163   1e-42   Elaeis guineensis
gb|AAC04687.1|  ClpC                                                    162   2e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010550758.1|  PREDICTED: chaperone protein ClpC1, chloropl...    162   2e-42   Tarenaya hassleriana [spider flower]
ref|XP_011083076.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    162   2e-42   
ref|XP_010442575.1|  PREDICTED: chaperone protein ClpC1, chloropl...    162   2e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010482409.1|  PREDICTED: chaperone protein ClpC1, chloropl...    162   2e-42   Camelina sativa [gold-of-pleasure]
emb|CDX83052.1|  BnaA01g20520D                                          162   2e-42   
ref|XP_009151567.1|  PREDICTED: chaperone protein ClpC2, chloropl...    162   3e-42   Brassica rapa
ref|XP_010442573.1|  PREDICTED: chaperone protein ClpC1, chloropl...    161   5e-42   
ref|XP_010555578.1|  PREDICTED: chaperone protein ClpC1, chloropl...    161   5e-42   Tarenaya hassleriana [spider flower]
ref|XP_010536587.1|  PREDICTED: chaperone protein ClpC1, chloropl...    160   9e-42   Tarenaya hassleriana [spider flower]
ref|XP_010536586.1|  PREDICTED: chaperone protein ClpC1, chloropl...    160   1e-41   Tarenaya hassleriana [spider flower]
ref|XP_004503801.1|  PREDICTED: chaperone protein ClpC, chloropla...    159   2e-41   Cicer arietinum [garbanzo]
ref|XP_010426385.1|  PREDICTED: chaperone protein ClpC2, chloropl...    159   3e-41   Camelina sativa [gold-of-pleasure]
gb|EYU21822.1|  hypothetical protein MIMGU_mgv1a000973mg                159   3e-41   Erythranthe guttata [common monkey flower]
ref|XP_002877635.1|  AtClpC                                             159   4e-41   
ref|XP_006290258.1|  hypothetical protein CARUB_v10016640mg             157   5e-41   
ref|XP_003532383.1|  PREDICTED: chaperone protein ClpC, chloropla...    158   5e-41   Glycine max [soybeans]
gb|KHN16879.1|  Chaperone protein ClpC, chloroplastic                   158   6e-41   Glycine soja [wild soybean]
emb|CDX68504.1|  BnaC01g25820D                                          158   8e-41   
ref|XP_011073186.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    157   9e-41   Sesamum indicum [beniseed]
ref|XP_008791045.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    157   1e-40   Phoenix dactylifera
ref|XP_006290259.1|  hypothetical protein CARUB_v10016640mg             157   1e-40   
ref|XP_010503529.1|  PREDICTED: chaperone protein ClpC2, chloropl...    157   2e-40   Camelina sativa [gold-of-pleasure]
ref|XP_009132682.1|  PREDICTED: chaperone protein ClpC1, chloropl...    156   2e-40   Brassica rapa
emb|CDY45800.1|  BnaC03g16230D                                          156   3e-40   Brassica napus [oilseed rape]
ref|XP_010515218.1|  PREDICTED: chaperone protein ClpC2, chloropl...    155   8e-40   Camelina sativa [gold-of-pleasure]
ref|XP_008811697.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    155   1e-39   Phoenix dactylifera
ref|XP_009149790.1|  PREDICTED: LOW QUALITY PROTEIN: chaperone pr...    154   2e-39   
ref|XP_006485108.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    154   2e-39   Citrus sinensis [apfelsine]
ref|XP_009403788.1|  PREDICTED: chaperone protein ClpC1, chloropl...    153   4e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009393873.1|  PREDICTED: chaperone protein ClpC1, chloropl...    152   6e-39   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAL10478.1|  AT3g48870/T21J18_140                                    150   8e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009387981.1|  PREDICTED: chaperone protein ClpC1, chloropl...    152   8e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010929657.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    151   2e-38   Elaeis guineensis
ref|NP_001190035.1|  Clp ATPase                                         150   4e-38   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566912.2|  Clp ATPase                                            150   6e-38   Arabidopsis thaliana [mouse-ear cress]
emb|CAB87915.1|  AtClpC                                                 150   6e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006404210.1|  hypothetical protein EUTSA_v10010105mg             150   6e-38   Eutrema salsugineum [saltwater cress]
tpg|DAA38057.1|  TPA: hypothetical protein ZEAMMB73_563254              138   5e-37   
ref|XP_009411804.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    147   6e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010921845.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    146   8e-37   Elaeis guineensis
ref|XP_009404743.1|  PREDICTED: chaperone protein ClpC1, chloropl...    146   8e-37   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY05878.1|  BnaC08g20550D                                          145   3e-36   
ref|XP_003575035.1|  PREDICTED: chaperone protein ClpC1, chloropl...    141   6e-35   Brachypodium distachyon [annual false brome]
sp|P46523.1|CLPA_BRANA  RecName: Full=ATP-dependent Clp protease ...    141   6e-35   Brassica napus [oilseed rape]
gb|EMS54417.1|  ATP-dependent Clp protease ATP-binding subunit cl...    137   7e-35   Triticum urartu
ref|XP_003575034.2|  PREDICTED: chaperone protein ClpC1, chloropl...    141   7e-35   Brachypodium distachyon [annual false brome]
emb|CAN78847.1|  hypothetical protein VITISV_010724                     140   1e-34   Vitis vinifera
gb|EMT20100.1|  ATP-dependent Clp protease ATP-binding subunit cl...    135   8e-34   
gb|EMS48250.1|  ATP-dependent Clp protease ATP-binding subunit cl...    131   9e-34   Triticum urartu
ref|XP_004975455.1|  PREDICTED: chaperone protein ClpC1, chloropl...    137   1e-33   Setaria italica
ref|XP_004975454.1|  PREDICTED: chaperone protein ClpC1, chloropl...    137   1e-33   Setaria italica
gb|EMS46268.1|  ATP-dependent Clp protease ATP-binding subunit cl...    137   1e-33   Triticum urartu
ref|XP_008663153.1|  PREDICTED: chaperone protein ClpC1, chloropl...    137   1e-33   Zea mays [maize]
ref|XP_001690745.1|  hypothetical protein CHLREDRAFT_110360             125   2e-33   Chlamydomonas reinhardtii
gb|KGN63436.1|  hypothetical protein Csa_1G000600                       136   4e-33   Cucumis sativus [cucumbers]
ref|XP_002447724.1|  hypothetical protein SORBIDRAFT_06g014590          135   6e-33   Sorghum bicolor [broomcorn]
gb|EEC77204.1|  hypothetical protein OsI_15716                          134   8e-33   Oryza sativa Indica Group [Indian rice]
sp|Q7F9I1.2|CLPC1_ORYSJ  RecName: Full=Chaperone protein ClpC1, c...    135   1e-32   Oryza sativa Japonica Group [Japonica rice]
emb|CAE05148.2|  OSJNBa0039C07.4                                        134   1e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006652229.1|  PREDICTED: chaperone protein ClpC1, chloropl...    134   2e-32   
ref|WP_032558761.1|  hypothetical protein                               123   2e-32   
ref|WP_032554674.1|  hypothetical protein                               123   2e-32   
gb|EAZ30583.1|  hypothetical protein OsJ_14634                          134   2e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010238595.1|  PREDICTED: chaperone protein ClpC2, chloropl...    134   3e-32   Brachypodium distachyon [annual false brome]
ref|WP_032553896.1|  hypothetical protein                               124   3e-32   
dbj|BAJ99801.1|  predicted protein                                      133   5e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006663917.1|  PREDICTED: chaperone protein ClpC2, chloropl...    132   6e-32   Oryza brachyantha
ref|XP_001756645.1|  predicted protein                                  132   1e-31   
ref|XP_001779162.1|  predicted protein                                  132   1e-31   
ref|XP_004960741.1|  PREDICTED: chaperone protein ClpC2, chloropl...    132   1e-31   Setaria italica
ref|NP_001169540.1|  uncharacterized protein LOC100383416               131   2e-31   Zea mays [maize]
gb|KIY94281.1|  ATP-dependent Clp protease ATP-binding subunit ClpC     126   2e-31   Monoraphidium neglectum
gb|EDZ93048.1|  Clp domain protein                                      127   5e-31   Arthrospira maxima CS-328
ref|NP_001066442.1|  Os12g0230100                                       130   5e-31   
gb|AAB67745.1|  ClpC                                                    128   1e-30   Synechococcus elongatus PCC 7942
ref|XP_002952540.1|  hypothetical protein VOLCADRAFT_75431              129   1e-30   Volvox carteri f. nagariensis
ref|XP_002977161.1|  hypothetical protein SELMODRAFT_176012             128   2e-30   
dbj|BAB74698.1|  endopeptidase Clp ATP-binding chain                    128   2e-30   Nostoc sp. PCC 7120
ref|XP_010446016.1|  PREDICTED: chaperone protein ClpC1, chloropl...    126   2e-30   
gb|EEC69045.1|  hypothetical protein OsI_37876                          129   2e-30   Oryza sativa Indica Group [Indian rice]
gb|AFW96628.1|  ATP-dependent Clp family protein                        128   2e-30   Anabaena sp. 90
gb|AFY46028.1|  ATPase with chaperone activity, ATP-binding subunit     128   2e-30   Nostoc sp. PCC 7524
gb|EHC12174.1|  ATPase AAA-2 domain protein                             128   2e-30   Fischerella thermalis
gb|KIZ07494.1|  ATP-dependent Clp protease ATP-binding subunit ClpC     128   3e-30   Monoraphidium neglectum
ref|XP_006374569.1|  hypothetical protein POPTR_0015s11640g             127   3e-30   
gb|ABK95905.1|  unknown                                                 127   3e-30   Populus trichocarpa [western balsam poplar]
ref|WP_044105586.1|  Clp protease ClpX                                  127   3e-30   cyanobacterium endosymbiont of Epithemia turgida
emb|CDX84888.1|  BnaA03g13420D                                          127   4e-30   
ref|WP_015162264.1|  ATPase with chaperone activity, ATP-binding ...    127   4e-30   Chamaesiphon minutus
ref|WP_039899756.1|  Clp protease ClpX                                  127   4e-30   Microcystis sp. T1-4
ref|WP_011364587.1|  ATP-dependent Clp protease ATP-binding protein     127   4e-30   Synechococcus sp. CC9605
ref|WP_012162462.1|  ATP-dependent Clp protease ATP-binding protein     127   5e-30   Acaryochloris marina
ref|WP_038554285.1|  Clp protease ClpX                                  127   5e-30   Synechococcus sp. KORDI-52
ref|WP_010467511.1|  ATP-dependent Clp protease ATP-binding protein     127   5e-30   Acaryochloris sp. CCMEE 5410
ref|WP_041428551.1|  Clp protease ClpX                                  127   5e-30   Synechococcus sp. WH 7803
ref|WP_038544339.1|  Clp protease ClpX                                  127   5e-30   Synechococcus sp. KORDI-100
gb|AHF63374.1|  ATPase                                                  127   5e-30   Synechococcus sp. WH 8109
ref|WP_006170858.1|  ATP-dependent Clp protease ATP-binding protein     127   5e-30   Synechococcus sp. WH 5701
ref|WP_028951828.1|  Clp protease ClpX                                  127   5e-30   Synechococcus sp. CC9616
ref|WP_006852318.1|  ATP-dependent Clp protease ATP-binding protein     127   5e-30   Synechococcus sp. WH 8016
ref|WP_007100194.1|  ATP-dependent Clp protease ATP-binding protein     127   5e-30   Synechococcus sp. RS9917
ref|WP_015107874.1|  chaperone ATPase                                   127   5e-30   Cyanobium gracile
ref|WP_011127803.1|  ATP-dependent Clp protease ATP-binding protein     127   5e-30   Synechococcus
ref|XP_002965312.1|  hypothetical protein SELMODRAFT_439163             127   5e-30   Selaginella moellendorffii
ref|WP_044521582.1|  Clp protease ClpX                                  127   5e-30   Nostocaceae
ref|WP_002765002.1|  ATP-dependent Clp protease ATP-binding protein     127   5e-30   Microcystis aeruginosa
ref|WP_004160623.1|  ATP-dependent Clp protease ATP-binding subun...    127   5e-30   Microcystis
ref|WP_010303504.1|  ATP-dependent Clp protease ATP-binding protein     127   5e-30   Synechococcus sp. CB0101
ref|WP_011317764.1|  ATP-dependent Clp protease ATP-binding protein     127   5e-30   Trichormus variabilis
ref|WP_006041704.1|  ATP-dependent Clp protease ATP-binding protein     127   5e-30   Synechococcus sp. WH 7805
ref|WP_002777520.1|  ATP-dependent Clp protease ATP-binding protein     127   6e-30   Microcystis aeruginosa
ref|WP_002732350.1|  ATP-dependent Clp protease ATP-binding protein     127   6e-30   Microcystis aeruginosa
ref|WP_039726508.1|  MULTISPECIES: Clp protease ClpX                    127   6e-30   Lyngbya confervoides
ref|WP_043691512.1|  Clp protease ClpX                                  127   6e-30   Synechococcus sp. KORDI-49
ref|WP_008226206.1|  ATP-dependent Clp protease, ATP-binding subu...    127   6e-30   Richelia intracellularis
ref|WP_007098208.1|  ATP-dependent Clp protease ATP-binding protein     127   6e-30   Synechococcus sp. RS9916
ref|WP_006910091.1|  ATP-dependent Clp protease ATP-binding protein     127   6e-30   Cyanobium sp. PCC 7001
ref|NP_050661.1|  Clp protease ATP binding subunit                      127   6e-30   Guillardia theta
ref|WP_041555480.1|  Clp protease ClpX                                  127   6e-30   Nostoc sp. PCC 7524
ref|WP_015111477.1|  ATPase                                             127   6e-30   Nostoc sp. PCC 7107
ref|WP_004158851.1|  ATP-dependent Clp protease ATP-binding protein     127   6e-30   Microcystis aeruginosa
ref|WP_029638478.1|  Clp protease ClpX [                                127   6e-30   [Scytonema hofmanni] UTEX B 1581
ref|WP_008231833.1|  ATP-dependent Clp protease, ATP-binding subu...    127   6e-30   Richelia intracellularis
ref|YP_001293474.1|  Clp protease ATP binding subunit                   127   6e-30   Rhodomonas salina
ref|WP_011377512.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    127   6e-30   Synechococcus
ref|WP_039740335.1|  Clp protease ClpX                                  127   6e-30   
ref|WP_006454749.1|  ATP-dependent Clp protease ATP-binding protein     127   6e-30   Synechococcus sp. PCC 7335
ref|WP_015216290.1|  ATPase AAA-2 domain protein                        127   6e-30   Anabaena cylindrica
ref|WP_041035515.1|  Clp protease ClpX                                  127   6e-30   Tolypothrix campylonemoides
ref|WP_023174246.1|  ATPase AAA-2 domain protein                        127   6e-30   Gloeobacter kilaueensis
ref|WP_015128787.1|  ATPase                                             127   6e-30   Calothrix sp. PCC 7507
ref|WP_019498394.1|  ATP-dependent Clp protease ATP-binding protein     127   6e-30   Pseudanabaena sp. PCC 6802
ref|WP_006198453.1|  ATP-dependent Clp protease ATP-binding protein     127   6e-30   Nodularia spumigena
ref|WP_027250152.1|  Clp protease ClpX                                  127   6e-30   Planktothrix agardhii
ref|WP_026785489.1|  MULTISPECIES: Clp protease ClpX                    127   6e-30   Planktothrix
ref|WP_012630051.1|  ATP-dependent Clp protease ATP-binding protein     127   6e-30   Cyanothece sp. PCC 7425
ref|WP_013192942.1|  ATP-dependent Clp protease ATP-binding protein     126   6e-30   Trichormus azollae
ref|WP_042153862.1|  Clp protease ClpX                                  126   6e-30   Planktothrix agardhii
ref|WP_026795885.1|  MULTISPECIES: Clp protease ClpX                    126   6e-30   Planktothrix
ref|WP_015189078.1|  ATPase AAA-2 domain protein                        126   6e-30   Gloeocapsa sp. PCC 7428
ref|WP_011618961.1|  ATP-dependent Clp protease ATP-binding protein     127   6e-30   Synechococcus sp. CC9311
ref|WP_011935205.1|  ATP-dependent Clp protease ATP-binding protein     127   6e-30   Synechococcus sp. RCC307
ref|WP_026097796.1|  Clp protease ClpX                                  126   7e-30   Geitlerinema sp. PCC 7105
ref|WP_017318713.1|  ATP-dependent Clp protease ATP-binding protein     126   7e-30   Mastigocladopsis repens
ref|WP_027404746.1|  Clp protease ClpX                                  126   7e-30   Aphanizomenon flos-aquae
ref|WP_017741509.1|  ATP-dependent Clp protease ATP-binding protein     126   7e-30   Scytonema hofmannii
dbj|BAD79443.1|  ATP-dependent Clp protease regulatory subunit ClpC     127   7e-30   Synechococcus elongatus PCC 6301
gb|AGW80480.1|  Clp protease ATP binding subunit                        126   7e-30   Planktothrix agardhii NIVA-CYA 68
ref|WP_041458572.1|  Clp protease ClpX                                  126   7e-30   Anabaena sp. 90
ref|WP_036485541.1|  Clp protease ClpX                                  126   7e-30   Myxosarcina sp. GI1
ref|WP_012412218.1|  ATP-dependent Clp protease ATP-binding protein     126   7e-30   Nostoc punctiforme
ref|WP_039200429.1|  Clp protease ClpX                                  126   7e-30   Aphanizomenon flos-aquae
ref|WP_017717294.1|  ATP-dependent Clp protease ATP-binding protein     126   7e-30   Oscillatoria sp. PCC 10802
ref|XP_007509860.1|  predicted protein                                  127   7e-30   Bathycoccus prasinos
ref|WP_040939432.1|  Clp protease ClpX                                  126   7e-30   
ref|WP_022603946.1|  ATPase with chaperone activity, ATP-binding ...    126   7e-30   Rubidibacter lacunae
ref|WP_015117004.1|  chaperone ATPase                                   126   7e-30   Rivularia sp. PCC 7116
ref|WP_008312190.1|  ATPase with chaperone activity, ATP-binding ...    126   7e-30   Leptolyngbya sp. PCC 6406
ref|WP_011612018.1|  ATP-dependent Clp protease ATP-binding protein     126   7e-30   Trichodesmium erythraeum
ref|WP_027842712.1|  Clp protease ClpX                                  126   7e-30   Mastigocoleus testarum
ref|WP_023074118.1|  atp-dependent clp protease atp-binding protein     126   7e-30   Leptolyngbya sp. Heron Island J
ref|WP_011142062.1|  ATP-dependent Clp protease ATP-binding protein     126   7e-30   Gloeobacter violaceus
ref|WP_028090149.1|  Clp protease ClpX                                  126   7e-30   Dolichospermum circinale
ref|WP_016952177.1|  ATP-dependent Clp protease ATP-binding protein     126   7e-30   Anabaena sp. PCC 7108
ref|WP_035989117.1|  Clp protease ClpX                                  126   7e-30   Leptolyngbya sp. KIOST-1
ref|WP_015170572.1|  ATPase                                             126   7e-30   Geitlerinema sp. PCC 7407
gb|KIE07407.1|  Clp protease ClpX                                       126   7e-30   Tolypothrix bouteillei VB521301
ref|WP_028082153.1|  Clp protease ClpX                                  126   7e-30   Dolichospermum circinale
ref|WP_015166218.1|  ATPase                                             126   7e-30   Pseudanabaena sp. PCC 7367
ref|WP_017712666.1|  ATP-dependent Clp protease ATP-binding protein     126   7e-30   Prochlorothrix hollandica
ref|WP_017300481.1|  ATP-dependent Clp protease ATP-binding protein     126   7e-30   Nodosilinea nodulosa
gb|KIJ80614.1|  Clp protease ClpX                                       126   7e-30   Scytonema tolypothrichoides VB-61278
ref|WP_019504000.1|  ATP-dependent Clp protease ATP-binding protein     126   7e-30   Pleurocapsa sp. PCC 7319
ref|WP_006518530.1|  ATPase with chaperone activity, ATP-binding ...    126   7e-30   Leptolyngbya sp. PCC 7375
ref|WP_017324677.1|  ATP-dependent Clp protease ATP-binding protein     126   7e-30   Synechococcus sp. PCC 7336
ref|WP_015191669.1|  ATPase AAA-2 domain protein                        126   7e-30   Stanieria cyanosphaera
ref|WP_012594749.1|  ATP-dependent Clp protease ATP-binding protein     126   7e-30   Cyanothece sp. PCC 8801
ref|WP_019491687.1|  ATP-dependent Clp protease ATP-binding protein     126   7e-30   Calothrix sp. PCC 7103
ref|WP_007353377.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    126   7e-30   Kamptonema
ref|WP_009626822.1|  ATPase AAA-2 domain protein                        126   7e-30   Pseudanabaena biceps
ref|WP_015783654.1|  ATP-dependent Clp protease ATP-binding protein     126   7e-30   Cyanothece sp. PCC 8802
ref|WP_037222416.1|  Clp protease ClpX                                  126   7e-30   
ref|WP_009555478.1|  ATPase with chaperone activity, ATP-binding ...    126   7e-30   Oscillatoriales cyanobacterium JSC-12
ref|WP_015201320.1|  ATPase                                             126   7e-30   Crinalium epipsammum
ref|WP_015126250.1|  chaperone ATPase                                   126   7e-30   Synechococcus sp. PCC 6312
ref|WP_017651562.1|  ATP-dependent Clp protease ATP-binding protein     126   7e-30   Fortiea contorta
ref|WP_017306413.1|  ATP-dependent Clp protease ATP-binding protein     126   7e-30   Spirulina subsalsa
ref|WP_007303900.1|  ATP-dependent Clp protease ATP-binding protein     126   7e-30   Crocosphaera watsonii
ref|WP_006102932.1|  ATP-dependent Clp protease ATP-binding protein     126   7e-30   Coleofasciculus chthonoplastes
ref|WP_009784332.1|  ATP-dependent Clp protease ATP-binding protein     126   7e-30   Lyngbya sp. PCC 8106
ref|WP_006277610.1|  ATP-dependent Clp protease ATP-binding protein     126   7e-30   Aphanizomenonaceae
ref|WP_017293405.1|  ATP-dependent Clp protease ATP-binding protein     126   7e-30   Geminocystis herdmanii
ref|WP_015166859.1|  chaperone ATPase                                   126   7e-30   Synechococcus sp. PCC 7502
ref|WP_009543682.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    126   8e-30   Cyanothece
ref|WP_015145231.1|  chaperone ATPase                                   126   8e-30   Pleurocapsa minor
ref|WP_036000319.1|  Clp protease ClpX                                  126   8e-30   [Leptolyngbya] sp. JSC-1
ref|WP_023066904.1|  istB-like ATP binding family protein               126   8e-30   Lyngbya aestuarii
ref|WP_008274497.1|  ATP-dependent Clp protease ATP-binding protein     126   8e-30   Cyanothece sp. CCY0110
ref|WP_006632591.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    126   8e-30   Oscillatoriales
ref|WP_006620698.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    126   8e-30   Arthrospira
ref|WP_017289117.1|  ATP-dependent Clp protease ATP-binding protein     126   8e-30   Leptolyngbya boryana
ref|WP_026734190.1|  Clp protease ClpX                                  126   8e-30   Fischerella sp. PCC 9605
ref|WP_021832536.1|  ATP-dependent Clp protease, ATP-binding subu...    126   8e-30   Crocosphaera watsonii
ref|WP_015227883.1|  chaperone ATPase                                   126   8e-30   Dactylococcopsis salina
ref|WP_015206692.1|  ATPase with chaperone activity, ATP-binding ...    126   8e-30   Cylindrospermum stagnale
ref|WP_015200797.1|  ATPase                                             126   8e-30   
ref|WP_012954277.1|  ATP-dependent Clp protease ATP-binding protein     126   8e-30   
ref|WP_009342297.1|  ATP-dependent Clp protease ATP-binding protein     126   8e-30   
ref|WP_040943370.1|  Clp protease ClpX                                  126   8e-30   
ref|WP_026086125.1|  Clp protease ClpX                                  126   8e-30   
ref|WP_006512495.1|  ATPase with chaperone activity, ATP-binding ...    126   8e-30   
ref|WP_011360176.1|  ATP-dependent Clp protease ATP-binding protein     126   8e-30   
ref|WP_013324812.1|  ATP-dependent Clp protease ATP-binding protein     126   8e-30   
ref|WP_035153450.1|  Clp protease ClpX                                  126   8e-30   
ref|WP_026086344.1|  MULTISPECIES: Clp protease ClpX                    126   8e-30   
ref|WP_015185589.1|  chaperone ATPase                                   126   8e-30   
ref|WP_009789541.1|  ATP-dependent Clp protease ATP-binding protein     126   8e-30   
ref|WP_017320177.1|  ATP-dependent Clp protease ATP-binding protein     126   8e-30   
ref|WP_008179937.1|  ATP-dependent Clp protease ATP-binding protein     126   8e-30   
ref|WP_006618428.1|  ATP-dependent Clp protease ATP-binding protein     126   8e-30   
ref|WP_018396432.1|  ATP-dependent Clp protease ATP-binding protein     126   9e-30   
ref|WP_040054326.1|  Clp protease ClpX                                  126   9e-30   
ref|WP_015225278.1|  ATPase                                             126   9e-30   
ref|WP_016879619.1|  ATP-dependent Clp protease ATP-binding protein     126   9e-30   
ref|WP_016863560.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    126   9e-30   
ref|WP_015219504.1|  ATPase                                             126   9e-30   
ref|WP_011432255.1|  ATP-dependent Clp protease ATP-binding protein     126   9e-30   
ref|WP_015147858.1|  chaperone ATPase                                   126   9e-30   
ref|WP_028949334.1|  Clp protease ClpX                                  126   9e-30   
ref|WP_010873410.1|  ATP-dependent Clp protease ATP-binding protein     126   9e-30   
ref|WP_012599251.1|  ATP-dependent Clp protease ATP-binding protein     126   9e-30   
ref|WP_026722984.1|  Clp protease ClpX                                  126   1e-29   
ref|WP_011824074.1|  ATP-dependent Clp protease ATP-binding protein     126   1e-29   
ref|WP_011429552.1|  ATP-dependent Clp protease ATP-binding protein     126   1e-29   
ref|WP_011294749.1|  ATP-dependent Clp protease ATP-binding protein     126   1e-29   
ref|WP_036906575.1|  Clp protease ClpX                                  126   1e-29   
ref|WP_038653496.1|  Clp protease ClpX                                  126   1e-29   
gb|EMT29575.1|  ATP-dependent Clp protease ATP-binding subunit cl...    126   1e-29   
ref|WP_036917931.1|  MULTISPECIES: Clp protease ClpX                    126   1e-29   
ref|XP_011401568.1|  ATP-dependent Clp protease ATP-binding subun...    126   1e-29   
ref|WP_036909986.1|  Clp protease ClpX                                  126   1e-29   
ref|WP_011125259.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    126   1e-29   
ref|WP_002796578.1|  ATP-dependent Clp protease ATP-binding protein     125   1e-29   
ref|WP_036902654.1|  Clp protease ClpX                                  125   1e-29   
gb|ABR23161.1|  ATP-dependent Clp protease regulatory subunit ClpC      126   1e-29   
ref|WP_015157369.1|  ATPase                                             125   1e-29   
gb|EEE52971.1|  hypothetical protein OsJ_35634                          125   1e-29   
ref|WP_039713557.1|  Clp protease ClpX                                  125   1e-29   
ref|WP_006530480.1|  ATPase with chaperone activity, ATP-binding ...    125   2e-29   
ref|WP_009632308.1|  ATPase with chaperone activity, ATP-binding ...    125   2e-29   
ref|WP_015132374.1|  ATPase                                             125   2e-29   
ref|WP_030006722.1|  Clp protease ClpX                                  125   2e-29   
ref|WP_011056163.1|  ATP-dependent Clp protease ATP-binding protein     125   2e-29   
ref|WP_024123912.1|  ATP-dependent Clp protease ATPase subunit ClpC     125   2e-29   
ref|WP_024545676.1|  Clp protease ClpX                                  125   2e-29   
ref|WP_012305779.1|  ATP-dependent Clp protease ATP-binding protein     125   2e-29   
ref|XP_002505550.1|  predicted protein                                  125   2e-29   
ref|WP_041677108.1|  Clp protease ClpX                                  125   3e-29   
ref|WP_032527486.1|  Clp protease ClpX                                  125   3e-29   
emb|CDY64710.1|  BnaA06g38690D                                          125   3e-29   
ref|WP_019474998.1|  hypothetical protein                               124   3e-29   
ref|WP_036910555.1|  MULTISPECIES: Clp protease ClpX                    125   3e-29   
ref|WP_015223717.1|  ATPase                                             124   3e-29   
ref|WP_022023066.1|  aTP-dependent Clp protease regulatory subunit      124   3e-29   
ref|WP_025906631.1|  Clp protease ClpX                                  124   4e-29   
ref|WP_011130433.1|  ATP-dependent Clp protease ATP-binding protein     124   4e-29   
ref|WP_011825646.1|  ATP-dependent Clp protease ATP-binding protein     124   4e-29   
ref|WP_012007913.1|  ATP-dependent Clp protease ATP-binding protein     124   4e-29   
ref|WP_025881712.1|  MULTISPECIES: Clp protease ClpX                    124   4e-29   
ref|WP_025941830.1|  Clp protease ClpX                                  124   4e-29   
ref|WP_042850567.1|  Clp protease ClpX                                  124   4e-29   
ref|WP_025961281.1|  Clp protease ClpX                                  124   4e-29   
ref|WP_011863146.1|  ATP-dependent Clp protease ATP-binding protein     124   4e-29   
ref|WP_011376649.1|  ATP-dependent Clp protease ATP-binding protein     124   4e-29   
ref|WP_032523561.1|  Clp protease ClpX                                  124   4e-29   
ref|WP_025972244.1|  Clp protease ClpX                                  124   4e-29   
ref|WP_029976482.1|  Clp protease ClpX                                  124   4e-29   
ref|WP_025894690.1|  Clp protease ClpX                                  124   4e-29   
ref|WP_025954710.1|  Clp protease ClpX                                  124   4e-29   
ref|WP_025923359.1|  Clp protease ClpX                                  124   4e-29   
ref|WP_025970276.1|  Clp protease ClpX                                  124   4e-29   
ref|WP_025932059.1|  Clp protease ClpX                                  124   4e-29   
ref|WP_025925386.1|  MULTISPECIES: Clp protease ClpX                    124   4e-29   
ref|WP_025890951.1|  MULTISPECIES: Clp protease ClpX                    124   4e-29   
ref|WP_025935195.1|  MULTISPECIES: Clp protease ClpX                    124   4e-29   
ref|WP_025964345.1|  Clp protease ClpX                                  124   4e-29   
ref|WP_025935959.1|  Clp protease ClpX                                  124   4e-29   
ref|WP_032514205.1|  Clp protease ClpX                                  124   4e-29   
ref|WP_025968127.1|  Clp protease ClpX                                  124   4e-29   
ref|WP_032515069.1|  Clp protease ClpX                                  124   4e-29   
ref|WP_025962478.1|  Clp protease ClpX                                  124   4e-29   
ref|WP_002807987.1|  ATP-dependent Clp protease ATP-binding protein     124   4e-29   
ref|WP_025959792.1|  Clp protease ClpX                                  124   4e-29   
ref|WP_025928515.1|  Clp protease ClpX                                  124   4e-29   
ref|WP_025958425.1|  Clp protease ClpX                                  124   4e-29   
ref|WP_011818625.1|  ATP-dependent Clp protease ATP-binding protein     124   4e-29   
ref|WP_025956785.1|  Clp protease ClpX                                  124   4e-29   
ref|WP_025924610.1|  Clp protease ClpX                                  124   5e-29   
ref|WP_025922419.1|  MULTISPECIES: Clp protease ClpX                    124   5e-29   
ref|WP_032524589.1|  Clp protease ClpX                                  124   5e-29   
ref|WP_011820486.1|  ATP-dependent Clp protease ATP-binding protein     124   5e-29   
ref|WP_025914744.1|  Clp protease ClpX                                  124   5e-29   
ref|WP_025893396.1|  Clp protease ClpX                                  124   5e-29   
ref|WP_025955884.1|  Clp protease ClpX                                  124   5e-29   
ref|WP_025944115.1|  Clp protease ClpX                                  124   5e-29   
ref|WP_032522603.1|  Clp protease ClpX                                  124   5e-29   
ref|WP_025942442.1|  MULTISPECIES: Clp protease ClpX                    124   5e-29   
ref|WP_032516684.1|  Clp protease ClpX                                  124   5e-29   
ref|XP_005844402.1|  hypothetical protein CHLNCDRAFT_32555              124   5e-29   
ref|WP_025965623.1|  Clp protease ClpX                                  124   5e-29   
ref|WP_032519126.1|  Clp protease ClpX                                  124   5e-29   
ref|WP_025926674.1|  Clp protease ClpX                                  124   5e-29   
ref|WP_025930513.1|  Clp protease ClpX                                  124   5e-29   
ref|WP_011132721.1|  ATP-dependent Clp protease ATP-binding protein     124   5e-29   
ref|WP_012195650.1|  ATP-dependent Clp protease ATP-binding protein     124   6e-29   
gb|AJA71272.1|  HSP100                                                  124   6e-29   
ref|WP_036896901.1|  Clp protease ClpX                                  124   6e-29   
ref|XP_001766010.1|  predicted protein                                  124   6e-29   
ref|WP_022491472.1|  aTP-dependent Clp protease ATP-binding subun...    124   6e-29   
ref|YP_007947862.1|  Clp protease ATP binding subunit                   124   7e-29   
gb|AIA21566.1|  Clp protease ATP binding subunit                        124   7e-29   
ref|YP_537014.1|  Clp protease ATP binding subunit                      124   7e-29   
gb|AIA21360.1|  Clp protease ATP binding subunit                        124   7e-29   
ref|YP_009027615.1|  Clp protease ATP binding subunit                   124   7e-29   
ref|XP_001766888.1|  predicted protein                                  124   7e-29   
gb|AFC40000.1|  Clp protease ATP binding subunit                        123   8e-29   
ref|NP_053942.1|  Clp protease ATP binding subunit                      123   8e-29   
gb|ADJ57429.1|  clp protease ATP binding subunit                        123   9e-29   
emb|CEG02027.1|  Clp, N-terminal                                        124   9e-29   
ref|WP_022485745.1|  aTP-dependent Clp protease regulatory subunit      123   1e-28   
ref|WP_025781797.1|  Clp protease ClpX                                  123   1e-28   
ref|YP_277337.1|  Clp protease ATP binding subunit                      123   1e-28   
ref|YP_007627346.1|  Clp protease ATP binding subunit                   123   1e-28   
ref|YP_008144810.1|  ATP-dependent Clp protease ATP-binding subun...    123   1e-28   
gb|AJH65889.1|  ATP-dependent Clp protease                              123   1e-28   
ref|YP_063564.1|  Clp protease ATP binding subunit                      122   2e-28   
ref|YP_007878188.1|  Clp protease ATP binding subunit                   122   2e-28   
ref|YP_009019572.1|  Clp protease ATP binding subunit                   122   2e-28   
gb|AJO68399.1|  Clp protease ATP binding subunit                        122   2e-28   
gb|EKE04399.1|  hypothetical protein ACD_20C00084G0019                  122   2e-28   
ref|WP_010317861.1|  ATP-dependent Clp protease ATP-binding protein     122   2e-28   
ref|XP_003063658.1|  predicted protein                                  122   3e-28   
ref|NP_045112.1|  Clp protease ATP binding subunit                      122   3e-28   
ref|XP_001422509.1|  chaperone, Hsp100 family, ClpC-type                122   3e-28   
ref|WP_021918297.1|  aTP-dependent Clp protease ATP-binding subun...    121   5e-28   
ref|NP_190131.1|  Double Clp-N motif-containing P-loop nucleoside...    117   6e-28   
ref|WP_022457401.1|  aTP-dependent Clp protease ATP-binding subun...    121   6e-28   
ref|WP_021865017.1|  aTP-dependent Clp protease ATP-binding subun...    121   6e-28   
ref|WP_022482201.1|  aTP-dependent Clp protease ATP-binding subun...    121   6e-28   
ref|WP_022442206.1|  aTP-dependent Clp protease ATP-binding subun...    121   7e-28   
ref|WP_021945551.1|  aTP-dependent Clp protease ATP-binding subun...    120   7e-28   
ref|XP_002875732.1|  hypothetical protein ARALYDRAFT_484935             117   8e-28   
ref|WP_022246485.1|  aTP-dependent Clp protease ATP-binding subun...    120   9e-28   
gb|AHY04404.1|  ATP-dependent clp protease ATP binding subunit          120   2e-27   
ref|YP_005088687.1|  Clp protease ATP binding subunit                   119   2e-27   
ref|YP_008145463.1|  Clp protease ATP binding subunit                   119   2e-27   
gb|AIA61144.1|  Clp protease ATP binding subunit (chloroplast)          118   4e-27   
ref|YP_002049416.1|  endopeptidase Clp ATP-binding chain C              118   6e-27   
ref|WP_017285691.1|  hypothetical protein                               114   6e-27   
ref|YP_009051035.1|  Clp protease ATP binding subunit                   118   7e-27   
ref|YP_008965643.1|  ATP-dependent Clp protease ATP-binding subun...    117   8e-27   
ref|NP_849021.1|  Clp protease ATP binding subunit                      117   1e-26   
ref|WP_026735736.1|  hypothetical protein                               110   2e-26   
ref|WP_011142066.1|  endopeptidase Clp ATP-binding chain                113   2e-26   
ref|YP_007476253.1|  Clp protease ATP binding subunit                   116   2e-26   
ref|XP_010687841.1|  PREDICTED: chaperone protein ClpC, chloropla...    114   1e-25   
ref|WP_032525473.1|  hypothetical protein                               103   1e-24   
ref|XP_010687844.1|  PREDICTED: chaperone protein ClpC, chloropla...    112   1e-24   
ref|WP_011612826.1|  ATP-dependent Clp protease ATP-binding protein     111   2e-24   
ref|YP_003002285.1|  ATP-dependent clp protease ATP-binding subunit     110   2e-24   
ref|XP_005648968.1|  hypothetical protein COCSUDRAFT_28166              110   3e-24   
gb|AJH65844.1|  ATP-dependent Clp protease                              110   4e-24   
gb|ABG51946.1|  TPR repeat containing protein                           110   5e-24   
ref|WP_039961643.1|  Clp protease ClpX, partial [                       109   8e-24   
ref|WP_019487288.1|  ATP-dependent Clp protease ATP-binding protein     109   9e-24   
ref|YP_003002123.1|  ATP-dependent clp protease ATP-binding subunit     108   1e-23   
gb|AFR24744.1|  ATP-dependent clp protease ATP-binding subunit          108   1e-23   
ref|YP_003359282.1|  Clp protease ATP binding subunit                   107   2e-23   
ref|WP_011321026.1|  ATP-dependent Clp protease ATP-binding protein     107   5e-23   
ref|WP_010996127.1|  ATP-dependent Clp protease ATP-binding protein     107   5e-23   
ref|WP_006631728.1|  ATP-dependent Clp protease ATP-binding protein     107   5e-23   
ref|WP_016953419.1|  ATP-dependent Clp protease ATP-binding protein     107   6e-23   
ref|WP_015178164.1|  ATPase AAA-2 domain protein                        107   6e-23   
ref|WP_015147677.1|  chaperone ATPase                                   106   7e-23   
ref|WP_019489373.1|  ATP-dependent Clp protease ATP-binding protein     105   1e-22   
ref|WP_017653296.1|  ATP-dependent Clp protease ATP-binding protein     105   1e-22   
gb|AFZ60359.1|  ATPase AAA-2 domain protein                             105   1e-22   
ref|WP_015126728.1|  ATPase                                             105   1e-22   
ref|WP_044292615.1|  Clp protease ClpX                                  105   2e-22   
ref|WP_015137763.1|  chaperone ATPase                                   105   2e-22   
gb|AFY59127.1|  ATPase with chaperone activity, ATP-binding subunit     105   2e-22   
ref|WP_015181544.1|  chaperone ATPase                                   105   2e-22   
ref|WP_017321287.1|  ATP-dependent Clp protease ATP-binding protein     105   2e-22   
ref|WP_027845315.1|  Clp protease ClpX                                  105   2e-22   
gb|AFY44720.1|  Clp domain protein                                      103   3e-22   
gb|KIJ85031.1|  Clp protease ClpX                                       104   3e-22   
ref|WP_016875482.1|  ATP-dependent Clp protease ATP-binding protein     104   3e-22   
ref|WP_015206990.1|  ATPase with chaperone activity, ATP-binding ...    104   4e-22   
ref|WP_017744020.1|  ATP-dependent Clp protease ATP-binding protein     104   4e-22   
ref|WP_041038849.1|  Clp protease ClpX                                  104   4e-22   
gb|KIE09004.1|  Clp protease ClpX                                       104   4e-22   
ref|WP_006275568.1|  ATP-dependent Clp protease ATP-binding protein     104   4e-22   
ref|WP_012409943.1|  ATP-dependent Clp protease ATP-binding protein     104   4e-22   
ref|WP_009630510.1|  ATPase with chaperone activity, ATP-binding ...    104   5e-22   
ref|WP_042466185.1|  Clp protease ClpX                                  104   5e-22   
ref|WP_013190390.1|  ATP-dependent Clp protease ATP-binding protein     103   5e-22   
ref|WP_029638259.1|  Clp protease ClpX [                                103   5e-22   
ref|WP_015199655.1|  ATPase                                             103   6e-22   
ref|WP_039752731.1|  Clp protease ClpX                                  103   8e-22   
ref|WP_015113826.1|  ATPase                                             103   9e-22   
ref|WP_006196989.1|  ATP-dependent Clp protease ATP-binding protein     103   1e-21   
ref|WP_035148903.1|  Clp protease ClpX                                  103   1e-21   
ref|WP_026735213.1|  Clp protease ClpX                                  102   2e-21   
ref|WP_016866146.1|  ATP-dependent Clp protease ATP-binding protein     102   2e-21   
ref|WP_026082520.1|  Clp protease ClpX                                  102   2e-21   
ref|WP_028090410.1|  Clp protease ClpX                                  102   2e-21   
ref|WP_028082386.1|  Clp protease ClpX                                  102   3e-21   
ref|WP_015197969.1|  Clp domain-containing protein                      101   3e-21   
ref|WP_015083493.1|  ATP-dependent Clp protease                         102   3e-21   
emb|CAK23961.1|  ATP-dependent Clp protease ATP-binding subunit c...    102   3e-21   
ref|WP_032555672.1|  hypothetical protein                             93.2    4e-21   
ref|WP_039204073.1|  Clp protease ClpX                                  100   6e-21   
ref|WP_027402031.1|  Clp protease ClpX                                  100   6e-21   
gb|KGG15432.1|  ATP-dependent Clp protease                              100   7e-21   
gb|KGG32385.1|  ATP-dependent Clp protease                              100   8e-21   
gb|KGG13948.1|  ATP-dependent Clp protease                              100   8e-21   



>ref|XP_009592687.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic isoform X2 [Nicotiana tomentosiformis]
Length=927

 Score =   212 bits (540),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 148/178 (83%), Positives = 154/178 (87%), Gaps = 4/178 (2%)
 Frame = +3

Query  48   IMARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGG  227
            IMAR LVQSTNIPS VAGE   +F GSGK      R V MLCS+QSPSL+LR F+GLRG 
Sbjct  4    IMARALVQSTNIPSSVAGERTTKFNGSGKTN----RTVKMLCSAQSPSLRLRDFSGLRGC  59

Query  228  NALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGH  407
            NA+DT+ RSGQTL SKVAAATS RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGH
Sbjct  60   NAIDTLVRSGQTLQSKVAAATSVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGH  119

Query  408  NFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  120  NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  177



>ref|XP_009592686.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic isoform X1 [Nicotiana tomentosiformis]
Length=935

 Score =   212 bits (540),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 155/182 (85%), Gaps = 4/182 (2%)
 Frame = +3

Query  36   SLGGIMARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTG  215
             L  IMAR LVQSTNIPS VAGE   +F GSGK      R V MLCS+QSPSL+LR F+G
Sbjct  8    DLWSIMARALVQSTNIPSSVAGERTTKFNGSGKTN----RTVKMLCSAQSPSLRLRDFSG  63

Query  216  LRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEAR  395
            LRG NA+DT+ RSGQTL SKVAAATS RR RG R V KAMFERFTEKAIKVIMLAQEEAR
Sbjct  64   LRGCNAIDTLVRSGQTLQSKVAAATSVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEAR  123

Query  396  RLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFT  575
            RLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFT
Sbjct  124  RLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  183

Query  576  PR  581
            PR
Sbjct  184  PR  185



>gb|AIM41270.1| chloroplast ATP-dependent Clp protease chaperone protein [Nicotiana 
benthamiana]
Length=908

 Score =   209 bits (531),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 153/177 (86%), Gaps = 4/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MAR LVQSTNIPS V+GE   +F GSGK      R V MLCS+QSPSL+LR F+GLRG N
Sbjct  1    MARALVQSTNIPSSVSGERTTKFNGSGKTN----RTVKMLCSAQSPSLRLRDFSGLRGCN  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            A+DT+ RSGQTL SKVAAATS RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   AVDTLVRSGQTLQSKVAAATSVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  173



>gb|AIM41271.1| chloroplast ATP-dependent Clp protease chaperone protein [Nicotiana 
benthamiana]
Length=938

 Score =   209 bits (531),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 153/177 (86%), Gaps = 4/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MAR LVQSTNIPS V+GE   +F GSGK      R V MLCS+QSPSL+LR F+GLRG N
Sbjct  1    MARALVQSTNIPSSVSGERTTKFNGSGKTN----RTVKMLCSAQSPSLRLRDFSGLRGCN  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            A+DT+ RSGQTL SKVAAATS RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   AVDTLVRSGQTLQSKVAAATSVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  173



>ref|XP_009769540.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Nicotiana sylvestris]
Length=923

 Score =   207 bits (528),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 154/177 (87%), Gaps = 4/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MAR LVQSTNIPS VAGE   QF GSGK K    + V MLC+ QSPS++L +FTGLRG N
Sbjct  1    MARALVQSTNIPSSVAGERTRQFSGSGKNK----KTVKMLCNVQSPSIRLTNFTGLRGCN  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            A+DT+ +SGQTLHSKVAAATS RR +G R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   AVDTLVKSGQTLHSKVAAATSVRRPKGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  173



>ref|XP_009615664.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Nicotiana tomentosiformis]
Length=923

 Score =   207 bits (528),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 154/177 (87%), Gaps = 4/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MAR LVQSTNIPS VAGE   QF GSGK K    + V MLC+ QSPS++L +FTGLRG N
Sbjct  1    MARALVQSTNIPSSVAGERTRQFSGSGKNK----KTVKMLCNVQSPSIRLTNFTGLRGCN  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            A+DT+ +SGQTLHSKVAAATS RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   AIDTLVKSGQTLHSKVAAATSVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  173



>ref|XP_009798134.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Nicotiana sylvestris]
Length=923

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 152/177 (86%), Gaps = 4/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MAR LVQSTNIPS VAGE   +F GSGK      R V MLCS+QSPSL+LR F+GLRG N
Sbjct  1    MARALVQSTNIPSSVAGERTTKFNGSGKTN----RTVKMLCSAQSPSLRLRDFSGLRGCN  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            A+DT+ RS QTL SKVAAATS RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   AIDTLVRSEQTLQSKVAAATSVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  173



>gb|AIM41268.1| chloroplast ATP-dependent Clp protease chaperone protein [Nicotiana 
benthamiana]
Length=906

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 153/177 (86%), Gaps = 4/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MAR LVQSTNIPS VAGE   QF GSGK K    + V MLC+ Q PS++L +FTGLRG N
Sbjct  1    MARALVQSTNIPSSVAGERTRQFSGSGKNK----KTVKMLCNVQPPSIRLTNFTGLRGCN  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            A+DT+ +SGQTLHSKVAAATS RR +G R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   AIDTLVKSGQTLHSKVAAATSVRRPKGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  173



>ref|XP_004252280.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Solanum lycopersicum]
Length=923

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 151/177 (85%), Gaps = 4/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MAR LVQST+IPS VAGE   +F GSGK K    R V MLC++QS SL LR FTGLRG N
Sbjct  1    MARALVQSTSIPSSVAGERTTKFNGSGKTK----RAVTMLCNAQSSSLTLRDFTGLRGCN  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            A+DT+ RSGQTL SKVAAAT  RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   AIDTLVRSGQTLQSKVAAATYVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  173



>ref|XP_006346636.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Solanum tuberosum]
Length=923

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 151/177 (85%), Gaps = 4/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MAR LVQST+IPS VAGE   +F GSGK K    R V MLC++QS SL LR FTGLRG N
Sbjct  1    MARALVQSTSIPSSVAGERTTKFNGSGKTK----RAVTMLCNAQSSSLTLRDFTGLRGCN  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            A+DT+ RSGQTL SKVAAAT  RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   AIDTLVRSGQTLQSKVAAATYVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  173



>sp|P31542.1|CLPAB_SOLLC RecName: Full=ATP-dependent Clp protease ATP-binding subunit 
clpA homolog CD4B, chloroplastic; Flags: Precursor [Solanum 
lycopersicum]
 gb|AAA34161.1| ATP-dependent protease (CD4B) [Solanum lycopersicum]
Length=923

 Score =   202 bits (515),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 151/177 (85%), Gaps = 4/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MAR LVQST+IPS VAGE   +F GSGK K    R V MLC++QS SL LR FTGLRG N
Sbjct  1    MARALVQSTSIPSSVAGERTTKFNGSGKTK----RAVTMLCNAQSSSLTLRDFTGLRGCN  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            A+DT+ RSG+TL SKVAAAT  RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   AIDTLVRSGETLQSKVAAATYVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  173



>ref|XP_004297496.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Fragaria vesca subsp. vesca]
Length=922

 Score =   197 bits (502),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 147/177 (83%), Gaps = 4/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MARVLV STNIP LVAG+ +GQ     KG G  +R   M+CS ++P+L++ SF+GLR  N
Sbjct  1    MARVLVHSTNIPGLVAGQRLGQ----SKGSGNARRSTKMMCSLRTPALRISSFSGLRSVN  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            ALD MAR GQ L+SKV  A S RR + SR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   ALDIMARPGQDLYSKVGVAISSRRRKASRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  173



>ref|XP_004171086.1| PREDICTED: chaperone protein ClpC, chloroplastic-like, partial 
[Cucumis sativus]
Length=475

 Score =   192 bits (488),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 144/177 (81%), Gaps = 3/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MARVLVQSTNIP LV G   G    + +G    KR V M+ ++ SP L++R+F+GLRG N
Sbjct  1    MARVLVQSTNIPGLVGGRKNG---LTTRGSANVKRAVKMMSTAHSPGLRIRNFSGLRGFN  57

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            +LD M RS Q  HSKVA A S RR + SR V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  58   SLDNMLRSRQNFHSKVATAISSRRRKASRCVPRAMFERFTEKAIKVIMLAQEEARRLGHN  117

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  118  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  174



>gb|AIM41269.1| chloroplast ATP-dependent Clp protease chaperone protein [Nicotiana 
benthamiana]
Length=923

 Score =   197 bits (500),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 150/192 (78%), Gaps = 19/192 (10%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MAR LVQSTNIPS VAGE   QF GSGK K    + V MLC+ Q PS++L +FTGLRG N
Sbjct  1    MARALVQSTNIPSSVAGEMTRQFSGSGKNK----KTVKMLCNVQPPSIRLTNFTGLRGCN  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            A+DT+ +SGQTLHSKVAAATS RR +G R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   AIDTLVKSGQTLHSKVAAATSVRRPKGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  411  FV---------------gteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGS  545
            FV                  +ILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGS
Sbjct  117  FVGTEQILLGLIGEGTGIAAKILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGS  176

Query  546  GFVAVEIPFTPR  581
            GFVAVEIPFTPR
Sbjct  177  GFVAVEIPFTPR  188



>ref|XP_008464372.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Cucumis melo]
Length=923

 Score =   195 bits (496),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 144/177 (81%), Gaps = 3/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MARVLVQSTNIP LV G   G    + +G    KR V M+ ++ SP L++R+F+GLRG N
Sbjct  1    MARVLVQSTNIPGLVGGRKNG---LTSRGSASVKRAVKMMATAHSPGLRIRNFSGLRGFN  57

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            +LD M RSGQ  HSK+A   S RR + SR V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  58   SLDNMLRSGQDFHSKMAITISSRRRKASRCVPRAMFERFTEKAIKVIMLAQEEARRLGHN  117

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  118  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  174



>gb|ADN33858.1| ATP-dependent clp protease [Cucumis melo subsp. melo]
Length=929

 Score =   195 bits (496),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 144/177 (81%), Gaps = 3/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MARVLVQSTNIP LV G   G    + +G    KR V M+ ++ SP L++R+F+GLRG N
Sbjct  1    MARVLVQSTNIPGLVGGRKNG---LTSRGSASVKRAVKMMATAHSPGLRIRNFSGLRGFN  57

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            +LD M RSGQ  HSK+A   S RR + SR V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  58   SLDNMLRSGQDFHSKMAITISSRRRKASRCVPRAMFERFTEKAIKVIMLAQEEARRLGHN  117

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  118  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  174



>ref|XP_010099042.1| Chaperone protein ClpC [Morus notabilis]
 gb|EXB76502.1| Chaperone protein ClpC [Morus notabilis]
Length=571

 Score =   191 bits (485),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 144/177 (81%), Gaps = 4/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MARVLVQSTN+P LV+G   GQ     KG GK KR V M+   Q+P L++R F+GLR  N
Sbjct  1    MARVLVQSTNVPGLVSGLKHGQ----SKGSGKSKRAVRMMSCIQAPGLRMRGFSGLRSFN  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            ALDTM R GQ  +SKVA   S RR + SR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   ALDTMMRPGQDFYSKVAITRSSRRQKASRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  173



>ref|XP_004138021.1| PREDICTED: chaperone protein ClpC, chloroplastic-like [Cucumis 
sativus]
Length=929

 Score =   192 bits (488),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 144/177 (81%), Gaps = 3/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MARVLVQSTNIP LV G   G    + +G    KR V M+ ++ SP L++R+F+GLRG N
Sbjct  1    MARVLVQSTNIPGLVGGRKNG---LTTRGSANVKRAVKMMSTAHSPGLRIRNFSGLRGFN  57

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            +LD M RS Q  HSKVA A S RR + SR V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  58   SLDNMLRSRQNFHSKVATAISSRRRKASRCVPRAMFERFTEKAIKVIMLAQEEARRLGHN  117

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  118  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  174



>emb|CBI15747.3| unnamed protein product [Vitis vinifera]
Length=746

 Score =   190 bits (483),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 149/182 (82%), Gaps = 4/182 (2%)
 Frame = +3

Query  36   SLGGIMARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTG  215
            S+  +MAR LVQSTNI + VA    G+F+GS + K    + V M+C+ Q+P L++R F+G
Sbjct  44   SVSAVMARALVQSTNIFASVADGKHGKFQGSERTK----KSVKMMCNVQAPGLRIRGFSG  99

Query  216  LRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEAR  395
            LRG NALD + RSG   HS+VAAA S R G+ SR V +AMFERFTEKAIKVIMLAQEEAR
Sbjct  100  LRGANALDNLVRSGHDFHSRVAAAISVRGGKASRCVARAMFERFTEKAIKVIMLAQEEAR  159

Query  396  RLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFT  575
            RLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFT
Sbjct  160  RLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFT  219

Query  576  PR  581
            PR
Sbjct  220  PR  221



>ref|XP_008239551.1| PREDICTED: chaperone protein ClpC, chloroplastic [Prunus mume]
Length=922

 Score =   191 bits (486),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 144/177 (81%), Gaps = 4/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MARVLVQSTNIP +VAG  + Q     KG G  KR V M C+ ++P L++ SF+GLR  N
Sbjct  1    MARVLVQSTNIPGVVAGRRLSQ----SKGSGNAKRTVKMCCTLRAPGLRISSFSGLRSVN  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            ALD MA+ GQ  +SK+  A + RR + SR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   ALDIMAKPGQDFYSKMGVAITSRRRKASRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  173



>emb|CDO98310.1| unnamed protein product [Coffea canephora]
Length=923

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 148/177 (84%), Gaps = 4/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MAR +VQSTN+ SLVA    GQFKGSGK K    R V MLCS     L++R F+GLR  N
Sbjct  1    MARAIVQSTNVSSLVAPGRYGQFKGSGKNK----RAVMMLCSLHVAPLRMRGFSGLRTSN  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            ALD M ++GQ+LHSKVA ATS RRGRGSR   +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   ALDMMVKTGQSLHSKVAIATSSRRGRGSRMAPRAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  173



>ref|XP_007210385.1| hypothetical protein PRUPE_ppa001062mg [Prunus persica]
 gb|EMJ11584.1| hypothetical protein PRUPE_ppa001062mg [Prunus persica]
Length=921

 Score =   190 bits (482),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 141/177 (80%), Gaps = 5/177 (3%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MARVLVQSTNIP +VAG  +GQ     KG G  KR V M C+ ++P L++ SF+GLR  N
Sbjct  1    MARVLVQSTNIPGVVAGRRLGQ----SKGSGNAKRTVKMCCTLRAPGLRISSFSGLRSVN  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            ALD MA+ GQ  +SK+  A + RR        KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   ALDIMAKPGQDFYSKMGVAITSRRKASRCVP-KAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  172



>ref|XP_004235839.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4A, chloroplastic [Solanum lycopersicum]
Length=926

 Score =   189 bits (479),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 148/179 (83%), Gaps = 5/179 (3%)
 Frame = +3

Query  48   IMARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGG  227
            +MAR LVQSTNI   VAGE  GQF GS K +    R V MLC+ +  S +L +F GLRG 
Sbjct  1    MMARALVQSTNILPSVAGERAGQFNGSRKDQ----RTVRMLCNVKCCSSRLNNFAGLRGC  56

Query  228  NALDTM-ARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLG  404
            NALDT+  +SG+TLHSKVAAAT  RR RG R V KAMFERFTEKAIKVIMLAQEEARRLG
Sbjct  57   NALDTLLVKSGETLHSKVAAATFVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLG  116

Query  405  HNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            HNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGF+AVEIPFTPR
Sbjct  117  HNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFIAVEIPFTPR  175



>sp|P31541.1|CLPAA_SOLLC RecName: Full=ATP-dependent Clp protease ATP-binding subunit 
clpA homolog CD4A, chloroplastic; Flags: Precursor [Solanum 
lycopersicum]
 gb|AAA34160.1| ATP-dependent protease (CD4A) [Solanum lycopersicum]
Length=926

 Score =   188 bits (478),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 148/179 (83%), Gaps = 5/179 (3%)
 Frame = +3

Query  48   IMARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGG  227
            +MAR LVQSTNI   VAGE  GQF GS K +    R V MLC+ +  S +L +F GLRG 
Sbjct  1    MMARALVQSTNILPSVAGERAGQFNGSRKDQ----RTVRMLCNVKCCSSRLNNFAGLRGC  56

Query  228  NALDTM-ARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLG  404
            NALDT+  +SG+TLHSKVAAAT  RR RG R V KAMFERFTEKAIKVIMLAQEEARRLG
Sbjct  57   NALDTLLVKSGETLHSKVAAATFVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLG  116

Query  405  HNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            HNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGF+AVEIPFTPR
Sbjct  117  HNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFIAVEIPFTPR  175



>ref|XP_010663794.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Vitis vinifera]
 ref|XP_010663795.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Vitis vinifera]
Length=923

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 146/177 (82%), Gaps = 4/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MAR LVQSTNI + VA    G+F+GS + K    + V M+C+ Q+P L++R F+GLRG N
Sbjct  1    MARALVQSTNIFASVADGKHGKFQGSERTK----KSVKMMCNVQAPGLRIRGFSGLRGAN  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            ALD + RSG   HS+VAAA S R G+ SR V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   ALDNLVRSGHDFHSRVAAAISVRGGKASRCVARAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  173



>ref|XP_006341485.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4A, chloroplastic-like [Solanum tuberosum]
Length=925

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 138/178 (78%), Positives = 147/178 (83%), Gaps = 5/178 (3%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MAR LVQST+I S VA E  GQF GS K +    R V MLC+ +  S +L SF GLRG N
Sbjct  1    MARALVQSTDILSSVASERAGQFNGSRKNQ----RTVRMLCNVKCSSSRLNSFAGLRGCN  56

Query  231  ALDTM-ARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGH  407
            ALDT+  +SG+TLHSKVAAAT  RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGH
Sbjct  57   ALDTLLVKSGETLHSKVAAATFVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGH  116

Query  408  NFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGF+AVEIPFTPR
Sbjct  117  NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFIAVEIPFTPR  174



>gb|KDP22549.1| hypothetical protein JCGZ_26380 [Jatropha curcas]
Length=924

 Score =   186 bits (471),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 140/177 (79%), Gaps = 3/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MAR+LV STNIP+L  G   G    S + +   +    M+CS++ P+L LR F+GLR  N
Sbjct  1    MARLLVHSTNIPALSHGVKHG---LSQESETSRRTATKMMCSTRPPALTLRGFSGLRNSN  57

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
             LDT+ RSGQ  HS+VA + S R+ +  R + +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  58   CLDTLLRSGQDFHSRVAISMSRRQQKAKRFLPRAMFERFTEKAIKVIMLAQEEARRLGHN  117

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  118  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  174



>gb|KHG07735.1| Chaperone ClpC, chloroplastic [Gossypium arboreum]
Length=893

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 145/177 (82%), Gaps = 4/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MA++L QS  +P+L++  + G    + K  GK KR   M+CS Q+P L++RSF+GLRG N
Sbjct  1    MAKILAQSAIVPTLLSSRSHG----ASKESGKPKRSAKMMCSLQTPGLRIRSFSGLRGSN  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            +LD + R GQ  HSKV  + S +RGRGSR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   SLDNIVRYGQDFHSKVGISISSQRGRGSRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  173



>gb|KJB19711.1| hypothetical protein B456_003G116200 [Gossypium raimondii]
Length=753

 Score =   183 bits (464),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 144/177 (81%), Gaps = 4/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MA++L QS  +P+L+   + G    + K  GK KR   M+CS Q+P L++RSF+GLRG N
Sbjct  1    MAKILSQSAIVPTLLTSRSHG----ASKESGKPKRSAKMMCSLQTPGLRIRSFSGLRGSN  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            +LD + R GQ  HSKV  + S RRGRGSR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   SLDNIVRFGQDFHSKVGISISSRRGRGSRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  173



>ref|XP_008457503.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Cucumis melo]
Length=924

 Score =   183 bits (465),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 141/178 (79%), Gaps = 5/178 (3%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MARVLVQ TNIP LV    +G+   S KG G  KR V M+ S  SP +++RSF+GLRG N
Sbjct  1    MARVLVQPTNIPGLV----VGRKSPSSKGSGNSKRAVKMMSSVHSPCMRMRSFSGLRGLN  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsra-vvKAMFERFTEKAIKVIMLAQEEARRLGH  407
            +LD M R GQ  HSK+A A S RR   +   V +AMFERFTEKAIKVIMLAQEEARRLGH
Sbjct  57   SLDNMFRPGQDFHSKMAIAISSRRVGRASRCVPRAMFERFTEKAIKVIMLAQEEARRLGH  116

Query  408  NFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RG GFVAVEIPFTPR
Sbjct  117  NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGGGFVAVEIPFTPR  174



>gb|KJB19712.1| hypothetical protein B456_003G116200 [Gossypium raimondii]
Length=919

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 144/177 (81%), Gaps = 4/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MA++L QS  +P+L+   + G    + K  GK KR   M+CS Q+P L++RSF+GLRG N
Sbjct  1    MAKILSQSAIVPTLLTSRSHG----ASKESGKPKRSAKMMCSLQTPGLRIRSFSGLRGSN  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            +LD + R GQ  HSKV  + S RRGRGSR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   SLDNIVRFGQDFHSKVGISISSRRGRGSRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  173



>gb|KJB19710.1| hypothetical protein B456_003G116200 [Gossypium raimondii]
Length=922

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 144/177 (81%), Gaps = 4/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MA++L QS  +P+L+   + G    + K  GK KR   M+CS Q+P L++RSF+GLRG N
Sbjct  1    MAKILSQSAIVPTLLTSRSHG----ASKESGKPKRSAKMMCSLQTPGLRIRSFSGLRGSN  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            +LD + R GQ  HSKV  + S RRGRGSR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   SLDNIVRFGQDFHSKVGISISSRRGRGSRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  173



>ref|XP_007038115.1| CLPC [Theobroma cacao]
 gb|EOY22616.1| CLPC [Theobroma cacao]
Length=922

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 133/177 (75%), Positives = 144/177 (81%), Gaps = 4/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MA+VL QST +P+LV   + G  K S K KG       M+CS Q+P L++RSF+GLRG N
Sbjct  1    MAKVLAQSTIVPALVTSRSHGPSKESSKSKG----SAKMMCSLQTPGLRIRSFSGLRGSN  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            +LD M R GQ   SKVA + S RRGRGSR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   SLDNMVRFGQDFRSKVAISISSRRGRGSRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  173



>gb|EPS63111.1| hypothetical protein M569_11677, partial [Genlisea aurea]
Length=195

 Score =   171 bits (432),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 139/180 (77%), Gaps = 6/180 (3%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQ-SPSLKLRSFTGLRGG  227
            MA VLVQST++PS V+   +    G  +   K +R V MLCSS+ +P+  +RSF+G RG 
Sbjct  1    MAGVLVQSTSLPSSVS---LANNGGKLEASTKNRRAVTMLCSSRLAPARTMRSFSGFRGV  57

Query  228  NALDTMA-RSGQTLHSKvaaatsgrrgrgsravv-KAMFERFTEKAIKVIMLAQEEARRL  401
            N LD +  +S QTLHSKVA A    R      +  +AMFERFTEKAIKVIMLAQEEARRL
Sbjct  58   NVLDRLVQKSSQTLHSKVAEAAGPSRRGRRTRMAPRAMFERFTEKAIKVIMLAQEEARRL  117

Query  402  GHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            GHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  118  GHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  177



>ref|XP_004152900.1| PREDICTED: chaperone protein ClpC, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004162592.1| PREDICTED: chaperone protein ClpC, chloroplastic-like [Cucumis 
sativus]
 gb|KGN65697.1| hypothetical protein Csa_1G502360 [Cucumis sativus]
Length=924

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 141/178 (79%), Gaps = 5/178 (3%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MARVLVQ TNIP LV    + +   S +G G  KRVV M+ S  SP +++RSF+GLRG N
Sbjct  1    MARVLVQPTNIPGLV----VARKSPSSRGSGNAKRVVKMMSSVHSPGMRMRSFSGLRGLN  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsra-vvKAMFERFTEKAIKVIMLAQEEARRLGH  407
            +LD M R GQ  HSKVA A S RRG      V +AMFERFTEKAIKVIMLAQEEARRLGH
Sbjct  57   SLDNMFRPGQDFHSKVAIAISSRRGGRPSRGVPRAMFERFTEKAIKVIMLAQEEARRLGH  116

Query  408  NFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RG GFVAVEIPFTPR
Sbjct  117  NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGGGFVAVEIPFTPR  174



>ref|XP_002511102.1| ATP-dependent clp protease, putative [Ricinus communis]
 gb|EEF51704.1| ATP-dependent clp protease, putative [Ricinus communis]
Length=924

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 138/177 (78%), Gaps = 3/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MAR+LV S N+P+L      GQ + SG  +    +   M+CSS+ P+L LR +TGLR  N
Sbjct  1    MARLLVHSINVPALAPHIKHGQSQESGTSRRTATK---MMCSSRLPALTLRGYTGLRSSN  57

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
             LDTM RSG   HS+VA   S R+ +  R + +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  58   CLDTMLRSGLDFHSRVAITMSRRQQKAKRFLPRAMFERFTEKAIKVIMLAQEEARRLGHN  117

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  118  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  174



>gb|AAD02267.1| ClpC protease [Spinacia oleracea]
Length=891

 Score =   181 bits (460),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 144/177 (81%), Gaps = 5/177 (3%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MA  L+QSTNIPSL A +  GQF+ S KG     + V M+ S Q P  ++R+F+G+RGGN
Sbjct  1    MAGALIQSTNIPSL-AYKVNGQFQRSDKGN----KAVKMMASLQDPGYRMRTFSGVRGGN  55

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            ALDT+  + +  +SK+ A  S R+G  SR VV+AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  56   ALDTLGTTSECFYSKMRAVLSVRKGTASRGVVRAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  172



>ref|XP_006367832.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4A, chloroplastic-like [Solanum tuberosum]
Length=921

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 146/179 (82%), Gaps = 7/179 (4%)
 Frame = +3

Query  51   MARVLVQSTNIPS--LVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRG  224
            MAR LVQST+I S   VAGE  GQF GS K +    R V M+C  + PSLKL+SF GLRG
Sbjct  1    MARALVQSTDILSSVAVAGERAGQFNGSRKNQ----RTVRMICDVKFPSLKLKSFVGLRG  56

Query  225  GNALDTM-ARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRL  401
             NALDT+  +SG+TLHSKVAAAT  RR +G R V KAMFERFTEKAIK IMLAQ+EARRL
Sbjct  57   CNALDTLLVKSGETLHSKVAAATFVRRSQGCRFVPKAMFERFTEKAIKGIMLAQDEARRL  116

Query  402  GHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTP  578
            GH+FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGS F+ VEIPFTP
Sbjct  117  GHDFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSVFITVEIPFTP  175



>ref|XP_010678345.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Beta vulgaris subsp. vulgaris]
Length=923

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 144/177 (81%), Gaps = 4/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MA  L+QST IP+  A +  GQF+ SGKGK      V M+ S Q+P  ++R+F+GLRGGN
Sbjct  1    MAGALIQSTTIPASFAYQRNGQFQRSGKGKQG----VKMMASLQAPGYRMRNFSGLRGGN  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            ALDT+  + +  +SK+ A  S R+G  SR VV+AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   ALDTLGSTSECFYSKMRAVLSVRKGTASRGVVRAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  173



>gb|KJB07945.1| hypothetical protein B456_001G054700 [Gossypium raimondii]
 gb|KJB07946.1| hypothetical protein B456_001G054700 [Gossypium raimondii]
Length=920

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 141/177 (80%), Gaps = 6/177 (3%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MA+VL QST +PSLV   + G+        GK KR V M+ S  +P L++ SF+GLRG  
Sbjct  1    MAKVLAQSTIVPSLVTSRSHGR------STGKSKRSVKMMSSLPTPGLRINSFSGLRGST  54

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            +LD M R  Q  HSKVA + S RRGRGSR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  55   SLDNMVRVDQDFHSKVAISISSRRGRGSRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  114

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  115  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  171



>gb|KCW48520.1| hypothetical protein EUGRSUZ_K02198 [Eucalyptus grandis]
Length=528

 Score =   175 bits (443),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 142/177 (80%), Gaps = 4/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MA VL QS N P++V+G+  G       G  K +R V M+ +  +PS+++R F+GLRG N
Sbjct  1    MAGVLAQSRNAPAIVSGQRYG----GSGGSAKSRRSVKMMSALTAPSIRMRGFSGLRGSN  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            +LDT+  S    HS+VA + S RRG+ SR VV+AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   SLDTLLNSSPDFHSRVANSISFRRGKASRGVVRAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  173



>gb|KEH35688.1| ATP-dependent Clp protease ATP-binding subunit [Medicago truncatula]
Length=922

 Score =   177 bits (450),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 140/177 (79%), Gaps = 4/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MARVL QS N+P LV G    Q KGSGK K    R V M+C+S++  L++  F+GLR  N
Sbjct  1    MARVLAQSINVPGLVVGHKQSQHKGSGKSK----RSVKMMCASRTIGLRMPGFSGLRTIN  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
             LDTM R G   H+KV+ A S RR R  R + +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   HLDTMLRPGLDFHAKVSMAISSRRARAKRIIPRAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  173



>ref|XP_010036860.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic isoform X1 [Eucalyptus grandis]
 ref|XP_010036861.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic isoform X1 [Eucalyptus grandis]
 gb|KCW48521.1| hypothetical protein EUGRSUZ_K02198 [Eucalyptus grandis]
Length=922

 Score =   175 bits (443),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 142/177 (80%), Gaps = 4/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MA VL QS N P++V+G+  G       G  K +R V M+ +  +PS+++R F+GLRG N
Sbjct  1    MAGVLAQSRNAPAIVSGQRYG----GSGGSAKSRRSVKMMSALTAPSIRMRGFSGLRGSN  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            +LDT+  S    HS+VA + S RRG+ SR VV+AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   SLDTLLNSSPDFHSRVANSISFRRGKASRGVVRAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  173



>ref|XP_010036862.1| PREDICTED: chaperone protein ClpC, chloroplastic isoform X2 [Eucalyptus 
grandis]
 gb|KCW48519.1| hypothetical protein EUGRSUZ_K02198 [Eucalyptus grandis]
Length=922

 Score =   175 bits (443),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 142/177 (80%), Gaps = 4/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MA VL QS N P++V+G+  G       G  K +R V M+ +  +PS+++R F+GLRG N
Sbjct  1    MAGVLAQSRNAPAIVSGQRYG----GSGGSAKSRRSVKMMSALTAPSIRMRGFSGLRGSN  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            +LDT+  S    HS+VA + S RRG+ SR VV+AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   SLDTLLNSSPDFHSRVANSISFRRGKASRGVVRAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  173



>gb|EYU24516.1| hypothetical protein MIMGU_mgv1a0010411mg, partial [Erythranthe 
guttata]
Length=400

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 139/178 (78%), Gaps = 8/178 (4%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MAR LVQSTN+PS V+      F+GS K K        MLC+S + S ++RSF+GLRG N
Sbjct  1    MARALVQSTNLPSSVSWANNCPFEGSNKTKAGP----TMLCNSLATSARMRSFSGLRGAN  56

Query  231  ALDTMARSG-QTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGH  407
            ++D M +   QTL SKV+ +  G++ R      +AMFERFTEKAIKVIMLAQEEARRLGH
Sbjct  57   SIDMMLQKNIQTLQSKVSVSRRGKKIRTGA---RAMFERFTEKAIKVIMLAQEEARRLGH  113

Query  408  NFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  114  NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  171



>ref|XP_003526929.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X1 [Glycine max]
 ref|XP_006581844.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X2 [Glycine max]
 gb|KHN09721.1| Chaperone protein ClpC, chloroplastic [Glycine soja]
Length=922

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 139/177 (79%), Gaps = 4/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MARVL QS N+P LVA    GQ     KG GK KR   M+ + ++  L++  F+GLR  N
Sbjct  1    MARVLAQSVNVPGLVAEHRHGQ----QKGSGKLKRSTKMMSALRTNGLRMSGFSGLRTFN  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
             LDTM R G   HSKV+ ATS R+ R +R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   PLDTMLRPGIDFHSKVSIATSSRQARATRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  173



>ref|XP_007159971.1| hypothetical protein PHAVU_002G282500g [Phaseolus vulgaris]
 gb|ESW31965.1| hypothetical protein PHAVU_002G282500g [Phaseolus vulgaris]
Length=923

 Score =   173 bits (439),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 126/177 (71%), Positives = 144/177 (81%), Gaps = 4/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MARVL QS  +P L++G+  GQ KGSGK +    R + M+ S Q P+L++ SF+GLR  N
Sbjct  1    MARVLAQSIGMPGLLSGQRHGQHKGSGKSR----RSLKMMSSLQMPALRMSSFSGLRTVN  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
             LD ++RS ++L SK+  +TS RR R  R V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   NLDLLSRSRRSLPSKMLTSTSSRRERAKRFVPRAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  173



>ref|XP_004501745.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X1 [Cicer arietinum]
 ref|XP_004501746.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X2 [Cicer arietinum]
 ref|XP_004501747.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X3 [Cicer arietinum]
Length=923

 Score =   173 bits (439),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 136/178 (76%), Gaps = 5/178 (3%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MARVL Q  N+P LVAG    Q K SGK K    R V M+C+ ++  L++  F+GLR  N
Sbjct  1    MARVLAQPINVPGLVAGHRQNQHKASGKSK----RSVKMMCAFRTNRLRMPGFSGLRTFN  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsra-vvKAMFERFTEKAIKVIMLAQEEARRLGH  407
             LDTM R G   HSKV+ A S  R   +   + KAMFERFTEKAIKVIMLAQEEARRLGH
Sbjct  57   HLDTMLRPGLDFHSKVSIAISSSRRARATRCIPKAMFERFTEKAIKVIMLAQEEARRLGH  116

Query  408  NFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  117  NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  174



>ref|XP_010249192.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Nelumbo nucifera]
Length=916

 Score =   173 bits (438),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 139/177 (79%), Gaps = 7/177 (4%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MAR LVQSTN+ + V G+  GQF+GS +      R   M  +  +PSL LR F+GLR  N
Sbjct  1    MARALVQSTNLSAAV-GQHHGQFRGSNR------RSSIMAYNIPAPSLMLRGFSGLRASN  53

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            ALD+M RS    HSKVAAA S  R + SR V  AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  54   ALDSMLRSHCNFHSKVAAAISIPRAKASRGVAVAMFERFTEKAIKVIMLAQEEARRLGHN  113

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  114  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  170



>sp|P35100.1|CLPC_PEA RecName: Full=Chaperone protein ClpC, chloroplastic; AltName: 
Full=ATP-dependent Clp protease ATP-binding subunit ClpC homolog; 
AltName: Full=Casein lytic proteinase C; Flags: Precursor 
[Pisum sativum]
 gb|AAA33680.1| nuclear encoded precursor to chloroplast protein [Pisum sativum]
Length=922

 Score =   172 bits (436),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 126/177 (71%), Positives = 139/177 (79%), Gaps = 4/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MARVL QS ++P LVAG    Q KGSGK K    R V  +C+ ++  L++  F+GLR  N
Sbjct  1    MARVLAQSLSVPGLVAGHKDSQHKGSGKSK----RSVKTMCALRTSGLRMSGFSGLRTFN  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
             L+TM R G   HSKV+ A S RR R  R + +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   HLNTMMRPGLDFHSKVSKAVSSRRARAKRFIPRAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  173



>gb|KHN31263.1| Chaperone protein ClpC, chloroplastic [Glycine soja]
Length=907

 Score =   172 bits (436),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 138/177 (78%), Gaps = 4/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MARVL QS N+P L+A    GQ     K  GK KR   M+ + ++  L++  F+GLR  N
Sbjct  1    MARVLAQSINVPGLLAEHRHGQ----QKESGKLKRSTKMMSALRTNGLRMSGFSGLRTFN  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
             LDTM R G   HSKV+ ATS RR R +R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   PLDTMLRPGIDFHSKVSIATSSRRARATRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  173



>ref|XP_002322299.1| ATP-dependent clp protease ATP-binding subunit clpA family protein 
[Populus trichocarpa]
 gb|EEF06426.1| ATP-dependent clp protease ATP-binding subunit clpA family protein 
[Populus trichocarpa]
Length=932

 Score =   172 bits (436),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 135/177 (76%), Gaps = 3/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MAR+LV S NIP++       QF+ S K +    R   M+ SS S  L +  ++GLR  N
Sbjct  1    MARLLVHSANIPAVAPCLRHCQFEESKKRRDSSAR---MMSSSPSQGLVMSGYSGLRSAN  57

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
             LDT+ R GQ+ HSKVA   S R+ +  R V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  58   CLDTLLRHGQSFHSKVAITISPRQQKAKRFVPRAMFERFTEKAIKVIMLAQEEARRLGHN  117

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  118  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  174



>ref|XP_003523172.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
1 [Glycine max]
 ref|XP_003523173.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
2 [Glycine max]
Length=922

 Score =   172 bits (436),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 138/177 (78%), Gaps = 4/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MARVL QS N+P L+A    GQ     K  GK KR   M+ + ++  L++  F+GLR  N
Sbjct  1    MARVLAQSINVPGLLAEHRHGQ----QKESGKLKRSTKMMSALRTNGLRMSGFSGLRTFN  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
             LDTM R G   HSKV+ ATS RR R +R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   PLDTMLRPGIDFHSKVSIATSSRRARATRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  173



>ref|XP_009368798.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Pyrus x bretschneideri]
Length=921

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 132/177 (75%), Gaps = 5/177 (3%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MAR LVQST IPS+  G  +G             R   M C+ ++P+L++ S+TGLR  N
Sbjct  1    MARNLVQSTYIPSVATGRRLG-----YSKGSGNARRTVMFCTLRAPALRMSSYTGLRSVN  55

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            ALD   +    L S V  A + RR R SR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  56   ALDVSVKPRHDLFSTVKFANTKRRERASRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  172



>ref|XP_008778670.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Phoenix dactylifera]
Length=195

 Score =   160 bits (404),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 135/177 (76%), Gaps = 4/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MA  LVQS  +PS V     GQ KG+GK +    +   M+ + +S  L+L+ F GLRG N
Sbjct  1    MAGALVQSAILPSQVVSRNRGQLKGAGKTR----KAPKMMGNLRSHPLRLQDFAGLRGAN  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
             LD ++RS Q  HS V+A  S  +G+  R V  AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   NLDLLSRSRQDFHSLVSAYISSPQGKACRGVPVAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMG+NLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGVNLKDARVEVEKIIGRGSGFVAVEIPFTPR  173



>ref|XP_008374277.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Malus domestica]
Length=936

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 132/177 (75%), Gaps = 5/177 (3%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MAR LVQST IPS+  G  +G             R   M C+ ++P+L++ S+TGLR  N
Sbjct  1    MARNLVQSTYIPSVATGRRLG-----YSKGSGNARRTVMFCTLRAPALRMSSYTGLRSVN  55

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            ALD   +    L S V  A + RR R SR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  56   ALDVSVKPRHDLFSTVKFANTKRRERASRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  172



>ref|XP_009337515.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Pyrus x bretschneideri]
 ref|XP_009337516.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Pyrus x bretschneideri]
Length=921

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 132/177 (75%), Gaps = 5/177 (3%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MA  LVQST IPSLV G  +G             R   MLC+ ++P+L++  +TGLR  N
Sbjct  1    MATNLVQSTYIPSLVTGRRLG-----YSKGSGNARRTVMLCTLRAPALRMSCYTGLRSVN  55

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            ALD   +  + L S V  A + R  R SR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  56   ALDISVKPRRDLFSSVKFANTKRCERASRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  172



>ref|XP_006376920.1| hypothetical protein POPTR_0012s10770g [Populus trichocarpa]
 ref|XP_006376921.1| ATP-dependent clp protease ATP-binding subunit clpA family protein 
[Populus trichocarpa]
 gb|ERP54717.1| hypothetical protein POPTR_0012s10770g [Populus trichocarpa]
 gb|ERP54718.1| ATP-dependent clp protease ATP-binding subunit clpA family protein 
[Populus trichocarpa]
Length=926

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 134/177 (76%), Gaps = 3/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MAR+LV S NIP++       Q++ S K +    +   M+CS  S  L +  ++GLR  N
Sbjct  1    MARLLVHSANIPAVAPCPRHCQYEESKKSRASSAK---MMCSLPSRGLVISGYSGLRSAN  57

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
             LDT+ R G + HSKVA   S R+ +  R V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  58   CLDTLLRHGHSFHSKVAITISPRQQKAKRFVPRAMFERFTEKAIKVIMLAQEEARRLGHN  117

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  118  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  174



>ref|XP_003630582.1| ATP-dependent Clp protease ATP-binding subunit clpA-like protein 
[Medicago truncatula]
 gb|AET05058.1| ATP-dependent Clp protease ATP-binding subunit [Medicago truncatula]
Length=926

 Score =   170 bits (431),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 139/180 (77%), Gaps = 6/180 (3%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            M+R L QS N+P LVAG    +   + KG  + +R V M+ ++++ S +L S++GLR  N
Sbjct  1    MSRALAQSINVPGLVAGR---RHVNNNKGAARSRRSVRMMFTTRTASPRLSSYSGLRTLN  57

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrg---sravvKAMFERFTEKAIKVIMLAQEEARRL  401
            +LD+M R GQ  HSKV       R +G   SR V KAMFERFTEKAIKVIMLAQEEARRL
Sbjct  58   SLDSMLRPGQDFHSKVLTQIGTNRAKGGRGSRCVTKAMFERFTEKAIKVIMLAQEEARRL  117

Query  402  GHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            GHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  118  GHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  177



>ref|XP_011042955.1| PREDICTED: chaperone protein ClpC, chloroplastic [Populus euphratica]
Length=926

 Score =   170 bits (430),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 134/177 (76%), Gaps = 3/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MAR+LV S NIP++       Q++ S K +    +   M+CS  S  L +  ++GLR  N
Sbjct  1    MARLLVHSANIPAVAPCPRHRQYEESKKSRASSAK---MMCSLPSRGLVISGYSGLRSAN  57

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
             LDT+ R G + HSKVA   S R+ +  R V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  58   CLDTLLRHGHSFHSKVAITISPRQQKAKRFVPRAMFERFTEKAIKVIMLAQEEARRLGHN  117

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  118  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  174



>ref|XP_010519480.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Tarenaya 
hassleriana]
 ref|XP_010519481.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Tarenaya 
hassleriana]
Length=926

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  153  RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  332
            R V M+   Q+  L+++SF+GLR  NALD MARSGQ  HSKV    S  +G+G R V KA
Sbjct  30   RCVKMMSGLQASGLRMQSFSGLRSSNALDFMARSGQDFHSKVRLHISSCKGKGCRFVPKA  89

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  90   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  149

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            VEVEKII RGSGFVAVEIPFTPR
Sbjct  150  VEVEKIIGRGSGFVAVEIPFTPR  172



>ref|XP_007137864.1| hypothetical protein PHAVU_009G162100g [Phaseolus vulgaris]
 gb|ESW09858.1| hypothetical protein PHAVU_009G162100g [Phaseolus vulgaris]
Length=922

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 138/177 (78%), Gaps = 4/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MARVL QS  +P LVA    GQ     KG GK KR   M+ + ++  L++  FTGLR  N
Sbjct  1    MARVLAQSVTVPGLVAEHRHGQ----QKGSGKLKRPAKMMSAVRTNGLRMSGFTGLRTFN  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
             LDTM R G    SKV+ ATS RRGR +R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   PLDTMLRPGIDFRSKVSIATSARRGRATRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  173



>ref|XP_010250552.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like isoform X1 [Nelumbo nucifera]
Length=945

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 140/189 (74%), Gaps = 6/189 (3%)
 Frame = +3

Query  15   FFIL*SGSLGGIMARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSL  194
            FF      L  IMA  LVQ TN+ + VAG+  GQ +GSG+   K      ML     PSL
Sbjct  18   FFPPIDSRLIRIMAMALVQLTNLSAAVAGQCHGQLRGSGRNPSK------MLFHVPFPSL  71

Query  195  KLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIM  374
             LR F+GLR  NALD+M RS    HS V AA S  RG+ SR V  AMFERFTEKAIKVIM
Sbjct  72   LLRGFSGLRASNALDSMLRSHCNFHSMVTAAISVPRGKASRGVAVAMFERFTEKAIKVIM  131

Query  375  LAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFV  554
            LAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFV
Sbjct  132  LAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFV  191

Query  555  AVEIPFTPR  581
            AVEIPFTPR
Sbjct  192  AVEIPFTPR  200



>ref|XP_006402040.1| hypothetical protein EUTSA_v10012603mg [Eutrema salsugineum]
 gb|ESQ43493.1| hypothetical protein EUTSA_v10012603mg [Eutrema salsugineum]
Length=929

 Score =   167 bits (424),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 136/176 (77%), Gaps = 6/176 (3%)
 Frame = +3

Query  57   RVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSS-QSPSLKLRSFTGLRGGNA  233
            RVL QST  PSL    A  Q     +G G+ +R V M+CS  Q   L+++ F GLRG N 
Sbjct  6    RVLAQSTP-PSL----ACYQRNVPSRGSGRTRRPVKMMCSQLQVSGLRMQGFLGLRGNNV  60

Query  234  LDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNF  413
            LDT+ RS Q  HS+V  A +  +G+ SR V KAMFERFTEKAIKVIMLAQEEARRLGHNF
Sbjct  61   LDTLGRSRQDFHSRVRQAMNVPKGKASRCVTKAMFERFTEKAIKVIMLAQEEARRLGHNF  120

Query  414  VgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            VGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  121  VGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  176



>ref|NP_568746.1| ATP-dependent Clp protease ATP-binding subunit ClpC [Arabidopsis 
thaliana]
 sp|Q9FI56.1|CLPC1_ARATH RecName: Full=Chaperone protein ClpC1, chloroplastic; AltName: 
Full=ATP-dependent Clp protease ATP-binding subunit ClpC homolog 
1; AltName: Full=Casein lytic proteinase C1; AltName: 
Full=Protein DE-REGULATED CAO ACCUMULATION 1; AltName: Full=Protein 
IRON-RESCUED MUTANT 1; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB08738.1| ATP-dependent Clp protease, ATP-binding subunit [Arabidopsis 
thaliana]
 gb|AAM26692.1| AT5g50920/K3K7_7 [Arabidopsis thaliana]
 dbj|BAE99213.1| ATP-dependent Clp protease [Arabidopsis thaliana]
 gb|AED96011.1| ATP-dependent Clp protease ATP-binding subunit ClpC [Arabidopsis 
thaliana]
Length=929

 Score =   167 bits (423),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 137/176 (78%), Gaps = 6/176 (3%)
 Frame = +3

Query  57   RVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSS-QSPSLKLRSFTGLRGGNA  233
            RVL QST  PSL    A  Q     +G G+ +R V M+CS  Q   L+++ F GLRG NA
Sbjct  6    RVLAQSTP-PSL----ACYQRNVPSRGSGRSRRSVKMMCSQLQVSGLRMQGFMGLRGNNA  60

Query  234  LDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNF  413
            LDT+ +S Q  HSKV  A +  +G+ SR  VKAMFERFTEKAIKVIMLAQEEARRLGHNF
Sbjct  61   LDTLGKSRQDFHSKVRQAMNVPKGKASRFTVKAMFERFTEKAIKVIMLAQEEARRLGHNF  120

Query  414  VgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            VGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  121  VGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  176



>ref|XP_008392716.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Malus domestica]
Length=921

 Score =   167 bits (423),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 132/177 (75%), Gaps = 5/177 (3%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MA  LVQST IPS+  G  +G             R   MLC+ ++P+L++  +TGLR  N
Sbjct  1    MATNLVQSTYIPSVAMGRRLG-----YSKGSGNARRTVMLCTLRAPALRMSGYTGLRSVN  55

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            ALD   +  + L S V  A + RR R SR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  56   ALDISVKPRRDLFSSVKFANTKRRERASRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  172



>ref|XP_010250553.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like isoform X2 [Nelumbo nucifera]
 ref|XP_010250554.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like isoform X2 [Nelumbo nucifera]
Length=916

 Score =   166 bits (420),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 136/177 (77%), Gaps = 6/177 (3%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MA  LVQ TN+ + VAG+  GQ +GSG+   K      ML     PSL LR F+GLR  N
Sbjct  1    MAMALVQLTNLSAAVAGQCHGQLRGSGRNPSK------MLFHVPFPSLLLRGFSGLRASN  54

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            ALD+M RS    HS V AA S  RG+ SR V  AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  55   ALDSMLRSHCNFHSMVTAAISVPRGKASRGVAVAMFERFTEKAIKVIMLAQEEARRLGHN  114

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  115  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  171



>ref|XP_002865831.1| heat shock protein 93-V [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42090.1| heat shock protein 93-V [Arabidopsis lyrata subsp. lyrata]
Length=929

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 137/176 (78%), Gaps = 6/176 (3%)
 Frame = +3

Query  57   RVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSS-QSPSLKLRSFTGLRGGNA  233
            RVL QST  PSL    A  Q     +G G+ +R V M+CS  Q   L+++ F GLRG NA
Sbjct  6    RVLAQSTP-PSL----ACYQRNVPSRGSGRSRRSVKMMCSQLQVSGLRMQGFLGLRGNNA  60

Query  234  LDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNF  413
            LDT+ ++ Q  HSKV  A +  +G+ SR  VKAMFERFTEKAIKVIMLAQEEARRLGHNF
Sbjct  61   LDTLGKNRQDFHSKVRQAMNVPKGKASRFTVKAMFERFTEKAIKVIMLAQEEARRLGHNF  120

Query  414  VgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            VGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  121  VGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  176



>gb|KEH35794.1| ATP-dependent Clp protease ATP-binding subunit [Medicago truncatula]
Length=927

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 133/180 (74%), Gaps = 5/180 (3%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            M+RVL QS N+P LVAG        +        R V M+ ++Q+ +++L  F+GLR  N
Sbjct  1    MSRVLAQSINVPGLVAGRR--HVNNNNGSVRSRPRSVRMMYATQTATMRLSGFSGLRPLN  58

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrg---sravvKAMFERFTEKAIKVIMLAQEEARRL  401
            +LD+M R  Q  HSKV       R RG   SR V +AMFERFTEKAIKVIMLAQEEARRL
Sbjct  59   SLDSMFRPRQDFHSKVLTQIGTNRARGGRGSRCVTRAMFERFTEKAIKVIMLAQEEARRL  118

Query  402  GHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            GHNFVGTEQILLGLIGEGTGI AKVLKSMGINLKD+RVEVEKII RGSGFVAVEIPFTPR
Sbjct  119  GHNFVGTEQILLGLIGEGTGIGAKVLKSMGINLKDSRVEVEKIIGRGSGFVAVEIPFTPR  178



>ref|XP_011040255.1| PREDICTED: chaperone protein ClpC, chloroplastic [Populus euphratica]
 ref|XP_011040256.1| PREDICTED: chaperone protein ClpC, chloroplastic [Populus euphratica]
Length=926

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 133/177 (75%), Gaps = 3/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MAR+LV S NIP++       QF+ S K +      V M+ S  S  L +  ++GLR  N
Sbjct  1    MARLLVYSANIPAVAPRLRHCQFEESKKRRDSS---VKMMSSLPSRGLVMSGYSGLRSAN  57

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
             LDT+ R G + HSKVA   S R+ +  R V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  58   CLDTLLRHGHSFHSKVAITISPRQQKAKRFVPRAMFERFTEKAIKVIMLAQEEARRLGHN  117

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  118  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  174



>ref|XP_003525431.1| PREDICTED: chaperone protein ClpC, chloroplastic-like [Glycine 
max]
 gb|KHN17465.1| Chaperone protein ClpC, chloroplastic [Glycine soja]
Length=919

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 140/177 (79%), Gaps = 8/177 (5%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MARVLVQST +P L++G+  G+ KGSGK K    R V M+ + + P+L++ SF+GLR  N
Sbjct  1    MARVLVQSTGMPGLLSGQRHGKHKGSGKSK----RSVKMMSTLRMPALRMSSFSGLRTLN  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
             +D+++R   T        T+ RR R  R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   PMDSLSRPRHTF----PLNTTSRRERAKRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  112

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  113  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  169



>ref|XP_006279971.1| hypothetical protein CARUB_v10025837mg [Capsella rubella]
 gb|EOA12869.1| hypothetical protein CARUB_v10025837mg [Capsella rubella]
Length=929

 Score =   164 bits (414),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 122/176 (69%), Positives = 135/176 (77%), Gaps = 6/176 (3%)
 Frame = +3

Query  57   RVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSS-QSPSLKLRSFTGLRGGNA  233
            RVL QST  PSL    A  Q     +G G+ +R V M+CS  Q    +++ F GLRG NA
Sbjct  6    RVLAQSTP-PSL----ACYQRNVPSRGSGRSRRSVKMMCSQLQVSGSRMQGFLGLRGSNA  60

Query  234  LDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNF  413
            LDT+ ++ Q  HSKV  A +  +G+ SR   KAMFERFTEKAIKVIMLAQEEARRLGHNF
Sbjct  61   LDTLGKTRQDFHSKVRQAMTVPKGKASRCTTKAMFERFTEKAIKVIMLAQEEARRLGHNF  120

Query  414  VgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            VGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  121  VGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  176



>ref|XP_010942381.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Elaeis guineensis]
Length=920

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 136/177 (77%), Gaps = 4/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MA  LVQS  +P  V      Q KGSGK +    +   M+C+ +S +L+L++F GLRG N
Sbjct  1    MAGALVQSAILPVQVVSRTCEQLKGSGKTR----KAAKMMCNLRSHALRLQAFAGLRGAN  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
             LD ++RS Q  HS V+A  S  +G+  R V  AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   NLDLLSRSRQDFHSLVSAYISAPQGKACRGVPVAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  173



>gb|AAC04687.1| ClpC [Arabidopsis thaliana]
Length=928

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 135/175 (77%), Gaps = 5/175 (3%)
 Frame = +3

Query  57   RVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNAL  236
            RVL QST  PSL    A  Q     +G G+ +R V M+C   +  L ++ F GLRG NAL
Sbjct  6    RVLAQSTP-PSL----ACYQRNVPSRGSGRSRRSVKMMCIIFNVWLPMQGFMGLRGNNAL  60

Query  237  DTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFV  416
            DT+ +S Q  HSKV  A +  +G+ SR  VKAMFERFTEKAIKVIMLAQEEARRLGHNFV
Sbjct  61   DTLGKSRQDFHSKVRQAMNVPKGKASRFTVKAMFERFTEKAIKVIMLAQEEARRLGHNFV  120

Query  417  gteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            GTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  121  GTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  175



>ref|XP_010550758.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Tarenaya hassleriana]
 ref|XP_010550759.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Tarenaya hassleriana]
Length=926

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 140/177 (79%), Gaps = 5/177 (3%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MAR+L  ST + SL A     ++    +G GK +R V M+ + ++P L+++SF+GLR  N
Sbjct  1    MARLLAHST-VSSLFAS----RWNVQSQGSGKPRRYVKMMYNLEAPGLRIQSFSGLRSSN  55

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            +LD +ARSG   HSKV   TS R+G+  R V KAMFERFTEKAIKVIMLAQEEA+RLGHN
Sbjct  56   SLDFIARSGHDFHSKVRLQTSSRKGKACRFVPKAMFERFTEKAIKVIMLAQEEAQRLGHN  115

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKS+GINLK ARVEVEKII RGSGFVAVEIPFTPR
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSLGINLKYARVEVEKIIGRGSGFVAVEIPFTPR  172



>ref|XP_011083076.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent Clp protease ATP-binding 
subunit clpA homolog CD4B, chloroplastic [Sesamum 
indicum]
Length=928

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 134/183 (73%), Gaps = 11/183 (6%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MAR LVQSTN+PS V     GQF+GS K K    +   MLC+S S  +++RSF+GLRG N
Sbjct  1    MARALVQSTNLPSSVGFVNNGQFEGSNKTK----KASTMLCNSWSAPVRMRSFSGLRGAN  56

Query  231  ALDTMA-RSGQTLHSKvaaats-----grrgrgsravvKAMFERFTEKAIKVIMLAQEEA  392
            ALD M  RSGQTL SKVAA  S       R            E F  KAIKVIMLAQEEA
Sbjct  57   ALDVMVQRSGQTLQSKVAATNSGKRGRKLRMAXXXXXXXXXXEGFX-KAIKVIMLAQEEA  115

Query  393  RRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPF  572
            RRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPF
Sbjct  116  RRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPF  175

Query  573  TPR  581
            TPR
Sbjct  176  TPR  178



>ref|XP_010442575.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Camelina 
sativa]
Length=929

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 122/176 (69%), Positives = 135/176 (77%), Gaps = 6/176 (3%)
 Frame = +3

Query  57   RVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSS-QSPSLKLRSFTGLRGGNA  233
            RVL QST  PSL    A  Q     +G G+ +R V M+CS  Q    +++ F GLRG NA
Sbjct  6    RVLAQSTP-PSL----ACYQRNVPSRGSGRSRRSVKMMCSQLQVSGSRMQGFMGLRGSNA  60

Query  234  LDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNF  413
            LDT+  + Q  HSKV  + +  +G+ SR  VKAMFERFTEKAIKVIMLAQEEARRLGHNF
Sbjct  61   LDTLGSTRQDFHSKVRQSMNVPKGKASRCTVKAMFERFTEKAIKVIMLAQEEARRLGHNF  120

Query  414  VgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            VGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  121  VGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  176



>ref|XP_010482409.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Camelina sativa]
Length=929

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 135/176 (77%), Gaps = 6/176 (3%)
 Frame = +3

Query  57   RVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSS-QSPSLKLRSFTGLRGGNA  233
            RVL QST  PSL    A  Q     +G G+ +R V M+CS  Q    +++ F GLRG NA
Sbjct  6    RVLAQSTP-PSL----ACYQRNVPSRGSGRSRRSVKMMCSQLQVSGSRMQGFMGLRGSNA  60

Query  234  LDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNF  413
            LDT+  + Q  HSKV  A +  +G+ SR  VKAMFERFTEKAIKVIMLAQEEARRLGHNF
Sbjct  61   LDTLGSTRQDFHSKVRQAMNVPKGKASRCTVKAMFERFTEKAIKVIMLAQEEARRLGHNF  120

Query  414  VgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            VGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  121  VGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  176



>emb|CDX83052.1| BnaA01g20520D [Brassica napus]
Length=927

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 132/177 (75%), Gaps = 5/177 (3%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MAR+L   T  P L  G  +           K +R V M+ +SQ+P L ++SF+GLR  N
Sbjct  1    MARLLANFTARPLLGPGRHV-----QSDDYRKPRRCVKMMYTSQTPVLSIQSFSGLRAAN  55

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            A+D +AR      SKV    S R+G+ SR V KAMFERFTEKAIKVIML+QEEARRLGHN
Sbjct  56   AVDLIARPAHGFFSKVNLQISSRKGKSSRCVTKAMFERFTEKAIKVIMLSQEEARRLGHN  115

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVEVEKII RGSGFVAVEIPFTPR
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVEVEKIIGRGSGFVAVEIPFTPR  172



>ref|XP_009151567.1| PREDICTED: chaperone protein ClpC2, chloroplastic [Brassica rapa]
 ref|XP_009151572.1| PREDICTED: chaperone protein ClpC2, chloroplastic [Brassica rapa]
Length=928

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 132/177 (75%), Gaps = 5/177 (3%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MAR+L   T  P L  G  +           K +R V M+ +SQ+P L ++SF+GLR  N
Sbjct  1    MARLLANFTARPLLGPGRHV-----QSDDYRKPRRCVKMMYTSQTPVLSIQSFSGLRAAN  55

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            A+D +AR      SKV    S R+G+ SR V KAMFERFTEKAIKVIML+QEEARRLGHN
Sbjct  56   AVDLIARPAHGFFSKVNLQISSRKGKASRCVTKAMFERFTEKAIKVIMLSQEEARRLGHN  115

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVEVEKII RGSGFVAVEIPFTPR
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVEVEKIIGRGSGFVAVEIPFTPR  172



>ref|XP_010442573.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Camelina 
sativa]
Length=929

 Score =   161 bits (408),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 135/176 (77%), Gaps = 6/176 (3%)
 Frame = +3

Query  57   RVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSS-QSPSLKLRSFTGLRGGNA  233
            RVL QST  PSL    A  Q     +G G+ +R V M+CS  Q    +++ F GLRG NA
Sbjct  6    RVLAQSTP-PSL----ACYQRNVPSRGSGRSRRSVKMMCSQLQVSGSRMQGFMGLRGRNA  60

Query  234  LDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNF  413
            LDT+  + Q  HSKV  A +  +G+ SR  VKAMFERFTEKAIKVIMLAQEEARRLGHNF
Sbjct  61   LDTLGSTRQDFHSKVRQAMNVPKGKASRCTVKAMFERFTEKAIKVIMLAQEEARRLGHNF  120

Query  414  VgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            VGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  121  VGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  176



>ref|XP_010555578.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Tarenaya hassleriana]
 ref|XP_010555579.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Tarenaya hassleriana]
Length=927

 Score =   161 bits (408),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = +3

Query  165  MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  344
            M    Q+P L+++ F GLRG N LD + RS Q  HSKV    S RRG+ SR + KAMFER
Sbjct  38   MSSQPQAPGLRIQGFLGLRGQNVLDMLGRSRQDFHSKVRLTMSSRRGKPSRCMPKAMFER  97

Query  345  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVE  524
            FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE
Sbjct  98   FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE  157

Query  525  KIIWRGSGFVAVEIPFTPR  581
            KII RGSGFVAVEIPFTPR
Sbjct  158  KIIGRGSGFVAVEIPFTPR  176



>ref|XP_010536587.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like isoform 
X2 [Tarenaya hassleriana]
Length=929

 Score =   160 bits (406),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +3

Query  183  SPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAI  362
            SP L+++ F GLRG N LDT+ RS Q  HSK+  A +  RG+ +R+   AMFERFTEKAI
Sbjct  45   SPGLRIQGFLGLRGQNVLDTLGRSHQDFHSKIRLAMTSGRGKPTRSTPTAMFERFTEKAI  104

Query  363  KVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRG  542
            KVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RG
Sbjct  105  KVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRG  164

Query  543  SGFVAVEIPFTPR  581
            SGFVAVEIPFTPR
Sbjct  165  SGFVAVEIPFTPR  177



>ref|XP_010536586.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like isoform 
X1 [Tarenaya hassleriana]
Length=936

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +3

Query  183  SPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAI  362
            SP L+++ F GLRG N LDT+ RS Q  HSK+  A +  RG+ +R+   AMFERFTEKAI
Sbjct  52   SPGLRIQGFLGLRGQNVLDTLGRSHQDFHSKIRLAMTSGRGKPTRSTPTAMFERFTEKAI  111

Query  363  KVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRG  542
            KVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RG
Sbjct  112  KVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRG  171

Query  543  SGFVAVEIPFTPR  581
            SGFVAVEIPFTPR
Sbjct  172  SGFVAVEIPFTPR  184



>ref|XP_004503801.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X1 [Cicer arietinum]
 ref|XP_004503802.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X2 [Cicer arietinum]
Length=926

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 134/180 (74%), Gaps = 6/180 (3%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            M+R+LV S N+P LV G+  G    + K   K +R V M+ ++ + + ++  F+GLR  N
Sbjct  1    MSRLLVHSLNVPGLVPGQRHGN---NNKVLAKVRRPVKMMFATGTAASRMPGFSGLRTVN  57

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrg---sravvKAMFERFTEKAIKVIMLAQEEARRL  401
            +LD+M R     HSKV       R R    +R V KAMFERFTEKAIKVIMLAQEEARRL
Sbjct  58   SLDSMLRPRLDFHSKVLTQIGTNRARSGRGNRVVPKAMFERFTEKAIKVIMLAQEEARRL  117

Query  402  GHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            GHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  118  GHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  177



>ref|XP_010426385.1| PREDICTED: chaperone protein ClpC2, chloroplastic [Camelina sativa]
 ref|XP_010426386.1| PREDICTED: chaperone protein ClpC2, chloroplastic [Camelina sativa]
Length=927

 Score =   159 bits (402),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 115/141 (82%), Gaps = 0/141 (0%)
 Frame = +3

Query  159  VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  338
            V M+ S Q+P LK++ FTGLR  NALD  AR  Q   SKV    S R  +  R V KAMF
Sbjct  31   VKMMFSVQAPVLKIQCFTGLRASNALDFRARPSQDFVSKVNRNISSRNEKARRCVPKAMF  90

Query  339  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  518
            ERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVE
Sbjct  91   ERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVE  150

Query  519  VEKIIWRGSGFVAVEIPFTPR  581
            VEKII RGSGFVAVEIPFTPR
Sbjct  151  VEKIIGRGSGFVAVEIPFTPR  171



>gb|EYU21822.1| hypothetical protein MIMGU_mgv1a000973mg [Erythranthe guttata]
Length=925

 Score =   159 bits (402),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 137/179 (77%), Gaps = 6/179 (3%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            M   L++ TN+PS V     GQ  GS K +    +   MLCS+Q  +++L+SF+GLR  N
Sbjct  1    MTHTLIRPTNLPSSVVLGNNGQLNGSNKAR----KAPTMLCSTQPTAIRLQSFSGLRRAN  56

Query  231  ALDTMA-RSGQTLHSKvaaatsgrrg-rgsravvKAMFERFTEKAIKVIMLAQEEARRLG  404
            +LD M  +   TL SKVAAA +  R  R SR   +AMFERFTEKAIKVIMLAQEEARRLG
Sbjct  57   SLDIMVWQPRHTLQSKVAAAIAPVRQGRKSRMAPRAMFERFTEKAIKVIMLAQEEARRLG  116

Query  405  HNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            HNFVGTEQILLGLIGEG+GIAAKV+KSMGINLKDAR+EVEKII RGSGFVAVEIPFTPR
Sbjct  117  HNFVGTEQILLGLIGEGSGIAAKVIKSMGINLKDARIEVEKIIGRGSGFVAVEIPFTPR  175



>ref|XP_002877635.1| AtClpC [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53894.1| AtClpC [Arabidopsis lyrata subsp. lyrata]
Length=953

 Score =   159 bits (402),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = +3

Query  159  VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  338
            V M+CS Q+P LK++SF+GLR  +ALD MAR       K   A S RR + SR V KAMF
Sbjct  56   VKMMCSLQAPVLKIQSFSGLRAPSALDYMARPSPGFLVKFKRAISSRREKASRCVPKAMF  115

Query  339  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  518
            ERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVE
Sbjct  116  ERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVE  175

Query  519  VEKIIWRGSGFVAVEIPFTPR  581
            VEKII RGSGFVAVEIPFTPR
Sbjct  176  VEKIIGRGSGFVAVEIPFTPR  196



>ref|XP_006290258.1| hypothetical protein CARUB_v10016640mg [Capsella rubella]
 gb|EOA23156.1| hypothetical protein CARUB_v10016640mg [Capsella rubella]
Length=750

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 113/141 (80%), Gaps = 0/141 (0%)
 Frame = +3

Query  159  VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  338
            V M+ S Q+P LKL SF GLR  N LD M R  Q   S    +   R+ +G R V KAMF
Sbjct  81   VKMMYSCQAPVLKLHSFAGLRATNPLDIMGRPRQDWFSMSKLSIPKRKDKGKRCVTKAMF  140

Query  339  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  518
            ERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVE
Sbjct  141  ERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVE  200

Query  519  VEKIIWRGSGFVAVEIPFTPR  581
            VEKII RGSGFVAVEIPFTPR
Sbjct  201  VEKIIGRGSGFVAVEIPFTPR  221



>ref|XP_003532383.1| PREDICTED: chaperone protein ClpC, chloroplastic-like [Glycine 
max]
Length=919

 Score =   158 bits (400),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 136/177 (77%), Gaps = 8/177 (5%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MARVL QST +P L++G   G  KGSGK K    R V M+ + + P+L++ SF+GLR  N
Sbjct  1    MARVLAQSTGMPGLLSGRRHGPHKGSGKTK----RSVKMMSTLRIPALRMSSFSGLRTLN  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
             LD+++R   T        T+ RR R  R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   PLDSVSRPRHTF----PLTTTSRRERAKRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  112

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFT R
Sbjct  113  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTSR  169



>gb|KHN16879.1| Chaperone protein ClpC, chloroplastic [Glycine soja]
Length=919

 Score =   158 bits (400),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 136/177 (77%), Gaps = 8/177 (5%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MARVL QST +P L++G   G  KGSGK K    R V M+ + + P+L++ SF+GLR  N
Sbjct  1    MARVLAQSTGMPGLLSGRRHGPHKGSGKTK----RSVKMMSTLRIPALRMSSFSGLRTLN  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
             LD+++R   T        T+ RR R  R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   PLDSVSRPRHTF----PLTTTSRRERAKRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  112

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFT R
Sbjct  113  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTSR  169



>emb|CDX68504.1| BnaC01g25820D [Brassica napus]
Length=928

 Score =   158 bits (399),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 127/178 (71%), Gaps = 6/178 (3%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MAR+L   T  P L  G  +           K +R V M+ +SQ+P L ++SF+GLR  N
Sbjct  1    MARLLANFTARPLLGPGRHV-----QSDEYRKPRRCVKMMYTSQTPVLSIQSFSGLRSAN  55

Query  231  ALDTMARSGQTLHSKvaaatsgrr-grgsravvKAMFERFTEKAIKVIMLAQEEARRLGH  407
            A+D +AR      SKV    S R+         KAMFERFTEKAIKVIML+QEEARRLGH
Sbjct  56   AVDLIARPAHGFFSKVNLQISSRKGKASRCVTTKAMFERFTEKAIKVIMLSQEEARRLGH  115

Query  408  NFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVEVEKII RGSGFVAVEIPFTPR
Sbjct  116  NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVEVEKIIGRGSGFVAVEIPFTPR  173



>ref|XP_011073186.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Sesamum indicum]
Length=924

 Score =   157 bits (398),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 120/141 (85%), Gaps = 2/141 (1%)
 Frame = +3

Query  165  MLCSSQSPSLKLRSFTGLRGGNALDTMAR-SGQTLHSKvaaats-grrgrgsravvKAMF  338
            MLCS+    L L  FTGLR  NALD M R +GQTL SK+AA  +  +RG+ +R V +AMF
Sbjct  35   MLCSAHFAPLTLTGFTGLRRANALDMMVRQAGQTLQSKIAAKNTFAKRGKHARMVPRAMF  94

Query  339  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  518
            ERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVE
Sbjct  95   ERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVE  154

Query  519  VEKIIWRGSGFVAVEIPFTPR  581
            VEKII RGSGFVAVEIPFTPR
Sbjct  155  VEKIIGRGSGFVAVEIPFTPR  175



>ref|XP_008791045.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Phoenix dactylifera]
Length=920

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 132/177 (75%), Gaps = 4/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MA  L QS  +P+ V     GQ KGSGK +        M+C+ +   L+L+ F GLRG N
Sbjct  1    MAGALFQSAILPAQVLSRNRGQLKGSGKAR----EAAKMMCNMRLHPLRLQGFAGLRGSN  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
             LD ++RS +  HS V+A  S  + +  R V  AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   NLDLLSRSRRDFHSVVSAYISAPQAKACRGVPVAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  173



>ref|XP_006290259.1| hypothetical protein CARUB_v10016640mg [Capsella rubella]
 gb|EOA23157.1| hypothetical protein CARUB_v10016640mg [Capsella rubella]
Length=977

 Score =   157 bits (398),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 113/141 (80%), Gaps = 0/141 (0%)
 Frame = +3

Query  159  VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  338
            V M+ S Q+P LKL SF GLR  N LD M R  Q   S    +   R+ +G R V KAMF
Sbjct  81   VKMMYSCQAPVLKLHSFAGLRATNPLDIMGRPRQDWFSMSKLSIPKRKDKGKRCVTKAMF  140

Query  339  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  518
            ERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVE
Sbjct  141  ERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVE  200

Query  519  VEKIIWRGSGFVAVEIPFTPR  581
            VEKII RGSGFVAVEIPFTPR
Sbjct  201  VEKIIGRGSGFVAVEIPFTPR  221



>ref|XP_010503529.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like [Camelina 
sativa]
 ref|XP_010503530.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like [Camelina 
sativa]
Length=928

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 117/142 (82%), Gaps = 1/142 (1%)
 Frame = +3

Query  159  VAMLCSSQSPSLKLRSFTGLRGGNALDTMAR-SGQTLHSKvaaatsgrrgrgsravvKAM  335
            V M+ SSQ+P LK++ FTGL+  NALD  AR S Q   SKV    S R  +  R V KAM
Sbjct  31   VKMMFSSQAPVLKIQCFTGLKASNALDFRARPSHQDFVSKVNLNISYRMEKARRCVPKAM  90

Query  336  FERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARV  515
            FERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RV
Sbjct  91   FERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRV  150

Query  516  EVEKIIWRGSGFVAVEIPFTPR  581
            EVEKII RGSGFVAVEIPFTPR
Sbjct  151  EVEKIIGRGSGFVAVEIPFTPR  172



>ref|XP_009132682.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Brassica rapa]
Length=929

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 120/144 (83%), Gaps = 1/144 (1%)
 Frame = +3

Query  153  RVVAMLCSS-QSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvK  329
            R V M+C+  Q    +++ F GLRG N LDT+ RS Q+   KV  A +  +G+GSR VVK
Sbjct  33   RSVKMMCTQLQVSGSRMQGFLGLRGNNVLDTLGRSRQSFGGKVRQAMNVPKGKGSRGVVK  92

Query  330  AMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDA  509
            AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDA
Sbjct  93   AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDA  152

Query  510  RVEVEKIIWRGSGFVAVEIPFTPR  581
            RVEVEKII RGSGFVAVEIPFTPR
Sbjct  153  RVEVEKIIGRGSGFVAVEIPFTPR  176



>emb|CDY45800.1| BnaC03g16230D [Brassica napus]
Length=921

 Score =   156 bits (395),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 121/143 (85%), Gaps = 2/143 (1%)
 Frame = +3

Query  159  VAMLCSSQ--SPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  332
            V M+C+    S S +++ F GLRG NALDT+ RS Q+   KV  A +  +G+GSR VVKA
Sbjct  35   VKMMCTQLQVSGSSRMQGFLGLRGNNALDTLGRSRQSFGGKVRHAMNVPKGKGSRGVVKA  94

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  95   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  154

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            VEVEKII RGSGFVAVEIPFTPR
Sbjct  155  VEVEKIIGRGSGFVAVEIPFTPR  177



>ref|XP_010515218.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like [Camelina 
sativa]
 ref|XP_010515219.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like [Camelina 
sativa]
Length=928

 Score =   155 bits (392),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 116/142 (82%), Gaps = 1/142 (1%)
 Frame = +3

Query  159  VAMLCSSQSPSLKLRSFTGLRGGNALDTMAR-SGQTLHSKvaaatsgrrgrgsravvKAM  335
            V M+ S Q+P LK++ FTGLR  NALD  AR S Q   SKV    S R  +  R V KAM
Sbjct  31   VKMMFSLQAPVLKIQCFTGLRASNALDFRARPSHQDFVSKVNLNISSRIEKARRCVPKAM  90

Query  336  FERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARV  515
            FERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RV
Sbjct  91   FERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRV  150

Query  516  EVEKIIWRGSGFVAVEIPFTPR  581
            EVEKII RGSGFVAVEIPFTPR
Sbjct  151  EVEKIIGRGSGFVAVEIPFTPR  172



>ref|XP_008811697.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4A, chloroplastic-like [Phoenix dactylifera]
Length=916

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 131/177 (74%), Gaps = 5/177 (3%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MA  LV+S   P++ +   I       +G  +  R+  M+C+ +   L+L  FTGLR  N
Sbjct  1    MAGTLVKSATFPAVTSRAHI-----QIQGSRRPSRLTLMMCNVRVSPLRLHGFTGLRQLN  55

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            ALD   +SG+  HS ++A     RGR  R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  56   ALDFPYKSGKDFHSLISALNPASRGRAKRVVPKAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKS+GI+LKDAR+EVEKII RGSGFVAVEIPFTPR
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSLGISLKDARIEVEKIIGRGSGFVAVEIPFTPR  172



>ref|XP_009149790.1| PREDICTED: LOW QUALITY PROTEIN: chaperone protein ClpC2, chloroplastic 
[Brassica rapa]
Length=930

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 128/178 (72%), Gaps = 6/178 (3%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MAR+L  ST+   L +G          +   K +R V M+ +SQ+  L ++SF+GLR  N
Sbjct  1    MARLLANSTSRSLLGSGRDF-----QSEDYRKPRRCVKMMYTSQTSVLSIQSFSGLRASN  55

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsra-vvKAMFERFTEKAIKVIMLAQEEARRLGH  407
            ALD +AR       KV    S  R   +   V KAMFERFTEKAIKVIML+QEEARRLGH
Sbjct  56   ALDRVARPSHDFFGKVNLQMSSSRREKASRGVTKAMFERFTEKAIKVIMLSQEEARRLGH  115

Query  408  NFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVEVEKII RGSGFVAVEIPFTPR
Sbjct  116  NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVEVEKIIGRGSGFVAVEIPFTPR  173



>ref|XP_006485108.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like isoform X1 [Citrus sinensis]
 ref|XP_006485109.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like isoform X2 [Citrus sinensis]
Length=923

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 131/177 (74%), Gaps = 4/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MAR+L Q TN P+LV G    Q     +  G+ +R V M+   Q  + ++ SF+GLR  N
Sbjct  1    MARLLAQLTNAPALVPGGRHFQ----SQNAGRSRRNVKMMSYMQPSASRISSFSGLRRSN  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            ALDT      +  +   ++  G+ GR    VVKAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   ALDTFTCDFHSTVAVSLSSRRGKSGRAGGFVVKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  173



>ref|XP_009403788.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=922

 Score =   153 bits (386),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 135/177 (76%), Gaps = 4/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MA  LVQS  +P++    A+ + +   +G GK KR   M+C  +  SL+L+ F GLR  +
Sbjct  1    MAGSLVQSAILPTV----AVNRIQSHLRGSGKVKRGSKMMCQPRKHSLRLQGFAGLRRSD  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
             ++  +R+ +  HS V+   S  RG+ SR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   NVEFSSRNQRDFHSVVSGYISYSRGKASRGVAKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  173



>ref|XP_009393873.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=922

 Score =   152 bits (385),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 132/177 (75%), Gaps = 4/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MA  LV S  +PS V   +  Q +GSGK K    R   M+ S +   L+L+SF GLR  +
Sbjct  1    MADSLVHSAILPSAVMTRSQSQLRGSGKAK----RGAKMVRSMRMHPLRLQSFAGLRAAD  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
             LD  +R  Q  HS V+   S  RG+ +R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   NLDFSSRCQQDFHSVVSRYISNPRGKATRGVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  173



>gb|AAL10478.1| AT3g48870/T21J18_140 [Arabidopsis thaliana]
Length=558

 Score =   150 bits (378),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 114/141 (81%), Gaps = 0/141 (0%)
 Frame = +3

Query  159  VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  338
            V M+ S Q+P L ++SF+GLR  +ALD + R       K   A S  R + SR V KAMF
Sbjct  56   VKMMSSLQAPLLTIQSFSGLRAPSALDYLGRPSPGFLVKYKLAKSSGREKASRCVPKAMF  115

Query  339  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  518
            ERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVE
Sbjct  116  ERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVE  175

Query  519  VEKIIWRGSGFVAVEIPFTPR  581
            VEKII RGSGFVAVEIPFTPR
Sbjct  176  VEKIIGRGSGFVAVEIPFTPR  196



>ref|XP_009387981.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009387982.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=922

 Score =   152 bits (384),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 130/177 (73%), Gaps = 4/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MA  LVQ T +PS +A     Q +GSGK K    R   M+C  Q   L+L  F GLR  +
Sbjct  1    MAGSLVQLTILPSALANRRQSQLRGSGKAK----RGAKMMCQLQMHPLRLPGFAGLRRAD  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
             L+  +R+    HS V+   S   G+ SR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   NLEFFSRNRHDFHSLVSVYVSYAWGKASRGVAKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  173



>ref|XP_010929657.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Elaeis guineensis]
Length=920

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 134/177 (76%), Gaps = 4/177 (2%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MA  LVQS  +P+ V      Q KGSG+ +G       M+ + +  S++L+ F GLRG N
Sbjct  1    MAGALVQSAVLPAQVLSRNHRQLKGSGRTRG----AAKMMYNMRLHSIRLQGFAGLRGSN  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
             LD ++RS +  HS V+A  S  +G+  R V  AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   NLDLLSRSRRDFHSVVSAYISAPQGKACRGVPVAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  173



>ref|NP_001190035.1| Clp ATPase [Arabidopsis thaliana]
 gb|AEE78467.1| Clp ATPase [Arabidopsis thaliana]
Length=921

 Score =   150 bits (379),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 114/141 (81%), Gaps = 0/141 (0%)
 Frame = +3

Query  159  VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  338
            V M+ S Q+P L ++SF+GLR  +ALD + R       K   A S  R + SR V KAMF
Sbjct  25   VKMMSSLQAPLLTIQSFSGLRAPSALDYLGRPSPGFLVKYKLAKSSGREKASRCVPKAMF  84

Query  339  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  518
            ERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVE
Sbjct  85   ERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVE  144

Query  519  VEKIIWRGSGFVAVEIPFTPR  581
            VEKII RGSGFVAVEIPFTPR
Sbjct  145  VEKIIGRGSGFVAVEIPFTPR  165



>ref|NP_566912.2| Clp ATPase [Arabidopsis thaliana]
 sp|Q9SXJ7.1|CLPC2_ARATH RecName: Full=Chaperone protein ClpC2, chloroplastic; AltName: 
Full=ATP-dependent Clp protease ATP-binding subunit ClpC homolog 
2; AltName: Full=AtClpC; AltName: Full=Casein lytic proteinase 
C2; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAA82062.1| AtClpC [Arabidopsis thaliana]
 gb|AEE78466.1| Clp ATPase [Arabidopsis thaliana]
Length=952

 Score =   150 bits (378),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 114/141 (81%), Gaps = 0/141 (0%)
 Frame = +3

Query  159  VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  338
            V M+ S Q+P L ++SF+GLR  +ALD + R       K   A S  R + SR V KAMF
Sbjct  56   VKMMSSLQAPLLTIQSFSGLRAPSALDYLGRPSPGFLVKYKLAKSSGREKASRCVPKAMF  115

Query  339  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  518
            ERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVE
Sbjct  116  ERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVE  175

Query  519  VEKIIWRGSGFVAVEIPFTPR  581
            VEKII RGSGFVAVEIPFTPR
Sbjct  176  VEKIIGRGSGFVAVEIPFTPR  196



>emb|CAB87915.1| AtClpC [Arabidopsis thaliana]
Length=952

 Score =   150 bits (378),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 114/141 (81%), Gaps = 0/141 (0%)
 Frame = +3

Query  159  VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  338
            V M+ S Q+P L ++SF+GLR  +ALD + R       K   A S  R + SR V KAMF
Sbjct  56   VKMMSSLQAPLLTIQSFSGLRAPSALDYLGRPSPGFLVKYKLAKSSGREKASRCVPKAMF  115

Query  339  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  518
            ERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVE
Sbjct  116  ERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVE  175

Query  519  VEKIIWRGSGFVAVEIPFTPR  581
            VEKII RGSGFVAVEIPFTPR
Sbjct  176  VEKIIGRGSGFVAVEIPFTPR  196



>ref|XP_006404210.1| hypothetical protein EUTSA_v10010105mg [Eutrema salsugineum]
 gb|ESQ45663.1| hypothetical protein EUTSA_v10010105mg [Eutrema salsugineum]
Length=929

 Score =   150 bits (378),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = +3

Query  159  VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  338
            V M+ S  +P L +R+++GLR  +ALD MA       +KV  + S R+G+ SR V KAMF
Sbjct  32   VKMMSSLHAPVLSIRNYSGLRVNSALDLMASRSPDFFAKVNISISSRKGKASRCVPKAMF  91

Query  339  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVE  518
            ERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+RVE
Sbjct  92   ERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVE  151

Query  519  VEKIIWRGSGFVAVEIPFTPR  581
            VEKII RGSGFVAVEIPFTPR
Sbjct  152  VEKIIGRGSGFVAVEIPFTPR  172



>tpg|DAA38057.1| TPA: hypothetical protein ZEAMMB73_563254, partial [Zea mays]
Length=188

 Score =   138 bits (347),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 128/177 (72%), Gaps = 5/177 (3%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            M   LVQS  +P++    + G+F+   + +        M+ +  + +L L  F GLR  N
Sbjct  1    MEGTLVQSAVVPTVYRSSS-GRFRVRARARTN----ATMVRNMPTRTLTLGGFQGLRQTN  55

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
             LDT +   +   S VA+  +  RG  SR VV+AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  56   FLDTRSVIKRDFGSIVASQIARPRGSASRGVVRAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  172



>ref|XP_009411804.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Musa acuminata subsp. malaccensis]
 ref|XP_009411805.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=921

 Score =   147 bits (370),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 135/177 (76%), Gaps = 5/177 (3%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MAR L +S+ +P  V+G ++  F+GSGK +    +   M+CS +S  L+   FTGL+G N
Sbjct  1    MARPLFKSSVLPDAVSG-SVPLFQGSGKAR----KPANMMCSRRSSQLRFLGFTGLKGSN  55

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
             L  ++   +     V+A+ S  +G+ SR V  AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  56   DLHLVSGPSKDFRLAVSASVSAPKGKASRGVAVAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR+EVEKII RGSGFVAVEIPFTPR
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARIEVEKIIGRGSGFVAVEIPFTPR  172



>ref|XP_010921845.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4A, chloroplastic-like [Elaeis guineensis]
Length=914

 Score =   146 bits (369),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = +3

Query  153  RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  332
            R+  M+C+ +   L+++ FTGLR  NALD   +SG+  H  ++A +   RGR  R V KA
Sbjct  30   RLALMMCNVRVSPLRMQGFTGLRQLNALDFPYKSGRDFHFLISALSPTARGRAKRVVPKA  89

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKS+GI+LKDAR
Sbjct  90   VFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSLGISLKDAR  149

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
             EVEKII RGSGFVAVEIPFTPR
Sbjct  150  AEVEKIIGRGSGFVAVEIPFTPR  172



>ref|XP_009404743.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009404744.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=921

 Score =   146 bits (369),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 133/177 (75%), Gaps = 5/177 (3%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MA  LVQS  +P+++   +  Q +GSGK K    R   M+C  Q   L+L+ F GLR  +
Sbjct  1    MAGSLVQSAVLPAVIMNRSHSQLQGSGKAK----RGARMICQLQMHPLRLQGFAGLRVAD  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
             L + +R  Q  HS V+   +  RGR SR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   NLFS-SRHRQDFHSVVSGYITNPRGRPSRLVTKAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGI+LKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGISLKDARVEVEKIIGRGSGFVAVEIPFTPR  172



>emb|CDY05878.1| BnaC08g20550D [Brassica napus]
Length=932

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 113/144 (78%), Gaps = 2/144 (1%)
 Frame = +3

Query  156  VVAMLCSSQSPSLKLRSFTGLRGG-NALDTMARSGQTLHSKvaaatsgrrgrgsra-vvK  329
            V  M+ +SQ+  L ++SF+GLR   NALD +AR       KV    S  R   +   V K
Sbjct  32   VKMMMYTSQTSVLSIQSFSGLRASSNALDRVARPSHDFFGKVNLQISSSRKGKASRGVTK  91

Query  330  AMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDA  509
            AMFERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD+
Sbjct  92   AMFERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDS  151

Query  510  RVEVEKIIWRGSGFVAVEIPFTPR  581
            RVEVEKII RGSGFVAVEIPFTPR
Sbjct  152  RVEVEKIIGRGSGFVAVEIPFTPR  175



>ref|XP_003575035.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Brachypodium 
distachyon]
Length=921

 Score =   141 bits (356),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 116/140 (83%), Gaps = 0/140 (0%)
 Frame = +3

Query  162  AMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFE  341
            A +CS ++ ++ L  F GLR  N LDT +   +   S VA+  +  RG+GSR VV+AMFE
Sbjct  33   ASVCSMRTQTMTLGGFQGLRRANFLDTRSVVRRDFGSIVASQLARPRGKGSRMVVRAMFE  92

Query  342  RFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEV  521
            RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEV
Sbjct  93   RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEV  152

Query  522  EKIIWRGSGFVAVEIPFTPR  581
            EKII RGSGFVAVEIPFTPR
Sbjct  153  EKIIGRGSGFVAVEIPFTPR  172



>sp|P46523.1|CLPA_BRANA RecName: Full=ATP-dependent Clp protease ATP-binding subunit 
clpA homolog, chloroplastic; Flags: Precursor, partial [Brassica 
napus]
 emb|CAA53077.1| clpA [Brassica napus]
Length=874

 Score =   141 bits (355),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +3

Query  222  GGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRL  401
            G N LDT+ RS Q+   KV  A +  +G+GSR VVKAMFERFTEKAIKVIMLAQEEARRL
Sbjct  4    GNNVLDTLGRSRQSFGGKVRQAMNVPKGKGSRGVVKAMFERFTEKAIKVIMLAQEEARRL  63

Query  402  GHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            GHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  64   GHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  123



>gb|EMS54417.1| ATP-dependent Clp protease ATP-binding subunit clpA-like protein 
CD4B, chloroplastic [Triticum urartu]
Length=376

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 112/136 (82%), Gaps = 0/136 (0%)
 Frame = +3

Query  174  SSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTE  353
            S ++ ++ L  F GLR  N LDT +       S VA+  +  RG+GSR VV+AMFERFTE
Sbjct  32   SMETQTITLGGFQGLRRANFLDTKSVVRHDFGSIVASQLARPRGKGSRMVVRAMFERFTE  91

Query  354  KAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKII  533
            KAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII
Sbjct  92   KAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII  151

Query  534  WRGSGFVAVEIPFTPR  581
             RGSGFVAVEIPFTPR
Sbjct  152  GRGSGFVAVEIPFTPR  167



>ref|XP_003575034.2| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Brachypodium 
distachyon]
Length=921

 Score =   141 bits (355),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 115/140 (82%), Gaps = 0/140 (0%)
 Frame = +3

Query  162  AMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFE  341
            A +CS ++ ++ L  F GLR  N LDT +   +   S VA   +  RG+GSR VV+AMFE
Sbjct  33   ASVCSMRTQTMTLGGFQGLRRANFLDTRSVVRRDFGSIVAHQLARPRGKGSRMVVRAMFE  92

Query  342  RFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEV  521
            RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEV
Sbjct  93   RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEV  152

Query  522  EKIIWRGSGFVAVEIPFTPR  581
            EKII RGSGFVAVEIPFTPR
Sbjct  153  EKIIGRGSGFVAVEIPFTPR  172



>emb|CAN78847.1| hypothetical protein VITISV_010724 [Vitis vinifera]
Length=890

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 121/177 (68%), Gaps = 30/177 (17%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MAR LVQSTNI + VA    G+F+GS + K    + V M+C++     + +    +RGG 
Sbjct  1    MARALVQSTNIFASVADGKHGKFQGSERTK----KSVKMMCNAMISIPEWQLLFLVRGGK  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            A   +AR                          AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   ASRCVAR--------------------------AMFERFTEKAIKVIMLAQEEARRLGHN  90

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  91   FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  147



>gb|EMT20100.1| ATP-dependent Clp protease ATP-binding subunit clpA-like CD4A 
protein, chloroplastic [Aegilops tauschii]
Length=546

 Score =   135 bits (341),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 112/136 (82%), Gaps = 0/136 (0%)
 Frame = +3

Query  174  SSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTE  353
            S ++ ++ L  F GLR  N LDT +       S VA+  +  RG+GSR VV+AMFERFTE
Sbjct  32   SMETQTITLGGFQGLRRANFLDTKSVVRHDFGSIVASQLARPRGKGSRMVVRAMFERFTE  91

Query  354  KAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKII  533
            KAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII
Sbjct  92   KAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII  151

Query  534  WRGSGFVAVEIPFTPR  581
             RGSGFVAVEIPFTPR
Sbjct  152  GRGSGFVAVEIPFTPR  167



>gb|EMS48250.1| ATP-dependent Clp protease ATP-binding subunit clpA-like protein 
CD4B, chloroplastic [Triticum urartu]
Length=241

 Score =   131 bits (329),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 112/143 (78%), Gaps = 2/143 (1%)
 Frame = +3

Query  153  RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  332
            R  +ML  S +  +++ +F GLR  ++   +  S     S VA+    RRGR +  V +A
Sbjct  80   RTPSMLAMSLNRPVRMAAFVGLRSVHSFSAVRSS--NFRSTVASYRFSRRGRRASFVTRA  137

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQ+LLGL+GEGTGIAAKVLKSMGINLKDAR
Sbjct  138  MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQVLLGLVGEGTGIAAKVLKSMGINLKDAR  197

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            VEVEKII RG+GFVAVEIPFTPR
Sbjct  198  VEVEKIIGRGNGFVAVEIPFTPR  220



>ref|XP_004975455.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Setaria 
italica]
Length=918

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = +3

Query  165  MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  344
            ML S+ + +L L  F GLR  N LDT +   +     VA+  S  RG  SR VV+AMFER
Sbjct  31   MLRSTPTRTLTLGGFQGLRQTNFLDTRSVVKRDFGYIVASQISRPRGSASRGVVRAMFER  90

Query  345  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVE  524
            FTEKAIKV+MLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE
Sbjct  91   FTEKAIKVVMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE  150

Query  525  KIIWRGSGFVAVEIPFTPR  581
            KII RGSGFVAVEIPFTPR
Sbjct  151  KIIGRGSGFVAVEIPFTPR  169



>ref|XP_004975454.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Setaria 
italica]
Length=921

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 128/177 (72%), Gaps = 5/177 (3%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            M   LVQS  +P++    + G+F+   + +        M+ +  + +L L  F GLR  N
Sbjct  1    MEGALVQSAIVPTIYRSNS-GRFRVRARARTN----ATMVRNMPTRTLTLGGFQGLRQTN  55

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
             LDT +   +   S VA+  +  RG  SR VV+AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  56   FLDTRSVVKRDFGSIVASQIARPRGSASRGVVRAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  172



>gb|EMS46268.1| ATP-dependent Clp protease ATP-binding subunit clpA-like protein 
CD4B, chloroplastic [Triticum urartu]
Length=887

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 114/140 (81%), Gaps = 0/140 (0%)
 Frame = +3

Query  162  AMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFE  341
             ML S+ + +L L  F GLR  N LDT +   +   S VA+  S  RG GSR VV+AMFE
Sbjct  29   TMLRSTPTRTLTLGGFQGLRQTNFLDTRSVIKRDFGSIVASQISRPRGSGSRMVVRAMFE  88

Query  342  RFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEV  521
            RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGI+LKDARVEV
Sbjct  89   RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGISLKDARVEV  148

Query  522  EKIIWRGSGFVAVEIPFTPR  581
            EKII RGSGFVAVEIPFTPR
Sbjct  149  EKIIGRGSGFVAVEIPFTPR  168



>ref|XP_008663153.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Zea mays]
 gb|AFW58112.1| hypothetical protein ZEAMMB73_120778 [Zea mays]
Length=921

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 129/177 (73%), Gaps = 5/177 (3%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            M   LVQS  +P++    + G+F+   + +        M+ ++ + +L L  F GLR  N
Sbjct  1    MEGALVQSAIVPAVYRSSS-GRFRVRARARTN----ATMVRNTPTRTLTLGGFQGLRQTN  55

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
             LDT +   +   S VA+  +  RG  SR VV+AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  56   FLDTRSVIKRDFGSIVASQIARPRGSASRGVVRAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKV+KSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVMKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  172



>ref|XP_001690745.1| hypothetical protein CHLREDRAFT_110360 [Chlamydomonas reinhardtii]
 gb|EDO95778.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=97

 Score =   125 bits (315),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/83 (94%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKV+MLAQEEARRLGHNFVGTEQ+LLGLIGE TGIAAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVVMLAQEEARRLGHNFVGTEQLLLGLIGESTGIAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            VEVEKII RGSGFVAVEIPFTPR
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPR  83



>gb|KGN63436.1| hypothetical protein Csa_1G000600 [Cucumis sativus]
Length=862

 Score =   136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = +3

Query  243  MARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgt  422
            M RS Q  HSKVA A S RR + SR V +AMFERFTEKAIKVIMLAQEEARRLGHNFVGT
Sbjct  1    MLRSRQNFHSKVATAISSRRRKASRCVPRAMFERFTEKAIKVIMLAQEEARRLGHNFVGT  60

Query  423  eqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            EQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSGFVAVEIPFTPR
Sbjct  61   EQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR  113



>ref|XP_002447724.1| hypothetical protein SORBIDRAFT_06g014590 [Sorghum bicolor]
 gb|EES12052.1| hypothetical protein SORBIDRAFT_06g014590 [Sorghum bicolor]
Length=921

 Score =   135 bits (341),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = +3

Query  189  SLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKV  368
            +L L  F GLR  N LDT +   +   S VA+  +  RG  SR VV+AMFERFTEKAIKV
Sbjct  42   TLTLGGFQGLRQTNFLDTRSVIKRDFVSIVASQIARPRGSASRGVVRAMFERFTEKAIKV  101

Query  369  IMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSG  548
            IMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RGSG
Sbjct  102  IMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSG  161

Query  549  FVAVEIPFTPR  581
            FVAVEIPFTPR
Sbjct  162  FVAVEIPFTPR  172



>gb|EEC77204.1| hypothetical protein OsI_15716 [Oryza sativa Indica Group]
Length=785

 Score =   134 bits (338),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = +3

Query  165  MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  344
            M+ +  + +L L  F GLR  N LD+ +   +   S VA+  S  RG GSR VV+AMFER
Sbjct  31   MMRTMPTRTLTLGGFQGLRQTNFLDSRSVIKRDFGSIVASQISRPRGLGSRGVVRAMFER  90

Query  345  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVE  524
            FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE
Sbjct  91   FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE  150

Query  525  KIIWRGSGFVAVEIPFTPR  581
            KII RGSGFVAVEIPFTPR
Sbjct  151  KIIGRGSGFVAVEIPFTPR  169



>sp|Q7F9I1.2|CLPC1_ORYSJ RecName: Full=Chaperone protein ClpC1, chloroplastic; AltName: 
Full=ATP-dependent Clp protease ATP-binding subunit ClpC homolog 
1; AltName: Full=Casein lytic proteinase C1; Flags: Precursor 
[Oryza sativa Japonica Group]
Length=918

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = +3

Query  165  MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  344
            M+ +  + +L L  F GLR  N LD+ +   +   S VA+  S  RG GSR VV+AMFER
Sbjct  31   MMRTMPTRTLTLGGFQGLRQTNFLDSRSVIKRDFGSIVASQISRPRGLGSRGVVRAMFER  90

Query  345  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVE  524
            FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE
Sbjct  91   FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE  150

Query  525  KIIWRGSGFVAVEIPFTPR  581
            KII RGSGFVAVEIPFTPR
Sbjct  151  KIIGRGSGFVAVEIPFTPR  169



>emb|CAE05148.2| OSJNBa0039C07.4 [Oryza sativa Japonica Group]
Length=888

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = +3

Query  165  MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  344
            M+ +  + +L L  F GLR  N LD+ +   +   S VA+  S  RG GSR VV+AMFER
Sbjct  1    MMRTMPTRTLTLGGFQGLRQTNFLDSRSVIKRDFGSIVASQISRPRGLGSRGVVRAMFER  60

Query  345  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVE  524
            FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE
Sbjct  61   FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE  120

Query  525  KIIWRGSGFVAVEIPFTPR  581
            KII RGSGFVAVEIPFTPR
Sbjct  121  KIIGRGSGFVAVEIPFTPR  139



>ref|XP_006652229.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Oryza 
brachyantha]
Length=888

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = +3

Query  165  MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  344
            M+ +  + +L L  F GLR  N LD+ +   +   + VA+  S  RG  SR VV+AMFER
Sbjct  1    MMRTMPTRTLTLGGFQGLRQTNFLDSRSVVKRDFGAIVASQISRHRGSASRGVVRAMFER  60

Query  345  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVE  524
            FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE
Sbjct  61   FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE  120

Query  525  KIIWRGSGFVAVEIPFTPR  581
            KII RGSGFVAVEIPFTPR
Sbjct  121  KIIGRGSGFVAVEIPFTPR  139



>ref|WP_032558761.1| hypothetical protein, partial [Prochlorococcus sp. scB243_498A3]
Length=100

 Score =   123 bits (309),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/83 (93%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKS+G+NLKD+R
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSLGVNLKDSR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_032554674.1| hypothetical protein, partial [Prochlorococcus sp. scB245a_518J7]
Length=91

 Score =   123 bits (308),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/83 (93%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKS+G+NLKD+R
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSLGVNLKDSR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>gb|EAZ30583.1| hypothetical protein OsJ_14634 [Oryza sativa Japonica Group]
Length=1033

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 113/140 (81%), Gaps = 0/140 (0%)
 Frame = +3

Query  162  AMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFE  341
             M+ +  + +L L  F GLR  N LD+ +   +   S VA+  S  RG GSR VV+AMFE
Sbjct  145  TMMRTMPTRTLTLGGFQGLRQTNFLDSRSVIKRDFGSIVASQISRPRGLGSRGVVRAMFE  204

Query  342  RFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEV  521
            RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEV
Sbjct  205  RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEV  264

Query  522  EKIIWRGSGFVAVEIPFTPR  581
            EKII RGSGFVAVEIPFTPR
Sbjct  265  EKIIGRGSGFVAVEIPFTPR  284



>ref|XP_010238595.1| PREDICTED: chaperone protein ClpC2, chloroplastic [Brachypodium 
distachyon]
Length=920

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 125/177 (71%), Gaps = 6/177 (3%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MA  L+    + S  AG A GQ           +R  +ML  S +  +++ +F GLR  +
Sbjct  1    MAGTLLLPVALGSTFAGRASGQ----RWKSHGTRRPASMLAMSLNRPVRMAAFVGLRSAH  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            +    A       S VA+  S RRGR +R V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   SF--TATPASNYRSTVASYRSSRRGRRTRFVTRAMFERFTEKAIKVIMLAQEEARRLGHN  114

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGL+GEGTGIAAKVLKSMGINLKDARVEVEKII RG+GFVAVEIPFTPR
Sbjct  115  FVGTEQILLGLVGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGNGFVAVEIPFTPR  171



>ref|WP_032553896.1| hypothetical protein, partial [Prochlorococcus sp. scB243_498J20]
Length=123

 Score =   124 bits (310),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 77/83 (93%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKS+G+NLKD+R
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSLGVNLKDSR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>dbj|BAJ99801.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=920

 Score =   133 bits (334),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 112/143 (78%), Gaps = 2/143 (1%)
 Frame = +3

Query  153  RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  332
            R  +ML  S +  +++ +F GLR  ++   M  S     S VA+    RRGR +  V +A
Sbjct  31   RTPSMLAMSLNRPVRMAAFVGLRSVHSFSAMRSS--NFRSTVASYRFSRRGRRASFVTRA  88

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQ+LLGL+GEGTGIAAKVLKSMGINLKDAR
Sbjct  89   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQVLLGLVGEGTGIAAKVLKSMGINLKDAR  148

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            VEVEKII RG+GFVAVEIPFTPR
Sbjct  149  VEVEKIIGRGNGFVAVEIPFTPR  171



>ref|XP_006663917.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like [Oryza 
brachyantha]
Length=919

 Score =   132 bits (333),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 123/177 (69%), Gaps = 7/177 (4%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MA  L+Q   + +  AG   GQ           +R  +ML  S S  +K+ +F GLR  +
Sbjct  1    MAGTLLQPVALGTTFAGRVSGQ----RWKSHGTRRPPSMLAMSLSRPVKMAAFVGLRSVH  56

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            +   M  S         A+   RRGR +R V ++MFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   SFSVMPVSN---FRSTVASYRSRRGRRTRFVTRSMFERFTEKAIKVIMLAQEEARRLGHN  113

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RG+GFVAVEIPFTPR
Sbjct  114  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGNGFVAVEIPFTPR  170



>ref|XP_001756645.1| predicted protein [Physcomitrella patens]
 gb|EDQ78599.1| predicted protein [Physcomitrella patens]
Length=933

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 129/181 (71%), Gaps = 9/181 (5%)
 Frame = +3

Query  63   LVQSTNIPSLVAGEAIGQFkgsgkgkgk-gkRVVAM----LCSSQSPSL-KLRSFTGLRG  224
            +  S  IPS V    +GQF GS K K +   R  +M    +  S S S+ + +SF+G+R 
Sbjct  1    MAHSLTIPS-VGASPVGQFNGSRKSKKQGAARAASMGRRNVDKSASMSVARFQSFSGMRK  59

Query  225  GNALDTMA-RSGQTLHSKvaaatsgrrgrgsra-vvKAMFERFTEKAIKVIMLAQEEARR  398
            G+ +D +  + G+   S VA +T+          V  AMFERFTEKAIKVIMLAQEEARR
Sbjct  60   GSVVDALVVKQGKDFKSVVANSTAVTGHSRPSRGVTTAMFERFTEKAIKVIMLAQEEARR  119

Query  399  LGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTP  578
            LGHNFVGTEQILLGLIGEGTGIAAKVLKSMG+NLK+ARVEVEKII RGSGFVAVEIPFTP
Sbjct  120  LGHNFVGTEQILLGLIGEGTGIAAKVLKSMGVNLKEARVEVEKIIGRGSGFVAVEIPFTP  179

Query  579  R  581
            R
Sbjct  180  R  180



>ref|XP_001779162.1| predicted protein [Physcomitrella patens]
 gb|EDQ56008.1| predicted protein [Physcomitrella patens]
Length=922

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 125/184 (68%), Gaps = 15/184 (8%)
 Frame = +3

Query  63   LVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLK---------LRSFTG  215
            +  S  +PS V    +GQ   S K K    R +A   S+   +LK          +SF+G
Sbjct  4    MAHSLTLPS-VGSSLVGQLNDSAKSKR---RTIAQAASTGRKNLKKSASLSVSGFQSFSG  59

Query  216  LRGGNALDTMA-RSGQTLHSKvaaatsgrrgrgsravvK-AMFERFTEKAIKVIMLAQEE  389
            +R  +A+D +  + G+ L S VA + +          V  AMFERFTEKAIKVIMLAQEE
Sbjct  60   MRKASAVDALTVKQGKDLKSVVAKSMAVAGHSRPSRGVTFAMFERFTEKAIKVIMLAQEE  119

Query  390  ARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIP  569
            ARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMG+NLK+ARVEVEKII RGSGFVAVEIP
Sbjct  120  ARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGVNLKEARVEVEKIIGRGSGFVAVEIP  179

Query  570  FTPR  581
            FTPR
Sbjct  180  FTPR  183



>ref|XP_004960741.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like isoform 
X1 [Setaria italica]
 ref|XP_004960742.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like isoform 
X2 [Setaria italica]
Length=921

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 112/143 (78%), Gaps = 1/143 (1%)
 Frame = +3

Query  153  RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  332
            R  +ML  S S  +K+ +F GLR  ++         +  S VA+  S RR R SR V +A
Sbjct  31   RPASMLAMSLSRPVKMSAFVGLRSVHSFSVTPTVSNS-RSAVASYRSSRRTRRSRFVTRA  89

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  90   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  149

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            VEVEKII RG+GFVAVEIPFTPR
Sbjct  150  VEVEKIIGRGNGFVAVEIPFTPR  172



>ref|NP_001169540.1| uncharacterized protein LOC100383416 [Zea mays]
 gb|ACN34070.1| unknown [Zea mays]
 gb|AFW56690.1| cytokinin inducible protease1 [Zea mays]
Length=921

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 112/143 (78%), Gaps = 1/143 (1%)
 Frame = +3

Query  153  RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  332
            R  +ML  S S  +K+ +F GLR  ++         +  S VA+  S R+ R SR V +A
Sbjct  31   RPASMLAVSLSRPVKMSAFVGLRSVHSFSVTPTVSNS-RSAVASYRSSRQTRRSRFVTQA  89

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  90   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  149

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            VEVEKII RG+GFVAVEIPFTPR
Sbjct  150  VEVEKIIGRGNGFVAVEIPFTPR  172



>gb|KIY94281.1| ATP-dependent Clp protease ATP-binding subunit ClpC [Monoraphidium 
neglectum]
Length=300

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKV+MLAQEEARRLGHNFVGTEQILLGLIGE TGIAAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVVMLAQEEARRLGHNFVGTEQILLGLIGESTGIAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            VEVEKII RGSGFVAVEIPFTPR
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPR  83



>gb|EDZ93048.1| Clp domain protein [Arthrospira maxima CS-328]
Length=402

 Score =   127 bits (318),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|NP_001066442.1| Os12g0230100 [Oryza sativa Japonica Group]
 sp|Q2QVG9.2|CLPC2_ORYSJ RecName: Full=Chaperone protein ClpC2, chloroplastic; AltName: 
Full=ATP-dependent Clp protease ATP-binding subunit ClpC homolog 
2; AltName: Full=Casein lytic proteinase C2; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|ABA96309.2| ATP-dependent Clp protease ATP-binding subunit clpA CD4B,chloroplast 
precursor, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABG21929.1| ATP-dependent Clp protease ATP-binding subunit clpA CD4B,chloroplast 
precursor, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29461.1| Os12g0230100 [Oryza sativa Japonica Group]
Length=919

 Score =   130 bits (327),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 125/177 (71%), Gaps = 7/177 (4%)
 Frame = +3

Query  51   MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  230
            MA  L+Q   + +  AG   GQ           +R  +ML  S S  +K+ +F GLR   
Sbjct  1    MAGTLLQPVALGTTFAGRVSGQ----RWKSHGTRRPPSMLAMSLSRPVKMAAFVGLR---  53

Query  231  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  410
            ++ + + +  T      A+   RRGR +R V ++MFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  54   SVHSFSVTPVTNFRSTVASYRSRRGRRARFVTRSMFERFTEKAIKVIMLAQEEARRLGHN  113

Query  411  FVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPFTPR  581
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RG+GFVAVEIPFTPR
Sbjct  114  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGNGFVAVEIPFTPR  170



>gb|AAB67745.1| ClpC [Synechococcus elongatus PCC 7942]
Length=839

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 80/85 (94%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +3

Query  327  KAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  506
            +AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  14   EAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  73

Query  507  ARVEVEKIIWRGSGFVAVEIPFTPR  581
            AR+EVEKII RGSGFVAVEIPFTPR
Sbjct  74   ARIEVEKIIGRGSGFVAVEIPFTPR  98



>ref|XP_002952540.1| hypothetical protein VOLCADRAFT_75431 [Volvox carteri f. nagariensis]
 gb|EFJ46387.1| hypothetical protein VOLCADRAFT_75431 [Volvox carteri f. nagariensis]
Length=915

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 79/85 (93%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +3

Query  327  KAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  506
            K+MFERFTEKAIKV+MLAQEEARRLGHNFVGTEQ+LLGLIGE TGIAAKVLKSMG+NLKD
Sbjct  73   KSMFERFTEKAIKVVMLAQEEARRLGHNFVGTEQLLLGLIGESTGIAAKVLKSMGVNLKD  132

Query  507  ARVEVEKIIWRGSGFVAVEIPFTPR  581
            ARVEVEKII RGSGFVAVEIPFTPR
Sbjct  133  ARVEVEKIIGRGSGFVAVEIPFTPR  157



>ref|XP_002977161.1| hypothetical protein SELMODRAFT_176012 [Selaginella moellendorffii]
 gb|EFJ21770.1| hypothetical protein SELMODRAFT_176012 [Selaginella moellendorffii]
Length=901

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 110/129 (85%), Gaps = 1/129 (1%)
 Frame = +3

Query  198  LRSFTGLRGGNALDTMA-RSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIM  374
            L+++ G+R  + LD++A R+ +  +S V++ ++      SR VV AMFERFTEKAIKVIM
Sbjct  21   LQTYVGMRKPSPLDSLATRTCKDWNSVVSSVSTSGGRGASRGVVVAMFERFTEKAIKVIM  80

Query  375  LAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFV  554
            LAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMG+NLK+ARVEVEKII RGSGFV
Sbjct  81   LAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGVNLKEARVEVEKIIGRGSGFV  140

Query  555  AVEIPFTPR  581
            AVEIPFTPR
Sbjct  141  AVEIPFTPR  149



>dbj|BAB74698.1| endopeptidase Clp ATP-binding chain [Nostoc sp. PCC 7120]
Length=839

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 80/84 (95%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  AMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDA  509
            AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDA
Sbjct  16   AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDA  75

Query  510  RVEVEKIIWRGSGFVAVEIPFTPR  581
            R+EVEKII RGSGFVAVEIPFTPR
Sbjct  76   RIEVEKIIGRGSGFVAVEIPFTPR  99



>ref|XP_010446016.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Camelina 
sativa]
Length=546

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 81/83 (98%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNF+GTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFMGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            VEVEKII RGSGFVAVEIPFTPR
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPR  83



>gb|EEC69045.1| hypothetical protein OsI_37876 [Oryza sativa Indica Group]
Length=1412

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 127/183 (69%), Gaps = 7/183 (4%)
 Frame = +3

Query  33   GSLGGIMARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFT  212
            G L   MA  L+Q   + +  AG   GQ           +R  +ML  S S  +K+ +F 
Sbjct  488  GKLLLTMAGTLLQPVALGTTFAGRVSGQ----RWKSHGTRRPPSMLAMSLSRPVKMAAFV  543

Query  213  GLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEA  392
            GLR   ++ + + +  T      A+   RRGR +R V ++MFERFTEKAIKVIMLAQEEA
Sbjct  544  GLR---SVHSFSVTPVTNFRSTVASYRSRRGRRARFVTRSMFERFTEKAIKVIMLAQEEA  600

Query  393  RRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFVAVEIPF  572
            RRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKII RG+GFVAVEIPF
Sbjct  601  RRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGNGFVAVEIPF  660

Query  573  TPR  581
            TPR
Sbjct  661  TPR  663



>gb|AFW96628.1| ATP-dependent Clp family protein [Anabaena sp. 90]
Length=838

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 80/85 (94%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +3

Query  327  KAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  506
             AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  15   NAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  74

Query  507  ARVEVEKIIWRGSGFVAVEIPFTPR  581
            AR+EVEKII RGSGFVAVEIPFTPR
Sbjct  75   ARIEVEKIIGRGSGFVAVEIPFTPR  99



>gb|AFY46028.1| ATPase with chaperone activity, ATP-binding subunit [Nostoc sp. 
PCC 7524]
Length=856

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 80/84 (95%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  AMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDA  509
            AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDA
Sbjct  33   AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDA  92

Query  510  RVEVEKIIWRGSGFVAVEIPFTPR  581
            R+EVEKII RGSGFVAVEIPFTPR
Sbjct  93   RIEVEKIIGRGSGFVAVEIPFTPR  116



>gb|EHC12174.1| ATPase AAA-2 domain protein [Fischerella sp. JSC-11]
Length=851

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 80/85 (94%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +3

Query  327  KAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  506
             AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  28   NAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  87

Query  507  ARVEVEKIIWRGSGFVAVEIPFTPR  581
            AR+EVEKII RGSGFVAVEIPFTPR
Sbjct  88   ARIEVEKIIGRGSGFVAVEIPFTPR  112



>gb|KIZ07494.1| ATP-dependent Clp protease ATP-binding subunit ClpC [Monoraphidium 
neglectum]
Length=938

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 80/84 (95%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +3

Query  330  AMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDA  509
            AMFERFTEKAIKV+MLAQEEARRLGHNFVGTEQILLGLIGE TGIAAKVLKSMG+NLKDA
Sbjct  78   AMFERFTEKAIKVVMLAQEEARRLGHNFVGTEQILLGLIGESTGIAAKVLKSMGVNLKDA  137

Query  510  RVEVEKIIWRGSGFVAVEIPFTPR  581
            RVEVEKII RGSGFVAVEIPFTPR
Sbjct  138  RVEVEKIIGRGSGFVAVEIPFTPR  161



>ref|XP_006374569.1| hypothetical protein POPTR_0015s11640g [Populus trichocarpa]
 gb|ERP52366.1| hypothetical protein POPTR_0015s11640g [Populus trichocarpa]
Length=835

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 82/83 (99%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            VEVEKII RGSGFVAVEIPFTPR
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPR  83



>gb|ABK95905.1| unknown [Populus trichocarpa]
Length=835

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 82/83 (99%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            VEVEKII RGSGFVAVEIPFTPR
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_044105586.1| Clp protease ClpX [cyanobacterium endosymbiont of Epithemia turgida]
 dbj|BAP16974.1| ATP-dependent Clp protease regulatory subunit [cyanobacterium 
endosymbiont of Epithemia turgida isolate EtSB Lake Yunoko]
Length=823

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 81/83 (98%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMGINLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGINLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            VEVEKII RGSGFVAVEIPFTPR
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPR  83



>emb|CDX84888.1| BnaA03g13420D [Brassica napus]
Length=827

 Score =   127 bits (319),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 82/83 (99%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            VEVEKII RGSGFVAVEIPFTPR
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_015162264.1| ATPase with chaperone activity, ATP-binding subunit [Chamaesiphon 
minutus]
 gb|AFY96180.1| ATPase with chaperone activity, ATP-binding subunit [Chamaesiphon 
minutus PCC 6605]
Length=833

 Score =   127 bits (319),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 80/83 (96%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMGINLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGINLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_039899756.1| Clp protease ClpX, partial [Microcystis sp. T1-4]
Length=718

 Score =   127 bits (318),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 80/83 (96%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            VEVEKII RGSGFVAVEIPFTPR
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_011364587.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. CC9605]
 gb|ABB35376.1| ATPase [Synechococcus sp. CC9605]
Length=846

 Score =   127 bits (319),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 80/83 (96%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            VEVEKII RGSGFVAVEIPFTPR
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_012162462.1| ATP-dependent Clp protease ATP-binding protein [Acaryochloris 
marina]
 gb|ABW26964.1| ATP-dependent protease, ATP-binding subunit ClpC [Acaryochloris 
marina MBIC11017]
Length=822

 Score =   127 bits (319),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 80/83 (96%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            VEVEKII RGSGFVAVEIPFTPR
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_038554285.1| Clp protease ClpX [Synechococcus sp. KORDI-52]
 gb|AII49099.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. KORDI-52]
Length=846

 Score =   127 bits (319),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 80/83 (96%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            VEVEKII RGSGFVAVEIPFTPR
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_010467511.1| ATP-dependent Clp protease ATP-binding protein [Acaryochloris 
sp. CCMEE 5410]
Length=822

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 80/83 (96%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            VEVEKII RGSGFVAVEIPFTPR
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_041428551.1| Clp protease ClpX [Synechococcus sp. WH 7803]
Length=857

 Score =   127 bits (319),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 80/83 (96%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            VEVEKII RGSGFVAVEIPFTPR
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_038544339.1| Clp protease ClpX [Synechococcus sp. KORDI-100]
 gb|AII43210.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. KORDI-100]
Length=862

 Score =   127 bits (319),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 80/83 (96%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            VEVEKII RGSGFVAVEIPFTPR
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPR  83



>gb|AHF63374.1| ATPase [Synechococcus sp. WH 8109]
Length=846

 Score =   127 bits (319),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 80/83 (96%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            VEVEKII RGSGFVAVEIPFTPR
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_006170858.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. WH 5701]
 gb|EAQ74030.1| endopeptidase Clp ATP-binding chain C [Synechococcus sp. WH 5701]
Length=856

 Score =   127 bits (319),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 80/83 (96%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            VEVEKII RGSGFVAVEIPFTPR
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_028951828.1| Clp protease ClpX [Synechococcus sp. CC9616]
Length=856

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 80/83 (96%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            VEVEKII RGSGFVAVEIPFTPR
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_006852318.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. WH 8016]
 gb|EHA63138.1| ATPase AAA-2 domain protein [Synechococcus sp. WH 8016]
Length=860

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 80/83 (96%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            VEVEKII RGSGFVAVEIPFTPR
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_007100194.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. RS9917]
 gb|EAQ68890.1| endopeptidase Clp ATP-binding chain C [Synechococcus sp. RS9917]
Length=860

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 80/83 (96%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            VEVEKII RGSGFVAVEIPFTPR
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_015107874.1| chaperone ATPase [Cyanobium gracile]
 gb|AFY27415.1| ATPase with chaperone activity, ATP-binding subunit [Cyanobium 
gracile PCC 6307]
Length=849

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 80/83 (96%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            VEVEKII RGSGFVAVEIPFTPR
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_011127803.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. WH 8102]
 emb|CAE07453.1| endopeptidase Clp ATP-binding chain C [Synechococcus sp. WH 8102]
Length=846

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 80/83 (96%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            VEVEKII RGSGFVAVEIPFTPR
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPR  83



>ref|XP_002965312.1| hypothetical protein SELMODRAFT_439163 [Selaginella moellendorffii]
 gb|EFJ34150.1| hypothetical protein SELMODRAFT_439163 [Selaginella moellendorffii]
Length=937

 Score =   127 bits (319),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 109/129 (84%), Gaps = 1/129 (1%)
 Frame = +3

Query  198  LRSFTGLRGGNALDTMARSG-QTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIM  374
            L+++ G+R  + LD++A S  +  +S V++ ++      SR VV AMFERFTEKAIKVIM
Sbjct  57   LQTYVGMRKPSPLDSLATSTCKDWNSVVSSVSTSGGRGASRGVVVAMFERFTEKAIKVIM  116

Query  375  LAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEKIIWRGSGFV  554
            LAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMG+NLK+ARVEVEKII RGSGFV
Sbjct  117  LAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGVNLKEARVEVEKIIGRGSGFV  176

Query  555  AVEIPFTPR  581
            AVEIPFTPR
Sbjct  177  AVEIPFTPR  185



>ref|WP_044521582.1| Clp protease ClpX [Nostoc sp. PCC 7120]
Length=823

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_002765002.1| ATP-dependent Clp protease ATP-binding protein [Microcystis aeruginosa]
 emb|CCI03294.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 9443]
 emb|CCI17774.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 9807]
Length=821

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 80/83 (96%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            VEVEKII RGSGFVAVEIPFTPR
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_004160623.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa]
 emb|CCI13172.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 9806]
Length=821

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 80/83 (96%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            VEVEKII RGSGFVAVEIPFTPR
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_010303504.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. CB0101]
Length=853

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 80/83 (96%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            VEVEKII RGSGFVAVEIPFTPR
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_011317764.1| ATP-dependent Clp protease ATP-binding protein [Anabaena variabilis]
 gb|ABA20534.1| UvrB/UvrC protein [Anabaena variabilis ATCC 29413]
Length=823

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_006041704.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. WH 7805]
 gb|EAR18013.1| ATPase [Synechococcus sp. WH 7805]
Length=857

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 80/83 (96%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            VEVEKII RGSGFVAVEIPFTPR
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_002777520.1| ATP-dependent Clp protease ATP-binding protein [Microcystis aeruginosa]
 emb|CCI07823.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 7941]
 gb|EPF22760.1| Negative regulator of genetic competence ClpC/MecB [Microcystis 
aeruginosa SPC777]
Length=821

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 80/83 (96%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            VEVEKII RGSGFVAVEIPFTPR
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_002732350.1| ATP-dependent Clp protease ATP-binding protein [Microcystis aeruginosa]
 emb|CAO87778.1| clpC [Microcystis aeruginosa PCC 7806]
 emb|CCH96065.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 9717]
 emb|CCI26165.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 9808]
 emb|CCI35401.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 9701]
 gb|ELP55843.1| clp amino terminal domain protein [Microcystis aeruginosa TAIHU98]
 gb|ELS46866.1| clp amino terminal domain protein [Microcystis aeruginosa DIANCHI905]
 dbj|GAL91758.1| ATP-dependent Clp protease, ATP-binding subunit ClpC [Microcystis 
aeruginosa NIES-44]
Length=821

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 80/83 (96%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            VEVEKII RGSGFVAVEIPFTPR
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_039726508.1| MULTISPECIES: Clp protease ClpX [Oscillatoriophycideae]
 gb|KIF14711.1| Clp protease ClpX [Aphanocapsa montana BDHKU210001]
 gb|KIF39633.1| Clp protease ClpX [Lyngbya confervoides BDU141951]
Length=822

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_043691512.1| Clp protease ClpX [Synechococcus sp. KORDI-49]
 gb|AII45534.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. KORDI-49]
Length=843

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 80/83 (96%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            VEVEKII RGSGFVAVEIPFTPR
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_008226206.1| ATP-dependent Clp protease, ATP-binding subunit ClpC / Negative 
regulator of genetic competence clcC/mecB [Richelia intracellularis]
 emb|CCH64853.1| ATP-dependent Clp protease, ATP-binding subunit ClpC / Negative 
regulator of genetic competence clcC/mecB [Richelia intracellularis 
HM01]
Length=822

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_007098208.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. RS9916]
 gb|EAU74102.1| ATPase [Synechococcus sp. RS9916]
Length=859

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 80/83 (96%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            VEVEKII RGSGFVAVEIPFTPR
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_006910091.1| ATP-dependent Clp protease ATP-binding protein [Cyanobium sp. 
PCC 7001]
 gb|EDY38192.1| ATPase, AAA family [Cyanobium sp. PCC 7001]
Length=843

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 80/83 (96%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            VEVEKII RGSGFVAVEIPFTPR
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPR  83



>ref|NP_050661.1| Clp protease ATP binding subunit (chloroplast) [Guillardia theta]
 sp|O78410.1|CLPC_GUITH RecName: Full=ATP-dependent Clp protease ATP-binding subunit 
clpA homolog (chloroplast) [Guillardia theta]
 gb|AAC35595.1| Clp protease ATP binding subunit (chloroplast) [Guillardia theta]
Length=819

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 81/83 (98%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            VEVEKII RGSGFVAVEIPFTPR
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_041555480.1| Clp protease ClpX [Nostoc sp. PCC 7524]
Length=823

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_015111477.1| ATPase [Nostoc sp. PCC 7107]
 gb|AFY41237.1| ATPase AAA-2 domain protein [Nostoc sp. PCC 7107]
Length=823

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_004158851.1| ATP-dependent Clp protease ATP-binding protein [Microcystis aeruginosa]
 emb|CCH94083.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 9432]
Length=821

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 80/83 (96%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            VEVEKII RGSGFVAVEIPFTPR
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_029638478.1| Clp protease ClpX [[Scytonema hofmanni] UTEX B 1581]
Length=823

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_008231833.1| ATP-dependent Clp protease, ATP-binding subunit ClpC / Negative 
regulator of genetic competence clcC/mecB [Richelia intracellularis]
 emb|CCH66412.1| ATP-dependent Clp protease, ATP-binding subunit ClpC / Negative 
regulator of genetic competence clcC/mecB [Richelia intracellularis 
HH01]
Length=822

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|YP_001293474.1| Clp protease ATP binding subunit [Rhodomonas salina]
 gb|ABO70723.1| Clp protease ATP binding subunit [Rhodomonas salina]
Length=819

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 81/83 (98%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            VEVEKII RGSGFVAVEIPFTPR
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_011377512.1| MULTISPECIES: ATP-dependent Clp protease ATP-binding protein 
[Synechococcus]
 gb|ABB56292.1| ATPase [Synechococcus elongatus PCC 7942]
 gb|AJD56659.1| Clp protease ClpX [Synechococcus sp. UTEX 2973]
Length=824

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_039740335.1| Clp protease ClpX [Hassallia byssoidea]
 gb|KIF37306.1| Clp protease ClpX [Hassallia byssoidea VB512170]
Length=822

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_006454749.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. PCC 7335]
 gb|EDX85005.1| ATPase, AAA family [Synechococcus sp. PCC 7335]
Length=826

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_015216290.1| ATPase AAA-2 domain protein [Anabaena cylindrica]
 gb|AFZ59673.1| ATPase AAA-2 domain protein [Anabaena cylindrica PCC 7122]
Length=824

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_041035515.1| Clp protease ClpX [Tolypothrix campylonemoides]
 gb|KIJ77734.1| Clp protease ClpX [Tolypothrix campylonemoides VB511288]
Length=822

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_023174246.1| ATPase AAA-2 domain protein [Gloeobacter kilaueensis]
 gb|AGY59031.1| ATPase AAA-2 domain protein [Gloeobacter kilaueensis JS1]
Length=821

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_015128787.1| ATPase [Calothrix sp. PCC 7507]
 gb|AFY32974.1| ATPase AAA-2 domain protein [Calothrix sp. PCC 7507]
Length=822

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_019498394.1| ATP-dependent Clp protease ATP-binding protein [Pseudanabaena 
sp. PCC 6802]
Length=828

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_006198453.1| ATP-dependent Clp protease ATP-binding protein [Nodularia spumigena]
 gb|EAW43399.1| endopeptidase Clp ATP-binding chain [Nodularia spumigena CCY9414]
 gb|AHJ31070.1| ATP-dependent Clp protease, ATP-binding subunit ClpC / Negative 
regulator of genetic competence clcC/mecB [Nodularia spumigena 
CCY9414]
Length=823

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_027250152.1| Clp protease ClpX [Planktothrix agardhii]
Length=825

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_026785489.1| MULTISPECIES: Clp protease ClpX [Planktothrix]
Length=825

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_012630051.1| ATP-dependent Clp protease ATP-binding protein [Cyanothece sp. 
PCC 7425]
 gb|ACL47009.1| ATPase AAA-2 domain protein [Cyanothece sp. PCC 7425]
Length=825

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_013192942.1| ATP-dependent Clp protease ATP-binding protein [Trichormus azollae]
 gb|ADI65932.1| ATPase AAA-2 domain protein ['Nostoc azollae' 0708]
Length=824

 Score =   126 bits (317),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_042153862.1| Clp protease ClpX [Planktothrix agardhii]
 gb|KEI66870.1| ClpC [Planktothrix agardhii NIVA-CYA 126/8]
Length=825

 Score =   126 bits (317),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_026795885.1| MULTISPECIES: Clp protease ClpX [Planktothrix]
Length=825

 Score =   126 bits (317),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_015189078.1| ATPase AAA-2 domain protein [Gloeocapsa sp. PCC 7428]
 gb|AFZ31206.1| ATPase AAA-2 domain protein [Gloeocapsa sp. PCC 7428]
Length=825

 Score =   126 bits (317),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_011618961.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. CC9311]
 gb|ABI47413.1| putative Clp protease, ATP-binding subunit ClpC [Synechococcus 
sp. CC9311]
Length=860

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 80/83 (96%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            VEVEKII RGSGFVAVEIPFTPR
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_011935205.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. RCC307]
 emb|CAK27691.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Synechococcus 
sp. RCC307]
Length=852

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 80/83 (96%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            VEVEKII RGSGFVAVEIPFTPR
Sbjct  61   VEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_026097796.1| Clp protease ClpX [Geitlerinema sp. PCC 7105]
Length=822

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_017318713.1| ATP-dependent Clp protease ATP-binding protein [Mastigocladopsis 
repens]
Length=822

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_027404746.1| Clp protease ClpX [Aphanizomenon flos-aquae]
Length=823

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_017741509.1| ATP-dependent Clp protease ATP-binding protein [Scytonema hofmanni]
Length=823

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>dbj|BAD79443.1| ATP-dependent Clp protease regulatory subunit ClpC [Synechococcus 
elongatus PCC 6301]
Length=839

 Score =   127 bits (318),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 79/85 (93%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +3

Query  327  KAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  506
            +AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  14   EAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  73

Query  507  ARVEVEKIIWRGSGFVAVEIPFTPR  581
            AR+EVEKII RGSGFVA EIPFTPR
Sbjct  74   ARIEVEKIIGRGSGFVAAEIPFTPR  98



>gb|AGW80480.1| Clp protease ATP binding subunit [Planktothrix agardhii NIVA-CYA 
68]
Length=825

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_041458572.1| Clp protease ClpX [Anabaena sp. 90]
Length=822

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_036485541.1| Clp protease ClpX [Myxosarcina sp. GI1]
Length=822

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_012412218.1| ATP-dependent Clp protease ATP-binding protein [Nostoc punctiforme]
 gb|ACC84277.1| ATPase AAA-2 domain protein [Nostoc punctiforme PCC 73102]
Length=822

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_039200429.1| Clp protease ClpX [Aphanizomenon flos-aquae]
 gb|KHG42537.1| Clp protease ClpX [Aphanizomenon flos-aquae 2012/KM1/D3]
Length=823

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_017717294.1| ATP-dependent Clp protease ATP-binding protein [Oscillatoria 
sp. PCC 10802]
Length=823

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|XP_007509860.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18975.1| predicted protein [Bathycoccus prasinos]
Length=944

 Score =   127 bits (318),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 110/138 (80%), Gaps = 12/138 (9%)
 Frame = +3

Query  204  SFTGLRGGNALD---TMARSGQ---------TLHSKvaaatsgrrgrgsravvKAMFERF  347
            +F+GLR  NA+D   T++R+G          +  S  ++++SG++        +AMFERF
Sbjct  51   NFSGLRSTNAIDMTSTLSRNGNFKGVTSRQLSTKSGSSSSSSGKKLGAVIKGPRAMFERF  110

Query  348  TEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDARVEVEK  527
            TEKAIKV+MLAQEEARRLGHNFVGTEQI+LGLIGEGTGIAAKVLKSMGI+LK+ARVEVEK
Sbjct  111  TEKAIKVVMLAQEEARRLGHNFVGTEQIMLGLIGEGTGIAAKVLKSMGISLKEARVEVEK  170

Query  528  IIWRGSGFVAVEIPFTPR  581
            II RGSGFVAVEIPFTPR
Sbjct  171  IIGRGSGFVAVEIPFTPR  188



>ref|WP_040939432.1| Clp protease ClpX [Prochloron didemni]
Length=822

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_022603946.1| ATPase with chaperone activity, ATP-binding subunit [Rubidibacter 
lacunae]
 gb|ERN42931.1| ATPase with chaperone activity, ATP-binding subunit [Rubidibacter 
lacunae KORDI 51-2]
Length=826

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_015117004.1| chaperone ATPase [Rivularia sp. PCC 7116]
 gb|AFY53426.1| ATPase with chaperone activity, ATP-binding subunit [Rivularia 
sp. PCC 7116]
Length=831

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_008312190.1| ATPase with chaperone activity, ATP-binding subunit [Leptolyngbya 
sp. PCC 6406]
Length=823

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_011612018.1| ATP-dependent Clp protease ATP-binding protein [Trichodesmium 
erythraeum]
 gb|ABG51652.1| ATPase AAA-2 [Trichodesmium erythraeum IMS101]
Length=825

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_027842712.1| Clp protease ClpX [Mastigocoleus testarum]
Length=822

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_023074118.1| atp-dependent clp protease atp-binding protein [Leptolyngbya 
sp. Heron Island J]
 gb|ESA35054.1| atp-dependent clp protease atp-binding protein [Leptolyngbya 
sp. Heron Island J]
Length=822

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_011142062.1| ATP-dependent Clp protease ATP-binding protein [Gloeobacter violaceus]
 ref|NP_925010.1| endopeptidase Clp ATP-binding chain [Gloeobacter violaceus PCC 
7421]
 dbj|BAC90005.1| endopeptidase Clp ATP-binding chain [Gloeobacter violaceus PCC 
7421]
Length=819

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_028090149.1| Clp protease ClpX [Dolichospermum circinale]
Length=823

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_016952177.1| ATP-dependent Clp protease ATP-binding protein [Anabaena sp. 
PCC 7108]
Length=824

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_035989117.1| Clp protease ClpX [Leptolyngbya sp. KIOST-1]
Length=821

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_015170572.1| ATPase [Geitlerinema sp. PCC 7407]
 gb|AFY65004.1| ATPase AAA-2 domain protein [Geitlerinema sp. PCC 7407]
Length=822

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>gb|KIE07407.1| Clp protease ClpX [Tolypothrix bouteillei VB521301]
Length=823

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_028082153.1| Clp protease ClpX [Dolichospermum circinale]
Length=823

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_015166218.1| ATPase [Pseudanabaena sp. PCC 7367]
 gb|AFY71262.1| ATPase AAA-2 domain protein [Pseudanabaena sp. PCC 7367]
Length=831

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_017712666.1| ATP-dependent Clp protease ATP-binding protein [Prochlorothrix 
hollandica]
Length=824

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_017300481.1| ATP-dependent Clp protease ATP-binding protein [Nodosilinea nodulosa]
Length=821

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>gb|KIJ80614.1| Clp protease ClpX [Scytonema tolypothrichoides VB-61278]
Length=822

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_019504000.1| ATP-dependent Clp protease ATP-binding protein [Pleurocapsa sp. 
PCC 7319]
Length=823

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_006518530.1| ATPase with chaperone activity, ATP-binding subunit [Leptolyngbya 
sp. PCC 7375]
 gb|EKU97345.1| ATPase with chaperone activity, ATP-binding subunit [Leptolyngbya 
sp. PCC 7375]
Length=822

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_017324677.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. PCC 7336]
Length=828

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



>ref|WP_015191669.1| ATPase AAA-2 domain protein [Stanieria cyanosphaera]
 gb|AFZ33996.1| ATPase AAA-2 domain protein [Stanieria cyanosphaera PCC 7437]
Length=822

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +3

Query  333  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKDAR  512
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKDAR
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR  60

Query  513  VEVEKIIWRGSGFVAVEIPFTPR  581
            +EVEKII RGSGFVAVEIPFTPR
Sbjct  61   IEVEKIIGRGSGFVAVEIPFTPR  83



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 723952452455