BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS061D02

Length=627
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001275453.1|  respiratory burst oxidase homolog protein C        167   5e-44   Solanum tuberosum [potatoes]
ref|XP_009619772.1|  PREDICTED: respiratory burst oxidase homolog...    166   3e-43   Nicotiana tomentosiformis
ref|NP_001234271.1|  whitefly-induced gp91-phox                         165   5e-43   
ref|XP_009775685.1|  PREDICTED: respiratory burst oxidase homolog...    164   1e-42   Nicotiana sylvestris
emb|CAC84140.1|  NADPH oxidase                                          164   1e-42   Nicotiana tabacum [American tobacco]
dbj|BAC56865.1|  respiratory burst oxidase homolog                      162   4e-42   Nicotiana benthamiana
emb|CDO98277.1|  unnamed protein product                                162   7e-42   Coffea canephora [robusta coffee]
gb|ABW87870.1|  NADPH oxidase                                           159   7e-41   Nicotiana attenuata
ref|XP_011073263.1|  PREDICTED: LOW QUALITY PROTEIN: respiratory ...    152   1e-38   Sesamum indicum [beniseed]
ref|XP_007038195.1|  NADPH/respiratory burst oxidase protein D          152   2e-38   
gb|AII25876.1|  NADPH oxidase A                                         149   2e-37   Camellia sinensis [black tea]
gb|EYU21773.1|  hypothetical protein MIMGU_mgv1a002672mg                142   1e-35   Erythranthe guttata [common monkey flower]
ref|XP_008797083.1|  PREDICTED: respiratory burst oxidase homolog...    135   1e-32   Phoenix dactylifera
ref|XP_010249370.1|  PREDICTED: respiratory burst oxidase homolog...    131   3e-31   Nelumbo nucifera [Indian lotus]
ref|XP_006844712.1|  hypothetical protein AMTR_s00016p00250800          130   9e-31   Amborella trichopoda
ref|XP_010929525.1|  PREDICTED: respiratory burst oxidase homolog...    129   2e-30   Elaeis guineensis
gb|KDO57669.1|  hypothetical protein CISIN_1g003558mg                   127   8e-30   Citrus sinensis [apfelsine]
gb|KDO57668.1|  hypothetical protein CISIN_1g003558mg                   127   8e-30   Citrus sinensis [apfelsine]
gb|ADQ74913.1|  respiratory burst oxidase protein 1                     126   2e-29   Picea abies
ref|XP_002511059.1|  respiratory burst oxidase, putative                125   3e-29   
ref|XP_010250429.1|  PREDICTED: respiratory burst oxidase homolog...    125   4e-29   Nelumbo nucifera [Indian lotus]
ref|XP_011015154.1|  PREDICTED: respiratory burst oxidase homolog...    125   5e-29   Populus euphratica
ref|XP_011003531.1|  PREDICTED: respiratory burst oxidase homolog...    125   5e-29   Populus euphratica
gb|KJB51324.1|  hypothetical protein B456_008G212100                    123   1e-28   Gossypium raimondii
gb|KJB07927.1|  hypothetical protein B456_001G053300                    124   1e-28   Gossypium raimondii
ref|XP_006485050.1|  PREDICTED: respiratory burst oxidase homolog...    124   1e-28   Citrus sinensis [apfelsine]
ref|XP_006437008.1|  hypothetical protein CICLE_v10030649mg             124   1e-28   Citrus clementina [clementine]
gb|KHG02500.1|  Respiratory burst oxidase C                             123   1e-28   Gossypium arboreum [tree cotton]
gb|KJB51328.1|  hypothetical protein B456_008G212100                    123   2e-28   Gossypium raimondii
gb|KJB51327.1|  hypothetical protein B456_008G212100                    123   2e-28   Gossypium raimondii
gb|KJB51323.1|  hypothetical protein B456_008G212100                    123   2e-28   Gossypium raimondii
gb|KJB51326.1|  hypothetical protein B456_008G212100                    123   2e-28   Gossypium raimondii
gb|KDP22507.1|  hypothetical protein JCGZ_26338                         122   4e-28   Jatropha curcas
ref|XP_002318793.2|  respiratory burst oxidase C family protein         120   2e-27   Populus trichocarpa [western balsam poplar]
gb|KHG00108.1|  Respiratory burst oxidase C                             120   2e-27   Gossypium arboreum [tree cotton]
ref|XP_010657584.1|  PREDICTED: respiratory burst oxidase homolog...    119   4e-27   Vitis vinifera
gb|KJB19752.1|  hypothetical protein B456_003G117900                    117   1e-26   Gossypium raimondii
gb|KJB19751.1|  hypothetical protein B456_003G117900                    117   2e-26   Gossypium raimondii
gb|ADR70880.1|  respiratory burst oxidase A                             116   4e-26   Manihot esculenta [manioc]
ref|XP_002322314.2|  respiratory burst oxidase C family protein         115   7e-26   
ref|XP_008807835.1|  PREDICTED: respiratory burst oxidase homolog...    115   9e-26   
ref|XP_008807834.1|  PREDICTED: respiratory burst oxidase homolog...    115   1e-25   Phoenix dactylifera
ref|XP_008807833.1|  PREDICTED: respiratory burst oxidase homolog...    115   1e-25   Phoenix dactylifera
ref|XP_007210905.1|  hypothetical protein PRUPE_ppa000984mg             115   1e-25   Prunus persica
ref|XP_011040313.1|  PREDICTED: respiratory burst oxidase homolog...    115   1e-25   Populus euphratica
ref|XP_008239295.1|  PREDICTED: respiratory burst oxidase homolog...    114   2e-25   Prunus mume [ume]
ref|XP_010942321.1|  PREDICTED: respiratory burst oxidase homolog...    114   3e-25   Elaeis guineensis
ref|XP_009404193.1|  PREDICTED: respiratory burst oxidase homolog...    110   6e-24   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADR70892.1|  respiratory burst oxidase C                             102   3e-21   Manihot esculenta [manioc]
ref|XP_010032776.1|  PREDICTED: respiratory burst oxidase homolog...    100   1e-20   Eucalyptus grandis [rose gum]
ref|XP_003602726.1|  Respiratory burst oxidase-like protein             100   1e-20   Medicago truncatula
gb|EPS73914.1|  hypothetical protein M569_00842                       98.6    6e-20   Genlisea aurea
ref|XP_011082784.1|  PREDICTED: respiratory burst oxidase homolog...  98.6    6e-20   Sesamum indicum [beniseed]
ref|XP_004979405.1|  PREDICTED: respiratory burst oxidase homolog...  97.1    2e-19   Setaria italica
ref|XP_009421001.1|  PREDICTED: respiratory burst oxidase homolog...  94.0    2e-18   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBI29289.3|  unnamed protein product                              94.0    2e-18   Vitis vinifera
ref|XP_002268641.1|  PREDICTED: respiratory burst oxidase homolog...  93.6    3e-18   Vitis vinifera
gb|ABA94089.2|  respiratory burst oxidase protein D, putative, ex...  91.3    2e-17   Oryza sativa Japonica Group [Japonica rice]
gb|EEC68302.1|  hypothetical protein OsI_36373                        91.3    2e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_009792218.1|  PREDICTED: respiratory burst oxidase homolog...  89.7    5e-17   Nicotiana sylvestris
gb|ADR70882.1|  respiratory burst oxidase D                           89.7    6e-17   Manihot esculenta [manioc]
gb|KJB59802.1|  hypothetical protein B456_009G273400                  88.6    1e-16   Gossypium raimondii
ref|XP_009792203.1|  PREDICTED: respiratory burst oxidase homolog...  88.6    1e-16   Nicotiana sylvestris
ref|XP_009792212.1|  PREDICTED: respiratory burst oxidase homolog...  87.0    4e-16   Nicotiana sylvestris
ref|XP_006279397.1|  hypothetical protein CARUB_v10007974mg           87.4    4e-16   Capsella rubella
ref|XP_004141156.1|  PREDICTED: respiratory burst oxidase homolog...  87.4    4e-16   Cucumis sativus [cucumbers]
ref|XP_004166291.1|  PREDICTED: LOW QUALITY PROTEIN: respiratory ...  87.4    4e-16   
ref|XP_008465165.1|  PREDICTED: respiratory burst oxidase homolog...  87.0    5e-16   Cucumis melo [Oriental melon]
ref|XP_002512702.1|  respiratory burst oxidase, putative              86.7    6e-16   
gb|ACF05504.2|  respiratory burst oxidase-like protein                86.7    7e-16   Citrullus colocynthis [alhandal]
ref|XP_008375433.1|  PREDICTED: respiratory burst oxidase homolog...  86.7    7e-16   Malus domestica [apple tree]
ref|XP_010482026.1|  PREDICTED: respiratory burst oxidase homolog...  86.3    9e-16   Camelina sativa [gold-of-pleasure]
ref|XP_002863831.1|  hypothetical protein ARALYDRAFT_917612           85.9    1e-15   Arabidopsis lyrata subsp. lyrata
ref|XP_007017524.1|  Respiratory burst oxidase D                      85.9    1e-15   
gb|KJB59801.1|  hypothetical protein B456_009G273400                  85.9    1e-15   Gossypium raimondii
ref|XP_006487656.1|  PREDICTED: respiratory burst oxidase homolog...  85.5    2e-15   Citrus sinensis [apfelsine]
ref|XP_006423884.1|  hypothetical protein CICLE_v10027774mg           85.5    2e-15   
ref|XP_003522455.1|  PREDICTED: respiratory burst oxidase homolog...  85.5    2e-15   Glycine max [soybeans]
gb|KHN31235.1|  Respiratory burst oxidase like protein C              85.1    2e-15   Glycine soja [wild soybean]
ref|XP_007137830.1|  hypothetical protein PHAVU_009G159200g           85.1    2e-15   Phaseolus vulgaris [French bean]
gb|AEX56133.1|  NADPH oxidase                                         85.1    2e-15   Phaseolus vulgaris [French bean]
gb|KJB14501.1|  hypothetical protein B456_002G128200                  84.3    4e-15   Gossypium raimondii
gb|KHG05306.1|  Respiratory burst oxidase D -like protein             84.3    4e-15   Gossypium arboreum [tree cotton]
gb|AAC39479.1|  respiratory burst oxidase protein D                   84.3    4e-15   Arabidopsis thaliana [mouse-ear cress]
ref|NP_199602.1|  respiratory burst oxidase-D                         84.3    4e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009390376.1|  PREDICTED: respiratory burst oxidase homolog...  84.0    5e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002450884.1|  hypothetical protein SORBIDRAFT_05g020380        84.0    6e-15   
gb|KJB58284.1|  hypothetical protein B456_009G202500                  83.6    7e-15   Gossypium raimondii
ref|XP_009360267.1|  PREDICTED: respiratory burst oxidase homolog...  83.2    9e-15   Pyrus x bretschneideri [bai li]
ref|XP_010438870.1|  PREDICTED: respiratory burst oxidase homolog...  82.8    1e-14   Camelina sativa [gold-of-pleasure]
ref|XP_009610989.1|  PREDICTED: respiratory burst oxidase homolog...  81.6    2e-14   Nicotiana tomentosiformis
ref|XP_009610990.1|  PREDICTED: respiratory burst oxidase homolog...  81.6    3e-14   
gb|AFW64932.1|  respiratory burst oxidase protein D variant beta      81.3    3e-14   
ref|NP_001108123.1|  LOC100136880 isoform 2                           81.3    3e-14   
gb|AFW64934.1|  hypothetical protein ZEAMMB73_295489                  81.3    3e-14   
ref|XP_003577502.1|  PREDICTED: respiratory burst oxidase homolog...  81.3    4e-14   Brachypodium distachyon [annual false brome]
gb|AFW64933.1|  respiratory burst oxidase protein D variant alpha     81.3    4e-14   
ref|NP_001157759.1|  LOC100136880 isoform 1                           81.3    4e-14   Zea mays [maize]
ref|XP_009610987.1|  PREDICTED: respiratory burst oxidase homolog...  80.9    5e-14   Nicotiana tomentosiformis
ref|XP_009610988.1|  PREDICTED: respiratory burst oxidase homolog...  80.9    6e-14   Nicotiana tomentosiformis
ref|XP_007225362.1|  hypothetical protein PRUPE_ppa000883mg           80.9    6e-14   Prunus persica
ref|XP_003526909.1|  PREDICTED: respiratory burst oxidase homolog...  80.1    9e-14   Glycine max [soybeans]
gb|KHN09692.1|  Respiratory burst oxidase like protein C              80.1    1e-13   Glycine soja [wild soybean]
ref|XP_004503030.1|  PREDICTED: respiratory burst oxidase homolog...  79.3    2e-13   Cicer arietinum [garbanzo]
gb|KDP23231.1|  hypothetical protein JCGZ_23064                       79.0    3e-13   Jatropha curcas
gb|KJB45301.1|  hypothetical protein B456_007G299500                  79.0    3e-13   Gossypium raimondii
gb|KFK35232.1|  hypothetical protein AALP_AA5G257400                  79.0    3e-13   Arabis alpina [alpine rockcress]
ref|XP_009404717.1|  PREDICTED: respiratory burst oxidase homolog...  78.6    4e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009353482.1|  PREDICTED: respiratory burst oxidase homolog...  78.6    4e-13   Pyrus x bretschneideri [bai li]
ref|XP_009404716.1|  PREDICTED: respiratory burst oxidase homolog...  78.6    4e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010259644.1|  PREDICTED: respiratory burst oxidase homolog...  77.8    6e-13   Nelumbo nucifera [Indian lotus]
ref|XP_008222292.1|  PREDICTED: respiratory burst oxidase homolog...  77.4    8e-13   Prunus mume [ume]
dbj|BAJ86360.1|  predicted protein                                    77.4    9e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ94299.1|  predicted protein                                    77.0    9e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008378424.1|  PREDICTED: respiratory burst oxidase homolog...  77.0    1e-12   
ref|XP_007030987.1|  Respiratory burst oxidase B                      76.6    1e-12   
ref|XP_009359839.1|  PREDICTED: respiratory burst oxidase homolog...  77.0    1e-12   Pyrus x bretschneideri [bai li]
dbj|BAJ97450.1|  predicted protein                                    76.6    1e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK03403.1|  predicted protein                                    76.6    1e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008369593.1|  PREDICTED: respiratory burst oxidase homolog...  76.6    1e-12   Malus domestica [apple tree]
ref|XP_010530642.1|  PREDICTED: respiratory burst oxidase homolog...  76.3    2e-12   Tarenaya hassleriana [spider flower]
ref|XP_004299201.1|  PREDICTED: respiratory burst oxidase homolog...  75.9    2e-12   Fragaria vesca subsp. vesca
emb|CDX85316.1|  BnaC07g26270D                                        75.1    4e-12   
ref|XP_004241641.1|  PREDICTED: respiratory burst oxidase homolog...  73.9    9e-12   Solanum lycopersicum
gb|KDP23484.1|  hypothetical protein JCGZ_23317                       73.6    1e-11   Jatropha curcas
ref|XP_010522982.1|  PREDICTED: respiratory burst oxidase homolog...  72.8    2e-11   Tarenaya hassleriana [spider flower]
gb|KDP44025.1|  hypothetical protein JCGZ_05492                       69.3    6e-11   Jatropha curcas
emb|CDY45918.1|  BnaAnng07990D                                        71.6    6e-11   Brassica napus [oilseed rape]
ref|XP_009129697.1|  PREDICTED: respiratory burst oxidase homolog...  71.6    6e-11   Brassica rapa
ref|XP_007147029.1|  hypothetical protein PHAVU_006G090200g           70.9    1e-10   Phaseolus vulgaris [French bean]
gb|KHN43296.1|  Respiratory burst oxidase like protein B              70.9    1e-10   Glycine soja [wild soybean]
ref|XP_002303736.2|  hypothetical protein POPTR_0003s15810g           70.9    1e-10   Populus trichocarpa [western balsam poplar]
emb|CDX86335.1|  BnaA06g30520D                                        70.5    1e-10   
ref|XP_009151593.1|  PREDICTED: respiratory burst oxidase homolog...  70.5    1e-10   Brassica rapa
ref|XP_009402525.1|  PREDICTED: respiratory burst oxidase homolog...  70.5    1e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002512422.1|  respiratory burst oxidase, putative              69.3    3e-10   Ricinus communis
ref|XP_008450638.1|  PREDICTED: respiratory burst oxidase homolog...  68.6    5e-10   Cucumis melo [Oriental melon]
ref|XP_003554649.1|  PREDICTED: respiratory burst oxidase homolog...  67.8    9e-10   Glycine max [soybeans]
ref|XP_008450637.1|  PREDICTED: respiratory burst oxidase homolog...  67.8    1e-09   Cucumis melo [Oriental melon]
ref|XP_011020924.1|  PREDICTED: respiratory burst oxidase homolog...  67.0    1e-09   Populus euphratica
gb|AGI65628.1|  NADPH oxidase                                         66.6    2e-09   Fragaria x ananassa
ref|XP_006395230.1|  hypothetical protein EUTSA_v10003619mg           66.2    3e-09   Eutrema salsugineum [saltwater cress]
ref|XP_008670768.1|  PREDICTED: respiratory burst oxidase homolog...  65.9    4e-09   
sp|Q2HXK9.2|RBOHD_SOLTU  RecName: Full=Respiratory burst oxidase ...  65.5    4e-09   Solanum tuberosum [potatoes]
tpg|DAA42070.1|  TPA: hypothetical protein ZEAMMB73_604696            65.5    5e-09   
ref|XP_003525163.2|  PREDICTED: respiratory burst oxidase homolog...  65.5    5e-09   
gb|KHN17442.1|  Respiratory burst oxidase like protein C              65.5    5e-09   Glycine soja [wild soybean]
ref|XP_006382490.1|  respiratory burst oxidase protein B              64.7    1e-08   
ref|XP_011036858.1|  PREDICTED: respiratory burst oxidase homolog...  64.3    1e-08   Populus euphratica
ref|XP_004168501.1|  PREDICTED: respiratory burst oxidase homolog...  64.3    1e-08   
ref|XP_004135613.1|  PREDICTED: respiratory burst oxidase homolog...  63.9    2e-08   Cucumis sativus [cucumbers]
ref|XP_009778242.1|  PREDICTED: respiratory burst oxidase homolog...  63.2    2e-08   Nicotiana sylvestris
ref|XP_008246416.1|  PREDICTED: respiratory burst oxidase homolog...  62.8    3e-08   Prunus mume [ume]
ref|XP_008246413.1|  PREDICTED: respiratory burst oxidase homolog...  62.8    4e-08   
ref|XP_009611315.1|  PREDICTED: respiratory burst oxidase homolog...  62.0    6e-08   Nicotiana tomentosiformis
gb|EYU24549.1|  hypothetical protein MIMGU_mgv1a001003mg              61.6    9e-08   Erythranthe guttata [common monkey flower]
ref|XP_010931626.1|  PREDICTED: respiratory burst oxidase homolog...  60.8    2e-07   Elaeis guineensis
gb|KCW61821.1|  hypothetical protein EUGRSUZ_H04514                   60.1    2e-07   Eucalyptus grandis [rose gum]
gb|AEP25512.1|  putative respiratory burst oxidase-like protein A     60.1    3e-07   Vicia faba [broad bean]
ref|XP_003630437.1|  Respiratory burst oxidase-like protein           59.7    3e-07   Medicago truncatula
gb|AAW78863.1|  respiratory burst oxidase 1                           59.7    4e-07   Medicago truncatula
ref|XP_010269487.1|  PREDICTED: respiratory burst oxidase homolog...  59.7    4e-07   Nelumbo nucifera [Indian lotus]
ref|NP_001274981.1|  respiratory burst oxidase homolog protein B      59.3    5e-07   Solanum tuberosum [potatoes]
emb|CDY35764.1|  BnaC02g38300D                                        59.3    5e-07   Brassica napus [oilseed rape]
gb|KDO56233.1|  hypothetical protein CISIN_1g002711mg                 58.9    6e-07   Citrus sinensis [apfelsine]
ref|XP_006433403.1|  hypothetical protein CICLE_v10000227mg           58.9    6e-07   Citrus clementina [clementine]
gb|AFJ66196.1|  hypothetical protein 7G9.15                           58.9    7e-07   Boechera stricta
ref|XP_010025215.1|  PREDICTED: respiratory burst oxidase homolog...  58.5    8e-07   Eucalyptus grandis [rose gum]
ref|XP_008800853.1|  PREDICTED: respiratory burst oxidase homolog...  58.5    9e-07   Phoenix dactylifera
ref|XP_002299364.2|  hypothetical protein POPTR_0001s12650g           58.5    1e-06   
ref|XP_010041041.1|  PREDICTED: respiratory burst oxidase homolog...  58.2    1e-06   Eucalyptus grandis [rose gum]
gb|KCW44695.1|  hypothetical protein EUGRSUZ_L017712                  58.2    1e-06   Eucalyptus grandis [rose gum]
ref|XP_003521697.1|  PREDICTED: respiratory burst oxidase homolog...  57.8    1e-06   Glycine max [soybeans]
ref|XP_010112007.1|  Respiratory burst oxidase-like protein D         57.4    2e-06   
ref|XP_003532261.1|  PREDICTED: respiratory burst oxidase homolog...  57.0    3e-06   Glycine max [soybeans]
ref|XP_004230232.1|  PREDICTED: respiratory burst oxidase homolog...  56.6    4e-06   Solanum lycopersicum
ref|XP_010536571.1|  PREDICTED: respiratory burst oxidase homolog...  55.8    7e-06   Tarenaya hassleriana [spider flower]
ref|XP_004503856.1|  PREDICTED: respiratory burst oxidase homolog...  55.1    1e-05   Cicer arietinum [garbanzo]
ref|XP_010549734.1|  PREDICTED: respiratory burst oxidase homolog...  55.1    1e-05   Tarenaya hassleriana [spider flower]
ref|XP_007206556.1|  hypothetical protein PRUPE_ppa019730mg           55.1    1e-05   Prunus persica
ref|XP_003602723.1|  Respiratory burst oxidase-like protein           54.3    2e-05   Medicago truncatula
ref|XP_002283888.1|  PREDICTED: respiratory burst oxidase homolog...  53.9    3e-05   Vitis vinifera
ref|XP_008670770.1|  PREDICTED: respiratory burst oxidase homolog...  53.9    3e-05   
emb|CAN64415.1|  hypothetical protein VITISV_013316                   53.9    3e-05   Vitis vinifera
tpg|DAA42073.1|  TPA: hypothetical protein ZEAMMB73_696625            53.9    3e-05   
ref|XP_007159934.1|  hypothetical protein PHAVU_002G279700g           53.5    4e-05   Phaseolus vulgaris [French bean]
gb|AEX56131.1|  NADPH oxidase                                         53.1    6e-05   Phaseolus vulgaris [French bean]
ref|XP_003536070.1|  PREDICTED: respiratory burst oxidase homolog...  52.4    1e-04   
gb|AFJ66168.1|  hypothetical protein 11M19.12                         52.0    1e-04   Arabidopsis halleri
ref|XP_010674039.1|  PREDICTED: respiratory burst oxidase homolog...  52.0    1e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003626254.1|  Respiratory burst oxidase-like protein           52.0    1e-04   
ref|XP_003556516.1|  PREDICTED: respiratory burst oxidase homolog...  51.6    2e-04   Glycine max [soybeans]
gb|AAC39477.1|  respiratory burst oxidase protein C                   51.6    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|NP_199919.1|  Respiratory burst oxidase homolog protein C         51.6    2e-04   Arabidopsis thaliana [mouse-ear cress]
gb|AAS15724.1|  respiratory burst oxidase protein C                   51.6    2e-04   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC41837.1|  putative respiratory burst oxidase protein           51.6    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007144946.1|  hypothetical protein PHAVU_007G196800g           50.8    3e-04   Phaseolus vulgaris [French bean]
ref|XP_010482435.1|  PREDICTED: respiratory burst oxidase homolog...  50.4    4e-04   Camelina sativa [gold-of-pleasure]
gb|ADR70881.1|  respiratory burst oxidase B                           49.3    0.001   Manihot esculenta [manioc]



>ref|NP_001275453.1| respiratory burst oxidase homolog protein C [Solanum tuberosum]
 sp|Q2HXL0.2|RBOHC_SOLTU RecName: Full=Respiratory burst oxidase homolog protein C; AltName: 
Full=NADPH oxidase RBOHC; AltName: Full=StRBOHC [Solanum 
tuberosum]
 dbj|BAE79344.2| NADPH oxidase [Solanum tuberosum]
Length=938

 Score =   167 bits (424),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 106/137 (77%), Gaps = 6/137 (4%)
 Frame = +1

Query  193  MSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssse  372
            M +S+     H HHHSDTE+  +G D R SYSGPLSGPLNKR GKKSARFN+        
Sbjct  1    MQNSENHHPHHHHHHSDTEI--IGND-RASYSGPLSGPLNKRGGKKSARFNIPESTDIGT  57

Query  373  lgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLG  552
                 +    +NDDAYVEITLDVREDSVAVHSVKTA GADVEDPELALLA+GLEKK+TLG
Sbjct  58   SAGAGAK---SNDDAYVEITLDVREDSVAVHSVKTAGGADVEDPELALLAKGLEKKSTLG  114

Query  553  SSLVRNASSRIRQVSQE  603
            +SLVRNASSRIRQVSQE
Sbjct  115  ASLVRNASSRIRQVSQE  131



>ref|XP_009619772.1| PREDICTED: respiratory burst oxidase homolog protein C [Nicotiana 
tomentosiformis]
Length=938

 Score =   166 bits (419),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 105/137 (77%), Gaps = 6/137 (4%)
 Frame = +1

Query  193  MSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssse  372
            M +S+     H HHHSDTE+  +G D R SYSGPLSGPLNKR GKKSARFN+        
Sbjct  1    MQNSENHHPHHHHHHSDTEI--IGND-RASYSGPLSGPLNKRGGKKSARFNIPESTDIGT  57

Query  373  lgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLG  552
                 +    +NDDAYVEITLDVREDSVAVHSVKTA G DVEDPELALLA+GLEKK+TLG
Sbjct  58   SVGTGAK---SNDDAYVEITLDVREDSVAVHSVKTAGGDDVEDPELALLAKGLEKKSTLG  114

Query  553  SSLVRNASSRIRQVSQE  603
            SSLVRNASSRIRQVSQE
Sbjct  115  SSLVRNASSRIRQVSQE  131



>ref|NP_001234271.1| whitefly-induced gp91-phox [Solanum lycopersicum]
 gb|AAF73104.1|AF147783_1 whitefly-induced gp91-phox [Solanum lycopersicum]
 gb|AAF73124.1|AF148534_1 whitefly-induced gp91-phox [Solanum lycopersicum]
Length=938

 Score =   165 bits (417),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 96/137 (70%), Positives = 105/137 (77%), Gaps = 6/137 (4%)
 Frame = +1

Query  193  MSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssse  372
            M +S+     H HHHSDTEV  +G D R SYSGPLSGPLNKR GKK ARFN+        
Sbjct  1    MQNSENHHPHHHHHHSDTEV--IGND-RASYSGPLSGPLNKRGGKKCARFNIPESTDIGT  57

Query  373  lgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLG  552
                 +    +NDDAYVEITLDVREDSVAVHSVKTA GADVEDPELALLA+GLEKK+TLG
Sbjct  58   SAGAGAK---SNDDAYVEITLDVREDSVAVHSVKTAGGADVEDPELALLAKGLEKKSTLG  114

Query  553  SSLVRNASSRIRQVSQE  603
            +SLVRNASSRIRQVSQE
Sbjct  115  ASLVRNASSRIRQVSQE  131



>ref|XP_009775685.1| PREDICTED: respiratory burst oxidase homolog protein C [Nicotiana 
sylvestris]
 gb|AAM28891.1| NADPH oxidase [Nicotiana tabacum]
 gb|ABN58915.1| rbohD [Nicotiana tabacum]
Length=938

 Score =   164 bits (415),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 97/137 (71%), Positives = 105/137 (77%), Gaps = 6/137 (4%)
 Frame = +1

Query  193  MSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssse  372
            M +S+     HQHHHSDTE+  +G D R SYSGPLSGPLNKR GKKSARFN+        
Sbjct  1    MQNSENHHPHHQHHHSDTEI--IGND-RASYSGPLSGPLNKRGGKKSARFNIPESTDIGT  57

Query  373  lgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLG  552
                      +NDDAYVEITLDVREDSVAVHSVKTA G DVEDPELALLA+GLEKK+TLG
Sbjct  58   SVGTGGK---SNDDAYVEITLDVREDSVAVHSVKTAGGDDVEDPELALLAKGLEKKSTLG  114

Query  553  SSLVRNASSRIRQVSQE  603
            SSLVRNASSRIRQVSQE
Sbjct  115  SSLVRNASSRIRQVSQE  131



>emb|CAC84140.1| NADPH oxidase [Nicotiana tabacum]
Length=939

 Score =   164 bits (414),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 97/137 (71%), Positives = 105/137 (77%), Gaps = 6/137 (4%)
 Frame = +1

Query  193  MSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssse  372
            M +S+     HQHHHSDTE+  +G D R SYSGPLSGPLNKR GKKSARFN+        
Sbjct  1    MQNSENHHPHHQHHHSDTEI--IGND-RASYSGPLSGPLNKRGGKKSARFNIPESTDIGT  57

Query  373  lgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLG  552
                      +NDDAYVEITLDVREDSVAVHSVKTA G DVEDPELALLA+GLEKK+TLG
Sbjct  58   SVGTGGK---SNDDAYVEITLDVREDSVAVHSVKTAGGDDVEDPELALLAKGLEKKSTLG  114

Query  553  SSLVRNASSRIRQVSQE  603
            SSLVRNASSRIRQVSQE
Sbjct  115  SSLVRNASSRIRQVSQE  131



>dbj|BAC56865.1| respiratory burst oxidase homolog [Nicotiana benthamiana]
Length=939

 Score =   162 bits (410),  Expect = 4e-42, Method: Composition-based stats.
 Identities = 95/137 (69%), Positives = 105/137 (77%), Gaps = 5/137 (4%)
 Frame = +1

Query  193  MSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssse  372
            M +S+     H HHHSDTE+  +G D R SYSGPLSGPLNKR GKKSARFN+        
Sbjct  1    MQNSENHHPHHHHHHSDTEI--IGND-RASYSGPLSGPLNKRGGKKSARFNIPESTDIGT  57

Query  373  lgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLG  552
                +  +  +NDDAYVEITLDVREDSVAVHSVKTA G DVEDPELALLA+GLEKK+ LG
Sbjct  58   SVGTAGGK--SNDDAYVEITLDVREDSVAVHSVKTAGGDDVEDPELALLAKGLEKKSALG  115

Query  553  SSLVRNASSRIRQVSQE  603
            SSLVRNASSRIRQVSQE
Sbjct  116  SSLVRNASSRIRQVSQE  132



>emb|CDO98277.1| unnamed protein product [Coffea canephora]
Length=933

 Score =   162 bits (409),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 106/137 (77%), Gaps = 11/137 (8%)
 Frame = +1

Query  193  MSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssse  372
            M S + Q   H HHHSD E+  +G D R SYSGPLSGPLNKRTGKKSARFN++    ++ 
Sbjct  1    MQSPETQ---HYHHHSDNEI--IGND-RTSYSGPLSGPLNKRTGKKSARFNISDSAGNAN  54

Query  373  lgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLG  552
              S       NNDDAYVEITLDVR+DSVAVHSVKTA GA +ED ELALLARGLEKK++ G
Sbjct  55   SSSG-----NNNDDAYVEITLDVRDDSVAVHSVKTADGAAIEDSELALLARGLEKKSSFG  109

Query  553  SSLVRNASSRIRQVSQE  603
            SS+VRNASS+IRQVSQE
Sbjct  110  SSVVRNASSKIRQVSQE  126



>gb|ABW87870.1| NADPH oxidase [Nicotiana attenuata]
Length=937

 Score =   159 bits (401),  Expect = 7e-41, Method: Composition-based stats.
 Identities = 94/137 (69%), Positives = 102/137 (74%), Gaps = 6/137 (4%)
 Frame = +1

Query  193  MSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssse  372
            M +S+     H HHHSDTE+  +G D R SYSGPLSGPLNKR GKKSARFN+        
Sbjct  1    MQNSENHHPHHHHHHSDTEI--IGND-RASYSGPLSGPLNKRGGKKSARFNIPESTDIGT  57

Query  373  lgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLG  552
                      +NDDAYVEITLDVREDSVAVHS KTA G DVEDPELALLA+GLEKK+T G
Sbjct  58   SVGTGGK---SNDDAYVEITLDVREDSVAVHSAKTAGGDDVEDPELALLAKGLEKKSTSG  114

Query  553  SSLVRNASSRIRQVSQE  603
            SSLVRNASSRIRQVSQE
Sbjct  115  SSLVRNASSRIRQVSQE  131



>ref|XP_011073263.1| PREDICTED: LOW QUALITY PROTEIN: respiratory burst oxidase homolog 
protein C-like [Sesamum indicum]
Length=918

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 94/128 (73%), Gaps = 12/128 (9%)
 Frame = +1

Query  220  RHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssars  399
            +H HHHSDTE++      R SYSGPLSGPLNKR G+KSARFNL    SS    +      
Sbjct  7    KHHHHHSDTEIVA---GDRTSYSGPLSGPLNKRGGRKSARFNLPADHSSGASPAA-----  58

Query  400  ANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASS  579
                D YVEITLDVR+DSVAVHSVK A G +VEDPELALLA+GLEKK++ GSS+ RNASS
Sbjct  59   ----DDYVEITLDVRDDSVAVHSVKNAGGGEVEDPELALLAKGLEKKSSFGSSVARNASS  114

Query  580  RIRQVSQE  603
            RIRQVS E
Sbjct  115  RIRQVSHE  122



>ref|XP_007038195.1| NADPH/respiratory burst oxidase protein D [Theobroma cacao]
 gb|EOY22696.1| NADPH/respiratory burst oxidase protein D [Theobroma cacao]
Length=910

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 101/140 (72%), Gaps = 17/140 (12%)
 Frame = +1

Query  187  REMSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdss  366
            +EM++ D   ++H HHHSDTEV+      +  +SGPLSGPLNKR GKKSARF++      
Sbjct  2    QEMTAEDGNRYQHHHHHSDTEVLA---GDKVPHSGPLSGPLNKRAGKKSARFSVPDST--  56

Query  367  selgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADV-EDPELALLARGLEKKT  543
                       ++ DD YVEITLDVR+DSVAVHSVK A GAD+ EDPEL LLA+GLEK++
Sbjct  57   -----------SSKDDGYVEITLDVRDDSVAVHSVKAANGADLQEDPELTLLAKGLEKRS  105

Query  544  TLGSSLVRNASSRIRQVSQE  603
            T+GSS+VRNAS++IRQV  E
Sbjct  106  TVGSSMVRNASAKIRQVGHE  125



>gb|AII25876.1| NADPH oxidase A [Camellia sinensis]
Length=922

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 98/128 (77%), Gaps = 10/128 (8%)
 Frame = +1

Query  223  HQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTG-KKSARFNLAggdssselgspssars  399
            H  HHSDT++  VG D R SYSGPLSGPLNKR G +KSARFNL     +    +      
Sbjct  16   HHRHHSDTDI--VGGD-RASYSGPLSGPLNKRAGGRKSARFNLPDSAGAGGSVA------  66

Query  400  ANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASS  579
             ++D +YVEITLDVR+DSVAVHSVKTA GA+VEDPEL LLA+GLEK+++  SS+VRNASS
Sbjct  67   GDDDQSYVEITLDVRDDSVAVHSVKTAGGAEVEDPELTLLAKGLEKRSSFKSSIVRNASS  126

Query  580  RIRQVSQE  603
            RI+QVSQE
Sbjct  127  RIKQVSQE  134



>gb|EYU21773.1| hypothetical protein MIMGU_mgv1a002672mg [Erythranthe guttata]
Length=648

 Score =   142 bits (358),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 81/125 (65%), Positives = 93/125 (74%), Gaps = 17/125 (14%)
 Frame = +1

Query  229  HHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANN  408
            +H+SD+EV    V  R SYSGPL    NKR GKKSARFN+    + +          A+ 
Sbjct  6    NHNSDSEV----VGDRTSYSGPL----NKRPGKKSARFNIPESSNRNSS--------ADA  49

Query  409  DDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIR  588
            DD YVEITLDVREDSVAVHSVKTA G +VEDPELALLARGLEKK++ GSS+VRNASSRI+
Sbjct  50   DD-YVEITLDVREDSVAVHSVKTAGGGEVEDPELALLARGLEKKSSFGSSVVRNASSRIK  108

Query  589  QVSQE  603
            QVSQE
Sbjct  109  QVSQE  113



>ref|XP_008797083.1| PREDICTED: respiratory burst oxidase homolog protein C [Phoenix 
dactylifera]
Length=934

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 97/140 (69%), Gaps = 17/140 (12%)
 Frame = +1

Query  187  REMSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdss  366
            ++M + D +   HQ    +TE   +G D R  YSGPLSGPLNKR G++SARFNLA     
Sbjct  2    QKMGTDDGRGGDHQSDVVETES--IGSD-RVPYSGPLSGPLNKRGGRRSARFNLADSA--  56

Query  367  selgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKT-  543
                         +D+ YVEITLDVR+DSVAVHSVK AAG D EDPE+ LLAR LEK++ 
Sbjct  57   -----------GGDDEQYVEITLDVRDDSVAVHSVKPAAGGDAEDPEVTLLARTLEKRSG  105

Query  544  TLGSSLVRNASSRIRQVSQE  603
            ++GSS++R+ASSRIRQVSQE
Sbjct  106  SIGSSVIRSASSRIRQVSQE  125



>ref|XP_010249370.1| PREDICTED: respiratory burst oxidase homolog protein C [Nelumbo 
nucifera]
Length=926

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 95/128 (74%), Gaps = 11/128 (9%)
 Frame = +1

Query  232  HHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNL----Aggdssselgspssars  399
            HHSDTE   VG ++  +YSGPL    NKR G+KSARFNL    A   S     S +S  +
Sbjct  16   HHSDTES--VGSERSSAYSGPL----NKR-GRKSARFNLPESTARTISGVGRTSSNSINA  68

Query  400  ANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASS  579
            A +DDAYVEITLDVR+DSVAVHSVK A GAD EDPEL LLA+ LEK+++ GSS++R+ASS
Sbjct  69   APDDDAYVEITLDVRDDSVAVHSVKPAGGADAEDPELTLLAKNLEKRSSFGSSVMRSASS  128

Query  580  RIRQVSQE  603
            RI+QVSQE
Sbjct  129  RIKQVSQE  136



>ref|XP_006844712.1| hypothetical protein AMTR_s00016p00250800 [Amborella trichopoda]
 gb|ERN06387.1| hypothetical protein AMTR_s00016p00250800 [Amborella trichopoda]
Length=917

 Score =   130 bits (326),  Expect = 9e-31, Method: Composition-based stats.
 Identities = 69/106 (65%), Positives = 80/106 (75%), Gaps = 13/106 (12%)
 Frame = +1

Query  286  SGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDSVAVH  465
            SGPLSGPLNKR G++SARFN+    +             N DD YVEITLDVR+DSVAVH
Sbjct  34   SGPLSGPLNKRGGRRSARFNIPEPSTQ------------NPDDGYVEITLDVRDDSVAVH  81

Query  466  SVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQVSQE  603
            SVK  AG D EDPE+ LLAR LEKKT+LGSS++R+ASSRI+QVSQE
Sbjct  82   SVK-PAGQDNEDPEVTLLARTLEKKTSLGSSVIRSASSRIKQVSQE  126



>ref|XP_010929525.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Elaeis 
guineensis]
Length=934

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 95/140 (68%), Gaps = 15/140 (11%)
 Frame = +1

Query  187  REMSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdss  366
            +EM + D +   HQ    +TE   +G D R SYSGPLSGPLNKR G++SARFN+      
Sbjct  2    QEMGTDDGRGGDHQSDVMETES--IGSD-RVSYSGPLSGPLNKRGGRRSARFNIPDSAGG  58

Query  367  selgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKT-  543
                          D+ YVEITLDVR+DSVAVHSVK AA  + EDP++ LLAR LEK++ 
Sbjct  59   -----------GGGDEQYVEITLDVRDDSVAVHSVKPAAAGEEEDPDVTLLARTLEKRSG  107

Query  544  TLGSSLVRNASSRIRQVSQE  603
            ++GSS++R+ASSRIRQVSQE
Sbjct  108  SIGSSVIRSASSRIRQVSQE  127



>gb|KDO57669.1| hypothetical protein CISIN_1g003558mg [Citrus sinensis]
 gb|KDO57670.1| hypothetical protein CISIN_1g003558mg [Citrus sinensis]
Length=811

 Score =   127 bits (318),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 75/126 (60%), Positives = 92/126 (73%), Gaps = 16/126 (13%)
 Frame = +1

Query  238  SDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDA  417
            SDTEV+    ++R  YSGPLSGPLNKR G+KS +FNLA         + SS+ S+ +D+ 
Sbjct  13   SDTEVLG---NERIPYSGPLSGPLNKRVGRKSTKFNLA---------TESSSGSSPHDEP  60

Query  418  YVEITLDVREDSVAVHSVKTAAGADV---EDPELALLARGLEKK-TTLGSSLVRNASSRI  585
            YVEITLDVR+DSVAVHSVK A G      EDPE+ LLA+GLEK+ T+ GSS+ R AS+RI
Sbjct  61   YVEITLDVRDDSVAVHSVKAAGGDHSNLQEDPEITLLAKGLEKRSTSFGSSVARTASARI  120

Query  586  RQVSQE  603
            RQVSQE
Sbjct  121  RQVSQE  126



>gb|KDO57668.1| hypothetical protein CISIN_1g003558mg [Citrus sinensis]
Length=808

 Score =   127 bits (318),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 75/126 (60%), Positives = 92/126 (73%), Gaps = 16/126 (13%)
 Frame = +1

Query  238  SDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDA  417
            SDTEV+    ++R  YSGPLSGPLNKR G+KS +FNLA         + SS+ S+ +D+ 
Sbjct  13   SDTEVLG---NERIPYSGPLSGPLNKRVGRKSTKFNLA---------TESSSGSSPHDEP  60

Query  418  YVEITLDVREDSVAVHSVKTAAGADV---EDPELALLARGLEKK-TTLGSSLVRNASSRI  585
            YVEITLDVR+DSVAVHSVK A G      EDPE+ LLA+GLEK+ T+ GSS+ R AS+RI
Sbjct  61   YVEITLDVRDDSVAVHSVKAAGGDHSNLQEDPEITLLAKGLEKRSTSFGSSVARTASARI  120

Query  586  RQVSQE  603
            RQVSQE
Sbjct  121  RQVSQE  126



>gb|ADQ74913.1| respiratory burst oxidase protein 1 [Picea abies]
Length=954

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 83/110 (75%), Gaps = 7/110 (6%)
 Frame = +1

Query  274  RKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDS  453
            R ++SGPLSGPLNKR G++SARFN+ G  +++   +         D+ YVEITLDV +DS
Sbjct  67   RVAFSGPLSGPLNKRPGRRSARFNIPGDGATTSKSN-------GGDEGYVEITLDVMDDS  119

Query  454  VAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQVSQE  603
            +AVHSVK A   D EDPE+ALLA+ LEKKT+ GSS++RNAS+RI+ VSQE
Sbjct  120  IAVHSVKPAGPGDQEDPEIALLAKDLEKKTSFGSSIIRNASARIKHVSQE  169



>ref|XP_002511059.1| respiratory burst oxidase, putative [Ricinus communis]
 gb|EEF51661.1| respiratory burst oxidase, putative [Ricinus communis]
Length=910

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 84/112 (75%), Gaps = 16/112 (14%)
 Frame = +1

Query  268  DKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVRE  447
            D+R  YSGPLSGPLNKRT +KSARFN+                +++ D+ Y+E+TLDVR+
Sbjct  22   DQRVPYSGPLSGPLNKRTTRKSARFNIP-------------DSTSSQDEQYLEVTLDVRD  68

Query  448  DSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQVSQE  603
            DSVAVHSVKTA GA+ EDPEL LLA+GLEKK+   S++VRNAS+R RQVSQE
Sbjct  69   DSVAVHSVKTANGAE-EDPELTLLAKGLEKKSN--SNIVRNASNRFRQVSQE  117



>ref|XP_010250429.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Nelumbo 
nucifera]
Length=924

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 86/111 (77%), Gaps = 1/111 (1%)
 Frame = +1

Query  271  KRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVRED  450
            +R S+SGPLSGPLNKR G+KSARFNL    SS    S SS+ +  +DDAYVEIT+DVR D
Sbjct  19   ERSSFSGPLSGPLNKR-GRKSARFNLPEPISSVSRASCSSSNNIPDDDAYVEITIDVRGD  77

Query  451  SVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQVSQE  603
            SVAVHSVK A G D ED EL LLA+ LEK+++ GSS++R AS RI+QVSQE
Sbjct  78   SVAVHSVKPAGGEDDEDHELTLLAKNLEKRSSFGSSVMRTASLRIKQVSQE  128



>ref|XP_011015154.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Populus 
euphratica]
Length=909

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 90/132 (68%), Gaps = 19/132 (14%)
 Frame = +1

Query  208  QQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgsps  387
             Q    + HHSD+E+      +R +YSGPLSGPLNKR G+KSARF++A            
Sbjct  1    MQDMGREDHHSDSEM---SGSERLAYSGPLSGPLNKRPGRKSARFSIA------------  45

Query  388  sarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVR  567
               + + D+ YVEITLDVR DSVAVHSVK A G + EDPE+ALLA+GLEK++   S+LVR
Sbjct  46   -GTTTSKDEQYVEITLDVRNDSVAVHSVKAANGVE-EDPEMALLAKGLEKRS--ASNLVR  101

Query  568  NASSRIRQVSQE  603
             AS+RIRQVS E
Sbjct  102  TASARIRQVSHE  113



>ref|XP_011003531.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Populus 
euphratica]
Length=909

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 90/132 (68%), Gaps = 19/132 (14%)
 Frame = +1

Query  208  QQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgsps  387
             Q    + HHSD+E+      +R +YSGPLSGPLNKR G+KSARF++A            
Sbjct  1    MQDMGREDHHSDSEM---SGSERLAYSGPLSGPLNKRPGRKSARFSIA------------  45

Query  388  sarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVR  567
               + + D+ YVEITLDVR DSVAVHSVK A G + EDPE+ALLA+GLEK++   S+LVR
Sbjct  46   -GTTTSKDEQYVEITLDVRNDSVAVHSVKAANGVE-EDPEMALLAKGLEKRS--ASNLVR  101

Query  568  NASSRIRQVSQE  603
             AS+RIRQVS E
Sbjct  102  TASARIRQVSHE  113



>gb|KJB51324.1| hypothetical protein B456_008G212100 [Gossypium raimondii]
 gb|KJB51329.1| hypothetical protein B456_008G212100 [Gossypium raimondii]
Length=697

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 94/141 (67%), Gaps = 23/141 (16%)
 Frame = +1

Query  190  EMSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRT--GKKSARFNLAggds  363
            +MSS D   + H+HH+SDT+V+  G +K   +SGPLSGPLNK+   GKK+A FN+     
Sbjct  3    KMSSEDGDRYHHRHHYSDTDVL--GSEK-VPHSGPLSGPLNKKVAAGKKTAHFNIPDSS-  58

Query  364  sselgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADV-EDPELALLARGLEKK  540
                        ++NDD YVEITLDV  DSVAV SVK A G D+ EDPEL+LLA+GLEKK
Sbjct  59   ------------SSNDDRYVEITLDVTADSVAVQSVKAANGGDLQEDPELSLLAKGLEKK  106

Query  541  TTLGSSLVRNASSRIRQVSQE  603
                S +VRNAS++IRQV  E
Sbjct  107  ----SKVVRNASAKIRQVGHE  123



>gb|KJB07927.1| hypothetical protein B456_001G053300 [Gossypium raimondii]
Length=907

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 83/116 (72%), Gaps = 15/116 (13%)
 Frame = +1

Query  259  VGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLD  438
            +G DK   +SGPLSGPLNKR  +KSARFN+                 ++ DD YVEITLD
Sbjct  6    LGTDK-VPHSGPLSGPLNKRVPRKSARFNVPDSS-------------SSKDDGYVEITLD  51

Query  439  VREDSVAVHSVKTAAGADVE-DPELALLARGLEKKTTLGSSLVRNASSRIRQVSQE  603
            V +DSVAVHS+K A G D+E DPELALLA+GLEK+TTLGS + RNAS++IRQVS E
Sbjct  52   VCDDSVAVHSLKAANGDDLEQDPELALLAKGLEKRTTLGSLMARNASAKIRQVSHE  107



>ref|XP_006485050.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Citrus 
sinensis]
Length=929

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 94/127 (74%), Gaps = 18/127 (14%)
 Frame = +1

Query  238  SDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDA  417
            SDTEV+    ++R  YSGPLSGPLNKR G+KS +FNLA         + SS+ S+ +D+ 
Sbjct  13   SDTEVLG---NERIPYSGPLSGPLNKRVGRKSTKFNLA---------TESSSGSSPHDEP  60

Query  418  YVEITLDVREDSVAVHSVKTAAGAD----VEDPELALLARGLEKK-TTLGSSLVRNASSR  582
            YVEITLDVR+DSVAVHSVK AAG D     EDPE+ LLA+GLEK+ T+ GSS+ R AS++
Sbjct  61   YVEITLDVRDDSVAVHSVK-AAGGDHSNLQEDPEITLLAKGLEKRSTSFGSSVARTASAK  119

Query  583  IRQVSQE  603
            IRQVSQE
Sbjct  120  IRQVSQE  126



>ref|XP_006437008.1| hypothetical protein CICLE_v10030649mg [Citrus clementina]
 gb|ESR50248.1| hypothetical protein CICLE_v10030649mg [Citrus clementina]
Length=929

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 94/127 (74%), Gaps = 18/127 (14%)
 Frame = +1

Query  238  SDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDA  417
            SDTEV+    ++R  YSGPLSGPLNKR G+KS +FNLA         + SS+ S+ +D+ 
Sbjct  13   SDTEVLG---NERIPYSGPLSGPLNKRVGRKSTKFNLA---------TESSSGSSPHDEP  60

Query  418  YVEITLDVREDSVAVHSVKTAAGAD----VEDPELALLARGLEKK-TTLGSSLVRNASSR  582
            YVEITLDVR+DSVAVHSVK AAG D     EDPE+ LLA+GLEK+ T+ GSS+ R AS++
Sbjct  61   YVEITLDVRDDSVAVHSVK-AAGGDHSNLQEDPEITLLAKGLEKRSTSFGSSVARTASAK  119

Query  583  IRQVSQE  603
            IRQVSQE
Sbjct  120  IRQVSQE  126



>gb|KHG02500.1| Respiratory burst oxidase C [Gossypium arboreum]
Length=919

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 95/140 (68%), Gaps = 20/140 (14%)
 Frame = +1

Query  187  REMSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdss  366
            ++MSS D     + HHHSD E +  G DK   + GPLSG LNKR G+K +RFNL G    
Sbjct  2    QKMSSDDGI---YHHHHSDKEAL--GTDK-VPHIGPLSGSLNKRAGRKGSRFNLPGSS--  53

Query  367  selgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVED-PELALLARGLEKKT  543
                       ++  D YVEITLDV +DSVAVHS+K A G D++D PEL LLA+GLEKK+
Sbjct  54   -----------SSKGDDYVEITLDVGDDSVAVHSLKAANGDDLQDDPELTLLAKGLEKKS  102

Query  544  TLGSSLVRNASSRIRQVSQE  603
            ++GSS+VRNAS++I+QV QE
Sbjct  103  SVGSSMVRNASAKIKQVGQE  122



>gb|KJB51328.1| hypothetical protein B456_008G212100 [Gossypium raimondii]
Length=920

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 94/141 (67%), Gaps = 23/141 (16%)
 Frame = +1

Query  190  EMSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRT--GKKSARFNLAggds  363
            +MSS D   + H+HH+SDT+V+  G +K   +SGPLSGPLNK+   GKK+A FN+     
Sbjct  3    KMSSEDGDRYHHRHHYSDTDVL--GSEK-VPHSGPLSGPLNKKVAAGKKTAHFNIPDSS-  58

Query  364  sselgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADV-EDPELALLARGLEKK  540
                        ++NDD YVEITLDV  DSVAV SVK A G D+ EDPEL+LLA+GLEKK
Sbjct  59   ------------SSNDDRYVEITLDVTADSVAVQSVKAANGGDLQEDPELSLLAKGLEKK  106

Query  541  TTLGSSLVRNASSRIRQVSQE  603
                S +VRNAS++IRQV  E
Sbjct  107  ----SKVVRNASAKIRQVGHE  123



>gb|KJB51327.1| hypothetical protein B456_008G212100 [Gossypium raimondii]
Length=888

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 94/141 (67%), Gaps = 23/141 (16%)
 Frame = +1

Query  190  EMSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRT--GKKSARFNLAggds  363
            +MSS D   + H+HH+SDT+V+  G +K   +SGPLSGPLNK+   GKK+A FN+     
Sbjct  3    KMSSEDGDRYHHRHHYSDTDVL--GSEK-VPHSGPLSGPLNKKVAAGKKTAHFNIPDSS-  58

Query  364  sselgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADV-EDPELALLARGLEKK  540
                        ++NDD YVEITLDV  DSVAV SVK A G D+ EDPEL+LLA+GLEKK
Sbjct  59   ------------SSNDDRYVEITLDVTADSVAVQSVKAANGGDLQEDPELSLLAKGLEKK  106

Query  541  TTLGSSLVRNASSRIRQVSQE  603
                S +VRNAS++IRQV  E
Sbjct  107  ----SKVVRNASAKIRQVGHE  123



>gb|KJB51323.1| hypothetical protein B456_008G212100 [Gossypium raimondii]
Length=918

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 94/141 (67%), Gaps = 23/141 (16%)
 Frame = +1

Query  190  EMSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRT--GKKSARFNLAggds  363
            +MSS D   + H+HH+SDT+V+  G +K   +SGPLSGPLNK+   GKK+A FN+     
Sbjct  3    KMSSEDGDRYHHRHHYSDTDVL--GSEK-VPHSGPLSGPLNKKVAAGKKTAHFNIPDSS-  58

Query  364  sselgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADV-EDPELALLARGLEKK  540
                        ++NDD YVEITLDV  DSVAV SVK A G D+ EDPEL+LLA+GLEKK
Sbjct  59   ------------SSNDDRYVEITLDVTADSVAVQSVKAANGGDLQEDPELSLLAKGLEKK  106

Query  541  TTLGSSLVRNASSRIRQVSQE  603
                S +VRNAS++IRQV  E
Sbjct  107  ----SKVVRNASAKIRQVGHE  123



>gb|KJB51326.1| hypothetical protein B456_008G212100 [Gossypium raimondii]
Length=912

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 94/141 (67%), Gaps = 23/141 (16%)
 Frame = +1

Query  190  EMSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRT--GKKSARFNLAggds  363
            +MSS D   + H+HH+SDT+V+  G +K   +SGPLSGPLNK+   GKK+A FN+     
Sbjct  3    KMSSEDGDRYHHRHHYSDTDVL--GSEK-VPHSGPLSGPLNKKVAAGKKTAHFNIPDSS-  58

Query  364  sselgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADV-EDPELALLARGLEKK  540
                        ++NDD YVEITLDV  DSVAV SVK A G D+ EDPEL+LLA+GLEKK
Sbjct  59   ------------SSNDDRYVEITLDVTADSVAVQSVKAANGGDLQEDPELSLLAKGLEKK  106

Query  541  TTLGSSLVRNASSRIRQVSQE  603
                S +VRNAS++IRQV  E
Sbjct  107  ----SKVVRNASAKIRQVGHE  123



>gb|KDP22507.1| hypothetical protein JCGZ_26338 [Jatropha curcas]
Length=904

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 85/123 (69%), Gaps = 19/123 (15%)
 Frame = +1

Query  223  HQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsA  402
            HQHHHSDTE++     ++  YSGPLSGPLNKR  +KSARFN+                 +
Sbjct  8    HQHHHSDTELLS---GEKVPYSGPLSGPLNKRGTRKSARFNIPESS-------------S  51

Query  403  NNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSR  582
            + D+ YVE+TLDVR+DSVAVHSVK A G   EDPE+ LLA+GLEK++   S +VRNAS++
Sbjct  52   SQDEQYVEVTLDVRDDSVAVHSVKAANGV-AEDPEVTLLAKGLEKRS--ASKIVRNASAK  108

Query  583  IRQ  591
            IRQ
Sbjct  109  IRQ  111



>ref|XP_002318793.2| respiratory burst oxidase C family protein [Populus trichocarpa]
 gb|EEE97013.2| respiratory burst oxidase C family protein [Populus trichocarpa]
Length=909

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 89/132 (67%), Gaps = 19/132 (14%)
 Frame = +1

Query  208  QQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgsps  387
             Q    + HHSD+E+      +R +YSGPLSGPLNKR G+KSARF++ G           
Sbjct  1    MQDMGREDHHSDSEM---SGSERLAYSGPLSGPLNKRPGRKSARFSIPGTT---------  48

Query  388  sarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVR  567
                 + D+ YVEITLDVR DSVAVHSVK A G + EDPE+ALLA+GLEK++   S+++R
Sbjct  49   ----TSKDEQYVEITLDVRNDSVAVHSVKAANGVE-EDPEMALLAKGLEKRS--ASNVLR  101

Query  568  NASSRIRQVSQE  603
             AS+RIRQVS E
Sbjct  102  TASARIRQVSHE  113



>gb|KHG00108.1| Respiratory burst oxidase C [Gossypium arboreum]
Length=915

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 93/140 (66%), Gaps = 23/140 (16%)
 Frame = +1

Query  193  MSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRT--GKKSARFNLAggdss  366
            MSS D   + H+HH+SDT+V+  G +K   +SGPLSGPLNK+   GKK+A FN+      
Sbjct  1    MSSEDGDRYHHRHHYSDTDVL--GSEK-VPHSGPLSGPLNKKVAAGKKTAHFNIPDSS--  55

Query  367  selgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADV-EDPELALLARGLEKKT  543
                       ++ DD YVEITLDV  DSVAV SVK A G D+ EDPEL+LLA+GLEKK 
Sbjct  56   -----------SSKDDRYVEITLDVTADSVAVQSVKAANGGDLQEDPELSLLAKGLEKK-  103

Query  544  TLGSSLVRNASSRIRQVSQE  603
               S++VRNAS++IRQV  E
Sbjct  104  ---SNVVRNASAKIRQVGHE  120



>ref|XP_010657584.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Vitis 
vinifera]
 ref|XP_010657595.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Vitis 
vinifera]
Length=923

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 92/125 (74%), Gaps = 7/125 (6%)
 Frame = +1

Query  235  HSDTEVMVVGVDKRKSYSGPLSGPLNK-RTGKKSARFNLAggdssselgspssarsANND  411
            +SDTE   V  DK  SYSGPL+GP NK R+ +KSARFN+    S     S  + R  ++D
Sbjct  7    NSDTES--VQSDK-ASYSGPLAGPPNKKRSARKSARFNIPPETSPQLKTSSVTRR--DDD  61

Query  412  DAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLA-RGLEKKTTLGSSLVRNASSRIR  588
            DAYVEITLD+ +DS+AVHSV+ A GA  EDPELALLA + LEKK++LGSS+ RN SSRI+
Sbjct  62   DAYVEITLDILDDSIAVHSVQAAGGAKGEDPELALLAKKTLEKKSSLGSSVFRNTSSRIK  121

Query  589  QVSQE  603
            QVSQE
Sbjct  122  QVSQE  126



>gb|KJB19752.1| hypothetical protein B456_003G117900 [Gossypium raimondii]
Length=691

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 93/140 (66%), Gaps = 20/140 (14%)
 Frame = +1

Query  187  REMSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdss  366
            ++MSS D     + HHHS  EV+  G DK   + GPLSG LNKR G+K +RFNL G    
Sbjct  2    QKMSSDDGI---YHHHHSGKEVL--GTDK-VPHIGPLSGSLNKRAGRKGSRFNLPGSS--  53

Query  367  selgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVED-PELALLARGLEKKT  543
                       ++  D YVEITLDV +DSVAVHS+K   G D++D  EL LLA+GLEKK+
Sbjct  54   -----------SSKGDDYVEITLDVGDDSVAVHSLKATNGDDLQDDAELTLLAKGLEKKS  102

Query  544  TLGSSLVRNASSRIRQVSQE  603
            ++GSS+VRNAS++I+QV QE
Sbjct  103  SVGSSMVRNASAKIKQVGQE  122



>gb|KJB19751.1| hypothetical protein B456_003G117900 [Gossypium raimondii]
Length=919

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 93/140 (66%), Gaps = 20/140 (14%)
 Frame = +1

Query  187  REMSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdss  366
            ++MSS D     + HHHS  EV+  G DK   + GPLSG LNKR G+K +RFNL G    
Sbjct  2    QKMSSDDGI---YHHHHSGKEVL--GTDK-VPHIGPLSGSLNKRAGRKGSRFNLPGSS--  53

Query  367  selgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVED-PELALLARGLEKKT  543
                       ++  D YVEITLDV +DSVAVHS+K   G D++D  EL LLA+GLEKK+
Sbjct  54   -----------SSKGDDYVEITLDVGDDSVAVHSLKATNGDDLQDDAELTLLAKGLEKKS  102

Query  544  TLGSSLVRNASSRIRQVSQE  603
            ++GSS+VRNAS++I+QV QE
Sbjct  103  SVGSSMVRNASAKIKQVGQE  122



>gb|ADR70880.1| respiratory burst oxidase A [Manihot esculenta]
Length=908

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 84/126 (67%), Gaps = 20/126 (16%)
 Frame = +1

Query  226  QHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsAN  405
            QHH SDTE++     +R  YSGPLSGPLNKR  +KSARFN+                S+ 
Sbjct  9    QHHRSDTELIS---GERAPYSGPLSGPLNKRGTRKSARFNIP-------------ESSSA  52

Query  406  NDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRI  585
             D+ YVE+TLDVR+DSVAV SVK A     EDPE  LL +GLEK++T  S ++RNAS+RI
Sbjct  53   QDEQYVEVTLDVRDDSVAVRSVKAAEME--EDPEATLLGKGLEKRST--SKVMRNASTRI  108

Query  586  RQVSQE  603
            RQVSQE
Sbjct  109  RQVSQE  114



>ref|XP_002322314.2| respiratory burst oxidase C family protein [Populus trichocarpa]
 gb|EEF06441.2| respiratory burst oxidase C family protein [Populus trichocarpa]
Length=915

 Score =   115 bits (289),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 83/124 (67%), Gaps = 19/124 (15%)
 Frame = +1

Query  232  HHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANND  411
            HHSDTE+      +R +YSGPLSGPLNKR GKKSARFN+                + + D
Sbjct  9    HHSDTEL---SGSERVAYSGPLSGPLNKRPGKKSARFNIP-------------ETTTSKD  52

Query  412  DAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQ  591
            + YVEITLDVR D VAVHSVK + G   EDPE+ LLA+G +K++   S++VR AS+RIRQ
Sbjct  53   EQYVEITLDVRNDFVAVHSVKPSHGVK-EDPEMTLLAKGPDKRSV--SNVVRTASARIRQ  109

Query  592  VSQE  603
            VS E
Sbjct  110  VSHE  113



>ref|XP_008807835.1| PREDICTED: respiratory burst oxidase homolog protein B-like isoform 
X3 [Phoenix dactylifera]
Length=929

 Score =   115 bits (288),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 91/140 (65%), Gaps = 19/140 (14%)
 Frame = +1

Query  187  REMSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdss  366
            ++M + D +   HQ      E   VG D+        SGPL+KR+ +KSARFNL G    
Sbjct  2    QKMGTDDGKGGDHQSDSDIIETESVGSDRVGH-----SGPLSKRSSRKSARFNLPGSA--  54

Query  367  selgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKT-  543
                       A +D+ YVEITLDVR+DSVAVHSVK AAG + EDPE+ LLAR LEK++ 
Sbjct  55   -----------AGDDEQYVEITLDVRDDSVAVHSVKPAAGGEAEDPEMTLLARTLEKQSG  103

Query  544  TLGSSLVRNASSRIRQVSQE  603
            ++GSS++R+ASSRIRQVSQE
Sbjct  104  SIGSSVLRSASSRIRQVSQE  123



>ref|XP_008807834.1| PREDICTED: respiratory burst oxidase homolog protein C-like isoform 
X2 [Phoenix dactylifera]
Length=921

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 91/140 (65%), Gaps = 19/140 (14%)
 Frame = +1

Query  187  REMSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdss  366
            ++M + D +   HQ      E   VG D+        SGPL+KR+ +KSARFNL G    
Sbjct  2    QKMGTDDGKGGDHQSDSDIIETESVGSDRVGH-----SGPLSKRSSRKSARFNLPGSA--  54

Query  367  selgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKT-  543
                       A +D+ YVEITLDVR+DSVAVHSVK AAG + EDPE+ LLAR LEK++ 
Sbjct  55   -----------AGDDEQYVEITLDVRDDSVAVHSVKPAAGGEAEDPEMTLLARTLEKQSG  103

Query  544  TLGSSLVRNASSRIRQVSQE  603
            ++GSS++R+ASSRIRQVSQE
Sbjct  104  SIGSSVLRSASSRIRQVSQE  123



>ref|XP_008807833.1| PREDICTED: respiratory burst oxidase homolog protein C-like isoform 
X1 [Phoenix dactylifera]
Length=921

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 91/140 (65%), Gaps = 19/140 (14%)
 Frame = +1

Query  187  REMSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdss  366
            ++M + D +   HQ      E   VG D+        SGPL+KR+ +KSARFNL G    
Sbjct  2    QKMGTDDGKGGDHQSDSDIIETESVGSDRVGH-----SGPLSKRSSRKSARFNLPGSA--  54

Query  367  selgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKT-  543
                       A +D+ YVEITLDVR+DSVAVHSVK AAG + EDPE+ LLAR LEK++ 
Sbjct  55   -----------AGDDEQYVEITLDVRDDSVAVHSVKPAAGGEAEDPEMTLLARTLEKQSG  103

Query  544  TLGSSLVRNASSRIRQVSQE  603
            ++GSS++R+ASSRIRQVSQE
Sbjct  104  SIGSSVLRSASSRIRQVSQE  123



>ref|XP_007210905.1| hypothetical protein PRUPE_ppa000984mg [Prunus persica]
 gb|EMJ12104.1| hypothetical protein PRUPE_ppa000984mg [Prunus persica]
Length=941

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 92/127 (72%), Gaps = 8/127 (6%)
 Frame = +1

Query  229  HHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTG-KKSARFNLAggdssselgspssarsAN  405
            H+HSDTE++  G ++  +YSGPLSGPLNKR+G KK+A+FN+A    S+     S     +
Sbjct  10   HYHSDTEIL--GSERMVNYSGPLSGPLNKRSGNKKTAKFNIAEPAGSAVKPGIS----TS  63

Query  406  NDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEK-KTTLGSSLVRNASSR  582
            +++ YVE+ LDVREDSVAVHSVK AA    +  E+ LL +GLEK ++  GSS+VR AS+R
Sbjct  64   DEEPYVEVILDVREDSVAVHSVKPAADDHEDHVEMNLLGKGLEKNQSPKGSSVVRTASAR  123

Query  583  IRQVSQE  603
            I+QVSQE
Sbjct  124  IKQVSQE  130



>ref|XP_011040313.1| PREDICTED: respiratory burst oxidase homolog protein C [Populus 
euphratica]
Length=909

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 83/124 (67%), Gaps = 19/124 (15%)
 Frame = +1

Query  232  HHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANND  411
            HHSDTE+      +R +YSGPLSGPLNKR GKKSARFN+                + + D
Sbjct  9    HHSDTEL---SGSERVAYSGPLSGPLNKRPGKKSARFNIP-------------ETATSKD  52

Query  412  DAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQ  591
            + YVEITLDVR D VA+HSVK + G   EDPE+ LLA+G +K++   S++VR AS+RIRQ
Sbjct  53   EQYVEITLDVRNDFVALHSVKPSHGVK-EDPEMTLLAKGADKRS--ASNVVRTASARIRQ  109

Query  592  VSQE  603
            VS E
Sbjct  110  VSHE  113



>ref|XP_008239295.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Prunus 
mume]
Length=940

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 92/127 (72%), Gaps = 8/127 (6%)
 Frame = +1

Query  229  HHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTG-KKSARFNLAggdssselgspssarsAN  405
            H+HSDTE+  VG ++  +YSGPLSGPLNK++G KK+A+FN+A    S+     S     +
Sbjct  10   HYHSDTEI--VGSERMVTYSGPLSGPLNKKSGNKKTAKFNIAEPAGSAVKPGIS----TS  63

Query  406  NDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEK-KTTLGSSLVRNASSR  582
            +++ YVE+ LDVREDSVAVHSVK +A    +  E+ LL +GLEK ++  GSS+VR AS+R
Sbjct  64   DEEPYVEVILDVREDSVAVHSVKPSADDHEDHVEMTLLGKGLEKNQSPKGSSVVRTASAR  123

Query  583  IRQVSQE  603
            I+QVSQE
Sbjct  124  IKQVSQE  130



>ref|XP_010942321.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Elaeis 
guineensis]
Length=928

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 77/103 (75%), Gaps = 14/103 (14%)
 Frame = +1

Query  298  SGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDSVAVHSVKT  477
            SGPL+KR  +KSARFNL                 A +D+ YVEITLDVR+DSVAVHSVK 
Sbjct  32   SGPLSKRGSRKSARFNLPESA-------------AGDDEQYVEITLDVRDDSVAVHSVKP  78

Query  478  AAGADVEDPELALLARGLEKKT-TLGSSLVRNASSRIRQVSQE  603
            AAG +VEDPE+ LLAR LEK++ ++GS+++R+ASSRIRQVSQE
Sbjct  79   AAGGEVEDPEVTLLARTLEKQSGSIGSAVLRSASSRIRQVSQE  121



>ref|XP_009404193.1| PREDICTED: respiratory burst oxidase homolog protein B [Musa 
acuminata subsp. malaccensis]
Length=938

 Score =   110 bits (275),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 80/107 (75%), Gaps = 14/107 (13%)
 Frame = +1

Query  295  LSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDSVAVHSVK  474
             SGPL+KR  +KSARFNL    +++            +D+AYVEITLDVR+D+VAVHSVK
Sbjct  29   FSGPLSKRGSRKSARFNLPASSAAA----------GEDDEAYVEITLDVRDDTVAVHSVK  78

Query  475  TAAGA---DVEDPELALLARGLEKKT-TLGSSLVRNASSRIRQVSQE  603
             AAGA   ++EDPE++LLAR LE+++ + GSS++R ASSRIRQVSQE
Sbjct  79   PAAGAGGGEMEDPEVSLLARTLERRSASFGSSVIRTASSRIRQVSQE  125



>gb|ADR70892.1| respiratory burst oxidase C [Manihot esculenta]
Length=882

 Score =   102 bits (254),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 58/103 (56%), Positives = 72/103 (70%), Gaps = 16/103 (16%)
 Frame = +1

Query  295  LSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDSVAVHSVK  474
            +SGPLNK+ GKKSARFN+    S+              D+ YVE+TLDVR+DSVAVHSVK
Sbjct  1    MSGPLNKKGGKKSARFNIPESSSA-------------QDEQYVEVTLDVRDDSVAVHSVK  47

Query  475  TAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQVSQE  603
            TA G + E  E+ LL RGLEK++T  S + RNAS+RI+QVSQE
Sbjct  48   TAKGGE-EVGEMTLLGRGLEKRST--SKVARNASARIKQVSQE  87



>ref|XP_010032776.1| PREDICTED: respiratory burst oxidase homolog protein D [Eucalyptus 
grandis]
 gb|KCW52247.1| hypothetical protein EUGRSUZ_J01662 [Eucalyptus grandis]
Length=967

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 78/121 (64%), Gaps = 6/121 (5%)
 Frame = +1

Query  259  VGVDKRKSYSGPLSGPL--NKRTGKKSARFNLAggdssselgspssarsANNDDAYVEIT  432
            VG D R ++SGPL   L  +KR  +KSARFN+    +       +S     + D YVEIT
Sbjct  26   VGSDGRTAFSGPLGSALRSSKRGSRKSARFNIPAETAGLRSAGATSKDEQEDGDPYVEIT  85

Query  433  LDVREDSVAVHSVKTAAGA-DVEDPELALLA-RGLE--KKTTLGSSLVRNASSRIRQVSQ  600
            LD+R+D VAVHSV+ A GA + EDPELALLA R  E  + ++ GSS+ R+ SSR RQVSQ
Sbjct  86   LDIRDDGVAVHSVQAAGGATNFEDPELALLAKRTFETRRSSSFGSSVFRSTSSRFRQVSQ  145

Query  601  E  603
            E
Sbjct  146  E  146



>ref|XP_003602726.1| Respiratory burst oxidase-like protein [Medicago truncatula]
 gb|AES72977.1| respiratory burst oxidase-like protein D [Medicago truncatula]
Length=923

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 81/127 (64%), Gaps = 8/127 (6%)
 Frame = +1

Query  223  HQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsA  402
            H H  SDTE++ +       ++G  SGPLNKR G++SA+ N++   S+ +L         
Sbjct  11   HNHRDSDTELIAL-------HNGSFSGPLNKRVGRRSAKLNVSNSTSAIDLNHQEQDEEK  63

Query  403  NNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSR  582
               D YVE+T+D++ DSVA+HSVKT  G + ED +L LL +G+EKK + G+S VR AS R
Sbjct  64   AEQD-YVEVTMDIQGDSVALHSVKTVPGNNGEDEKLVLLGKGMEKKRSFGASFVRTASIR  122

Query  583  IRQVSQE  603
            ++ VSQE
Sbjct  123  MKHVSQE  129



>gb|EPS73914.1| hypothetical protein M569_00842 [Genlisea aurea]
Length=887

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 71/102 (70%), Gaps = 13/102 (13%)
 Frame = +1

Query  298  SGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDSVAVHSVKT  477
            SGPL+ R  ++S RF L+   +SS          A  D+ YVEITLDVREDSVAVHS+KT
Sbjct  20   SGPLSGRDSRRSTRFGLSEKRNSSA---------AGADEDYVEITLDVREDSVAVHSLKT  70

Query  478  AAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQVSQE  603
            A G DV+DPE ALLA GLE +    +S V+NASS+++QVSQE
Sbjct  71   AGGGDVDDPEFALLANGLEAR----ASAVKNASSKLKQVSQE  108



>ref|XP_011082784.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Sesamum 
indicum]
Length=921

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 71/125 (57%), Positives = 79/125 (63%), Gaps = 24/125 (19%)
 Frame = +1

Query  238  SDTEVMVVGVDKRKSYSGPLSGPLNKRTG--KKSARFNLAggdssselgspssarsANND  411
            SDTEV  +G D R S+SGPLSGPLNKR G  +KS +F+            P +  SA   
Sbjct  17   SDTEV--IGGD-RTSFSGPLSGPLNKRAGGGRKSPQFS-----------HPDTPTSAATA  62

Query  412  DAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSR-IR  588
            D YVEITLDVREDSVAVHSVK A G +VEDP L  L   LEKK    SS  RNA +R IR
Sbjct  63   DDYVEITLDVREDSVAVHSVKAAGGGEVEDPGLTKL---LEKK----SSFARNAPARIIR  115

Query  589  QVSQE  603
            QVS E
Sbjct  116  QVSLE  120



>ref|XP_004979405.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Setaria 
italica]
Length=931

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 79/109 (72%), Gaps = 6/109 (6%)
 Frame = +1

Query  292  PLSGPLNKRTG-KKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDSVAVHS  468
            P SGPL+K+TG +KSARF      +      P ++ SA +DD YVEITLDVR+DSVAVHS
Sbjct  37   PHSGPLSKKTGARKSARFA-ESVSAPLSAPPPRASPSATDDDDYVEITLDVRDDSVAVHS  95

Query  469  VKTAA--GADVEDPELALLARGLEKK--TTLGSSLVRNASSRIRQVSQE  603
            VK AA  GA  EDP++ LLAR LE +  ++ G +++RNASSRI+QVSQE
Sbjct  96   VKPAAHGGAGGEDPDVTLLARTLENRRSSSYGHNVIRNASSRIKQVSQE  144



>ref|XP_009421001.1| PREDICTED: respiratory burst oxidase homolog protein B [Musa 
acuminata subsp. malaccensis]
Length=940

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 72/112 (64%), Gaps = 2/112 (2%)
 Frame = +1

Query  274  RKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDS  453
            R S+SGPLSGPLNKR  K  AR +  G  SS            ++DD YVEITLDVR+D+
Sbjct  28   RISFSGPLSGPLNKRGEKSGARVSFPGSPSSVGSVKGKEQEEEDDDDTYVEITLDVRDDT  87

Query  454  VAVHSVKTAAGADVED--PELALLARGLEKKTTLGSSLVRNASSRIRQVSQE  603
            VAVHSVK A         PE+A LAR LE+++  G+S++R AS R RQVSQE
Sbjct  88   VAVHSVKAAGAGGDAAGDPEVAALARELERRSAFGASVMRTASWRFRQVSQE  139



>emb|CBI29289.3| unnamed protein product [Vitis vinifera]
Length=906

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 61/127 (48%), Positives = 80/127 (63%), Gaps = 8/127 (6%)
 Frame = +1

Query  229  HHHSDTEVMVVGVDKRKSYSGPLSGPLNK-RTGKKSARFNLAggdssselgspssarsAN  405
            H +SDTE   V  DK  SY GPL GP +K R+ ++SARFN+    SS    +  +     
Sbjct  4    HDNSDTEN--VQSDK-ASYCGPLGGPPDKKRSARESARFNIPPVTSSQLKSTSVT---PR  57

Query  406  NDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLA-RGLEKKTTLGSSLVRNASSR  582
            +DD YVEITL V +DS+ VHSV+   GA  EDP+LA LA + L+KK++  SS+    SSR
Sbjct  58   DDDDYVEITLGVLDDSITVHSVQAPGGAKGEDPQLAQLAKKSLQKKSSYASSIFCTTSSR  117

Query  583  IRQVSQE  603
            I+ VSQE
Sbjct  118  IKPVSQE  124



>ref|XP_002268641.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Vitis 
vinifera]
Length=922

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 61/127 (48%), Positives = 80/127 (63%), Gaps = 8/127 (6%)
 Frame = +1

Query  229  HHHSDTEVMVVGVDKRKSYSGPLSGPLNK-RTGKKSARFNLAggdssselgspssarsAN  405
            H +SDTE   V  DK  SY GPL GP +K R+ ++SARFN+    SS    +  +     
Sbjct  4    HDNSDTEN--VQSDK-ASYCGPLGGPPDKKRSARESARFNIPPVTSSQLKSTSVT---PR  57

Query  406  NDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLA-RGLEKKTTLGSSLVRNASSR  582
            +DD YVEITL V +DS+ VHSV+   GA  EDP+LA LA + L+KK++  SS+    SSR
Sbjct  58   DDDDYVEITLGVLDDSITVHSVQAPGGAKGEDPQLAQLAKKSLQKKSSYASSIFCTTSSR  117

Query  583  IRQVSQE  603
            I+ VSQE
Sbjct  118  IKPVSQE  124



>gb|ABA94089.2| respiratory burst oxidase protein D, putative, expressed [Oryza 
sativa Japonica Group]
Length=936

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 79/112 (71%), Gaps = 9/112 (8%)
 Frame = +1

Query  292  PLSGPLNKRTG-KKSARF----NLAggdssselgspssarsANNDDA--YVEITLDVRED  450
            P SGPL+KR+G +KSARF    +      S    +  +A +AN+DD   YVEITLDVR+D
Sbjct  36   PHSGPLSKRSGMRKSARFAESVSAPLSAPSGVAAARRAAAAANDDDEEDYVEITLDVRDD  95

Query  451  SVAVHSVKTAAGADVEDPELALLARGLEKK-TTLGSSLVRNASSRIRQVSQE  603
            SVAVHSVK A G   ED ++ LLAR LEK+ ++ G S++RNASSRI+QVSQE
Sbjct  96   SVAVHSVKPAGGGG-EDSDVTLLARTLEKRSSSFGHSVIRNASSRIKQVSQE  146



>gb|EEC68302.1| hypothetical protein OsI_36373 [Oryza sativa Indica Group]
Length=983

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 79/112 (71%), Gaps = 9/112 (8%)
 Frame = +1

Query  292  PLSGPLNKRTG-KKSARF----NLAggdssselgspssarsANNDDA--YVEITLDVRED  450
            P SGPL+KR+G +KSARF    +      S    +  +A +AN+DD   YVEITLDVR+D
Sbjct  36   PHSGPLSKRSGMRKSARFAESVSAPLSAPSGVAAARRAAAAANDDDEEDYVEITLDVRDD  95

Query  451  SVAVHSVKTAAGADVEDPELALLARGLEKK-TTLGSSLVRNASSRIRQVSQE  603
            SVAVHSVK A G   ED ++ LLAR LEK+ ++ G S++RNASSRI+QVSQE
Sbjct  96   SVAVHSVKPAGGGG-EDSDVTLLARTLEKRSSSFGHSVIRNASSRIKQVSQE  146



>ref|XP_009792218.1| PREDICTED: respiratory burst oxidase homolog protein D-like isoform 
X3 [Nicotiana sylvestris]
Length=707

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 44/67 (66%), Positives = 55/67 (82%), Gaps = 2/67 (3%)
 Frame = +1

Query  409  DDAYVEITLDVREDSVAVHSVKTAAGADVEDPELAL--LARGLEKKTTLGSSLVRNASSR  582
            DD YVEITLDVRED+VAVHSVK A+GA+VE+ EL +  LA+ L KK + G+S+VRN S R
Sbjct  32   DDTYVEITLDVREDTVAVHSVKNASGANVEEAELQVLRLAKNLRKKQSFGTSVVRNTSIR  91

Query  583  IRQVSQE  603
            +RQV+QE
Sbjct  92   MRQVAQE  98



>gb|ADR70882.1| respiratory burst oxidase D [Manihot esculenta]
Length=914

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 63/128 (49%), Positives = 81/128 (63%), Gaps = 19/128 (15%)
 Frame = +1

Query  235  HSDTEVMVVGVDKRKSYSGPLSGP-LNK-RTGKKSARFNLAggdssselgspssarsANN  408
            +SD+E +      R ++SGPL GP LNK R+ KKSAR N+    +++          A+ 
Sbjct  6    YSDSESIA---SDRTAFSGPLGGPPLNKKRSSKKSARLNIPPETTTTYSN-------ADE  55

Query  409  D-DAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARG-LEKKT-TLGSSLVRNASS  579
            D  +YVEITLD+R+DSVAVHSV  A     EDPE ALLA+  LE KT +  +SL RN SS
Sbjct  56   DPSSYVEITLDIRDDSVAVHSVHPAN----EDPEFALLAKKTLENKTSSFRASLFRNTSS  111

Query  580  RIRQVSQE  603
             I+QVSQE
Sbjct  112  HIKQVSQE  119



>gb|KJB59802.1| hypothetical protein B456_009G273400 [Gossypium raimondii]
Length=673

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 67/138 (49%), Positives = 90/138 (65%), Gaps = 15/138 (11%)
 Frame = +1

Query  223  HQHHHSDTEVMVVGVDKRKSYSGPL------SGPLNKRTGKKSARFNLA---ggdsssel  375
            +  ++SDTE +      R ++SGPL       G  NK++ KKS RFNL        ++  
Sbjct  10   YSENNSDTESIA---SDRATFSGPLVLGGGGGGVSNKKSSKKSTRFNLPPEITMAKTNST  66

Query  376  gspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARG-LEKKT-TL  549
             S +S   A+NDD+YVEITLD+R+DSVAVHSV+ A G + EDPELALLA+  LE K+ + 
Sbjct  67   RSAASLAGADNDDSYVEITLDIRDDSVAVHSVQGAGGGN-EDPELALLAKKTLENKSASF  125

Query  550  GSSLVRNASSRIRQVSQE  603
             S L+RN S+RI+QVSQE
Sbjct  126  RSYLLRNTSNRIKQVSQE  143



>ref|XP_009792203.1| PREDICTED: respiratory burst oxidase homolog protein D-like isoform 
X1 [Nicotiana sylvestris]
Length=892

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 44/67 (66%), Positives = 55/67 (82%), Gaps = 2/67 (3%)
 Frame = +1

Query  409  DDAYVEITLDVREDSVAVHSVKTAAGADVEDPELAL--LARGLEKKTTLGSSLVRNASSR  582
            DD YVEITLDVRED+VAVHSVK A+GA+VE+ EL +  LA+ L KK + G+S+VRN S R
Sbjct  32   DDTYVEITLDVREDTVAVHSVKNASGANVEEAELQVLRLAKNLRKKQSFGTSVVRNTSIR  91

Query  583  IRQVSQE  603
            +RQV+QE
Sbjct  92   MRQVAQE  98



>ref|XP_009792212.1| PREDICTED: respiratory burst oxidase homolog protein D-like isoform 
X2 [Nicotiana sylvestris]
Length=711

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 44/67 (66%), Positives = 55/67 (82%), Gaps = 2/67 (3%)
 Frame = +1

Query  409  DDAYVEITLDVREDSVAVHSVKTAAGADVEDPELAL--LARGLEKKTTLGSSLVRNASSR  582
            DD YVEITLDVRED+VAVHSVK A+GA+VE+ EL +  LA+ L KK + G+S+VRN S R
Sbjct  32   DDTYVEITLDVREDTVAVHSVKNASGANVEEAELQVLRLAKNLRKKQSFGTSVVRNTSIR  91

Query  583  IRQVSQE  603
            +RQV+QE
Sbjct  92   MRQVAQE  98



>ref|XP_006279397.1| hypothetical protein CARUB_v10007974mg [Capsella rubella]
 gb|EOA12295.1| hypothetical protein CARUB_v10007974mg [Capsella rubella]
Length=921

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 67/159 (42%), Positives = 86/159 (54%), Gaps = 23/159 (14%)
 Frame = +1

Query  175  LKEEREMSSSDQQ----SFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARF  342
            +K  R  SSSD +       +  ++SDTE M      R ++SGPL  P  KR  KK+ARF
Sbjct  1    MKMRRGNSSSDHELGILRGANSDNNSDTETMPA---DRGAFSGPLGRP--KRASKKNARF  55

Query  343  NLAggdssselgspssarsANNDDAYVEITLDVREDSVAVHSVKTAA--GADVEDPELAL  516
                  +     S S      +DD YVEITLD+R+DSVAVHSV+ AA  G  +EDPELAL
Sbjct  56   -----AADLPKRSNSLTGGRGDDDEYVEITLDIRDDSVAVHSVQQAAGGGGHLEDPELAL  110

Query  517  LAR-----GLEKKTTLGSSLVRNASSRIRQVSQEQAHSF  618
            L +      L   T+L  S  R+ SSRI+  S+E    F
Sbjct  111  LTKKTLESSLNNTTSL--SFFRSTSSRIKNASRELRRVF  147



>ref|XP_004141156.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Cucumis 
sativus]
 gb|KGN59783.1| hypothetical protein Csa_3G845500 [Cucumis sativus]
Length=926

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 82/116 (71%), Gaps = 16/116 (14%)
 Frame = +1

Query  274  RKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDS  453
            R+++SGP+S    K   +K+A+F+L+   SS +         A++DD YVEITLD+R+DS
Sbjct  25   RRAFSGPISSSTTK--PRKNAKFDLSSSSSSLKA--------ADDDDTYVEITLDIRDDS  74

Query  454  VAVHSVKTAA-GAD---VEDPELALLA-RGLEKK-TTLGSSLVRNASSRIRQVSQE  603
            VAVHSV TA  G D   +EDPEL+LLA R LEKK ++  +S++R+ SSRI+QVSQE
Sbjct  75   VAVHSVHTAGPGQDPNSLEDPELSLLAKRTLEKKSSSFRASVLRSTSSRIKQVSQE  130



>ref|XP_004166291.1| PREDICTED: LOW QUALITY PROTEIN: respiratory burst oxidase homolog 
protein C-like [Cucumis sativus]
Length=926

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 82/116 (71%), Gaps = 16/116 (14%)
 Frame = +1

Query  274  RKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDS  453
            R+++SGP+S    K   +K+A+F+L+   SS +         A++DD YVEITLD+R+DS
Sbjct  25   RRAFSGPISSSTTK--PRKNAKFDLSSSSSSLKA--------ADDDDTYVEITLDIRDDS  74

Query  454  VAVHSVKTAA-GAD---VEDPELALLA-RGLEKK-TTLGSSLVRNASSRIRQVSQE  603
            VAVHSV TA  G D   +EDPEL+LLA R LEKK ++  +S++R+ SSRI+QVSQE
Sbjct  75   VAVHSVHTAGPGQDPNSLEDPELSLLAKRTLEKKSSSFRASVLRSTSSRIKQVSQE  130



>ref|XP_008465165.1| PREDICTED: respiratory burst oxidase homolog protein C [Cucumis 
melo]
 ref|XP_008465166.1| PREDICTED: respiratory burst oxidase homolog protein C [Cucumis 
melo]
Length=924

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 82/116 (71%), Gaps = 16/116 (14%)
 Frame = +1

Query  274  RKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDS  453
            R+++SGP+S    K   +K+A+F+L+   SS +         A+ DD YVEITLD+R+DS
Sbjct  25   RRAFSGPISSSTTKP--RKNAKFDLSSSSSSLKA--------ADEDDTYVEITLDIRDDS  74

Query  454  VAVHSVKTA-AGAD---VEDPELALLA-RGLEKK-TTLGSSLVRNASSRIRQVSQE  603
            VAVHSV TA AG D   +EDPEL+LLA + LEKK ++  +S++R+ SSRI+QVSQE
Sbjct  75   VAVHSVHTAGAGQDPNSLEDPELSLLAKKTLEKKSSSFRASVLRSTSSRIKQVSQE  130



>ref|XP_002512702.1| respiratory burst oxidase, putative [Ricinus communis]
 gb|EEF50154.1| respiratory burst oxidase, putative [Ricinus communis]
Length=709

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 63/143 (44%), Positives = 88/143 (62%), Gaps = 23/143 (16%)
 Frame = +1

Query  187  REMSSSDQQSFRHQHHHSD--TEVMVVGVDKRKSYSGPLS----GPLNK-RTGKKSARFN  345
            +E +++D    +  ++ SD  ++   +  D R ++SGPL      PL+K R+ KKSARFN
Sbjct  3    KETTTTDPHQGKGTYYFSDNTSDTESIASD-RTAFSGPLGVGVGAPLHKKRSSKKSARFN  61

Query  346  LAggdssselgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLA-  522
            L    SS+ +         +   +YVEITLD+R+DSVAVHSV+   GA+ EDP+LALLA 
Sbjct  62   LPPETSSAGVE--------DPSSSYVEITLDIRDDSVAVHSVQ---GANYEDPDLALLAK  110

Query  523  RGLEKKTTLGSSLVRNASSRIRQ  591
            R LE K+T   SL RN SS I+Q
Sbjct  111  RTLENKST---SLFRNTSSHIKQ  130



>gb|ACF05504.2| respiratory burst oxidase-like protein [Citrullus colocynthis]
Length=926

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 79/116 (68%), Gaps = 17/116 (15%)
 Frame = +1

Query  274  RKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDS  453
            R+++SGP+S     R   K+A+F+L+   SS +         A++DD YVEITLD+R+DS
Sbjct  26   RRAFSGPISSTTKPR---KNAKFDLSSSSSSPKA--------ADDDDTYVEITLDIRDDS  74

Query  454  VAVHSVKTAAGAD----VEDPELALLA-RGLEKK-TTLGSSLVRNASSRIRQVSQE  603
            VAVHSV TA  A     +EDPEL+LLA R LEKK ++  +S++R+ SSR +QVSQE
Sbjct  75   VAVHSVHTAGAAQDPNSLEDPELSLLAKRTLEKKSSSFRASVLRSTSSRFKQVSQE  130



>ref|XP_008375433.1| PREDICTED: respiratory burst oxidase homolog protein C [Malus 
domestica]
Length=941

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 85/131 (65%), Gaps = 18/131 (14%)
 Frame = +1

Query  229  HHHSDTEVMVVGVDKRKSYSGPLSGPLN-----KRTG-KKSARFNLAggdssselgspss  390
            H+HSDTE+ + G +K  +YSGPLSGPL+     KR+G KK+A+ N     +   + +   
Sbjct  10   HYHSDTEI-IGGNEKMANYSGPLSGPLSGPLNKKRSGTKKNAKIN-----TPEPISATKP  63

Query  391  arsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPE--LALLARGLEKKTTLGSSLV  564
              S+N++++YVE+TLDVR+DSVAVHSVK A     ED E  + LL +GLEK      S V
Sbjct  64   GISSNDEESYVEVTLDVRDDSVAVHSVKPADHPPHEDHEDHVELLGKGLEKS----RSFV  119

Query  565  RNASSRIRQVS  597
            RNAS  I++++
Sbjct  120  RNASFHIKRLA  130



>ref|XP_010482026.1| PREDICTED: respiratory burst oxidase homolog protein D [Camelina 
sativa]
Length=923

 Score = 86.3 bits (212),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 64/157 (41%), Positives = 87/157 (55%), Gaps = 19/157 (12%)
 Frame = +1

Query  175  LKEEREMSSSDQQ--SFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNL  348
            +K  R  SS+D +    R  +  ++++   +  D R + SGPL GP  KR  KK+ARF  
Sbjct  1    MKMRRGNSSTDHELGILRGANLDTNSDTESIASD-RGALSGPLGGP--KRASKKNARF--  55

Query  349  AggdssselgspssarsANNDDAYVEITLDVREDSVAVHSVKTAA--GADVEDPELALLA  522
                +     S S      +DD YVEITLD+R+DSVAVHSV+ AA  G+ +EDPELALL 
Sbjct  56   ---AADLPKRSNSVTGGHGDDDEYVEITLDIRDDSVAVHSVQQAAGGGSHLEDPELALLT  112

Query  523  R-----GLEKKTTLGSSLVRNASSRIRQVSQEQAHSF  618
            +      L   T+L  S  R+ SSRI+  S+E    F
Sbjct  113  KKTLESSLNNTTSL--SFFRSTSSRIKNASRELRRVF  147



>ref|XP_002863831.1| hypothetical protein ARALYDRAFT_917612 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40090.1| hypothetical protein ARALYDRAFT_917612 [Arabidopsis lyrata subsp. 
lyrata]
Length=920

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 65/157 (41%), Positives = 87/157 (55%), Gaps = 19/157 (12%)
 Frame = +1

Query  175  LKEEREMSSSDQQ--SFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNL  348
            +K  R  SS+D +    R  +  ++++   +  D R ++SGPL  P  KR  KK+ARF  
Sbjct  1    MKMRRGNSSTDHELGILRGANSDTNSDTESIASD-RGAFSGPLGRP--KRASKKNARF--  55

Query  349  AggdssselgspssarsANNDDAYVEITLDVREDSVAVHSVKTAA--GADVEDPELALLA  522
                      S S A    +DD YVEITLD+R+DSVAVHSV+ AA  GA +EDPELALL 
Sbjct  56   ---ADDLPKRSNSVAGGRGDDDEYVEITLDIRDDSVAVHSVQQAAGGGAHLEDPELALLT  112

Query  523  R-----GLEKKTTLGSSLVRNASSRIRQVSQEQAHSF  618
            +      L   T+L  S  R+ SSRI+  S+E    F
Sbjct  113  KKTLESSLNNTTSL--SFFRSTSSRIKNASRELRRVF  147



>ref|XP_007017524.1| Respiratory burst oxidase D [Theobroma cacao]
 gb|EOY14749.1| Respiratory burst oxidase D [Theobroma cacao]
Length=961

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 70/101 (69%), Gaps = 4/101 (4%)
 Frame = +1

Query  310  NKRTGKKSARFNLAggdssselgsp-ssarsANNDDAYVEITLDVREDSVAVHSVKTAAG  486
            NKR  KKSARFNL    + ++  S  SSA  A  D+ YVEITLD+R+DSVAVHSV+ A G
Sbjct  75   NKRASKKSARFNLPPEITLAKTNSTGSSASFAAADNDYVEITLDIRDDSVAVHSVQGAGG  134

Query  487  ADVEDPELALLA-RGLEKKT-TLGSSLVRNASSRIRQVSQE  603
             D EDPELALLA R LE K+ +  S L  N S+ I+QVSQE
Sbjct  135  GD-EDPELALLAKRTLENKSASFRSYLFGNTSAHIKQVSQE  174



>gb|KJB59801.1| hypothetical protein B456_009G273400 [Gossypium raimondii]
Length=930

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 90/138 (65%), Gaps = 15/138 (11%)
 Frame = +1

Query  223  HQHHHSDTEVMVVGVDKRKSYSGPL------SGPLNKRTGKKSARFNLA---ggdsssel  375
            +  ++SDTE +      R ++SGPL       G  NK++ KKS RFNL        ++  
Sbjct  10   YSENNSDTESIA---SDRATFSGPLVLGGGGGGVSNKKSSKKSTRFNLPPEITMAKTNST  66

Query  376  gspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLA-RGLEKKT-TL  549
             S +S   A+NDD+YVEITLD+R+DSVAVHSV+ A G + EDPELALLA + LE K+ + 
Sbjct  67   RSAASLAGADNDDSYVEITLDIRDDSVAVHSVQGAGGGN-EDPELALLAKKTLENKSASF  125

Query  550  GSSLVRNASSRIRQVSQE  603
             S L+RN S+RI+QVSQE
Sbjct  126  RSYLLRNTSNRIKQVSQE  143



>ref|XP_006487656.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Citrus 
sinensis]
Length=915

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 63/128 (49%), Positives = 81/128 (63%), Gaps = 18/128 (14%)
 Frame = +1

Query  232  HHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANND  411
            ++SDTE   +G DK  ++SGPL+   NKR  KKSARFNL    + +   +       N+D
Sbjct  16   NNSDTES--IGSDK-SAFSGPLA---NKRASKKSARFNLPPEAAVTSSSNN------NDD  63

Query  412  DAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGL----EKKTTLGSSLVRNASS  579
              YVEITLD+R+DSVAVHSV+ A     EDPEL+LLA+       K ++  SSL RN SS
Sbjct  64   GGYVEITLDIRDDSVAVHSVQGALHH--EDPELSLLAKKTLEINNKSSSFRSSLFRNTSS  121

Query  580  RIRQVSQE  603
             I+QVSQE
Sbjct  122  HIKQVSQE  129



>ref|XP_006423884.1| hypothetical protein CICLE_v10027774mg [Citrus clementina]
 gb|ESR37124.1| hypothetical protein CICLE_v10027774mg [Citrus clementina]
 gb|KDO45136.1| hypothetical protein CISIN_1g002525mg [Citrus sinensis]
Length=912

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 63/128 (49%), Positives = 81/128 (63%), Gaps = 18/128 (14%)
 Frame = +1

Query  232  HHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANND  411
            ++SDTE   +G DK  ++SGPL+   NKR  KKSARFNL    + +   +       N+D
Sbjct  13   NNSDTES--IGSDK-SAFSGPLA---NKRASKKSARFNLPPEAAVTSSSNN------NDD  60

Query  412  DAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGL----EKKTTLGSSLVRNASS  579
              YVEITLD+R+DSVAVHSV+ A     EDPEL+LLA+       K ++  SSL RN SS
Sbjct  61   GGYVEITLDIRDDSVAVHSVQGALHH--EDPELSLLAKKTLEINNKSSSFRSSLFRNTSS  118

Query  580  RIRQVSQE  603
             I+QVSQE
Sbjct  119  HIKQVSQE  126



>ref|XP_003522455.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Glycine 
max]
Length=928

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 80/125 (64%), Gaps = 14/125 (11%)
 Frame = +1

Query  229  HHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANN  408
            HHH D+++ ++   +R     P SGPLNKR   +S++ N       +   + +SA    +
Sbjct  16   HHHRDSDIELIA--ERAPL--PHSGPLNKR---RSSKLN-------NTSSASTSATEEQD  61

Query  409  DDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIR  588
            +  YVE+T+D++ DSVA+HSVKT      ED +L LL +G+EKK + G+S+VR+AS RI+
Sbjct  62   EGDYVEVTMDIQGDSVALHSVKTVNNDQSEDEKLILLGKGMEKKRSFGASVVRSASIRIQ  121

Query  589  QVSQE  603
            QVSQE
Sbjct  122  QVSQE  126



>gb|KHN31235.1| Respiratory burst oxidase like protein C [Glycine soja]
Length=928

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 80/125 (64%), Gaps = 14/125 (11%)
 Frame = +1

Query  229  HHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANN  408
            HHH D+++ ++   +R     P SGPLNKR   +S++ N       +   + +SA    +
Sbjct  16   HHHRDSDIELIA--ERAPL--PHSGPLNKR---RSSKLN-------NTSSASTSATEEQD  61

Query  409  DDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIR  588
            +  YVE+T+D++ DSVA+HSVKT      ED +L LL +G+EKK + G+S+VR+AS RI+
Sbjct  62   EGDYVEVTMDIQGDSVALHSVKTVNNDQSEDEKLILLGKGMEKKRSFGASVVRSASIRIQ  121

Query  589  QVSQE  603
            QVSQE
Sbjct  122  QVSQE  126



>ref|XP_007137830.1| hypothetical protein PHAVU_009G159200g [Phaseolus vulgaris]
 gb|ESW09824.1| hypothetical protein PHAVU_009G159200g [Phaseolus vulgaris]
Length=930

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 82/126 (65%), Gaps = 8/126 (6%)
 Frame = +1

Query  232  HHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANND  411
            H  D+++ ++G ++      P SGPL+KR G++S++ + A   +S      S ++  +  
Sbjct  14   HLRDSDIELIGGER-----APHSGPLSKRVGRRSSKLSNASASTSGSDVGHSISQEQDEG  68

Query  412  DAYVEITLDVREDSVAVHSVKTAAGA--DVEDPELALLARGLEKKTTLGSSLVRNASSRI  585
            D YVE+T+D++ DSVA+HSV   AG     ED +L LL +G+EKK + G+S+VR+AS RI
Sbjct  69   D-YVEVTMDIKGDSVALHSVIPVAGNSDQGEDEKLVLLGKGMEKKRSFGASVVRSASIRI  127

Query  586  RQVSQE  603
            +QVSQE
Sbjct  128  QQVSQE  133



>gb|AEX56133.1| NADPH oxidase [Phaseolus vulgaris]
Length=930

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 82/126 (65%), Gaps = 8/126 (6%)
 Frame = +1

Query  232  HHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANND  411
            H  D+++ ++G ++      P SGPL+KR G++S++ + A   +S      S ++  +  
Sbjct  14   HLRDSDIELIGGER-----APHSGPLSKRVGRRSSKLSNASASTSGSDVGHSISQEQDEG  68

Query  412  DAYVEITLDVREDSVAVHSVKTAAGA--DVEDPELALLARGLEKKTTLGSSLVRNASSRI  585
            D YVE+T+D++ DSVA+HSV   AG     ED +L LL +G+EKK + G+S+VR+AS RI
Sbjct  69   D-YVEVTMDIKGDSVALHSVIPVAGNSDQGEDEKLVLLGKGMEKKRSFGASVVRSASIRI  127

Query  586  RQVSQE  603
            +QVSQE
Sbjct  128  QQVSQE  133



>gb|KJB14501.1| hypothetical protein B456_002G128200 [Gossypium raimondii]
Length=786

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 59/133 (44%), Positives = 81/133 (61%), Gaps = 17/133 (13%)
 Frame = +1

Query  223  HQHHHSDTEVMVVGVDKRKSYSGPL---SGPL-NKRTGKKSARFNLAggdssselgspss  390
            +  ++SDTE +     +R ++S PL   + P  NKR  KKSA FNL    ++    +   
Sbjct  10   YSENNSDTESIA---SERTTFSEPLPLNAAPFSNKRGSKKSATFNLPPEITTMPNSAAED  66

Query  391  arsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLA-RGLEKKT-TLGSSLV  564
                + D+ YVEITLD+R++SVAV+SV+       EDPELALLA   +E KT +L SSL 
Sbjct  67   ----DEDEGYVEITLDIRDNSVAVYSVQGGN----EDPELALLALSTMENKTMSLRSSLF  118

Query  565  RNASSRIRQVSQE  603
             N S+RI+QVSQE
Sbjct  119  SNTSARIKQVSQE  131



>gb|KHG05306.1| Respiratory burst oxidase D -like protein [Gossypium arboreum]
Length=916

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 59/133 (44%), Positives = 81/133 (61%), Gaps = 17/133 (13%)
 Frame = +1

Query  223  HQHHHSDTEVMVVGVDKRKSYSGPL---SGPL-NKRTGKKSARFNLAggdssselgspss  390
            +  ++SDTE +     +R ++S PL   + P  NKR  KKSA FNL    ++    +   
Sbjct  10   YSENNSDTESIA---SERTTFSEPLPLNAAPFSNKRGSKKSATFNLPPEITTMPNSAAED  66

Query  391  arsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLA-RGLEKK-TTLGSSLV  564
                + D+ YVEITLD+R+DSVAV+S +       EDPELALL+ R +E K T+L SSL 
Sbjct  67   ----DEDEGYVEITLDIRDDSVAVYSFQGGN----EDPELALLSLRTMENKSTSLRSSLF  118

Query  565  RNASSRIRQVSQE  603
             N S+RI+QVSQE
Sbjct  119  SNTSARIKQVSQE  131



>gb|AAC39479.1| respiratory burst oxidase protein D [Arabidopsis thaliana]
Length=921

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 64/157 (41%), Positives = 86/157 (55%), Gaps = 19/157 (12%)
 Frame = +1

Query  175  LKEEREMSSSDQQ--SFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNL  348
            +K  R  SS+D +    R  +  ++++   +  D R ++SGPL  P  KR  KK+ARF  
Sbjct  1    MKMRRGNSSNDHELGILRGANSDTNSDTESIASD-RGAFSGPLGRP--KRASKKNARF--  55

Query  349  AggdssselgspssarsANNDDAYVEITLDVREDSVAVHSVKTAA--GADVEDPELALLA  522
                      S S A    +DD YVEITLD+R+DSVAVHSV+ AA  G  +EDPELALL 
Sbjct  56   ---ADDLPKRSNSVAGGRGDDDEYVEITLDIRDDSVAVHSVQQAAGGGGHLEDPELALLT  112

Query  523  R-----GLEKKTTLGSSLVRNASSRIRQVSQEQAHSF  618
            +      L   T+L  S  R+ SSRI+  S+E    F
Sbjct  113  KKTLESSLNNTTSL--SFFRSTSSRIKNASRELRRVF  147



>ref|NP_199602.1| respiratory burst oxidase-D [Arabidopsis thaliana]
 sp|Q9FIJ0.1|RBOHD_ARATH RecName: Full=Respiratory burst oxidase homolog protein D; AltName: 
Full=NADPH oxidase RBOHD; Short=AtRBOHD [Arabidopsis 
thaliana]
 gb|AAL11618.1|AF424625_1 AT5g47910/MCA23_25 [Arabidopsis thaliana]
 dbj|BAB11338.1| respiratory burst oxidase protein [Arabidopsis thaliana]
 gb|AAO11567.1| At5g47910/MCA23_25 [Arabidopsis thaliana]
 gb|AED95593.1| respiratory burst oxidase-D [Arabidopsis thaliana]
Length=921

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 64/157 (41%), Positives = 86/157 (55%), Gaps = 19/157 (12%)
 Frame = +1

Query  175  LKEEREMSSSDQQ--SFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNL  348
            +K  R  SS+D +    R  +  ++++   +  D R ++SGPL  P  KR  KK+ARF  
Sbjct  1    MKMRRGNSSNDHELGILRGANSDTNSDTESIASD-RGAFSGPLGRP--KRASKKNARF--  55

Query  349  AggdssselgspssarsANNDDAYVEITLDVREDSVAVHSVKTAA--GADVEDPELALLA  522
                      S S A    +DD YVEITLD+R+DSVAVHSV+ AA  G  +EDPELALL 
Sbjct  56   ---ADDLPKRSNSVAGGRGDDDEYVEITLDIRDDSVAVHSVQQAAGGGGHLEDPELALLT  112

Query  523  R-----GLEKKTTLGSSLVRNASSRIRQVSQEQAHSF  618
            +      L   T+L  S  R+ SSRI+  S+E    F
Sbjct  113  KKTLESSLNNTTSL--SFFRSTSSRIKNASRELRRVF  147



>ref|XP_009390376.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Musa 
acuminata subsp. malaccensis]
Length=909

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 73/111 (66%), Gaps = 19/111 (17%)
 Frame = +1

Query  295  LSGPLNKRTG---KKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDSVAVH  465
             SGPLNK  G   +KSARFNL    ++             + + ++EITLDV +DSVAVH
Sbjct  25   FSGPLNKHGGGSNRKSARFNLPPPPAAPV-----------DGETFLEITLDVTDDSVAVH  73

Query  466  SVKTAA---GADVEDP-ELALLARGLEKKT-TLGSSLVRNASSRIRQVSQE  603
            SVK AA   G   EDP E++LL + LE+++ + GSS++R+ASSRIRQVSQE
Sbjct  74   SVKPAAGGVGGKEEDPEEVSLLVQKLERQSASFGSSVLRSASSRIRQVSQE  124



>ref|XP_002450884.1| hypothetical protein SORBIDRAFT_05g020380 [Sorghum bicolor]
 gb|EES09872.1| hypothetical protein SORBIDRAFT_05g020380 [Sorghum bicolor]
Length=936

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 78/109 (72%), Gaps = 5/109 (5%)
 Frame = +1

Query  292  PLSGPLNKRTG-KKSARF--NLAggdssselgspssarsANNDDAYVEITLDVREDSVAV  462
            P SGPL+K+TG +KSARF  +++   ++      SSA + ++DD YVEITLDVR+DSVAV
Sbjct  36   PHSGPLSKKTGARKSARFAESVSAPLTAPPPPRASSANNNDDDDDYVEITLDVRDDSVAV  95

Query  463  HSVKTA--AGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQVSQE  603
            HSVK A   G   +D ++ LLAR LE +   G S++RNASSRI+QVSQE
Sbjct  96   HSVKPAHGGGGGGDDSDVTLLARTLENRRASGHSVIRNASSRIKQVSQE  144



>gb|KJB58284.1| hypothetical protein B456_009G202500 [Gossypium raimondii]
Length=936

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 65/136 (48%), Positives = 85/136 (63%), Gaps = 17/136 (13%)
 Frame = +1

Query  235  HSDTEVMVVGVDKRKSYSGPLS--GPL--NKRTGKKSARFNLAggdssselgsp------  384
            +SDTE +     +R ++SGPL   G +  +KR  KKSA FNL    + S+  S       
Sbjct  14   NSDTESIA---SERATFSGPLGVGGGIVSSKRASKKSATFNLPPEITMSKANSAGSFASF  70

Query  385  -ssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLA-RGLEKKT-TLGS  555
             SSA +A  DD YVEITLD+ +DS+AVH V+ A G   EDPEL+LLA R LE K+ +  S
Sbjct  71   DSSAVAAAGDDDYVEITLDILDDSIAVHRVQGADGGH-EDPELSLLAKRTLENKSASFRS  129

Query  556  SLVRNASSRIRQVSQE  603
             L+RN S+RI+Q SQE
Sbjct  130  YLLRNTSARIKQFSQE  145



>ref|XP_009360267.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Pyrus 
x bretschneideri]
 ref|XP_009360299.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Pyrus 
x bretschneideri]
Length=947

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 90/132 (68%), Gaps = 15/132 (11%)
 Frame = +1

Query  229  HHHSDTEVMVVGVDKRKSYSGPLSGPLN-----KRTG-KKSARFNLAggdssselgspss  390
            H+HSDTE+ + G +K  +YSGPLSGPL+     KR+G KK+A+FN     +   + +   
Sbjct  10   HYHSDTEI-IDGNEKMANYSGPLSGPLSGPLNKKRSGTKKNAKFN-----TPEPISATKP  63

Query  391  arsANNDDAYVEITLDVREDSVAVHSVKTA--AGADVEDPELALLARGLEK-KTTLGSSL  561
              S+N++++YVE+TLDVR+DSVAVHSVK A     +  +  + LL +GLEK  ++L SS+
Sbjct  64   GISSNDEESYVEVTLDVRDDSVAVHSVKPADHPHHEDHEDHVELLGKGLEKSPSSLSSSV  123

Query  562  VRNASSRIRQVS  597
            VRNAS  I++++
Sbjct  124  VRNASFHIKRLA  135



>ref|XP_010438870.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Camelina 
sativa]
Length=924

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 62/157 (39%), Positives = 86/157 (55%), Gaps = 19/157 (12%)
 Frame = +1

Query  175  LKEEREMSSSDQQ--SFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNL  348
            +K  R  SS+D +    R  +  ++++   +  D   ++SGPL  P  KR  KK+ARF  
Sbjct  1    MKMRRGNSSTDHELGILRGANSDTNSDTESIASD-HGAFSGPLGRP--KRASKKNARF--  55

Query  349  AggdssselgspssarsANNDDAYVEITLDVREDSVAVHSVKTAA--GADVEDPELALLA  522
                +     S S      +DD YVEITLD+R+DSVAVHSV+ AA  G+ +EDPELALL 
Sbjct  56   ---AADLPKRSNSVTGGHGDDDEYVEITLDIRDDSVAVHSVQQAAGGGSHLEDPELALLT  112

Query  523  R-----GLEKKTTLGSSLVRNASSRIRQVSQEQAHSF  618
            +      L   T+L  S  R+ SSRI+  S+E    F
Sbjct  113  KKTLESSLNNTTSL--SFFRSTSSRIKNASRELRRVF  147



>ref|XP_009610989.1| PREDICTED: respiratory burst oxidase homolog protein D-like isoform 
X3 [Nicotiana tomentosiformis]
Length=701

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 41/68 (60%), Positives = 56/68 (82%), Gaps = 3/68 (4%)
 Frame = +1

Query  409  DDAYVEITLDVREDSVAVHSVKTAAGAD-VEDPELAL--LARGLEKKTTLGSSLVRNASS  579
            DD YVEITLD+RED+VAVHSVK A+GA+ VE+ E+ +  LA+ ++KK + G+S+VRN S 
Sbjct  28   DDTYVEITLDIREDTVAVHSVKNASGANIVEEAEVEVLGLAKNVKKKHSFGASVVRNTSM  87

Query  580  RIRQVSQE  603
            R+RQV+QE
Sbjct  88   RMRQVAQE  95



>ref|XP_009610990.1| PREDICTED: respiratory burst oxidase homolog protein D-like isoform 
X4 [Nicotiana tomentosiformis]
Length=681

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 41/68 (60%), Positives = 56/68 (82%), Gaps = 3/68 (4%)
 Frame = +1

Query  409  DDAYVEITLDVREDSVAVHSVKTAAGAD-VEDPELAL--LARGLEKKTTLGSSLVRNASS  579
            DD YVEITLD+RED+VAVHSVK A+GA+ VE+ E+ +  LA+ ++KK + G+S+VRN S 
Sbjct  28   DDTYVEITLDIREDTVAVHSVKNASGANIVEEAEVEVLGLAKNVKKKHSFGASVVRNTSM  87

Query  580  RIRQVSQE  603
            R+RQV+QE
Sbjct  88   RMRQVAQE  95



>gb|AFW64932.1| respiratory burst oxidase protein D variant beta [Zea mays]
Length=648

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 83/117 (71%), Gaps = 13/117 (11%)
 Frame = +1

Query  292  PLSGPLNKRTG-KKSARF--NLAggdssselgspssarsANNDDAYVEITLDVREDSVAV  462
            P SGPL+K++G +KSARF  +++   S+    + ++  + N+DD YVEITLDVR+DSVAV
Sbjct  26   PHSGPLSKKSGARKSARFAESVSAPLSAPPPRASANNNNNNDDDDYVEITLDVRDDSVAV  85

Query  463  HSVKTA--------AGADVEDPELALLARGLE--KKTTLGSSLVRNASSRIRQVSQE  603
            HSVK A        AGA  +DP++ LLAR LE  + ++ G S++RNASSRI+QVSQE
Sbjct  86   HSVKPAHGGGAGAGAGAGGDDPDVTLLARTLESRRSSSYGHSVIRNASSRIKQVSQE  142



>ref|NP_001108123.1| LOC100136880 isoform 2 [Zea mays]
 gb|ABP48737.1| respiratory burst oxidase protein D variant beta [Zea mays]
Length=648

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 83/117 (71%), Gaps = 13/117 (11%)
 Frame = +1

Query  292  PLSGPLNKRTG-KKSARF--NLAggdssselgspssarsANNDDAYVEITLDVREDSVAV  462
            P SGPL+K++G +KSARF  +++   S+    + ++  + N+DD YVEITLDVR+DSVAV
Sbjct  26   PHSGPLSKKSGARKSARFAESVSAPLSAPPPRASANNNNNNDDDDYVEITLDVRDDSVAV  85

Query  463  HSVKTA--------AGADVEDPELALLARGLE--KKTTLGSSLVRNASSRIRQVSQE  603
            HSVK A        AGA  +DP++ LLAR LE  + ++ G S++RNASSRI+QVSQE
Sbjct  86   HSVKPAHGGGAGAGAGAGGDDPDVTLLARTLESRRSSSYGHSVIRNASSRIKQVSQE  142



>gb|AFW64934.1| hypothetical protein ZEAMMB73_295489 [Zea mays]
Length=724

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 83/117 (71%), Gaps = 13/117 (11%)
 Frame = +1

Query  292  PLSGPLNKRTG-KKSARF--NLAggdssselgspssarsANNDDAYVEITLDVREDSVAV  462
            P SGPL+K++G +KSARF  +++   S+    + ++  + N+DD YVEITLDVR+DSVAV
Sbjct  26   PHSGPLSKKSGARKSARFAESVSAPLSAPPPRASANNNNNNDDDDYVEITLDVRDDSVAV  85

Query  463  HSVKTA--------AGADVEDPELALLARGLE--KKTTLGSSLVRNASSRIRQVSQE  603
            HSVK A        AGA  +DP++ LLAR LE  + ++ G S++RNASSRI+QVSQE
Sbjct  86   HSVKPAHGGGAGAGAGAGGDDPDVTLLARTLESRRSSSYGHSVIRNASSRIKQVSQE  142



>ref|XP_003577502.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Brachypodium 
distachyon]
Length=924

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 73/113 (65%), Gaps = 9/113 (8%)
 Frame = +1

Query  292  PLSGPLN-KRTG-KKSARF------NLAggdssselgspssarsANNDDAYVEITLDVRE  447
            P SGPL  KR+  +KSARF       L     +    + +     N+D+ YVEITLDVR+
Sbjct  30   PHSGPLGAKRSAMRKSARFAESVSAPLTAPHGAPRPRNNNDESDDNDDNDYVEITLDVRD  89

Query  448  DSVAVHSVKTAAGADVEDPELALLARGLEKKT-TLGSSLVRNASSRIRQVSQE  603
            DSVAVHSVK AAG   ED ++ LLAR LEK++ + G  ++RNASSRI+QVS E
Sbjct  90   DSVAVHSVKPAAGGSAEDSDVTLLARTLEKRSASYGHGVLRNASSRIKQVSHE  142



>gb|AFW64933.1| respiratory burst oxidase protein D variant alpha [Zea mays]
Length=932

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 83/117 (71%), Gaps = 13/117 (11%)
 Frame = +1

Query  292  PLSGPLNKRTG-KKSARF--NLAggdssselgspssarsANNDDAYVEITLDVREDSVAV  462
            P SGPL+K++G +KSARF  +++   S+    + ++  + N+DD YVEITLDVR+DSVAV
Sbjct  26   PHSGPLSKKSGARKSARFAESVSAPLSAPPPRASANNNNNNDDDDYVEITLDVRDDSVAV  85

Query  463  HSVKTA--------AGADVEDPELALLARGLE--KKTTLGSSLVRNASSRIRQVSQE  603
            HSVK A        AGA  +DP++ LLAR LE  + ++ G S++RNASSRI+QVSQE
Sbjct  86   HSVKPAHGGGAGAGAGAGGDDPDVTLLARTLESRRSSSYGHSVIRNASSRIKQVSQE  142



>ref|NP_001157759.1| LOC100136880 isoform 1 [Zea mays]
 gb|ACJ05393.1| respiratory burst oxidase protein D variant alpha [Zea mays]
Length=932

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 83/117 (71%), Gaps = 13/117 (11%)
 Frame = +1

Query  292  PLSGPLNKRTG-KKSARF--NLAggdssselgspssarsANNDDAYVEITLDVREDSVAV  462
            P SGPL+K++G +KSARF  +++   S+    + ++  + N+DD YVEITLDVR+DSVAV
Sbjct  26   PHSGPLSKKSGARKSARFAESVSAPLSAPPPRASANNNNNNDDDDYVEITLDVRDDSVAV  85

Query  463  HSVKTA--------AGADVEDPELALLARGLE--KKTTLGSSLVRNASSRIRQVSQE  603
            HSVK A        AGA  +DP++ LLAR LE  + ++ G S++RNASSRI+QVSQE
Sbjct  86   HSVKPAHGGGAGAGAGAGGDDPDVTLLARTLESRRSSSYGHSVIRNASSRIKQVSQE  142



>ref|XP_009610987.1| PREDICTED: respiratory burst oxidase homolog protein D-like isoform 
X1 [Nicotiana tomentosiformis]
Length=882

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 41/68 (60%), Positives = 56/68 (82%), Gaps = 3/68 (4%)
 Frame = +1

Query  409  DDAYVEITLDVREDSVAVHSVKTAAGAD-VEDPELAL--LARGLEKKTTLGSSLVRNASS  579
            DD YVEITLD+RED+VAVHSVK A+GA+ VE+ E+ +  LA+ ++KK + G+S+VRN S 
Sbjct  28   DDTYVEITLDIREDTVAVHSVKNASGANIVEEAEVEVLGLAKNVKKKHSFGASVVRNTSM  87

Query  580  RIRQVSQE  603
            R+RQV+QE
Sbjct  88   RMRQVAQE  95



>ref|XP_009610988.1| PREDICTED: respiratory burst oxidase homolog protein D-like isoform 
X2 [Nicotiana tomentosiformis]
Length=850

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 41/68 (60%), Positives = 56/68 (82%), Gaps = 3/68 (4%)
 Frame = +1

Query  409  DDAYVEITLDVREDSVAVHSVKTAAGAD-VEDPELAL--LARGLEKKTTLGSSLVRNASS  579
            DD YVEITLD+RED+VAVHSVK A+GA+ VE+ E+ +  LA+ ++KK + G+S+VRN S 
Sbjct  28   DDTYVEITLDIREDTVAVHSVKNASGANIVEEAEVEVLGLAKNVKKKHSFGASVVRNTSM  87

Query  580  RIRQVSQE  603
            R+RQV+QE
Sbjct  88   RMRQVAQE  95



>ref|XP_007225362.1| hypothetical protein PRUPE_ppa000883mg [Prunus persica]
 gb|EMJ26561.1| hypothetical protein PRUPE_ppa000883mg [Prunus persica]
Length=971

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 60/126 (48%), Positives = 76/126 (60%), Gaps = 19/126 (15%)
 Frame = +1

Query  271  KRKSYSGPLSGP--------LNKRTGKKSARFNLAggdssselgspssarsANNDDAYVE  426
            +R+++SGPL  P        L+ ++ +   R   A  D S+   + +     N DDAYVE
Sbjct  38   ERRAFSGPLGEPHNSYAPSSLSSKSTRAWRRIKSAKFDKSAVDSNRNPGTDQNEDDAYVE  97

Query  427  ITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLG-------SSLVRNASSRI  585
            ITLD+R+D+VAVHSV+ A GA  EDPELALLA    KKT  G       SSL+RN SS I
Sbjct  98   ITLDIRDDTVAVHSVQAAGGASNEDPELALLA----KKTLEGKKSSSFRSSLLRNTSSHI  153

Query  586  RQVSQE  603
            RQVSQE
Sbjct  154  RQVSQE  159



>ref|XP_003526909.1| PREDICTED: respiratory burst oxidase homolog protein C-like isoform 
1 [Glycine max]
Length=941

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 81/125 (65%), Gaps = 5/125 (4%)
 Frame = +1

Query  229  HHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANN  408
            HHH ++++ ++   +R     P SGPLNKR   +S++ + A   S+S   S S+     +
Sbjct  16   HHHRNSDIELIATAERAPL--PHSGPLNKR---RSSKLSNASSASASASASISAPEEQQD  70

Query  409  DDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIR  588
            +  YVE+T+D++  SVA+HSVKT      ED +L LL +G+EKK + G+S+VR+AS RI+
Sbjct  71   EGDYVEVTMDIQGGSVALHSVKTVNNDQGEDEKLILLGKGMEKKRSFGASVVRSASIRIQ  130

Query  589  QVSQE  603
            QVSQE
Sbjct  131  QVSQE  135



>gb|KHN09692.1| Respiratory burst oxidase like protein C [Glycine soja]
Length=939

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 77/126 (61%), Gaps = 9/126 (7%)
 Frame = +1

Query  229  HHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANN  408
            HHH ++++ ++   +R     P SGPLNKR      R +     SS+   +  SA     
Sbjct  16   HHHRNSDIELIATAERAPL--PHSGPLNKR------RSSKLSNASSASASASISAPEEQQ  67

Query  409  DDA-YVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRI  585
            D+  YVE+T+D++  SVA+HSVKT      ED +L LL +G+EKK + G+S+VR+AS RI
Sbjct  68   DEGDYVEVTMDIQGGSVALHSVKTVNNDQGEDEKLILLGKGMEKKRSFGASVVRSASIRI  127

Query  586  RQVSQE  603
            +QVSQE
Sbjct  128  QQVSQE  133



>ref|XP_004503030.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Cicer 
arietinum]
Length=927

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 65/106 (61%), Gaps = 8/106 (8%)
 Frame = +1

Query  295  LSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDSVAVHSVK  474
            LSGPLNKR  +KS++       + S   S         +  YVEIT+D++ DSVA+HSVK
Sbjct  35   LSGPLNKRVVRKSSKL-----LNVSNSSSAIDLCQDEQEQDYVEITMDIQGDSVALHSVK  89

Query  475  TAAGAD---VEDPELALLARGLEKKTTLGSSLVRNASSRIRQVSQE  603
               G      ED +L LL +G+EKK + G+S VR+AS R++QVSQE
Sbjct  90   PVTGNSNDRGEDEKLVLLGKGMEKKRSFGASFVRSASIRMKQVSQE  135



>gb|KDP23231.1| hypothetical protein JCGZ_23064 [Jatropha curcas]
Length=923

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 80/129 (62%), Gaps = 25/129 (19%)
 Frame = +1

Query  238  SDTEVMVVGVDKRKSYSGPLS----GPLNK-RTGKKSARFNLAggdssselgspssarsA  402
            SDTE +      R ++SGPL      PLNK R+ KKSARFN+    ++           A
Sbjct  20   SDTESIA---SDRTAFSGPLGVGGQAPLNKKRSSKKSARFNIPPETTA-----------A  65

Query  403  NNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLA-RGLEKK-TTLGSSLVRNAS  576
            ++  +YVEITLD+R+DSVAVHSV  A     EDPELALLA + LE K ++  SSL RN S
Sbjct  66   DDASSYVEITLDIRDDSVAVHSVHPAN----EDPELALLAKKTLENKSSSFRSSLFRNTS  121

Query  577  SRIRQVSQE  603
            S I+QVSQE
Sbjct  122  SHIKQVSQE  130



>gb|KJB45301.1| hypothetical protein B456_007G299500 [Gossypium raimondii]
Length=884

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 57/135 (42%), Positives = 68/135 (50%), Gaps = 41/135 (30%)
 Frame = +1

Query  223  HQHHHS--DTEVMVVGVDKRKSYSGPLSGPL------NKRTGKKSARFNLAggdssselg  378
            H  H S  DTE        R  YSGPLSGP+       K + KKSARF            
Sbjct  5    HSKHESWSDTESTS---SSRVGYSGPLSGPILVNNANKKHSSKKSARFK-----------  50

Query  379  spssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSS  558
                     + D YVEITLD+REDSV+V ++K        DPE A+LA  LEK+ + GS 
Sbjct  51   ---------DGDEYVEITLDIREDSVSVQNIKGG------DPETAMLATKLEKRHSFGSQ  95

Query  559  LVRNASSRIRQVSQE  603
            L    S +IRQVSQE
Sbjct  96   L----SFKIRQVSQE  106



>gb|KFK35232.1| hypothetical protein AALP_AA5G257400 [Arabis alpina]
Length=914

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 61/152 (40%), Positives = 79/152 (52%), Gaps = 19/152 (13%)
 Frame = +1

Query  187  REMSSSDQQSFRHQHHHSDTEVMVVGVDK-RKSYSGPLSGPLNKRTGKKSARFNLAggds  363
            R  S +D +    +  +SDT      ++  R ++SGPL  P  KRT KK+ARF       
Sbjct  3    RGNSGTDHELGILRRANSDTNSDAESINSDRTAFSGPLGRP--KRTSKKNARF-------  53

Query  364  sselgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGA----DVEDPELALLA-RG  528
                    S      +D YVEITLD+R+DSVAVHSV+ AAG      +EDPELALL  R 
Sbjct  54   --AADLTKSMSGRGEEDEYVEITLDIRDDSVAVHSVQQAAGGGGVHQLEDPELALLTKRT  111

Query  529  LE--KKTTLGSSLVRNASSRIRQVSQEQAHSF  618
            LE     +   S  R+ SSRI+  S+E    F
Sbjct  112  LESSLNNSTSLSFFRSTSSRIKHASRELRRVF  143



>ref|XP_009404717.1| PREDICTED: respiratory burst oxidase homolog protein C-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=926

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 68/113 (60%), Gaps = 9/113 (8%)
 Frame = +1

Query  280  SYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDSVA  459
            S+SGPL+GPL  + G + +         SS   +  +      D  YVEITLDVR+D+VA
Sbjct  29   SFSGPLTGPLGDKNGARCS----VPDSPSSAATAKGTEEEEEEDGTYVEITLDVRDDAVA  84

Query  460  VHSVKTA--AGADVEDPELALLARGLEKKT---TLGSSLVRNASSRIRQVSQE  603
            VHSVK A   G    DPE+A LAR LE+++     GSS++R AS + RQVSQE
Sbjct  85   VHSVKAAGGGGDGEGDPEVAALARELERRSAAAAFGSSVMRTASLKFRQVSQE  137



>ref|XP_009353482.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Pyrus 
x bretschneideri]
Length=962

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 56/70 (80%), Gaps = 3/70 (4%)
 Frame = +1

Query  403  NNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLA-RGLE--KKTTLGSSLVRNA  573
            NNDD YVEITLD+R+DSVAVHSV+ A GA  EDPELALLA R LE  K ++L SSL RN 
Sbjct  85   NNDDDYVEITLDIRDDSVAVHSVQAAGGASSEDPELALLAKRTLEGKKSSSLRSSLFRNT  144

Query  574  SSRIRQVSQE  603
            SS IRQVSQE
Sbjct  145  SSHIRQVSQE  154



>ref|XP_009404716.1| PREDICTED: respiratory burst oxidase homolog protein B-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=938

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 68/113 (60%), Gaps = 9/113 (8%)
 Frame = +1

Query  280  SYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDSVA  459
            S+SGPL+GPL  + G + +         SS   +  +      D  YVEITLDVR+D+VA
Sbjct  29   SFSGPLTGPLGDKNGARCS----VPDSPSSAATAKGTEEEEEEDGTYVEITLDVRDDAVA  84

Query  460  VHSVKTA--AGADVEDPELALLARGLEKKT---TLGSSLVRNASSRIRQVSQE  603
            VHSVK A   G    DPE+A LAR LE+++     GSS++R AS + RQVSQE
Sbjct  85   VHSVKAAGGGGDGEGDPEVAALARELERRSAAAAFGSSVMRTASLKFRQVSQE  137



>ref|XP_010259644.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Nelumbo 
nucifera]
 ref|XP_010259645.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Nelumbo 
nucifera]
Length=890

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 52/113 (46%), Positives = 65/113 (58%), Gaps = 33/113 (29%)
 Frame = +1

Query  274  RKSYSGPLSGPL--NKRTG-KKSARFNLAggdssselgspssarsANNDDAYVEITLDVR  444
            R  +SGPLSGPL  NKR+  ++SARF                     + + YVEITLDVR
Sbjct  26   RVGFSGPLSGPLTSNKRSSNRRSARFK--------------------DGEDYVEITLDVR  65

Query  445  EDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQVSQE  603
            +DSV+VH+VK        DPE ALLA  LE++ +LGS      S +IRQVSQE
Sbjct  66   DDSVSVHNVKGG------DPETALLASRLERRPSLGSQF----SMKIRQVSQE  108



>ref|XP_008222292.1| PREDICTED: respiratory burst oxidase homolog protein D [Prunus 
mume]
Length=971

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 75/126 (60%), Gaps = 19/126 (15%)
 Frame = +1

Query  271  KRKSYSGPLSGP--------LNKRTGKKSARFNLAggdssselgspssarsANNDDAYVE  426
            +R+++SGPL  P        L+ ++ +   R   A  D S+   + +     N DDAYVE
Sbjct  38   ERRAFSGPLGEPHNSYAPSSLSSKSTRAWRRIKSAKFDKSAVDSNRNPGTDQNEDDAYVE  97

Query  427  ITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLG-------SSLVRNASSRI  585
            ITLD+ +D+VAVHSV+ A GA  EDPELALLA    KKT  G       SSL+RN SS I
Sbjct  98   ITLDILDDTVAVHSVQAAGGASNEDPELALLA----KKTLEGKKSSSFRSSLLRNTSSHI  153

Query  586  RQVSQE  603
            RQVSQE
Sbjct  154  RQVSQE  159



>dbj|BAJ86360.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=925

 Score = 77.4 bits (189),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 85/130 (65%), Gaps = 15/130 (12%)
 Frame = +1

Query  247  EVMVVGVDKRKSYSGPLSGPLNKRTG-KKSARF--NLAggdssselgspssarsANNDDA  417
            +++  G ++   +SGPL G   KR+  +KSARF  +++    +   G  +  +  ++DD 
Sbjct  16   DIVEAGGERVVPHSGPLVG---KRSATRKSARFADSVSAPLRAGAGGRGNHHQDHDDDDD  72

Query  418  YVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTT--------LGSSLVRNA  573
            YVE+TLDVR+DSVAVHSVK AAG + EDP++ LLAR LE +++         G  ++RNA
Sbjct  73   YVEVTLDVRDDSVAVHSVKPAAGGE-EDPDVTLLARALETRSSSYGGRAGGHGGGVLRNA  131

Query  574  SSRIRQVSQE  603
            S+RI+QVSQE
Sbjct  132  STRIKQVSQE  141



>dbj|BAJ94299.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97805.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=925

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 85/130 (65%), Gaps = 15/130 (12%)
 Frame = +1

Query  247  EVMVVGVDKRKSYSGPLSGPLNKRTG-KKSARF--NLAggdssselgspssarsANNDDA  417
            +++  G ++   +SGPL G   KR+  +KSARF  +++    +   G  +  +  ++DD 
Sbjct  16   DIVEAGGERVVPHSGPLVG---KRSATRKSARFADSVSAPLRAGAGGRGNHHQDHDDDDD  72

Query  418  YVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTT--------LGSSLVRNA  573
            YVE+TLDVR+DSVAVHSVK AAG + EDP++ LLAR LE +++         G  ++RNA
Sbjct  73   YVEVTLDVRDDSVAVHSVKPAAGGE-EDPDVTLLARALETRSSSYGGRAGGHGGGVLRNA  131

Query  574  SSRIRQVSQE  603
            S+RI+QVSQE
Sbjct  132  STRIKQVSQE  141



>ref|XP_008378424.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Malus 
domestica]
Length=962

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 77/120 (64%), Gaps = 9/120 (8%)
 Frame = +1

Query  271  KRKSYSGPLS----GPLNKRTGKKSARFNLAggdssselgspssarsA--NNDDAYVEIT  432
            +R+++SGPL      P       ++ R N +    +S     +++ ++  NND+ YVEIT
Sbjct  35   ERRAFSGPLGTSNYAPTTSSNSSRAWRRNKSTKVDNSGGTDKTTSXTSDKNNDNDYVEIT  94

Query  433  LDVREDSVAVHSVKTAAGADVEDPELALLA-RGLE--KKTTLGSSLVRNASSRIRQVSQE  603
            LD+R+DSVAVHSV+ A GA  EDPELALLA R LE  K ++  SSL RN SS IRQVSQE
Sbjct  95   LDIRDDSVAVHSVQAAGGASSEDPELALLAKRTLEGKKSSSFRSSLFRNTSSHIRQVSQE  154



>ref|XP_007030987.1| Respiratory burst oxidase B [Theobroma cacao]
 gb|EOY11489.1| Respiratory burst oxidase B [Theobroma cacao]
Length=889

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 60/134 (45%), Positives = 70/134 (52%), Gaps = 38/134 (28%)
 Frame = +1

Query  220  RHQHHHS--DTEVMVVGVDKRKSYSGPLSGPL----NKRTGKKSARFNLAggdssselgs  381
            RH  H S  DTE        R  YSGPLSGP+     K + KKSARF             
Sbjct  4    RHSKHESWSDTESTS---SNRVGYSGPLSGPILMNNKKSSSKKSARFK------------  48

Query  382  pssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSL  561
                   + DD YVEITLD+REDSV+V ++K        DPE A+LA  LEK+ + GS L
Sbjct  49   -------DGDDEYVEITLDIREDSVSVQNIKGG------DPETAMLATRLEKRPSFGSQL  95

Query  562  VRNASSRIRQVSQE  603
                S RIRQVSQE
Sbjct  96   ----SFRIRQVSQE  105



>ref|XP_009359839.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Pyrus 
x bretschneideri]
Length=964

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 56/70 (80%), Gaps = 3/70 (4%)
 Frame = +1

Query  403  NNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLA-RGLE--KKTTLGSSLVRNA  573
            N+DD YVEITLD+R+DSVAVHSV+ A GA  EDPELALLA R LE  K ++  SSL+RN 
Sbjct  88   NDDDTYVEITLDIRDDSVAVHSVQAAGGASNEDPELALLAKRTLEGKKSSSFRSSLLRNT  147

Query  574  SSRIRQVSQE  603
            SS IRQVSQE
Sbjct  148  SSHIRQVSQE  157



>dbj|BAJ97450.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=916

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 75/109 (69%), Gaps = 8/109 (7%)
 Frame = +1

Query  286  SGPLSGPLNKRTG-KKSARFNLAggdsssel-gspssarsANNDDAYVEITLDVREDSVA  459
            SGPL G   KR+  +KSARF  +     +   G+P      ++DD YVEITLDVR+DSVA
Sbjct  24   SGPLGG---KRSAMRKSARFAESVSAPLTAPHGAPRGGGGNDDDDDYVEITLDVRDDSVA  80

Query  460  VHSVKTAAGADVEDPELALLARGLEKK-TTLGSSLVRNASSRIRQVSQE  603
            VHSVK AAG   ED ++ LLA+ LEK+ ++ G  ++RNAS+RI+QVSQE
Sbjct  81   VHSVKPAAGG--EDSDVKLLAQTLEKRSSSYGQGVLRNASTRIKQVSQE  127



>dbj|BAK03403.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=916

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 75/109 (69%), Gaps = 8/109 (7%)
 Frame = +1

Query  286  SGPLSGPLNKRTG-KKSARFNLAggdsssel-gspssarsANNDDAYVEITLDVREDSVA  459
            SGPL G   KR+  +KSARF  +     +   G+P      ++DD YVEITLDVR+DSVA
Sbjct  24   SGPLGG---KRSAMRKSARFAESVSAPLTAPHGAPRGGGGNDDDDDYVEITLDVRDDSVA  80

Query  460  VHSVKTAAGADVEDPELALLARGLEKK-TTLGSSLVRNASSRIRQVSQE  603
            VHSVK AAG   ED ++ LLA+ LEK+ ++ G  ++RNAS+RI+QVSQE
Sbjct  81   VHSVKPAAGG--EDSDVKLLAQTLEKRSSSYGQGVLRNASTRIKQVSQE  127



>ref|XP_008369593.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Malus 
domestica]
Length=965

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 56/70 (80%), Gaps = 3/70 (4%)
 Frame = +1

Query  403  NNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLA-RGLE--KKTTLGSSLVRNA  573
            N+DD YVEITLD+R+DSVAVHSV+ A GA  EDPELALLA R LE  K ++  SSL+RN 
Sbjct  88   NDDDTYVEITLDIRDDSVAVHSVQAAGGASNEDPELALLAKRTLEGKKSSSFRSSLLRNT  147

Query  574  SSRIRQVSQE  603
            SS IRQVSQE
Sbjct  148  SSHIRQVSQE  157



>ref|XP_010530642.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Tarenaya 
hassleriana]
Length=929

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 85/157 (54%), Gaps = 18/157 (11%)
 Frame = +1

Query  193  MSSSDQQSFRHQHH--------HSDTEVMVVGVDK-RKSYSGPLSGPLNKRTGKKSARFN  345
            M SS+  S  H HH        +SDT      +   R ++SGPL     KR  KK+ARF 
Sbjct  1    MRSSNSGSEDHHHHELGILRGAYSDTNSDADSITSDRSAFSGPLGRGGAKRASKKNARFA  60

Query  346  LAggdssselgspssarsANNDDAYVEITLDVREDSVAVHSVKTAA-GADVEDPELALLA  522
                   S+ GS     S+  DD +VEITLD+RED+VAVHSV+ AA G DVEDPELA L 
Sbjct  61   -PDLPKKSQSGSSRGGGSSVMDDEFVEITLDIREDAVAVHSVQNAAIGGDVEDPELAFLT  119

Query  523  R-----GLEKKTTLGSSLVRNASSRIRQVSQEQAHSF  618
            +      L K +++G   + + SSRI+  S+E    F
Sbjct  120  KRKLETSLNKSSSVG--FLGSTSSRIKSASRELLSVF  154



>ref|XP_004299201.1| PREDICTED: respiratory burst oxidase homolog protein D [Fragaria 
vesca subsp. vesca]
Length=935

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 54/70 (77%), Gaps = 3/70 (4%)
 Frame = +1

Query  403  NNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLA-RGLE--KKTTLGSSLVRNA  573
            ++D+AYVEITLD+ +DSVAVHSV+ A G   EDP+LALLA + LE  K  +  SSL+R+ 
Sbjct  56   DDDEAYVEITLDILDDSVAVHSVQAAGGGGHEDPQLALLAKKTLEGKKSASFRSSLLRST  115

Query  574  SSRIRQVSQE  603
            S+ IRQVSQE
Sbjct  116  STHIRQVSQE  125



>emb|CDX85316.1| BnaC07g26270D [Brassica napus]
Length=922

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 69/120 (58%), Gaps = 8/120 (7%)
 Frame = +1

Query  274  RKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDS  453
            R ++SGPL  P  KRT KK+ARF  A   + S   S         DD YVEITLD+R+DS
Sbjct  33   RSAFSGPLGRP--KRTSKKNARFA-ADLPTRSTSLSDGGVGRGGEDDEYVEITLDIRDDS  89

Query  454  VAVHSVKTAA--GADVEDPELALLA-RGLEKKTTLGSSL--VRNASSRIRQVSQEQAHSF  618
            VAVHSV+ A+  G   EDPEL LL  + LE      +SL   R+ SSRI+  S+E    F
Sbjct  90   VAVHSVQQASPGGGTHEDPELTLLTKKTLESNLNNSASLSFFRSTSSRIKNASRELRRVF  149



>ref|XP_004241641.1| PREDICTED: respiratory burst oxidase homolog protein D [Solanum 
lycopersicum]
Length=857

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 32/62 (52%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +1

Query  403  NNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSR  582
            +NDD YVE+TLD+R+D+VAVHSVK A     E+ E+  L + L+KK + G+++VRN S R
Sbjct  22   SNDDKYVEVTLDIRDDTVAVHSVKNATKTKAEEAEIEALGKNLQKKRSFGATIVRNLSKR  81

Query  583  IR  588
            +R
Sbjct  82   LR  83



>gb|KDP23484.1| hypothetical protein JCGZ_23317 [Jatropha curcas]
Length=891

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 49/113 (43%), Positives = 57/113 (50%), Gaps = 28/113 (25%)
 Frame = +1

Query  271  KRKSYSGPLSGPL--NKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVR  444
            +R  YSGP+SGPL  N +T KKSARF                      D  YVEITLDVR
Sbjct  23   RRAGYSGPMSGPLVSNNKTSKKSARFK--------------------EDQEYVEITLDVR  62

Query  445  EDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQVSQE  603
            +D+V V ++K        D E   LA  LEKK     SL    S R+RQVSQE
Sbjct  63   DDAVLVQNIKGG------DSETTFLASQLEKKHHHRPSLGSQLSFRLRQVSQE  109



>ref|XP_010522982.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Tarenaya 
hassleriana]
Length=945

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 81/138 (59%), Gaps = 15/138 (11%)
 Frame = +1

Query  235  HSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARF--NLAggd--ssselgspssarsA  402
            +SDTE +      R ++SGPL G   KR  KK+ARF  +L       S    S S + ++
Sbjct  26   NSDTESIA---SDRTAFSGPLGG--GKRGSKKNARFAPDLPKRSHSVSGVSVSGSGSGAS  80

Query  403  NNDDAYVEITLDVREDSVAVHSVKTAA--GAD-VEDPELALLA-RGLEKKTTLGSSL--V  564
              DD YVEITLD+R+D+VAVHSV+ AA  G D  EDPELALL  R LE      SSL  +
Sbjct  81   VADDEYVEITLDIRDDAVAVHSVQNAAIGGRDGSEDPELALLTKRTLETSLNNSSSLGFL  140

Query  565  RNASSRIRQVSQEQAHSF  618
            R+ SSRI+  S+E    F
Sbjct  141  RSTSSRIKHASRELRRVF  158



>gb|KDP44025.1| hypothetical protein JCGZ_05492 [Jatropha curcas]
Length=268

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 57/94 (61%), Gaps = 16/94 (17%)
 Frame = +1

Query  325  KKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDP  504
            +KSARFN+    ++            ++  +YVEITLD+R+DSV  HSV  A     EDP
Sbjct  111  QKSARFNIPPEATA-----------VDDPSSYVEITLDIRDDSVVFHSVHPAN----EDP  155

Query  505  ELALLA-RGLEKKTTLGSSLVRNASSRIRQVSQE  603
            ELALLA + LE K++   SL RN SS I+QVS E
Sbjct  156  ELALLAKKTLENKSSSFQSLFRNTSSHIKQVSHE  189



>emb|CDY45918.1| BnaAnng07990D [Brassica napus]
Length=921

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 49/121 (40%), Positives = 64/121 (53%), Gaps = 12/121 (10%)
 Frame = +1

Query  274  RKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDS  453
            R ++SGPL  P  KR  KK+ARF            +  S      DD YVEITLD+R+DS
Sbjct  33   RSAFSGPLGRP--KRASKKNARF----AADLPRRSNSISGVGGREDDEYVEITLDIRDDS  86

Query  454  VAVHSVKTAAGA---DVEDPELALLARG---LEKKTTLGSSLVRNASSRIRQVSQEQAHS  615
            VAVHSV+ A+     ++EDPEL LL +         +   S  R+ SSRI+  S+E    
Sbjct  87   VAVHSVQQASPGGPQNLEDPELTLLTKKTLESSLNKSSSLSFFRSTSSRIKNASRELRRV  146

Query  616  F  618
            F
Sbjct  147  F  147



>ref|XP_009129697.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Brassica 
rapa]
Length=921

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 49/121 (40%), Positives = 64/121 (53%), Gaps = 12/121 (10%)
 Frame = +1

Query  274  RKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDS  453
            R ++SGPL  P  KR  KK+ARF            +  S      DD YVEITLD+R+DS
Sbjct  33   RSAFSGPLGRP--KRASKKNARF----AADLPRRSNSISGVGGREDDEYVEITLDIRDDS  86

Query  454  VAVHSVKTAAGA---DVEDPELALLARG---LEKKTTLGSSLVRNASSRIRQVSQEQAHS  615
            VAVHSV+ A+     ++EDPEL LL +         +   S  R+ SSRI+  S+E    
Sbjct  87   VAVHSVQQASPGGPQNLEDPELTLLTKKTLESSLNKSSSLSFFRSTSSRIKNASRELRRV  146

Query  616  F  618
            F
Sbjct  147  F  147



>ref|XP_007147029.1| hypothetical protein PHAVU_006G090200g [Phaseolus vulgaris]
 gb|AEX56132.1| NADPH oxidase [Phaseolus vulgaris]
 gb|ESW19023.1| hypothetical protein PHAVU_006G090200g [Phaseolus vulgaris]
Length=881

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 50/112 (45%), Positives = 62/112 (55%), Gaps = 35/112 (31%)
 Frame = +1

Query  274  RKSYSGPLSGPL--NKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVRE  447
            R  +SGP+SGPL  NK+T KKSARF                     +D+  VEITLDVR+
Sbjct  23   RVGFSGPMSGPLVTNKKTSKKSARFK--------------------DDEELVEITLDVRD  62

Query  448  DSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQVSQE  603
            D V+V +++        DPE ALLA  LEK+    SSL    S R+RQVSQE
Sbjct  63   DVVSVQNIRGG------DPETALLASRLEKRP---SSL----SVRLRQVSQE  101



>gb|KHN43296.1| Respiratory burst oxidase like protein B [Glycine soja]
Length=866

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 52/131 (40%), Positives = 69/131 (53%), Gaps = 36/131 (27%)
 Frame = +1

Query  226  QHHHSDTEVMVVGV-DKRKSYSGPLSGPL----NKRTGKKSARFNLAggdssselgspss  390
            Q   S +E    G    R  +SGP+SGPL    NK++ KKSARF                
Sbjct  7    QQQESWSETSSTGSRSTRVGFSGPMSGPLVTPNNKKSSKKSARFK---------------  51

Query  391  arsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRN  570
                  ++ +VEITLDVR+D+V+V +++        DPE ALLA  LEK+    SSL   
Sbjct  52   ---DQEEEDFVEITLDVRDDTVSVQNIRGG------DPETALLASRLEKRP---SSL---  96

Query  571  ASSRIRQVSQE  603
             S+R+RQVSQE
Sbjct  97   -SARLRQVSQE  106



>ref|XP_002303736.2| hypothetical protein POPTR_0003s15810g [Populus trichocarpa]
 gb|EEE78715.2| hypothetical protein POPTR_0003s15810g [Populus trichocarpa]
Length=926

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 52/100 (52%), Positives = 64/100 (64%), Gaps = 14/100 (14%)
 Frame = +1

Query  313  KRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGAD  492
            KR+ +KSARFN+      +           ++  +YVEITLD+REDSVAVHSV+ A    
Sbjct  43   KRSSRKSARFNIPTETVINSGV-------PDDPSSYVEITLDIREDSVAVHSVQGAN---  92

Query  493  VEDPELALLAR-GLE--KKTTLGSSLVRNASSRIRQVSQE  603
             EDPEL LLA+  LE    ++L SSL RN SSRIRQVSQE
Sbjct  93   -EDPELTLLAKTALEGNNSSSLRSSLFRNTSSRIRQVSQE  131



>emb|CDX86335.1| BnaA06g30520D [Brassica napus]
Length=922

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 69/120 (58%), Gaps = 8/120 (7%)
 Frame = +1

Query  274  RKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDS  453
            R ++SGPL  P  KRT KK+ARF  A   + S   S         DD YVEITLD+R+DS
Sbjct  33   RSAFSGPLGRP--KRTSKKNARFA-ADLPTRSTSLSDGGGGRGGEDDEYVEITLDIRDDS  89

Query  454  VAVHSVKTAA--GADVEDPELALLA-RGLEKKTTLGSSL--VRNASSRIRQVSQEQAHSF  618
            VAVHSV+ A+  G   EDPEL LL  + LE      +SL   R+ SSRI+  S+E    F
Sbjct  90   VAVHSVQQASPGGGTHEDPELTLLTKKTLESNLNNSASLSFFRSTSSRIKNASRELRRVF  149



>ref|XP_009151593.1| PREDICTED: respiratory burst oxidase homolog protein D [Brassica 
rapa]
Length=922

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 69/120 (58%), Gaps = 8/120 (7%)
 Frame = +1

Query  274  RKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDS  453
            R ++SGPL  P  KRT KK+ARF  A   + S   S         DD YVEITLD+R+DS
Sbjct  33   RSAFSGPLGRP--KRTSKKNARFA-ADLPTRSTSLSDGGGGRGGEDDEYVEITLDIRDDS  89

Query  454  VAVHSVKTAA--GADVEDPELALLA-RGLEKKTTLGSSL--VRNASSRIRQVSQEQAHSF  618
            VAVHSV+ A+  G   EDPEL LL  + LE      +SL   R+ SSRI+  S+E    F
Sbjct  90   VAVHSVQQASPGGGTHEDPELTLLTKKTLESNLNNSASLSFFRSTSSRIKNASRELRRVF  149



>ref|XP_009402525.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Musa 
acuminata subsp. malaccensis]
Length=891

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 46/110 (42%), Positives = 65/110 (59%), Gaps = 33/110 (30%)
 Frame = +1

Query  283  YSGPLSGPL-NKRTGKK-SARFNLAggdssselgspssarsANNDDAYVEITLDVREDSV  456
            +SGPL GPL +K+ GKK SARF                      DD YVEITLDVR+D++
Sbjct  30   HSGPLGGPLASKKAGKKRSARFK--------------------GDDNYVEITLDVRDDAI  69

Query  457  AVHSVKTAAGADVEDPELALLARGLEKKTTL-GSSLVRNASSRIRQVSQE  603
            A+ S+++       DPE ALLA+ LE+++ + G+SL    SS+++QV  E
Sbjct  70   AIQSIQSG------DPEAALLAKNLERRSPMVGASL----SSKLKQVGHE  109



>ref|XP_002512422.1| respiratory burst oxidase, putative [Ricinus communis]
 gb|EEF49874.1| respiratory burst oxidase, putative [Ricinus communis]
Length=888

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 56/137 (41%), Positives = 67/137 (49%), Gaps = 40/137 (29%)
 Frame = +1

Query  211  QSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPL---NKRTGKKSARFNLAggdssselgs  381
            Q    Q   S+TE       +R  YSGP+SGPL    K + KKSARF             
Sbjct  4    QEKHQQETWSETESN--SSSRRFGYSGPMSGPLVTNAKNSSKKSARFK------------  49

Query  382  pssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKT---TLG  552
                      D YVEITLDVR+DSV+V +++        D E A LA  LEKK    +LG
Sbjct  50   ----------DEYVEITLDVRDDSVSVQNIRGG------DSETAYLASQLEKKKNHPSLG  93

Query  553  SSLVRNASSRIRQVSQE  603
            S L    S R+RQVSQE
Sbjct  94   SQL----SFRLRQVSQE  106



>ref|XP_008450638.1| PREDICTED: respiratory burst oxidase homolog protein B isoform 
X2 [Cucumis melo]
Length=695

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 50/123 (41%), Positives = 69/123 (56%), Gaps = 25/123 (20%)
 Frame = +1

Query  238  SDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDA  417
            SDTE   +G  KR  +SGPL+GP            ++A   ++S   S  S     +DD 
Sbjct  13   SDTES--IGSSKRVGFSGPLTGP------------SVAYKRTNSYSSSTRSTMRIKDDDQ  58

Query  418  YVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLE-KKTTLGSSLVRNASSRIRQV  594
            YVEITLDVR+D+V+V +++        D E A+LA  LE K+ TLGS L    S +++QV
Sbjct  59   YVEITLDVRDDTVSVQNIRGG------DSETAMLASRLETKRPTLGSQL----SFKLKQV  108

Query  595  SQE  603
            SQE
Sbjct  109  SQE  111



>ref|XP_003554649.1| PREDICTED: respiratory burst oxidase homolog protein B-like isoform 
1 [Glycine max]
Length=887

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 51/131 (39%), Positives = 67/131 (51%), Gaps = 36/131 (27%)
 Frame = +1

Query  226  QHHHSDTEVMVVGV-DKRKSYSGPLSGPL----NKRTGKKSARFNLAggdssselgspss  390
            Q   S +E    G    R  +SGP+SGPL    NK++ KKS RF                
Sbjct  7    QQQESWSETSSTGSRSTRVGFSGPMSGPLVTPNNKKSSKKSTRFK---------------  51

Query  391  arsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRN  570
                  ++ +VEITLDVR+D+V+V +++        DPE ALLA  LEK+    SSL   
Sbjct  52   ---DQEEEDFVEITLDVRDDTVSVQNIRGG------DPETALLASRLEKRP---SSL---  96

Query  571  ASSRIRQVSQE  603
             S R+RQVSQE
Sbjct  97   -SVRLRQVSQE  106



>ref|XP_008450637.1| PREDICTED: respiratory burst oxidase homolog protein B isoform 
X1 [Cucumis melo]
Length=889

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 50/123 (41%), Positives = 69/123 (56%), Gaps = 25/123 (20%)
 Frame = +1

Query  238  SDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDA  417
            SDTE   +G  KR  +SGPL+GP            ++A   ++S   S  S     +DD 
Sbjct  13   SDTES--IGSSKRVGFSGPLTGP------------SVAYKRTNSYSSSTRSTMRIKDDDQ  58

Query  418  YVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLE-KKTTLGSSLVRNASSRIRQV  594
            YVEITLDVR+D+V+V +++        D E A+LA  LE K+ TLGS L    S +++QV
Sbjct  59   YVEITLDVRDDTVSVQNIRGG------DSETAMLASRLETKRPTLGSQL----SFKLKQV  108

Query  595  SQE  603
            SQE
Sbjct  109  SQE  111



>ref|XP_011020924.1| PREDICTED: respiratory burst oxidase homolog protein D [Populus 
euphratica]
Length=926

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 51/100 (51%), Positives = 63/100 (63%), Gaps = 14/100 (14%)
 Frame = +1

Query  313  KRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGAD  492
            KR+ +KSARFN+      +           ++  +YVEITLD+ EDSVAVHSV+ A    
Sbjct  43   KRSSRKSARFNIPPETIINPGV-------PDDPSSYVEITLDIHEDSVAVHSVQGAN---  92

Query  493  VEDPELALLAR-GLE--KKTTLGSSLVRNASSRIRQVSQE  603
             EDPEL LLA+  LE    ++L SSL RN SSRIRQVSQE
Sbjct  93   -EDPELTLLAKTALEGNNSSSLRSSLFRNTSSRIRQVSQE  131



>gb|AGI65628.1| NADPH oxidase, partial [Fragaria x ananassa]
Length=817

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 41/70 (59%), Positives = 53/70 (76%), Gaps = 3/70 (4%)
 Frame = +1

Query  403  NNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGL---EKKTTLGSSLVRNA  573
            ++D+AYVEITLD+ +DSVAVHSV+ A G   EDP+LALLA+     +K  +  SSL+R+ 
Sbjct  1    DDDEAYVEITLDILDDSVAVHSVQAAGGGGHEDPQLALLAKKTLEGKKSASFRSSLLRST  60

Query  574  SSRIRQVSQE  603
            SS IRQVSQE
Sbjct  61   SSHIRQVSQE  70



>ref|XP_006395230.1| hypothetical protein EUTSA_v10003619mg [Eutrema salsugineum]
 gb|ESQ32516.1| hypothetical protein EUTSA_v10003619mg [Eutrema salsugineum]
Length=928

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 58/139 (42%), Positives = 72/139 (52%), Gaps = 16/139 (12%)
 Frame = +1

Query  235  HSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARF--NLAggdss-selgspssarsAN  405
            +SD E +      R ++SGPL  P  KR  KK+ARF  NL    +S S  GS        
Sbjct  23   NSDNESIA---SDRTAFSGPLGRP--KRASKKNARFAENLPRRSNSVSGGGSGGGRGRGG  77

Query  406  NDDAYVEITLDVREDSVAVHSV-----KTAAGADVEDPELALLARG-LE--KKTTLGSSL  561
             DD YVEITLD+R+DSVAVHSV            +EDPEL LL +  LE     +   S 
Sbjct  78   EDDEYVEITLDIRDDSVAVHSVQQAGGGGGGAQHLEDPELTLLTKKTLESSLNNSTSLSF  137

Query  562  VRNASSRIRQVSQEQAHSF  618
             R+ SSRI+  S+E    F
Sbjct  138  FRSTSSRIKNASRELRRVF  156



>ref|XP_008670768.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Zea 
mays]
Length=915

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 65/110 (59%), Gaps = 18/110 (16%)
 Frame = +1

Query  292  PLSGPLNKRT-GKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDSVAVHS  468
            P SG L+K+   + SARF          +    +  SA NDD  VEITLDVR+ SVA+ S
Sbjct  20   PHSGTLSKKPRARNSARF----------VEVAPAPSSAANDD--VEITLDVRDGSVAMLS  67

Query  469  VKTA-AGADVEDPELALLARGLE----KKTTLGSSLVRNASSRIRQVSQE  603
            V+ A AG+  +DP + LL R LE    +  + G SL+RNASSRI Q SQE
Sbjct  68   VEPAHAGSAGDDPSVTLLPRPLENNHRRSPSYGHSLIRNASSRIMQASQE  117



>sp|Q2HXK9.2|RBOHD_SOLTU RecName: Full=Respiratory burst oxidase homolog protein D; AltName: 
Full=NADPH oxidase RBOHD; AltName: Full=StRBOHD [Solanum 
tuberosum]
 dbj|BAE79345.2| NADPH oxidase [Solanum tuberosum]
Length=858

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = +1

Query  403  NNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSR  582
            +NDD  VEITLD+R+D++A  SVK A     E+ EL  L + L+KK + G+++VRN S R
Sbjct  22   SNDDKNVEITLDIRDDTMAGQSVKNATKTKAEEAELEALGKNLQKKCSFGATIVRNVSMR  81

Query  583  IRQVS-QEQAH  612
            +R  S + Q H
Sbjct  82   MRLPSFKRQPH  92



>tpg|DAA42070.1| TPA: hypothetical protein ZEAMMB73_604696 [Zea mays]
Length=948

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 65/110 (59%), Gaps = 18/110 (16%)
 Frame = +1

Query  292  PLSGPLNKRT-GKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDSVAVHS  468
            P SG L+K+   + SARF          +    +  SA NDD  VEITLDVR+ SVA+ S
Sbjct  20   PHSGTLSKKPRARNSARF----------VEVAPAPSSAANDD--VEITLDVRDGSVAMLS  67

Query  469  VKTA-AGADVEDPELALLARGLE----KKTTLGSSLVRNASSRIRQVSQE  603
            V+ A AG+  +DP + LL R LE    +  + G SL+RNASSRI Q SQE
Sbjct  68   VEPAHAGSAGDDPSVTLLPRPLENNHRRSPSYGHSLIRNASSRIMQASQE  117



>ref|XP_003525163.2| PREDICTED: respiratory burst oxidase homolog protein C-like isoform 
3 [Glycine max]
Length=898

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 53/70 (76%), Gaps = 4/70 (6%)
 Frame = +1

Query  418  YVEITLDVREDSVAVHSVKT-AAGADVEDPE---LALLARGLEKKTTLGSSLVRNASSRI  585
            YVE+T+D+  DSVA+HSVKT AAG D+ + E   L L+ + LEKKTT G+S+V++A++R+
Sbjct  55   YVEVTMDIHRDSVALHSVKTVAAGVDMVEEEGDKLGLMGKRLEKKTTFGASVVQSAANRM  114

Query  586  RQVSQEQAHS  615
            +Q+ +  + S
Sbjct  115  KQLKRLASFS  124



>gb|KHN17442.1| Respiratory burst oxidase like protein C [Glycine soja]
Length=898

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 53/70 (76%), Gaps = 4/70 (6%)
 Frame = +1

Query  418  YVEITLDVREDSVAVHSVKT-AAGADVEDPE---LALLARGLEKKTTLGSSLVRNASSRI  585
            YVE+T+D+  DSVA+HSVKT AAG D+ + E   L L+ + LEKKTT G+S+V++A++R+
Sbjct  55   YVEVTMDIHRDSVALHSVKTVAAGVDMVEEEGDKLGLMGKRLEKKTTFGASVVQSAANRM  114

Query  586  RQVSQEQAHS  615
            +Q+ +  + S
Sbjct  115  KQLKRLASFS  124



>ref|XP_006382490.1| respiratory burst oxidase protein B [Populus trichocarpa]
 gb|ERP60287.1| respiratory burst oxidase protein B [Populus trichocarpa]
Length=876

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 49/115 (43%), Positives = 59/115 (51%), Gaps = 36/115 (31%)
 Frame = +1

Query  274  RKSYSGPLSGPL----NKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDV  441
            R  YSGPLSGPL     K + KKSARF                      D+ YVEITLDV
Sbjct  22   RIGYSGPLSGPLVTTTKKNSSKKSARFK---------------------DEEYVEITLDV  60

Query  442  REDSVAVHSVKTAAGADVEDPELALLARGLEKK-TTLGSSLVRNASSRIRQVSQE  603
            R+DSV+V ++K        D E A LA  L +K  +LGS L    S ++RQVS E
Sbjct  61   RDDSVSVQNIKGG------DSETAYLASQLGRKHPSLGSQL----SIKLRQVSHE  105



>ref|XP_011036858.1| PREDICTED: respiratory burst oxidase homolog protein B [Populus 
euphratica]
 ref|XP_011036859.1| PREDICTED: respiratory burst oxidase homolog protein B [Populus 
euphratica]
Length=886

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 59/115 (51%), Gaps = 36/115 (31%)
 Frame = +1

Query  274  RKSYSGPLSGPL----NKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDV  441
            R  YSGPLSGPL     K + KKSARF                      D+ YVEITLDV
Sbjct  22   RIGYSGPLSGPLVTTTKKNSSKKSARFK---------------------DEEYVEITLDV  60

Query  442  REDSVAVHSVKTAAGADVEDPELALLARGLEKK-TTLGSSLVRNASSRIRQVSQE  603
            R+DSV+V ++K        D E A LA  L +K  +LGS L    S ++RQVS E
Sbjct  61   RDDSVSVQNIKGG------DSETAFLASQLGRKHPSLGSQL----SIKLRQVSHE  105



>ref|XP_004168501.1| PREDICTED: respiratory burst oxidase homolog protein B-like, 
partial [Cucumis sativus]
Length=853

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 49/123 (40%), Positives = 68/123 (55%), Gaps = 25/123 (20%)
 Frame = +1

Query  238  SDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDA  417
            SDTE   +G  KR  +SGPL+G             ++A   ++S   S  S     +DD 
Sbjct  13   SDTES--IGSSKRVGFSGPLTGA------------SVAYKRTNSYSSSTRSTMRIKDDDQ  58

Query  418  YVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLE-KKTTLGSSLVRNASSRIRQV  594
            YVEITLDVR+D+V+V +++        D E A+LA  LE K+ TLGS L    S +++QV
Sbjct  59   YVEITLDVRDDTVSVQNIRGG------DSETAMLASRLETKRPTLGSQL----SFKLKQV  108

Query  595  SQE  603
            SQE
Sbjct  109  SQE  111



>ref|XP_004135613.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Cucumis 
sativus]
 gb|KGN66068.1| hypothetical protein Csa_1G569450 [Cucumis sativus]
Length=889

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 49/123 (40%), Positives = 68/123 (55%), Gaps = 25/123 (20%)
 Frame = +1

Query  238  SDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDA  417
            SDTE   +G  KR  +SGPL+G             ++A   ++S   S  S     +DD 
Sbjct  13   SDTES--IGSSKRVGFSGPLTGA------------SVAYKRTNSYSSSTRSTMRIKDDDQ  58

Query  418  YVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLE-KKTTLGSSLVRNASSRIRQV  594
            YVEITLDVR+D+V+V +++        D E A+LA  LE K+ TLGS L    S +++QV
Sbjct  59   YVEITLDVRDDTVSVQNIRGG------DSETAMLASRLETKRPTLGSQL----SFKLKQV  108

Query  595  SQE  603
            SQE
Sbjct  109  SQE  111



>ref|XP_009778242.1| PREDICTED: respiratory burst oxidase homolog protein B [Nicotiana 
sylvestris]
Length=872

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 49/123 (40%), Positives = 65/123 (53%), Gaps = 42/123 (34%)
 Frame = +1

Query  271  KRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVRED  450
            +R  +SGPL       +GK+S+RFN                    +D++YVEITLDVR+D
Sbjct  16   RRVGFSGPLV------SGKRSSRFN--------------------DDESYVEITLDVRDD  49

Query  451  SVAVHSVKTAAGADVEDPELALLARGLEKK-TTLGSSLVRNASSRIRQVSQE-----QAH  612
            SV V ++K A      D E ALLA  LEK+  TLGS L    S  +RQVS+E      ++
Sbjct  50   SVLVQNIKGA------DQESALLASRLEKRPNTLGSQL----SFHLRQVSKELKRMTSSN  99

Query  613  SFH  621
             FH
Sbjct  100  KFH  102



>ref|XP_008246416.1| PREDICTED: respiratory burst oxidase homolog protein B isoform 
X2 [Prunus mume]
Length=893

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 50/126 (40%), Positives = 70/126 (56%), Gaps = 34/126 (27%)
 Frame = +1

Query  238  SDTEVMVVGVDKRKSYSGPLSGPL--NKR--TGKKSARFNLAggdssselgspssarsAN  405
            S+TE   VG      +SGPLSGPL  NKR  + K+SARF                  +++
Sbjct  12   SETESTGVG------HSGPLSGPLVTNKRNNSSKRSARFK-----------------ASD  48

Query  406  NDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRI  585
             ++ YVEITLDVR+D+V VH+++        D E A+LA  +E++ +   SL    S R+
Sbjct  49   QEECYVEITLDVRDDTVLVHNIRGG------DSETAMLASKIERRPSS-LSLGSQLSFRL  101

Query  586  RQVSQE  603
            RQVSQE
Sbjct  102  RQVSQE  107



>ref|XP_008246413.1| PREDICTED: respiratory burst oxidase homolog protein B isoform 
X1 [Prunus mume]
Length=894

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 50/126 (40%), Positives = 70/126 (56%), Gaps = 34/126 (27%)
 Frame = +1

Query  238  SDTEVMVVGVDKRKSYSGPLSGPL--NKR--TGKKSARFNLAggdssselgspssarsAN  405
            S+TE   VG      +SGPLSGPL  NKR  + K+SARF                  +++
Sbjct  12   SETESTGVG------HSGPLSGPLVTNKRNNSSKRSARFK-----------------ASD  48

Query  406  NDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRI  585
             ++ YVEITLDVR+D+V VH+++        D E A+LA  +E++ +   SL    S R+
Sbjct  49   QEECYVEITLDVRDDTVLVHNIRGG------DSETAMLASKIERRPSS-LSLGSQLSFRL  101

Query  586  RQVSQE  603
            RQVSQE
Sbjct  102  RQVSQE  107



>ref|XP_009611315.1| PREDICTED: respiratory burst oxidase homolog protein B [Nicotiana 
tomentosiformis]
Length=866

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 46/112 (41%), Positives = 61/112 (54%), Gaps = 37/112 (33%)
 Frame = +1

Query  271  KRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVRED  450
            +R  +SGPL       +GK+S+RFN                    ++++YVEITLDVR+D
Sbjct  13   RRVGFSGPLV------SGKRSSRFN--------------------DNESYVEITLDVRDD  46

Query  451  SVAVHSVKTAAGADVEDPELALLARGLEKK-TTLGSSLVRNASSRIRQVSQE  603
            SV V ++K A      D E ALLA  LEK+  TLGS L    S  +RQVS+E
Sbjct  47   SVLVQNIKGA------DQESALLASRLEKRPNTLGSQL----SFHLRQVSKE  88



>gb|EYU24549.1| hypothetical protein MIMGU_mgv1a001003mg [Erythranthe guttata]
Length=916

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 52/70 (74%), Gaps = 7/70 (10%)
 Frame = +1

Query  409  DDAYVEITLDVREDSVAVHSVKTA-----AGADVEDPELALL-ARGLEKK-TTLGSSLVR  567
            DD+ V+ITLDVREDSVAV SVKT      A  +V+D EL +L A+G+EKK ++ GSS  R
Sbjct  38   DDSVVDITLDVREDSVAVQSVKTVAAAAAAAGEVQDSELNILPAKGMEKKSSSSGSSFAR  97

Query  568  NASSRIRQVS  597
            NASS IRQVS
Sbjct  98   NASSTIRQVS  107



>ref|XP_010931626.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Elaeis 
guineensis]
Length=885

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 66/127 (52%), Gaps = 35/127 (28%)
 Frame = +1

Query  232  HHSDTEVMVVGVDKRKSYSGPLSGPLN--KRTGKKSARFNLAggdssselgspssarsAN  405
            HH DT            +SGPLSGPL   K + K+SARF                     
Sbjct  12   HHVDTSSESEDAGSGVGFSGPLSGPLGTKKASNKRSARFK--------------------  51

Query  406  NDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKT-TLGSSLVRNASSR  582
            ++  YVEITLDVR+DSVA+ ++++      +D E ALLA+ L +++  +G       +S+
Sbjct  52   DEQTYVEITLDVRDDSVAIQNIES------QDQEAALLAKALGRRSPPIG------ITSK  99

Query  583  IRQVSQE  603
            ++QVSQE
Sbjct  100  LKQVSQE  106



>gb|KCW61821.1| hypothetical protein EUGRSUZ_H04514 [Eucalyptus grandis]
Length=682

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 50/129 (39%), Positives = 63/129 (49%), Gaps = 33/129 (26%)
 Frame = +1

Query  223  HQHHH-SDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssars  399
            HQH   SDTE        R  YSGPLS    K   + +ARF                   
Sbjct  7    HQHAQWSDTES---NCSSRLGYSGPLSSTSTKI--RSNARFR-----------------D  44

Query  400  ANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLE-KKTTLGSSLVRNAS  576
              +++ YVEITLDV EDSV+VH++K        DPE AL    L  + ++LG+ L    S
Sbjct  45   DQDEECYVEITLDVGEDSVSVHNIKGGG-----DPETALFTSRLGLRPSSLGAQL----S  95

Query  577  SRIRQVSQE  603
             R+RQVSQE
Sbjct  96   FRLRQVSQE  104



>gb|AEP25512.1| putative respiratory burst oxidase-like protein A [Vicia faba]
Length=894

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 68/137 (50%), Gaps = 44/137 (32%)
 Frame = +1

Query  229  HHHSDTEVMVVG--------VDKRKSYSGPLSGPL----NKRTGKKSARFNLAggdssse  372
            HH + +E   +G        V    S SGPLSGPL     KR+ KKSARF          
Sbjct  8    HHETWSETESIGSRSTRSARVGFSGSLSGPLSGPLVSNNKKRSSKKSARF----------  57

Query  373  lgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLG  552
                     +++ + +VEITLDVR+D+V+V +++        D E ALLA  LEK+ +  
Sbjct  58   ---------SDDVEDFVEITLDVRDDTVSVQNIRGG------DSETALLASRLEKRPS--  100

Query  553  SSLVRNASSRIRQVSQE  603
                   S +++QVSQE
Sbjct  101  -----TLSVKLKQVSQE  112



>ref|XP_003630437.1| Respiratory burst oxidase-like protein [Medicago truncatula]
 gb|AET04913.1| respiratory burst oxidase-like protein D [Medicago truncatula]
Length=898

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 31/72 (43%), Positives = 49/72 (68%), Gaps = 3/72 (4%)
 Frame = +1

Query  409  DDAYVEITLDVREDSVAVHSVKTAAGADV---EDPELALLARGLEKKTTLGSSLVRNASS  579
            D  YVE+T+D++ DSVA+HSVKT   +D+   E  + +L    LEKK + G+S+V+NA+ 
Sbjct  44   DADYVEVTMDIQGDSVALHSVKTVTESDMGEGEHEKQSLTGNKLEKKKSFGASVVQNATI  103

Query  580  RIRQVSQEQAHS  615
            RI+Q+ +  + S
Sbjct  104  RIKQLKRLASFS  115



>gb|AAW78863.1| respiratory burst oxidase 1 [Medicago truncatula]
Length=932

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 31/72 (43%), Positives = 49/72 (68%), Gaps = 3/72 (4%)
 Frame = +1

Query  409  DDAYVEITLDVREDSVAVHSVKTAAGADV---EDPELALLARGLEKKTTLGSSLVRNASS  579
            D  YVE+T+D++ DSVA+HSVKT   +D+   E  + +L    LEKK + G+S+V+NA+ 
Sbjct  44   DADYVEVTMDIQGDSVALHSVKTVTESDMGEGEHEKQSLTGNKLEKKKSFGASVVQNATI  103

Query  580  RIRQVSQEQAHS  615
            RI+Q+ +  + S
Sbjct  104  RIKQLKRLASFS  115



>ref|XP_010269487.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Nelumbo 
nucifera]
Length=908

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 62/114 (54%), Gaps = 34/114 (30%)
 Frame = +1

Query  286  SGPLSGPL---NKRTG-KKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDS  453
            SGPLSGPL    K++G ++SARF                     + D YVEITLDVREDS
Sbjct  34   SGPLSGPLVTSTKKSGNRRSARFK--------------------DGDDYVEITLDVREDS  73

Query  454  VAVHSVKTAAGADVEDPELALLARGLE----KKTTLGSSLVRNASSRIRQVSQE  603
            V+V +VK        D E A+LA  LE     +T+LGS L    S +I+QVS+E
Sbjct  74   VSVQNVKGG------DHETAVLASRLETTTTTRTSLGSLLGSQFSMKIKQVSKE  121



>ref|NP_001274981.1| respiratory burst oxidase homolog protein B [Solanum tuberosum]
 sp|Q948T9.1|RBOHB_SOLTU RecName: Full=Respiratory burst oxidase homolog protein B; AltName: 
Full=NADPH oxidase RBOHB; AltName: Full=StRBOHB [Solanum 
tuberosum]
 dbj|BAB70751.1| respiratory burst oxidase homolog [Solanum tuberosum]
Length=867

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 47/112 (42%), Positives = 59/112 (53%), Gaps = 38/112 (34%)
 Frame = +1

Query  274  RKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDS  453
            R  +SG L       +GKKSARF                     +D++YVEITLDVR+DS
Sbjct  16   RVGFSGSLV------SGKKSARFK--------------------DDESYVEITLDVRDDS  49

Query  454  VAVHSVKTAAGADVEDPELALLARGLEKK--TTLGSSLVRNASSRIRQVSQE  603
            V+V ++K A      D E ALLA  LEK+   TLGS L    S  +RQVS+E
Sbjct  50   VSVQNIKGA------DHEAALLASRLEKRPNNTLGSQL----SFHLRQVSKE  91



>emb|CDY35764.1| BnaC02g38300D [Brassica napus]
Length=899

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 35/76 (46%), Positives = 46/76 (61%), Gaps = 6/76 (8%)
 Frame = +1

Query  409  DDAYVEITLDVREDSVAVHSVKTAAGA---DVEDPELALLARG---LEKKTTLGSSLVRN  570
            DD YVEITLD+R+DSVAVHSV+ A+     ++EDPEL LL +         +   S  R+
Sbjct  50   DDEYVEITLDIRDDSVAVHSVQQASPGGPQNLEDPELTLLTKKTLESSLNKSSSLSFFRS  109

Query  571  ASSRIRQVSQEQAHSF  618
             SSRI+  S+E    F
Sbjct  110  TSSRIKNASRELRRVF  125



>gb|KDO56233.1| hypothetical protein CISIN_1g002711mg [Citrus sinensis]
Length=889

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 38/94 (40%), Positives = 48/94 (51%), Gaps = 30/94 (32%)
 Frame = +1

Query  274  RKSYSGPLSGPL-----NKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLD  438
            R  YSGPLSGPL      K + +KSARF                    + D+ YVEITLD
Sbjct  21   RVGYSGPLSGPLVTTTNKKNSSRKSARFK-------------------DQDECYVEITLD  61

Query  439  VREDSVAVHSVKTAAGADVEDPELALLARGLEKK  540
            VR+DSV+V +++        D E A LA  LE+K
Sbjct  62   VRDDSVSVQNIRGG------DSETAFLASRLERK  89



>ref|XP_006433403.1| hypothetical protein CICLE_v10000227mg [Citrus clementina]
 ref|XP_006472080.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Citrus 
sinensis]
 gb|ESR46643.1| hypothetical protein CICLE_v10000227mg [Citrus clementina]
Length=889

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 38/94 (40%), Positives = 48/94 (51%), Gaps = 30/94 (32%)
 Frame = +1

Query  274  RKSYSGPLSGPL-----NKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLD  438
            R  YSGPLSGPL      K + +KSARF                    + D+ YVEITLD
Sbjct  21   RVGYSGPLSGPLVTTTNKKNSSRKSARFK-------------------DQDECYVEITLD  61

Query  439  VREDSVAVHSVKTAAGADVEDPELALLARGLEKK  540
            VR+DSV+V +++        D E A LA  LE+K
Sbjct  62   VRDDSVSVQNIRGG------DSETAFLASRLERK  89



>gb|AFJ66196.1| hypothetical protein 7G9.15 [Boechera stricta]
Length=893

 Score = 58.9 bits (141),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 45/131 (34%), Positives = 64/131 (49%), Gaps = 31/131 (24%)
 Frame = +1

Query  232  HHSDTEVMVVGVDKRKSYSGPLSG-----PLNKRTGKKSARFNLAggdssselgspssar  396
            +HSD E           YSGP+SG     P+ K+    ++RF              +   
Sbjct  12   YHSDAEA---------GYSGPMSGGGQLPPIYKKPATTNSRF-------------AAENS  49

Query  397  sANNDDAYVEITLDVREDSVAVHSVKTAAGADVED-PELALLARG-LEKKTTLGSSL--V  564
                   YV++T+DV++D V+VHS+K   G+ VE+ PEL LL R  LEKKTT+   L  V
Sbjct  50   QRTRTAPYVDLTVDVQDDRVSVHSLKMEGGSSVEESPELTLLKRNRLEKKTTVVKRLASV  109

Query  565  RNASSRIRQVS  597
             +   R+  VS
Sbjct  110  SHELKRLTSVS  120



>ref|XP_010025215.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Eucalyptus 
grandis]
 gb|KCW61820.1| hypothetical protein EUGRSUZ_H04514 [Eucalyptus grandis]
Length=889

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 63/129 (49%), Gaps = 33/129 (26%)
 Frame = +1

Query  223  HQH-HHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssars  399
            HQH   SDTE        R  YSGPLS    K   + +ARF                   
Sbjct  7    HQHAQWSDTES---NCSSRLGYSGPLSSTSTKI--RSNARFR-----------------D  44

Query  400  ANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLE-KKTTLGSSLVRNAS  576
              +++ YVEITLDV EDSV+VH++K        DPE AL    L  + ++LG+ L    S
Sbjct  45   DQDEECYVEITLDVGEDSVSVHNIKGGG-----DPETALFTSRLGLRPSSLGAQL----S  95

Query  577  SRIRQVSQE  603
             R+RQVSQE
Sbjct  96   FRLRQVSQE  104



>ref|XP_008800853.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Phoenix 
dactylifera]
Length=880

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 54/107 (50%), Gaps = 35/107 (33%)
 Frame = +1

Query  283  YSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDSVAV  462
            +SGPLSGP     G + ARF                     ++  YVEITLDVR+DSVA+
Sbjct  29   FSGPLSGP----PGTRKARFK--------------------DEQTYVEITLDVRDDSVAI  64

Query  463  HSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQVSQE  603
              ++       +D E A+LAR  E++     S     +S++RQVSQE
Sbjct  65   QDIRG------QDQEAAMLARAFERQ-----SPSTGITSKLRQVSQE  100



>ref|XP_002299364.2| hypothetical protein POPTR_0001s12650g [Populus trichocarpa]
 gb|EEE84169.2| hypothetical protein POPTR_0001s12650g [Populus trichocarpa]
Length=926

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 47/100 (47%), Positives = 62/100 (62%), Gaps = 14/100 (14%)
 Frame = +1

Query  313  KRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGAD  492
            K + KKSA FN+    + +           ++  ++VEITLD+ +DSVAVHSV+ A    
Sbjct  43   KHSSKKSAGFNIPPETTINSGF-------TDDSSSFVEITLDICDDSVAVHSVQGAN---  92

Query  493  VEDPELALLAR-GLE--KKTTLGSSLVRNASSRIRQVSQE  603
             EDPEL LLA+  LE    ++L SSL RN SS+IRQVSQE
Sbjct  93   -EDPELTLLAKTALEGNNSSSLRSSLFRNTSSKIRQVSQE  131



>ref|XP_010041041.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Eucalyptus 
grandis]
Length=889

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 62/129 (48%), Gaps = 33/129 (26%)
 Frame = +1

Query  223  HQH-HHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssars  399
            HQH   SDTE        R  YSGPLS    K   + +ARF                   
Sbjct  7    HQHAQWSDTES---NCSSRLGYSGPLSSTSTKI--RSNARFR-----------------D  44

Query  400  ANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLE-KKTTLGSSLVRNAS  576
              +++ YVEITLDV EDSV+VH +K        DPE AL    L  + ++LG+ L    S
Sbjct  45   DQDEECYVEITLDVGEDSVSVHDIKGGG-----DPETALFTSRLGLRPSSLGAQL----S  95

Query  577  SRIRQVSQE  603
             R+RQVSQE
Sbjct  96   FRLRQVSQE  104



>gb|KCW44695.1| hypothetical protein EUGRSUZ_L017712, partial [Eucalyptus grandis]
Length=853

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 62/129 (48%), Gaps = 33/129 (26%)
 Frame = +1

Query  223  HQH-HHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssars  399
            HQH   SDTE        R  YSGPLS    K   + +ARF                   
Sbjct  7    HQHAQWSDTES---NCSSRLGYSGPLSSTSTKI--RSNARFR-----------------D  44

Query  400  ANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLE-KKTTLGSSLVRNAS  576
              +++ YVEITLDV EDSV+VH +K        DPE AL    L  + ++LG+ L    S
Sbjct  45   DQDEECYVEITLDVGEDSVSVHDIKGGG-----DPETALFTSRLGLRPSSLGAQL----S  95

Query  577  SRIRQVSQE  603
             R+RQVSQE
Sbjct  96   FRLRQVSQE  104



>ref|XP_003521697.1| PREDICTED: respiratory burst oxidase homolog protein B-like isoform 
1 [Glycine max]
Length=885

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 49/113 (43%), Positives = 63/113 (56%), Gaps = 34/113 (30%)
 Frame = +1

Query  274  RKSYSGPLSGPL---NKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVR  444
            R  +SGP+SGPL   NK++ KKSARF                      D+ +VEITLDVR
Sbjct  24   RVGFSGPMSGPLVTSNKKSSKKSARFK------------------DQEDEDFVEITLDVR  65

Query  445  EDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQVSQE  603
            +D+V+V +++        DPE ALLA  LEK+    SSL    S R+RQVSQE
Sbjct  66   DDTVSVQNIRGG------DPETALLASRLEKRP---SSL----SVRLRQVSQE  105



>ref|XP_010112007.1| Respiratory burst oxidase-like protein D [Morus notabilis]
 gb|EXC32352.1| Respiratory burst oxidase-like protein D [Morus notabilis]
Length=924

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 8/51 (16%)
 Frame = +1

Query  403  NNDDA--YVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTL  549
            NNDD   YVEITLD+R+DSVAVHSV+ A+G+D ED ELALL      KTTL
Sbjct  77   NNDDNSNYVEITLDIRDDSVAVHSVQAASGSD-EDQELALLT-----KTTL  121



>ref|XP_003532261.1| PREDICTED: respiratory burst oxidase homolog protein C-like isoform 
1 [Glycine max]
Length=888

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 51/75 (68%), Gaps = 9/75 (12%)
 Frame = +1

Query  418  YVEITLDVREDSVAVHSVKTAAGADVE--------DPELALLARG-LEKKTTLGSSLVRN  570
            YVE+T+D+  DSVA+HSVKT A  DV+          +L L+ +  LEKKT+ G+S+V++
Sbjct  45   YVEVTMDIHRDSVALHSVKTVAADDVDMVEEEEEEGDKLGLMGKKRLEKKTSFGASVVQS  104

Query  571  ASSRIRQVSQEQAHS  615
            A++R++Q+ +  + S
Sbjct  105  AANRMKQLKRLASFS  119



>ref|XP_004230232.1| PREDICTED: respiratory burst oxidase homolog protein B [Solanum 
lycopersicum]
Length=865

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 46/112 (41%), Positives = 58/112 (52%), Gaps = 38/112 (34%)
 Frame = +1

Query  274  RKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDS  453
            R  +SG L       +GKKSARF                     +D++YVEITLDVR+DS
Sbjct  14   RVGFSGSLV------SGKKSARFK--------------------DDESYVEITLDVRDDS  47

Query  454  VAVHSVKTAAGADVEDPELALLARGLEKKT--TLGSSLVRNASSRIRQVSQE  603
            V V ++K A      D E ALLA  LEK+   TLGS L    S  ++QVS+E
Sbjct  48   VLVQNIKGA------DHEAALLASKLEKRPNHTLGSQL----SFHLKQVSKE  89



>ref|XP_010536571.1| PREDICTED: respiratory burst oxidase homolog protein C [Tarenaya 
hassleriana]
Length=911

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 60/115 (52%), Gaps = 30/115 (26%)
 Frame = +1

Query  232  HHSDTEVMVVGVDKRKSYSGPLSGPLN---KRTGKKSARFNLAggdssselgspssarsA  402
            +HSD +    G      +SGP+ GPL    K+  KKS R                   +A
Sbjct  15   YHSDADATTNG---GAHHSGPMGGPLPPALKKPAKKSPR------------------SAA  53

Query  403  NNDDA--YVEITLDVREDSVAVHSVKTAA---GADVEDPELALLARG-LEKKTTL  549
             N  A  YV++ LDV ED V+VHSV++ A   G+ VEDPEL LL R  LEKKT++
Sbjct  54   ENHRAPPYVDLALDVDEDRVSVHSVRSPASDGGSSVEDPELTLLRRKRLEKKTSV  108



>ref|XP_004503856.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Cicer 
arietinum]
Length=933

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 28/66 (42%), Positives = 45/66 (68%), Gaps = 4/66 (6%)
 Frame = +1

Query  418  YVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQVS  597
            YVE+T+D++ DSVA+HSVKT    D+ D +  L      KKT+ G+S+V+NA+ RI+++ 
Sbjct  88   YVEVTMDIKGDSVALHSVKTVTETDMGDEKQCLTG----KKTSFGASVVQNATIRIKKLK  143

Query  598  QEQAHS  615
            +  + S
Sbjct  144  RLASFS  149



>ref|XP_010549734.1| PREDICTED: respiratory burst oxidase homolog protein B [Tarenaya 
hassleriana]
Length=899

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 41/112 (37%), Positives = 63/112 (56%), Gaps = 27/112 (24%)
 Frame = +1

Query  271  KRKSY--SGPLSGPLNKR--TGKKSARFNLAggdssselgspssarsANNDDAYVEITLD  438
            K  SY  SGPLSGPL+++  TGKK+ARFN+ G  +S+          + + D YVEITLD
Sbjct  24   KTPSYYGSGPLSGPLSRKPVTGKKTARFNVTGSTTSNA---------SGSADEYVEITLD  74

Query  439  VREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQV  594
            +R+D+V +H++       V++  L          +++GS L    S R+R +
Sbjct  75   IRDDAVLMHNMD----GTVQEKRL----------SSIGSVLSGRISGRLRTM  112



>ref|XP_007206556.1| hypothetical protein PRUPE_ppa019730mg [Prunus persica]
 gb|EMJ07755.1| hypothetical protein PRUPE_ppa019730mg [Prunus persica]
Length=893

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 47/124 (38%), Positives = 66/124 (53%), Gaps = 30/124 (24%)
 Frame = +1

Query  238  SDTEVMVVGVDKRKSYSGPLSGPL--NKRTGKKSARFNLAggdssselgspssarsANND  411
            S+TE   VG      +SGPLSGPL  NKR                      + ++S++ +
Sbjct  12   SETESTGVG------HSGPLSGPLVTNKRNNSSKRS---------------ARSKSSDQE  50

Query  412  DAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQ  591
            + YVEITLDVR+D+V VH+++        D E A+LA  LE++ +   SL    S R+RQ
Sbjct  51   ECYVEITLDVRDDTVLVHNIRGG------DSETAMLASKLERRASS-LSLGSQLSFRLRQ  103

Query  592  VSQE  603
            VSQE
Sbjct  104  VSQE  107



>ref|XP_003602723.1| Respiratory burst oxidase-like protein [Medicago truncatula]
 gb|AES72974.1| respiratory burst oxidase-like protein D [Medicago truncatula]
Length=917

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 42/68 (62%), Gaps = 1/68 (1%)
 Frame = +1

Query  403  NNDDAYVEITLDVREDSVAVHSVKTAAGADVE-DPELALLARGLEKKTTLGSSLVRNASS  579
            N +   V++TLD++   VA+H        + E D +L LL +G+EKK + G S VR AS+
Sbjct  37   NKEGDLVDVTLDIQGKKVALHFTPVTGNNNYEEDEKLDLLGKGMEKKRSFGDSFVRTASN  96

Query  580  RIRQVSQE  603
             +R+VSQE
Sbjct  97   HLRKVSQE  104



>ref|XP_002283888.1| PREDICTED: respiratory burst oxidase homolog protein B [Vitis 
vinifera]
Length=894

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 41/99 (41%), Positives = 54/99 (55%), Gaps = 32/99 (32%)
 Frame = +1

Query  310  NKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGA  489
            NK+  KKSARF                       + YVEITLDVR+DSV+V +++   G 
Sbjct  43   NKKGSKKSARFK---------------------SEEYVEITLDVRDDSVSVQNIR---GG  78

Query  490  DVEDPELALLARGLEK-KTTLGSSLVRNASSRIRQVSQE  603
            D+E    ++LA  LE+ + +LGS L    S RIRQVSQE
Sbjct  79   DLET---SMLASRLERQRPSLGSQL----SFRIRQVSQE  110



>ref|XP_008670770.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Zea 
mays]
Length=930

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 67/120 (56%), Gaps = 16/120 (13%)
 Frame = +1

Query  292  PLSGPLNKRTGKKSARF-------NLAggdssselgspssarsANNDDAYVEITLDVRED  450
            P SG L+K++ ++S RF                   S ++    ++D+ YVEITLD+R+D
Sbjct  19   PHSGTLSKKSTRRSLRFVEPVTAAAPLPAPPLGASPSSAANDDDDDDNDYVEITLDMRDD  78

Query  451  SVA---VHSVKTAAGADVEDPELA-LLARGLE---KKTTLGSSLVRNASSR--IRQVSQE  603
            SVA   VH V+ A     +DP +  ++AR LE   + ++ G SL RNASSR   +QVSQE
Sbjct  79   SVAVAVVHGVEPAHAGPGDDPNVTQVVARPLENHRRSSSYGHSLTRNASSRFKFKQVSQE  138



>emb|CAN64415.1| hypothetical protein VITISV_013316 [Vitis vinifera]
Length=894

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 41/99 (41%), Positives = 54/99 (55%), Gaps = 32/99 (32%)
 Frame = +1

Query  310  NKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGA  489
            NK+  KKSARF                       + YVEITLDVR+DSV+V +++   G 
Sbjct  43   NKKGSKKSARFK---------------------SEEYVEITLDVRDDSVSVQNIR---GG  78

Query  490  DVEDPELALLARGLEK-KTTLGSSLVRNASSRIRQVSQE  603
            D+E    ++LA  LE+ + +LGS L    S RIRQVSQE
Sbjct  79   DLET---SMLASRLERQRPSLGSQL----SFRIRQVSQE  110



>tpg|DAA42073.1| TPA: hypothetical protein ZEAMMB73_696625 [Zea mays]
Length=976

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 67/120 (56%), Gaps = 16/120 (13%)
 Frame = +1

Query  292  PLSGPLNKRTGKKSARF-------NLAggdssselgspssarsANNDDAYVEITLDVRED  450
            P SG L+K++ ++S RF                   S ++    ++D+ YVEITLD+R+D
Sbjct  35   PHSGTLSKKSTRRSLRFVEPVTAAAPLPAPPLGASPSSAANDDDDDDNDYVEITLDMRDD  94

Query  451  SVA---VHSVKTAAGADVEDPELA-LLARGLE---KKTTLGSSLVRNASSR--IRQVSQE  603
            SVA   VH V+ A     +DP +  ++AR LE   + ++ G SL RNASSR   +QVSQE
Sbjct  95   SVAVAVVHGVEPAHAGPGDDPNVTQVVARPLENHRRSSSYGHSLTRNASSRFKFKQVSQE  154



>ref|XP_007159934.1| hypothetical protein PHAVU_002G279700g [Phaseolus vulgaris]
 gb|ESW31928.1| hypothetical protein PHAVU_002G279700g [Phaseolus vulgaris]
Length=899

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 45/69 (65%), Gaps = 3/69 (4%)
 Frame = +1

Query  418  YVEITLDVREDSVAVHSVKTAAGADV---EDPELALLARGLEKKTTLGSSLVRNASSRIR  588
            +VE+T+D+  DSVA+HSVK   G DV   E  +L L  +  EKK +  +S+V++A+ R++
Sbjct  54   FVEVTMDIHGDSVALHSVKAFGGVDVVEEEGEKLGLTGKRFEKKKSFSASVVQSAAIRMK  113

Query  589  QVSQEQAHS  615
            Q+ +  + S
Sbjct  114  QLKRLTSFS  122



>gb|AEX56131.1| NADPH oxidase [Phaseolus vulgaris]
Length=876

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 42/62 (68%), Gaps = 3/62 (5%)
 Frame = +1

Query  418  YVEITLDVREDSVAVHSVKTAAGADV---EDPELALLARGLEKKTTLGSSLVRNASSRIR  588
            +VE+T+D+  DSVA+HSVK   G DV   E  +L L  +  EKK +  +S+V++A+ R++
Sbjct  54   FVEVTMDIHGDSVALHSVKAFGGVDVVEEEGEKLGLTGKRFEKKKSFSASVVQSAAIRMK  113

Query  589  QV  594
            Q+
Sbjct  114  QL  115



>ref|XP_003536070.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Glycine 
max]
Length=888

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 64/139 (46%), Gaps = 47/139 (34%)
 Frame = +1

Query  229  HHHSDTEVMVVGVDKRK-SYSGPLSGPL-----------NKR--TGKKSARFNLAggdss  366
             H S +E    G   R+  +SGPLSGPL           NKR  +  KSARF        
Sbjct  7    QHESWSETESTGSRSRRVGFSGPLSGPLSGPLSGPLVSSNKRNSSKNKSARFK-------  59

Query  367  selgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTT  546
                         +D+  VEITLDVR+D+V+V +++        D E A LA  LE + +
Sbjct  60   -------------DDEEMVEITLDVRDDAVSVQNIRGG------DSETAFLASRLEMRPS  100

Query  547  LGSSLVRNASSRIRQVSQE  603
                   + S R+RQVS+E
Sbjct  101  -------SFSDRLRQVSRE  112



>gb|AFJ66168.1| hypothetical protein 11M19.12 [Arabidopsis halleri]
Length=819

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 44/130 (34%), Positives = 63/130 (48%), Gaps = 31/130 (24%)
 Frame = +1

Query  232  HHSDTEVMVVGVDKRKSYSGPLSG----PLNKRTGKKSARFNLAggdssselgspssars  399
            +HSD E            SGP+SG    P+ K+    ++RF       +           
Sbjct  12   YHSDAEA---------GNSGPMSGGQLPPIYKKPA--NSRFTAENSQRTRTAA-------  53

Query  400  ANNDDAYVEITLDVREDSVAVHSVKTAAGADVED-PELALLARG-LEKKTTLGSSL--VR  567
                  YV++T+DV++D V+VHS+K   G+ VE+ PEL LL R  LEKKTT+   L  V 
Sbjct  54   -----PYVDLTVDVQDDRVSVHSLKMEGGSSVEESPELTLLKRNRLEKKTTVVKRLASVS  108

Query  568  NASSRIRQVS  597
            +   R+  VS
Sbjct  109  HELKRLTSVS  118



>ref|XP_010674039.1| PREDICTED: respiratory burst oxidase homolog protein B [Beta 
vulgaris subsp. vulgaris]
Length=887

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 44/70 (63%), Gaps = 8/70 (11%)
 Frame = +1

Query  400  ANNDDA--YVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNA  573
            +N DD   YVEITLDVR+DSV+V  +K A G    D E ALL   LEK+     +L    
Sbjct  44   SNKDDENEYVEITLDVRDDSVSVQDIKGAVG----DQEAALLTSHLEKQRP--QTLTSQF  97

Query  574  SSRIRQVSQE  603
            S++I+QVS+E
Sbjct  98   SAKIKQVSRE  107



>ref|XP_003626254.1| Respiratory burst oxidase-like protein [Medicago truncatula]
 gb|AES82472.1| respiratory burst oxidase-like protein [Medicago truncatula]
Length=702

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 52/144 (36%), Positives = 69/144 (48%), Gaps = 38/144 (26%)
 Frame = +1

Query  193  MSSSDQQSFRHQHHHSDTEV---MVVGVDKRKSYSGPLSGPL----NKRTGKKSARFNLA  351
            M  S ++   HQ   S+TE        V    S SGPLSGPL     K++ KKSARF+  
Sbjct  1    MEISQERENHHQEIWSETESNGSRSTRVGFSGSLSGPLSGPLVSNNKKKSSKKSARFS--  58

Query  352  ggdssselgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGL  531
                               D  YVEITLDVR+D+V+V +++        D E ALLA  L
Sbjct  59   ----------------DEVDQDYVEITLDVRDDTVSVQNIRGG------DSETALLASRL  96

Query  532  EKKTTLGSSLVRNASSRIRQVSQE  603
            EK+ +         S +++QVSQE
Sbjct  97   EKRPS-------TLSVKLKQVSQE  113



>ref|XP_003556516.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Glycine 
max]
Length=889

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 56/111 (50%), Gaps = 38/111 (34%)
 Frame = +1

Query  286  SGPLSGPL---NKR--TGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVRED  450
            SGPLSGPL   NKR  +  KSARF                     +D+  VEITLDVR+D
Sbjct  35   SGPLSGPLVSSNKRNSSKNKSARFK--------------------DDEEMVEITLDVRDD  74

Query  451  SVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQVSQE  603
            +V+V +++        D E A LA  LE + +       + S R+RQVS+E
Sbjct  75   AVSVQNIRGG------DSETAFLASRLEMRPS-------SFSDRLRQVSRE  112



>gb|AAC39477.1| respiratory burst oxidase protein C [Arabidopsis thaliana]
Length=867

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 58/112 (52%), Gaps = 30/112 (27%)
 Frame = +1

Query  232  HHSDTEVMVVGVDKRKSYSGPLSG----PLNKRTGKKSARFNLAggdssselgspssars  399
            +HSD E            SGP+SG    P+ K+ G  ++RF              +    
Sbjct  12   YHSDAEA---------GNSGPMSGGQLPPIYKKPG--NSRFT-------------AENSQ  47

Query  400  ANNDDAYVEITLDVREDSVAVHSVKTAAGADVED-PELALLARG-LEKKTTL  549
                  YV++T+DV++D+V+VHS+K   G+ VE+ PEL LL R  LEKKTT+
Sbjct  48   RTRTAPYVDLTVDVQDDTVSVHSLKMEGGSSVEESPELTLLKRNRLEKKTTV  99



>ref|NP_199919.1| Respiratory burst oxidase homolog protein C [Arabidopsis thaliana]
 sp|O81210.2|RBOHC_ARATH RecName: Full=Respiratory burst oxidase homolog protein C; AltName: 
Full=NADPH oxidase RBOHC; Short=AtRBOHC; AltName: Full=Protein 
ROOT HAIR DEFECTIVE 2 [Arabidopsis thaliana]
 dbj|BAB08752.1| respiratory burst oxidase protein [Arabidopsis thaliana]
 gb|AED96028.1| Respiratory burst oxidase homolog protein C [Arabidopsis thaliana]
Length=905

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 58/112 (52%), Gaps = 30/112 (27%)
 Frame = +1

Query  232  HHSDTEVMVVGVDKRKSYSGPLSG----PLNKRTGKKSARFNLAggdssselgspssars  399
            +HSD E            SGP+SG    P+ K+ G  ++RF              +    
Sbjct  12   YHSDAEA---------GNSGPMSGGQLPPIYKKPG--NSRFT-------------AENSQ  47

Query  400  ANNDDAYVEITLDVREDSVAVHSVKTAAGADVED-PELALLARG-LEKKTTL  549
                  YV++T+DV++D+V+VHS+K   G+ VE+ PEL LL R  LEKKTT+
Sbjct  48   RTRTAPYVDLTVDVQDDTVSVHSLKMEGGSSVEESPELTLLKRNRLEKKTTV  99



>gb|AAS15724.1| respiratory burst oxidase protein C [Arabidopsis thaliana]
Length=905

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 58/112 (52%), Gaps = 30/112 (27%)
 Frame = +1

Query  232  HHSDTEVMVVGVDKRKSYSGPLSG----PLNKRTGKKSARFNLAggdssselgspssars  399
            +HSD E            SGP+SG    P+ K+ G  ++RF              +    
Sbjct  12   YHSDAEA---------GNSGPMSGGQLPPIYKKPG--NSRFT-------------AENSQ  47

Query  400  ANNDDAYVEITLDVREDSVAVHSVKTAAGADVED-PELALLARG-LEKKTTL  549
                  YV++T+DV++D+V+VHS+K   G+ VE+ PEL LL R  LEKKTT+
Sbjct  48   RTRTAPYVDLTVDVQDDTVSVHSLKMEGGSSVEESPELTLLKRNRLEKKTTV  99



>dbj|BAC41837.1| putative respiratory burst oxidase protein [Arabidopsis thaliana]
Length=905

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 58/112 (52%), Gaps = 30/112 (27%)
 Frame = +1

Query  232  HHSDTEVMVVGVDKRKSYSGPLSG----PLNKRTGKKSARFNLAggdssselgspssars  399
            +HSD E            SGP+SG    P+ K+ G  ++RF              +    
Sbjct  12   YHSDAEA---------GNSGPMSGGQLPPIYKKPG--NSRFT-------------AENSQ  47

Query  400  ANNDDAYVEITLDVREDSVAVHSVKTAAGADVED-PELALLARG-LEKKTTL  549
                  YV++T+DV++D+V+VHS+K   G+ VE+ PEL LL R  LEKKTT+
Sbjct  48   RTRTAPYVDLTVDVQDDTVSVHSLKMEGGSSVEESPELTLLKRNRLEKKTTV  99



>ref|XP_007144946.1| hypothetical protein PHAVU_007G196800g [Phaseolus vulgaris]
 gb|ESW16940.1| hypothetical protein PHAVU_007G196800g [Phaseolus vulgaris]
Length=890

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 56/116 (48%), Gaps = 42/116 (36%)
 Frame = +1

Query  283  YSGPLSGPLN-------KRTG--KKSARFNLAggdssselgspssarsANNDDAYVEITL  435
            +SGPLSGP +       KR G   KSARF                     +D+  VEITL
Sbjct  26   FSGPLSGPFSGPLLTSHKRNGSKNKSARFK--------------------DDEEMVEITL  65

Query  436  DVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQVSQE  603
            DVR+D+V+V +++        D E A LA  LE + +       + S R+RQVS+E
Sbjct  66   DVRDDAVSVQNIRGG------DSETAFLASRLEMRPS-------SFSGRLRQVSRE  108



>ref|XP_010482435.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Camelina 
sativa]
Length=913

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 52/96 (54%), Gaps = 21/96 (22%)
 Frame = +1

Query  286  SGPLSG-----PLNKRTGKKS-ARFNLAggdssselgspssarsANNDDAYVEITLDVRE  447
            SGP+SG     P+NK+    + +RF              +          YV++T+DV++
Sbjct  22   SGPMSGGGQLPPINKKPATNTNSRF-------------AAENSQRTRTAPYVDLTVDVQD  68

Query  448  DSVAVHSVKTAAGADVED-PELALLARG-LEKKTTL  549
            D V+VHS+K   G+ VE+ PEL LL R  LEKKTT+
Sbjct  69   DRVSVHSLKMEGGSSVEESPELTLLKRNRLEKKTTV  104



>gb|ADR70881.1| respiratory burst oxidase B [Manihot esculenta]
Length=885

 Score = 49.3 bits (116),  Expect = 0.001, Method: Composition-based stats.
 Identities = 32/63 (51%), Positives = 40/63 (63%), Gaps = 12/63 (19%)
 Frame = +1

Query  421  VEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKT--TLGSSLVRNASSRIRQV  594
            VEITLDVR+DSV+V +++        D E A LA  LE+K   +LGS L    S R+RQV
Sbjct  51   VEITLDVRDDSVSVQNIRGG------DSETAFLASQLERKNHPSLGSQL----SLRLRQV  100

Query  595  SQE  603
            SQE
Sbjct  101  SQE  103



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250