BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS061B04

Length=627
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAN80052.1|  hypothetical protein VITISV_020270                     121   5e-30   Vitis vinifera
ref|XP_004239625.1|  PREDICTED: probable methyltransferase PMT26        126   1e-29   Solanum lycopersicum
ref|XP_009771172.1|  PREDICTED: probable methyltransferase PMT26        125   4e-29   Nicotiana sylvestris
emb|CAN60874.1|  hypothetical protein VITISV_030592                     122   5e-29   Vitis vinifera
ref|XP_006345748.1|  PREDICTED: probable methyltransferase PMT26-...    123   2e-28   Solanum tuberosum [potatoes]
ref|XP_009590749.1|  PREDICTED: probable methyltransferase PMT26        122   2e-28   Nicotiana tomentosiformis
emb|CBI37509.3|  unnamed protein product                                122   4e-28   Vitis vinifera
ref|XP_002266357.1|  PREDICTED: probable methyltransferase PMT26        122   5e-28   Vitis vinifera
gb|EYU23728.1|  hypothetical protein MIMGU_mgv1a001484mg                110   3e-24   Erythranthe guttata [common monkey flower]
ref|XP_011099715.1|  PREDICTED: probable methyltransferase PMT26        109   8e-24   Sesamum indicum [beniseed]
ref|XP_002306259.2|  dehydration-responsive family protein              107   8e-23   
ref|XP_011031161.1|  PREDICTED: probable methyltransferase PMT26 ...    104   6e-22   Populus euphratica
ref|XP_011031160.1|  PREDICTED: probable methyltransferase PMT26 ...    104   6e-22   Populus euphratica
ref|XP_011031157.1|  PREDICTED: probable methyltransferase PMT26 ...    104   6e-22   Populus euphratica
ref|XP_011031158.1|  PREDICTED: probable methyltransferase PMT26 ...    104   7e-22   Populus euphratica
ref|XP_011031156.1|  PREDICTED: probable methyltransferase PMT26 ...    104   7e-22   Populus euphratica
ref|XP_008462649.1|  PREDICTED: probable methyltransferase PMT26        103   1e-21   Cucumis melo [Oriental melon]
ref|XP_004143348.1|  PREDICTED: probable methyltransferase PMT26-...    103   1e-21   Cucumis sativus [cucumbers]
ref|XP_004166405.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    103   1e-21   
ref|XP_010027631.1|  PREDICTED: probable methyltransferase PMT26        101   5e-21   Eucalyptus grandis [rose gum]
ref|XP_010090820.1|  putative methyltransferase PMT26                   101   7e-21   Morus notabilis
ref|XP_002516311.1|  ATP binding protein, putative                      100   8e-21   Ricinus communis
ref|XP_011022921.1|  PREDICTED: probable methyltransferase PMT26        100   9e-21   Populus euphratica
ref|XP_002309924.1|  dehydration-responsive family protein            99.8    3e-20   
ref|XP_004288094.1|  PREDICTED: probable methyltransferase PMT26      99.0    4e-20   Fragaria vesca subsp. vesca
ref|XP_003602639.1|  Ankyrin-like protein                             97.4    6e-20   
gb|KDO51661.1|  hypothetical protein CISIN_1g003776mg                 97.8    7e-20   Citrus sinensis [apfelsine]
ref|XP_003602638.1|  Ankyrin-like protein                             97.1    7e-20   
gb|KDP32896.1|  hypothetical protein JCGZ_12188                       97.8    1e-19   Jatropha curcas
gb|KDO51659.1|  hypothetical protein CISIN_1g003776mg                 97.4    1e-19   Citrus sinensis [apfelsine]
ref|XP_003602637.1|  Ankyrin-like protein                             97.1    2e-19   Medicago truncatula
ref|XP_006432154.1|  hypothetical protein CICLE_v10000328mg           97.1    2e-19   Citrus clementina [clementine]
ref|XP_007019267.1|  S-adenosyl-L-methionine-dependent methyltran...  96.7    2e-19   
ref|XP_004502956.1|  PREDICTED: probable methyltransferase PMT26-...  96.7    3e-19   Cicer arietinum [garbanzo]
ref|XP_002285889.2|  PREDICTED: probable methyltransferase PMT24      96.3    4e-19   Vitis vinifera
ref|XP_007048444.1|  S-adenosyl-L-methionine-dependent methyltran...  95.9    5e-19   
ref|XP_008360714.1|  PREDICTED: probable methyltransferase PMT26      95.1    8e-19   
gb|KDO83500.1|  hypothetical protein CISIN_1g015557mg                 93.2    8e-19   Citrus sinensis [apfelsine]
ref|XP_007214544.1|  hypothetical protein PRUPE_ppa001471mg           95.1    9e-19   Prunus persica
ref|XP_008227415.1|  PREDICTED: probable methyltransferase PMT26      94.7    1e-18   Prunus mume [ume]
ref|XP_007137790.1|  hypothetical protein PHAVU_009G155600g           94.4    1e-18   Phaseolus vulgaris [French bean]
ref|XP_006434319.1|  hypothetical protein CICLE_v10000311mg           92.8    4e-18   
ref|XP_006434317.1|  hypothetical protein CICLE_v10000311mg           92.0    8e-18   
ref|XP_006472883.1|  PREDICTED: probable methyltransferase PMT25-...  92.0    8e-18   Citrus sinensis [apfelsine]
ref|XP_011078779.1|  PREDICTED: probable methyltransferase PMT26      92.0    9e-18   Sesamum indicum [beniseed]
gb|KJB29131.1|  hypothetical protein B456_005G086100                  91.3    1e-17   Gossypium raimondii
gb|KJB29129.1|  hypothetical protein B456_005G086100                  91.7    1e-17   Gossypium raimondii
gb|KJB29130.1|  hypothetical protein B456_005G086100                  92.0    1e-17   Gossypium raimondii
gb|KJB29128.1|  hypothetical protein B456_005G086100                  92.0    1e-17   Gossypium raimondii
gb|KHG21530.1|  hypothetical protein F383_05601                       91.7    1e-17   Gossypium arboreum [tree cotton]
dbj|BAC43570.1|  putative ankyrin                                     87.4    2e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003526869.1|  PREDICTED: probable methyltransferase PMT26-...  91.3    2e-17   Glycine max [soybeans]
gb|KHN09623.1|  Putative methyltransferase PMT26                      91.3    2e-17   Glycine soja [wild soybean]
ref|XP_003523221.1|  PREDICTED: probable methyltransferase PMT26-...  91.3    2e-17   Glycine max [soybeans]
ref|XP_010546331.1|  PREDICTED: probable methyltransferase PMT26      90.5    3e-17   Tarenaya hassleriana [spider flower]
gb|KJB48928.1|  hypothetical protein B456_008G094300                  89.0    9e-17   Gossypium raimondii
gb|KJB48927.1|  hypothetical protein B456_008G094300                  89.0    1e-16   Gossypium raimondii
ref|XP_006394213.1|  hypothetical protein EUTSA_v10003654mg           88.6    2e-16   Eutrema salsugineum [saltwater cress]
ref|XP_010521110.1|  PREDICTED: probable methyltransferase PMT26      88.2    2e-16   Tarenaya hassleriana [spider flower]
ref|XP_002864883.1|  hypothetical protein ARALYDRAFT_496597           87.8    2e-16   
gb|KHN34092.1|  Putative methyltransferase PMT26                      87.4    3e-16   Glycine soja [wild soybean]
ref|XP_006580338.1|  PREDICTED: probable methyltransferase PMT26-...  87.4    4e-16   Glycine max [soybeans]
ref|XP_002307464.2|  hypothetical protein POPTR_0005s20670g           87.4    4e-16   
ref|XP_010277710.1|  PREDICTED: probable methyltransferase PMT24      87.4    4e-16   Nelumbo nucifera [Indian lotus]
ref|XP_006281931.1|  hypothetical protein CARUB_v10028139mg           87.0    4e-16   Capsella rubella
ref|XP_004503920.1|  PREDICTED: probable methyltransferase PMT26-...  87.0    5e-16   Cicer arietinum [garbanzo]
ref|XP_010270332.1|  PREDICTED: probable methyltransferase PMT26 ...  86.3    8e-16   Nelumbo nucifera [Indian lotus]
ref|XP_010270331.1|  PREDICTED: probable methyltransferase PMT26 ...  86.3    8e-16   Nelumbo nucifera [Indian lotus]
ref|XP_002520274.1|  ATP binding protein, putative                    86.3    8e-16   Ricinus communis
emb|CDP04655.1|  unnamed protein product                              85.9    1e-15   Coffea canephora [robusta coffee]
ref|NP_201208.2|  putative methyltransferase PMT26                    85.9    1e-15   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB10271.1|  ankyrin-like protein                                 85.9    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009355841.1|  PREDICTED: probable methyltransferase PMT26      85.5    2e-15   Pyrus x bretschneideri [bai li]
ref|XP_011006302.1|  PREDICTED: probable methyltransferase PMT24 ...  85.1    2e-15   Populus euphratica
ref|XP_011006303.1|  PREDICTED: probable methyltransferase PMT24 ...  84.7    2e-15   Populus euphratica
gb|KHG22120.1|  hypothetical protein F383_28461                       84.3    3e-15   Gossypium arboreum [tree cotton]
ref|XP_002300957.2|  hypothetical protein POPTR_0002s07640g           84.3    4e-15   Populus trichocarpa [western balsam poplar]
ref|XP_006584650.1|  PREDICTED: probable methyltransferase PMT26-...  84.3    4e-15   Glycine max [soybeans]
ref|XP_008394173.1|  PREDICTED: probable methyltransferase PMT26 ...  84.3    4e-15   
ref|XP_010444329.1|  PREDICTED: probable methyltransferase PMT26      84.3    4e-15   Camelina sativa [gold-of-pleasure]
ref|XP_008394175.1|  PREDICTED: probable methyltransferase PMT26 ...  84.0    4e-15   
ref|XP_010484172.1|  PREDICTED: probable methyltransferase PMT26      84.0    5e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010461320.1|  PREDICTED: probable methyltransferase PMT26      84.0    5e-15   
gb|KJB59346.1|  hypothetical protein B456_009G250600                  84.0    5e-15   Gossypium raimondii
gb|KJB40479.1|  hypothetical protein B456_007G066000                  83.6    7e-15   Gossypium raimondii
gb|KHG04009.1|  hypothetical protein F383_29196                       82.8    1e-14   Gossypium arboreum [tree cotton]
gb|KDP39437.1|  hypothetical protein JCGZ_03719                       82.4    2e-14   Jatropha curcas
ref|XP_010674444.1|  PREDICTED: probable methyltransferase PMT26      81.3    4e-14   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG06416.1|  hypothetical protein F383_32222                       80.9    6e-14   Gossypium arboreum [tree cotton]
ref|XP_008371671.1|  PREDICTED: probable methyltransferase PMT26      79.7    8e-14   
ref|XP_008345949.1|  PREDICTED: probable methyltransferase PMT26      79.3    9e-14   
gb|AAP72961.1|  putative ankyrin-like protein                         79.7    1e-13   Lactuca sativa [cultivated lettuce]
ref|XP_009150474.1|  PREDICTED: probable methyltransferase PMT26      79.3    2e-13   Brassica rapa
emb|CDY39830.1|  BnaC02g42880D                                        79.3    2e-13   Brassica napus [oilseed rape]
ref|XP_003630288.1|  Ankyrin-like protein                             79.3    2e-13   Medicago truncatula
ref|XP_009360657.1|  PREDICTED: probable methyltransferase PMT24      78.2    4e-13   Pyrus x bretschneideri [bai li]
ref|XP_008244575.1|  PREDICTED: probable methyltransferase PMT24      78.2    4e-13   Prunus mume [ume]
ref|XP_007159858.1|  hypothetical protein PHAVU_002G273700g           78.2    5e-13   Phaseolus vulgaris [French bean]
ref|XP_007199628.1|  hypothetical protein PRUPE_ppa001750mg           77.8    5e-13   
emb|CDX84478.1|  BnaC03g50220D                                        77.4    8e-13   
ref|XP_009366818.1|  PREDICTED: probable methyltransferase PMT24      77.0    9e-13   Pyrus x bretschneideri [bai li]
ref|XP_009130433.1|  PREDICTED: probable methyltransferase PMT26      77.0    1e-12   Brassica rapa
emb|CDY31339.1|  BnaA02g34020D                                        77.0    1e-12   Brassica napus [oilseed rape]
ref|XP_009410679.1|  PREDICTED: probable methyltransferase PMT26      74.7    5e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009414612.1|  PREDICTED: probable methyltransferase PMT24      74.3    7e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009383568.1|  PREDICTED: probable methyltransferase PMT26      73.9    9e-12   
ref|XP_010469377.1|  PREDICTED: probable methyltransferase PMT25      73.6    1e-11   Camelina sativa [gold-of-pleasure]
gb|KJB71369.1|  hypothetical protein B456_011G118900                  73.6    1e-11   Gossypium raimondii
ref|XP_004289881.1|  PREDICTED: probable methyltransferase PMT24      73.2    2e-11   Fragaria vesca subsp. vesca
ref|XP_010509773.1|  PREDICTED: probable methyltransferase PMT25      73.2    2e-11   Camelina sativa [gold-of-pleasure]
gb|KHG15143.1|  hypothetical protein F383_09666                       72.8    2e-11   Gossypium arboreum [tree cotton]
ref|XP_006578949.1|  PREDICTED: probable methyltransferase PMT26-...  72.4    3e-11   Glycine max [soybeans]
ref|XP_010501645.1|  PREDICTED: probable methyltransferase PMT24      71.2    7e-11   
ref|XP_006410572.1|  hypothetical protein EUTSA_v10016285mg           70.9    9e-11   Eutrema salsugineum [saltwater cress]
ref|XP_010460728.1|  PREDICTED: probable methyltransferase PMT24      70.9    9e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010413759.1|  PREDICTED: probable methyltransferase PMT25      70.9    9e-11   Camelina sativa [gold-of-pleasure]
ref|XP_007137499.1|  hypothetical protein PHAVU_009G132000g           70.9    1e-10   Phaseolus vulgaris [French bean]
gb|EPS72711.1|  hypothetical protein M569_02048                       65.5    1e-10   Genlisea aurea
ref|XP_010930722.1|  PREDICTED: probable methyltransferase PMT26      70.5    1e-10   Elaeis guineensis
ref|XP_010112029.1|  putative methyltransferase PMT24                 70.5    1e-10   Morus notabilis
dbj|BAH19463.1|  AT1G29470                                            66.6    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010478312.1|  PREDICTED: probable methyltransferase PMT24 ...  70.1    2e-10   Camelina sativa [gold-of-pleasure]
ref|XP_008781596.1|  PREDICTED: probable methyltransferase PMT26      70.1    2e-10   Phoenix dactylifera
ref|XP_008783335.1|  PREDICTED: probable methyltransferase PMT26      70.1    2e-10   Phoenix dactylifera
emb|CDY43782.1|  BnaA06g23180D                                        69.7    2e-10   Brassica napus [oilseed rape]
ref|XP_002893569.1|  hypothetical protein ARALYDRAFT_473159           68.9    3e-10   
ref|XP_006415572.1|  hypothetical protein EUTSA_v10006884mg           68.9    4e-10   Eutrema salsugineum [saltwater cress]
ref|XP_006303155.1|  hypothetical protein CARUB_v10008372mg           68.6    4e-10   
ref|XP_010911089.1|  PREDICTED: probable methyltransferase PMT26      68.6    5e-10   Elaeis guineensis
ref|XP_006847154.1|  hypothetical protein AMTR_s00017p00240980        68.6    5e-10   
ref|XP_003527960.1|  PREDICTED: probable methyltransferase PMT26-...  68.6    6e-10   Glycine max [soybeans]
ref|XP_002881329.1|  hypothetical protein ARALYDRAFT_482372           67.4    1e-09   
ref|XP_010908928.1|  PREDICTED: probable methyltransferase PMT26      66.6    2e-09   Elaeis guineensis
dbj|BAE99079.1|  hypothetical protein                                 66.6    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|NP_174240.2|  putative methyltransferase PMT24                    66.6    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|NP_180977.1|  putative methyltransferase PMT25                    65.5    4e-09   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE99717.1|  hypothetical protein                                 65.5    4e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010533385.1|  PREDICTED: probable methyltransferase PMT24      65.5    4e-09   Tarenaya hassleriana [spider flower]
emb|CDX94669.1|  BnaC07g09890D                                        65.5    5e-09   
ref|XP_006295874.1|  hypothetical protein CARUB_v10025004mg           65.1    6e-09   Capsella rubella
ref|NP_001140988.1|  uncharacterized protein LOC100273067             64.3    6e-09   
ref|XP_010547883.1|  PREDICTED: probable methyltransferase PMT26      64.7    8e-09   Tarenaya hassleriana [spider flower]
emb|CDY33300.1|  BnaA01g19670D                                        62.4    1e-08   Brassica napus [oilseed rape]
ref|XP_006290554.1|  hypothetical protein CARUB_v10016641mg           63.5    2e-08   Capsella rubella
ref|XP_010412715.1|  PREDICTED: probable methyltransferase PMT27      62.8    3e-08   Camelina sativa [gold-of-pleasure]
ref|XP_004502550.1|  PREDICTED: probable methyltransferase PMT26-...  62.8    4e-08   Cicer arietinum [garbanzo]
ref|XP_009102852.1|  PREDICTED: probable methyltransferase PMT24      62.4    4e-08   Brassica rapa
gb|AAG51752.1|AC068667_31  unknown protein; 55790-52851               62.4    4e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008805853.1|  PREDICTED: probable methyltransferase PMT26      62.4    5e-08   Phoenix dactylifera
ref|XP_002876067.1|  hypothetical protein ARALYDRAFT_485459           58.9    6e-08   
emb|CDX90190.1|  BnaA08g17940D                                        61.6    8e-08   
emb|CDY26534.1|  BnaC01g23650D                                        61.6    9e-08   Brassica napus [oilseed rape]
ref|XP_010426649.1|  PREDICTED: probable methyltransferase PMT27      61.2    1e-07   Camelina sativa [gold-of-pleasure]
gb|ADK88116.1|  AtIII19x5-like protein                                57.0    1e-07   Arabidopsis halleri
ref|XP_010515490.1|  PREDICTED: probable methyltransferase PMT27      61.2    1e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010503787.1|  PREDICTED: probable methyltransferase PMT27      61.2    1e-07   Camelina sativa [gold-of-pleasure]
ref|XP_009149307.1|  PREDICTED: probable methyltransferase PMT27      61.2    1e-07   Brassica rapa
gb|ACN28572.1|  unknown                                               61.2    1e-07   Zea mays [maize]
ref|XP_009109665.1|  PREDICTED: probable methyltransferase PMT24      61.2    1e-07   
ref|XP_009115236.1|  PREDICTED: probable methyltransferase PMT24 ...  60.1    3e-07   Brassica rapa
emb|CDY48339.1|  BnaA09g26820D                                        59.7    3e-07   Brassica napus [oilseed rape]
ref|XP_010527657.1|  PREDICTED: probable methyltransferase PMT24      59.7    3e-07   Tarenaya hassleriana [spider flower]
emb|CDX99828.1|  BnaC05g22500D                                        59.7    3e-07   
ref|XP_009115237.1|  PREDICTED: probable methyltransferase PMT24 ...  59.7    3e-07   Brassica rapa
emb|CDY44314.1|  BnaA07g07980D                                        59.3    4e-07   Brassica napus [oilseed rape]
gb|KHN36073.1|  Putative methyltransferase PMT27                      59.3    4e-07   Glycine soja [wild soybean]
ref|XP_003516560.1|  PREDICTED: probable methyltransferase PMT27-...  59.3    5e-07   Glycine max [soybeans]
gb|ADK88118.1|  AtIII19x5-like protein                                54.7    5e-07   Arabidopsis halleri
ref|XP_006403957.1|  hypothetical protein EUTSA_v10010109mg           58.5    8e-07   Eutrema salsugineum [saltwater cress]
ref|XP_010557710.1|  PREDICTED: probable methyltransferase PMT27      58.5    9e-07   Tarenaya hassleriana [spider flower]
emb|CDY66721.1|  BnaC03g76010D                                        57.4    2e-06   Brassica napus [oilseed rape]
gb|KEH35375.1|  methyltransferase PMT26-like protein, putative        57.4    2e-06   Medicago truncatula
ref|XP_009143789.1|  PREDICTED: probable methyltransferase PMT25      57.4    2e-06   Brassica rapa
emb|CDY17234.1|  BnaA05g09540D                                        57.4    2e-06   Brassica napus [oilseed rape]
ref|XP_009411900.1|  PREDICTED: probable methyltransferase PMT26      57.0    3e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_190676.1|  putative methyltransferase PMT27                    57.0    3e-06   Arabidopsis thaliana [mouse-ear cress]
gb|ABA96619.1|  dehydration-responsive protein, putative              56.6    4e-06   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ19833.1|  hypothetical protein OsJ_35417                        56.6    4e-06   Oryza sativa Japonica Group [Japonica rice]
emb|CDX84330.1|  BnaC04g10920D                                        56.6    4e-06   
gb|EAY82457.1|  hypothetical protein OsI_37674                        56.2    5e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_009115787.1|  PREDICTED: probable methyltransferase PMT27      56.2    5e-06   Brassica rapa
ref|XP_006828886.1|  hypothetical protein AMTR_s00001p00185010        55.8    7e-06   
ref|XP_010679252.1|  PREDICTED: probable methyltransferase PMT26      55.1    1e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006365916.1|  PREDICTED: probable methyltransferase PMT24-...  55.1    1e-05   Solanum tuberosum [potatoes]
ref|XP_010063906.1|  PREDICTED: probable methyltransferase PMT25 ...  53.5    4e-05   Eucalyptus grandis [rose gum]
ref|NP_001045015.1|  Os01g0883900                                     53.5    4e-05   
ref|XP_010679267.1|  PREDICTED: probable methyltransferase PMT26      53.1    5e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007158605.1|  hypothetical protein PHAVU_002G166600g           53.1    6e-05   Phaseolus vulgaris [French bean]
tpg|DAA38926.1|  TPA: hypothetical protein ZEAMMB73_582749            52.4    9e-05   
ref|XP_008669787.1|  PREDICTED: probable methyltransferase PMT26      52.4    1e-04   Zea mays [maize]
ref|XP_003580900.1|  PREDICTED: probable methyltransferase PMT26      52.0    1e-04   Brachypodium distachyon [annual false brome]
ref|XP_010271514.1|  PREDICTED: probable methyltransferase PMT27      52.0    2e-04   
ref|XP_004237701.1|  PREDICTED: probable methyltransferase PMT24      51.2    2e-04   Solanum lycopersicum
ref|XP_007046783.1|  S-adenosyl-L-methionine-dependent methyltran...  50.1    6e-04   
ref|XP_010263954.1|  PREDICTED: probable methyltransferase PMT27      50.1    6e-04   Nelumbo nucifera [Indian lotus]
gb|EEC67819.1|  hypothetical protein OsI_35396                        49.7    8e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_004170954.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...  49.3    9e-04   
ref|XP_010906388.1|  PREDICTED: probable methyltransferase PMT24      49.7    9e-04   Elaeis guineensis
ref|XP_010063908.1|  PREDICTED: probable methyltransferase PMT25      49.3    0.001   Eucalyptus grandis [rose gum]



>emb|CAN80052.1| hypothetical protein VITISV_020270 [Vitis vinifera]
Length=226

 Score =   121 bits (304),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 74/91 (81%), Gaps = 2/91 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVDGR+++ NYCS  T++ FVA+CLVGVWMMTSSSVVPVQNS+VS+QE+K ++
Sbjct  1    MALGKYSRVDGRRSTTNYCSAATLVAFVALCLVGVWMMTSSSVVPVQNSDVSTQETKDEV  60

Query  540  KTQVNESNESDTGXHE--SNNASDESNTSDG  626
            K QV ESN+SDT   E  S + +D++   DG
Sbjct  61   KQQVVESNDSDTRQFEDSSGDLTDDAKKGDG  91



>ref|XP_004239625.1| PREDICTED: probable methyltransferase PMT26 [Solanum lycopersicum]
 ref|XP_010321299.1| PREDICTED: probable methyltransferase PMT26 [Solanum lycopersicum]
Length=813

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 74/89 (83%), Gaps = 2/89 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVDGRK+S NYCSTVTI+VFVA+CLVGVWMMTSSSVVP QN ++SSQ  KTDL
Sbjct  1    MALGKYSRVDGRKSS-NYCSTVTIVVFVALCLVGVWMMTSSSVVPDQNLDLSSQGKKTDL  59

Query  540  KTQVNESNESDTGXHESNN-ASDESNTSD  623
             TQV E  ES  G +ESNN A DESN +D
Sbjct  60   STQVTEGKESYNGGNESNNKAGDESNPTD  88



>ref|XP_009771172.1| PREDICTED: probable methyltransferase PMT26 [Nicotiana sylvestris]
 ref|XP_009771173.1| PREDICTED: probable methyltransferase PMT26 [Nicotiana sylvestris]
Length=807

 Score =   125 bits (313),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 75/89 (84%), Gaps = 2/89 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVDGRK+S +YCSTVTI+VFVA+CLVGVWMMTSSSVVPVQNS+VSSQ   +D 
Sbjct  1    MALGKYSRVDGRKSS-SYCSTVTIVVFVALCLVGVWMMTSSSVVPVQNSDVSSQGKTSDA  59

Query  540  KTQVNESNESDTGXHES-NNASDESNTSD  623
             TQV+ES ES  G  ES NNA DESN +D
Sbjct  60   TTQVSESKESSNGGSESNNNAGDESNPTD  88



>emb|CAN60874.1| hypothetical protein VITISV_030592 [Vitis vinifera]
Length=485

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 75/91 (82%), Gaps = 2/91 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVDGR+++ NYCST T++ FVA+CLVGVWMMTSSSVVPVQNS+VS+QE+K ++
Sbjct  1    MALGKYSRVDGRRSTTNYCSTATLVAFVALCLVGVWMMTSSSVVPVQNSDVSTQETKDEV  60

Query  540  KTQVNESNESDTGXHE--SNNASDESNTSDG  626
            K QV ESN+SDT   E  S + +D++   DG
Sbjct  61   KQQVVESNDSDTRQFEDSSGDLTDDAKKGDG  91



>ref|XP_006345748.1| PREDICTED: probable methyltransferase PMT26-like [Solanum tuberosum]
Length=813

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 72/89 (81%), Gaps = 2/89 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVDGRK+S NYCSTVTI+VFVA+CLVGVWMMTSSSVVP QN ++SSQ  K DL
Sbjct  1    MALGKYSRVDGRKSS-NYCSTVTIVVFVALCLVGVWMMTSSSVVPDQNLDLSSQGKKNDL  59

Query  540  KTQVNESNESDTGXHESNN-ASDESNTSD  623
             TQV E  ES  G +ESNN A DE N +D
Sbjct  60   STQVTEGKESYNGGNESNNKAGDEGNPTD  88



>ref|XP_009590749.1| PREDICTED: probable methyltransferase PMT26 [Nicotiana tomentosiformis]
 ref|XP_009590750.1| PREDICTED: probable methyltransferase PMT26 [Nicotiana tomentosiformis]
Length=807

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 75/89 (84%), Gaps = 2/89 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVDGRK+S +YCSTVTI+VFVA+CLVGVWMMTSSSVVPVQNS+VSSQ   +D 
Sbjct  1    MALGKYSRVDGRKSS-SYCSTVTIVVFVALCLVGVWMMTSSSVVPVQNSDVSSQGKNSDA  59

Query  540  KTQVNESNESDTGXHES-NNASDESNTSD  623
             TQV+ S ES  G +ES NNA DESN +D
Sbjct  60   ATQVSGSKESYNGGNESNNNAGDESNPTD  88



>emb|CBI37509.3| unnamed protein product [Vitis vinifera]
Length=761

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 75/91 (82%), Gaps = 2/91 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVDGR+++ NYCST T++ FVA+CLVGVWMMTSSSVVPVQNS+VS+QE+K ++
Sbjct  1    MALGKYSRVDGRRSTTNYCSTATLVAFVALCLVGVWMMTSSSVVPVQNSDVSTQETKDEV  60

Query  540  KTQVNESNESDTGXHE--SNNASDESNTSDG  626
            K QV ESN+SDT   E  S + +D++   DG
Sbjct  61   KQQVVESNDSDTRQFEDSSGDLTDDAKKGDG  91



>ref|XP_002266357.1| PREDICTED: probable methyltransferase PMT26 [Vitis vinifera]
Length=825

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 75/91 (82%), Gaps = 2/91 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVDGR+++ NYCST T++ FVA+CLVGVWMMTSSSVVPVQNS+VS+QE+K ++
Sbjct  1    MALGKYSRVDGRRSTTNYCSTATLVAFVALCLVGVWMMTSSSVVPVQNSDVSTQETKDEV  60

Query  540  KTQVNESNESDTGXHE--SNNASDESNTSDG  626
            K QV ESN+SDT   E  S + +D++   DG
Sbjct  61   KQQVVESNDSDTRQFEDSSGDLTDDAKKGDG  91



>gb|EYU23728.1| hypothetical protein MIMGU_mgv1a001484mg [Erythranthe guttata]
Length=810

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 72/88 (82%), Gaps = 4/88 (5%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVDGRK+S  YCSTVTI+VFVA+CLVGVWMMTSS+VVPVQ S+V SQE+K +L
Sbjct  1    MALGKYSRVDGRKSSSGYCSTVTIVVFVALCLVGVWMMTSSTVVPVQPSDV-SQENKNEL  59

Query  540  KTQVNES---NESDTGXHESNNASDESN  614
            KT V E+   N++D   +E N+ ++E N
Sbjct  60   KTDVTETNAENQNDATNNEDNSNANEDN  87



>ref|XP_011099715.1| PREDICTED: probable methyltransferase PMT26 [Sesamum indicum]
Length=818

 Score =   109 bits (273),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 72/86 (84%), Gaps = 6/86 (7%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVDGRK+S +YCSTVT++VFVA+CLVGVWMMTSSSVVPVQNS+V SQE+K ++
Sbjct  1    MALGKYSRVDGRKSSSSYCSTVTVVVFVALCLVGVWMMTSSSVVPVQNSDV-SQENKNEV  59

Query  540  KTQVNESNESDTGXHESNNASDESNT  617
            KT V ESN  +     +N+A ++ N+
Sbjct  60   KTPVTESNAEN-----NNDARNDENS  80



>ref|XP_002306259.2| dehydration-responsive family protein [Populus trichocarpa]
 gb|EEE93255.2| dehydration-responsive family protein [Populus trichocarpa]
Length=796

 Score =   107 bits (266),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVD R+ + +YCSTVTI+VFV +CLVG WMMTSSSVVP QN +V +QE+K ++
Sbjct  1    MALGKYSRVDNRRHNSSYCSTVTIVVFVGLCLVGAWMMTSSSVVPGQNVDVPAQENKNEV  60

Query  540  KTQVNESNESDTGXHESN  593
            K QV ESNE +T   E N
Sbjct  61   KQQVTESNEINTKQFEDN  78



>ref|XP_011031161.1| PREDICTED: probable methyltransferase PMT26 isoform X6 [Populus 
euphratica]
Length=828

 Score =   104 bits (259),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 66/89 (74%), Gaps = 1/89 (1%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVD R+ + +YCSTVT++VFV +CLVG WMMTSSSVVP QN +V +QE+K ++
Sbjct  1    MALGKYSRVDNRRHNSSYCSTVTVVVFVGLCLVGAWMMTSSSVVPGQNVDVPAQENKNEV  60

Query  540  KTQVNESNESDTG-XHESNNASDESNTSD  623
            K QV ESNE +T   +E N    E N  D
Sbjct  61   KQQVTESNEINTTESNEINTKQFEDNPGD  89



>ref|XP_011031160.1| PREDICTED: probable methyltransferase PMT26 isoform X5 [Populus 
euphratica]
Length=828

 Score =   104 bits (259),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 66/89 (74%), Gaps = 1/89 (1%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVD R+ + +YCSTVT++VFV +CLVG WMMTSSSVVP QN +V +QE+K ++
Sbjct  1    MALGKYSRVDNRRHNSSYCSTVTVVVFVGLCLVGAWMMTSSSVVPGQNVDVPAQENKNEV  60

Query  540  KTQVNESNESDTG-XHESNNASDESNTSD  623
            K QV ESNE +T   +E N    E N  D
Sbjct  61   KQQVTESNEINTTESNEINTKQFEDNPGD  89



>ref|XP_011031157.1| PREDICTED: probable methyltransferase PMT26 isoform X2 [Populus 
euphratica]
Length=836

 Score =   104 bits (259),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 66/89 (74%), Gaps = 1/89 (1%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVD R+ + +YCSTVT++VFV +CLVG WMMTSSSVVP QN +V +QE+K ++
Sbjct  1    MALGKYSRVDNRRHNSSYCSTVTVVVFVGLCLVGAWMMTSSSVVPGQNVDVPAQENKNEV  60

Query  540  KTQVNESNESDTG-XHESNNASDESNTSD  623
            K QV ESNE +T   +E N    E N  D
Sbjct  61   KQQVTESNEINTTESNEINTKQFEDNPGD  89



>ref|XP_011031158.1| PREDICTED: probable methyltransferase PMT26 isoform X3 [Populus 
euphratica]
 ref|XP_011031159.1| PREDICTED: probable methyltransferase PMT26 isoform X4 [Populus 
euphratica]
Length=830

 Score =   104 bits (259),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 66/89 (74%), Gaps = 1/89 (1%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVD R+ + +YCSTVT++VFV +CLVG WMMTSSSVVP QN +V +QE+K ++
Sbjct  1    MALGKYSRVDNRRHNSSYCSTVTVVVFVGLCLVGAWMMTSSSVVPGQNVDVPAQENKNEV  60

Query  540  KTQVNESNE-SDTGXHESNNASDESNTSD  623
            K QV ESNE + T  +E N    E N  D
Sbjct  61   KQQVTESNEINTTESNEINTKQFEDNPGD  89



>ref|XP_011031156.1| PREDICTED: probable methyltransferase PMT26 isoform X1 [Populus 
euphratica]
Length=846

 Score =   104 bits (259),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 66/89 (74%), Gaps = 1/89 (1%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVD R+ + +YCSTVT++VFV +CLVG WMMTSSSVVP QN +V +QE+K ++
Sbjct  1    MALGKYSRVDNRRHNSSYCSTVTVVVFVGLCLVGAWMMTSSSVVPGQNVDVPAQENKNEV  60

Query  540  KTQVNESNE-SDTGXHESNNASDESNTSD  623
            K QV ESNE + T  +E N    E N  D
Sbjct  61   KQQVTESNEINTTESNEINTKQFEDNPGD  89



>ref|XP_008462649.1| PREDICTED: probable methyltransferase PMT26 [Cucumis melo]
Length=822

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 63/78 (81%), Gaps = 1/78 (1%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVD R++S +YCSTVTI+VFVA+CLVG+WM+TSSSVVPVQN +V  QE+K   
Sbjct  1    MALGKYSRVDNRRSSSSYCSTVTIVVFVALCLVGIWMLTSSSVVPVQNIDV-PQENKNLA  59

Query  540  KTQVNESNESDTGXHESN  593
            K+QV E+NE  T   E N
Sbjct  60   KSQVIETNEGKTQPFEDN  77



>ref|XP_004143348.1| PREDICTED: probable methyltransferase PMT26-like [Cucumis sativus]
 gb|KGN48314.1| hypothetical protein Csa_6G476050 [Cucumis sativus]
Length=830

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 63/78 (81%), Gaps = 1/78 (1%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVD R++S +YCSTVTI+VFVA+CLVG+WM+TSSSVVPVQN +V  QE+K   
Sbjct  1    MALGKYSRVDNRRSSSSYCSTVTIVVFVALCLVGIWMLTSSSVVPVQNIDV-PQENKNLA  59

Query  540  KTQVNESNESDTGXHESN  593
            K+QV E+NE  T   E N
Sbjct  60   KSQVIETNEGKTQPFEDN  77



>ref|XP_004166405.1| PREDICTED: LOW QUALITY PROTEIN: probable methyltransferase PMT26-like 
[Cucumis sativus]
Length=829

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 63/78 (81%), Gaps = 1/78 (1%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVD R++S +YCSTVTI+VFVA+CLVG+WM+TSSSVVPVQN +V  QE+K   
Sbjct  1    MALGKYSRVDNRRSSSSYCSTVTIVVFVALCLVGIWMLTSSSVVPVQNIDV-PQENKNLA  59

Query  540  KTQVNESNESDTGXHESN  593
            K+QV E+NE  T   E N
Sbjct  60   KSQVIETNEGKTQPFEDN  77



>ref|XP_010027631.1| PREDICTED: probable methyltransferase PMT26 [Eucalyptus grandis]
 gb|KCW54199.1| hypothetical protein EUGRSUZ_I00186 [Eucalyptus grandis]
Length=814

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 61/68 (90%), Gaps = 1/68 (1%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKY+RVD R++S +YCSTVTI VFVA+CLVGVWMMTSSSVVPVQN +V SQE+K+++
Sbjct  1    MALGKYTRVDNRRSSSSYCSTVTIAVFVALCLVGVWMMTSSSVVPVQNVDV-SQETKSEV  59

Query  540  KTQVNESN  563
            K QV E+N
Sbjct  60   KEQVVENN  67



>ref|XP_010090820.1| putative methyltransferase PMT26 [Morus notabilis]
 gb|EXB40945.1| putative methyltransferase PMT26 [Morus notabilis]
Length=816

 Score =   101 bits (251),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 71/111 (64%), Gaps = 27/111 (24%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQN--------SEVS  515
            MALGKY+RVD R++S +YCSTVTI+VFVA+CLVGVWMMTSSSVVPVQN        SEV 
Sbjct  1    MALGKYTRVDNRRSSSSYCSTVTIVVFVALCLVGVWMMTSSSVVPVQNVDVSPENKSEVK  60

Query  516  SQESKTDLKTQV---------------NESNESDTGXHESNNASDESNTSD  623
            +QESKT++  QV               NESNES+ G    N    E N  D
Sbjct  61   AQESKTEVSEQVSENNENNVNNESNAGNESNESNEG----NTRQFEDNPGD  107



>ref|XP_002516311.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF46058.1| ATP binding protein, putative [Ricinus communis]
Length=814

 Score =   100 bits (250),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKY+R+D R+ S NYCSTVTI+VFVA+CLVGVWMMTSSSVVP Q+ +V +Q++K+++
Sbjct  1    MALGKYTRIDTRRQSTNYCSTVTIVVFVALCLVGVWMMTSSSVVPGQSVDVPAQDTKSEV  60

Query  540  KTQVNESNES  569
            K +   SNES
Sbjct  61   KEEAPPSNES  70



>ref|XP_011022921.1| PREDICTED: probable methyltransferase PMT26 [Populus euphratica]
Length=840

 Score =   100 bits (250),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVD R+ + +YCSTVTI VFV +CLVGVWMMTSSSVVP Q+ +V +QE+K ++
Sbjct  1    MALGKYSRVDNRRQNSSYCSTVTITVFVGLCLVGVWMMTSSSVVPGQSVDVPAQENKNEV  60

Query  540  KTQVNESNE  566
            K QV ESNE
Sbjct  61   KQQVPESNE  69



>ref|XP_002309924.1| dehydration-responsive family protein [Populus trichocarpa]
 gb|EEE90374.1| dehydration-responsive family protein [Populus trichocarpa]
Length=824

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVD R+ + +YCSTVTI VFV +CLVGVWMMTSSSVVP Q+ +  +QE+K ++
Sbjct  1    MALGKYSRVDNRRQNSSYCSTVTITVFVGLCLVGVWMMTSSSVVPGQSVDAPAQENKNEV  60

Query  540  KTQVNESNE  566
            K QV ESNE
Sbjct  61   KQQVPESNE  69



>ref|XP_004288094.1| PREDICTED: probable methyltransferase PMT26 [Fragaria vesca subsp. 
vesca]
Length=800

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 71/91 (78%), Gaps = 3/91 (3%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVD R+++ +YCSTVTI+VFVA+CLVGVWMMTSSSVVPVQN +V +QE+K+++
Sbjct  1    MAMGKYSRVDNRRSAASYCSTVTIVVFVALCLVGVWMMTSSSVVPVQNVDV-AQENKSEV  59

Query  540  --KTQVNESNESDTGXHESNNASDESNTSDG  626
              + QV+E++E ++   E N      + + G
Sbjct  60   VKEEQVSETSEGNSKQFEDNPGDLPEDATKG  90



>ref|XP_003602639.1| Ankyrin-like protein [Medicago truncatula]
Length=501

 Score = 97.4 bits (241),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 66/84 (79%), Gaps = 8/84 (10%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESK---  530
            MALGKYSRVDGR++S +YCSTVTI+VFVA+ L+GVWMMTSSSVVPVQN +V  QESK   
Sbjct  1    MALGKYSRVDGRRSS-SYCSTVTIVVFVALALIGVWMMTSSSVVPVQNEDV-PQESKSEV  58

Query  531  ---TDLKTQVNESNESDTGXHESN  593
               T+++ QV+E++ S+    E N
Sbjct  59   KEQTEVREQVSETDNSNARQFEDN  82



>gb|KDO51661.1| hypothetical protein CISIN_1g003776mg [Citrus sinensis]
Length=595

 Score = 97.8 bits (242),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 68/93 (73%), Gaps = 4/93 (4%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMT---SSSVVPVQNSEVSSQESK  530
            MA GKY+RVDGR+++ +YCSTVTI VFVA+CLVGVWMMT   SSSVVPVQN +  +QE K
Sbjct  1    MANGKYTRVDGRRSASSYCSTVTITVFVALCLVGVWMMTSSSSSSVVPVQNVDEPAQEKK  60

Query  531  TDLKTQVNESNESDTGXH-ESNNASDESNTSDG  626
            ++ K Q+ ESNES +    E NNA    + + G
Sbjct  61   SEAKEQLTESNESSSNQQFEDNNADLPEDATKG  93



>ref|XP_003602638.1| Ankyrin-like protein [Medicago truncatula]
Length=508

 Score = 97.1 bits (240),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 66/84 (79%), Gaps = 8/84 (10%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESK---  530
            MALGKYSRVDGR++S +YCSTVTI+VFVA+ L+GVWMMTSSSVVPVQN +V  QESK   
Sbjct  1    MALGKYSRVDGRRSS-SYCSTVTIVVFVALALIGVWMMTSSSVVPVQNEDV-PQESKSEV  58

Query  531  ---TDLKTQVNESNESDTGXHESN  593
               T+++ QV+E++ S+    E N
Sbjct  59   KEQTEVREQVSETDNSNARQFEDN  82



>gb|KDP32896.1| hypothetical protein JCGZ_12188 [Jatropha curcas]
Length=813

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 57/68 (84%), Gaps = 1/68 (1%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDGRK+S +YCST+ ++VFVA CLVGVWM+ SSSVVP+QNS+ SSQE   D+
Sbjct  1    MAMGKYSRVDGRKSS-SYCSTIMVVVFVAFCLVGVWMLMSSSVVPIQNSDSSSQEPVNDV  59

Query  540  KTQVNESN  563
            K  V ESN
Sbjct  60   KQTVIESN  67



>gb|KDO51659.1| hypothetical protein CISIN_1g003776mg [Citrus sinensis]
 gb|KDO51660.1| hypothetical protein CISIN_1g003776mg [Citrus sinensis]
Length=796

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 68/93 (73%), Gaps = 4/93 (4%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMT---SSSVVPVQNSEVSSQESK  530
            MA GKY+RVDGR+++ +YCSTVTI VFVA+CLVGVWMMT   SSSVVPVQN +  +QE K
Sbjct  1    MANGKYTRVDGRRSASSYCSTVTITVFVALCLVGVWMMTSSSSSSVVPVQNVDEPAQEKK  60

Query  531  TDLKTQVNESNESDTGXH-ESNNASDESNTSDG  626
            ++ K Q+ ESNES +    E NNA    + + G
Sbjct  61   SEAKEQLTESNESSSNQQFEDNNADLPEDATKG  93



>ref|XP_003602637.1| Ankyrin-like protein [Medicago truncatula]
 gb|AES72888.1| methyltransferase PMT26-like protein, putative [Medicago truncatula]
Length=789

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 69/95 (73%), Gaps = 8/95 (8%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESK---  530
            MALGKYSRVDGR++S +YCSTVTI+VFVA+ L+GVWMMTSSSVVPVQN +V  QESK   
Sbjct  1    MALGKYSRVDGRRSS-SYCSTVTIVVFVALALIGVWMMTSSSVVPVQNEDV-PQESKSEV  58

Query  531  ---TDLKTQVNESNESDTGXHESNNASDESNTSDG  626
               T+++ QV+E++ S+    E N      + + G
Sbjct  59   KEQTEVREQVSETDNSNARQFEDNPGDLPEDATKG  93



>ref|XP_006432154.1| hypothetical protein CICLE_v10000328mg [Citrus clementina]
 ref|XP_006465082.1| PREDICTED: probable methyltransferase PMT26-like [Citrus sinensis]
 gb|ESR45394.1| hypothetical protein CICLE_v10000328mg [Citrus clementina]
Length=796

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 68/93 (73%), Gaps = 4/93 (4%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMT---SSSVVPVQNSEVSSQESK  530
            MA GKY+RVDGR+++ +YCSTVTI VFVA+CLVGVWMMT   SSSVVPVQN +  +QE K
Sbjct  1    MANGKYTRVDGRRSASSYCSTVTITVFVALCLVGVWMMTSSSSSSVVPVQNVDEPAQEKK  60

Query  531  TDLKTQVNESNESDTGXH-ESNNASDESNTSDG  626
            ++ K Q+ ESNES +    E NNA    + + G
Sbjct  61   SEAKEQLPESNESSSNQQFEDNNADLPEDATKG  93



>ref|XP_007019267.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY16492.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=837

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 56/67 (84%), Gaps = 1/67 (1%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MAL KYSRVDGRK+S +YCST TI+VFVA CLVG+WM  SSSVVPVQNSE+SSQE+  ++
Sbjct  1    MALAKYSRVDGRKSS-SYCSTATIVVFVAFCLVGIWMFMSSSVVPVQNSELSSQETTNEV  59

Query  540  KTQVNES  560
            K  V +S
Sbjct  60   KPTVPKS  66



>ref|XP_004502956.1| PREDICTED: probable methyltransferase PMT26-like [Cicer arietinum]
Length=803

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 67/84 (80%), Gaps = 7/84 (8%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESK---  530
            MA+GKYSRVDGR++S +YCSTVTI+VFVA+CL+GVWMMTSSSVVPV N + +SQESK   
Sbjct  1    MAVGKYSRVDGRRSSTSYCSTVTIVVFVALCLIGVWMMTSSSVVPVGNGD-ASQESKNEV  59

Query  531  ---TDLKTQVNESNESDTGXHESN  593
               +++K QV++++  ++   E N
Sbjct  60   TEQSEVKEQVSDTDNGNSRQFEDN  83



>ref|XP_002285889.2| PREDICTED: probable methyltransferase PMT24 [Vitis vinifera]
 ref|XP_010664148.1| PREDICTED: probable methyltransferase PMT24 [Vitis vinifera]
Length=844

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 68/90 (76%), Gaps = 5/90 (6%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDGR++S NYCST+ I+VFV VCLVGVWMM SSS+VP+QNS++ S ++  ++
Sbjct  1    MAMGKYSRVDGRRSS-NYCSTIAIVVFVGVCLVGVWMMMSSSIVPIQNSDLVSDDTPHEV  59

Query  540  KTQVNESN----ESDTGXHESNNASDESNT  617
            + ++++++    E  +G    + A  ESNT
Sbjct  60   QKKIDDNDSTQFEDSSGNFPLDAAKGESNT  89



>ref|XP_007048444.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOX92601.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=815

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 68/92 (74%), Gaps = 7/92 (8%)
 Frame = +3

Query  360  MALGKYSRVD--GRKASPN-YCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESK  530
            MALGKYSRVD  GR++S + YCSTVTI+VFV +CLVG+WMMTSSSVVP+QN + ++QE K
Sbjct  1    MALGKYSRVDNNGRRSSSSTYCSTVTIVVFVGLCLVGIWMMTSSSVVPLQNGDDTAQEKK  60

Query  531  TDLKTQVNES-NESDTGXHESNNASDESNTSD  623
             ++K QV    +ES+ G   SN A  E N  D
Sbjct  61   NEVKDQVTPVIDESNGG---SNTAQFEDNPGD  89



>ref|XP_008360714.1| PREDICTED: probable methyltransferase PMT26 [Malus domestica]
Length=840

 Score = 95.1 bits (235),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 65/93 (70%), Gaps = 10/93 (11%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPN-YCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTD  536
            MALGKY+RVD R+ S N YCSTVTI+VFVA+CL  VWMMTSSSVVPVQN +V  QE+K+D
Sbjct  1    MALGKYTRVDSRRPSSNGYCSTVTIVVFVALCLAAVWMMTSSSVVPVQNVDV-PQENKSD  59

Query  537  LKTQVNESNESDTGXHE----SNNASDESNTSD  623
            L    NE + +D G  E    +N+   E N  D
Sbjct  60   L----NEQDSNDVGVKEQVSDTNDRQFEDNPGD  88



>gb|KDO83500.1| hypothetical protein CISIN_1g015557mg [Citrus sinensis]
Length=404

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 58/66 (88%), Gaps = 1/66 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDGRK+S  YCSTVT++VFV +CLVGVWM+ SS+VVPV++ E+SS E+ +++
Sbjct  1    MAMGKYSRVDGRKSS-GYCSTVTVVVFVGLCLVGVWMLMSSTVVPVRDPELSSGEAISEV  59

Query  540  KTQVNE  557
            K +V+E
Sbjct  60   KQRVSE  65



>ref|XP_007214544.1| hypothetical protein PRUPE_ppa001471mg [Prunus persica]
 gb|EMJ15743.1| hypothetical protein PRUPE_ppa001471mg [Prunus persica]
Length=819

 Score = 95.1 bits (235),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 69/99 (70%), Gaps = 10/99 (10%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPN-YCSTVTIIVFVAVCLVGVWMMTSSSVVPVQN--------SEV  512
            MA GKY+RVD R++S + YCSTVTI+VFVA+CLVGVWMMTSSSVVPVQN        SE+
Sbjct  1    MATGKYTRVDNRRSSASSYCSTVTIVVFVALCLVGVWMMTSSSVVPVQNVDVPQEKKSEL  60

Query  513  SSQE-SKTDLKTQVNESNESDTGXHESNNASDESNTSDG  626
            + Q+ +K D+K QV+++NE  T   E N      + + G
Sbjct  61   NEQDNNKVDVKEQVSDTNEGTTRQFEDNPGDLPEDATKG  99



>ref|XP_008227415.1| PREDICTED: probable methyltransferase PMT26 [Prunus mume]
Length=819

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 69/99 (70%), Gaps = 10/99 (10%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPN-YCSTVTIIVFVAVCLVGVWMMTSSSVVPVQN--------SEV  512
            MA GKY+RVD R++S + YCSTVTI+VFVA+CLVGVWMMTSSSVVPVQN        SE+
Sbjct  1    MATGKYTRVDNRRSSASSYCSTVTIVVFVALCLVGVWMMTSSSVVPVQNVDVPQEKKSEL  60

Query  513  SSQE-SKTDLKTQVNESNESDTGXHESNNASDESNTSDG  626
            + Q+ +K D+K QV+++NE  T   E N      + + G
Sbjct  61   NEQDNNKVDVKEQVSDNNEGTTRQFEDNPGDLPEDATKG  99



>ref|XP_007137790.1| hypothetical protein PHAVU_009G155600g [Phaseolus vulgaris]
 gb|ESW09784.1| hypothetical protein PHAVU_009G155600g [Phaseolus vulgaris]
Length=818

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 64/88 (73%), Gaps = 2/88 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKY+RVDGR++S ++CSTVT++VFVA+CLVGVWMMTSSSVVPV N +  +QE+K ++
Sbjct  1    MALGKYTRVDGRRSS-SWCSTVTVVVFVALCLVGVWMMTSSSVVPVNNGD-EAQETKNEV  58

Query  540  KTQVNESNESDTGXHESNNASDESNTSD  623
            K Q +   E+      SN    E N  D
Sbjct  59   KEQTDIKEEAAIEIGNSNTRQFEDNPGD  86



>ref|XP_006434319.1| hypothetical protein CICLE_v10000311mg [Citrus clementina]
 ref|XP_006434320.1| hypothetical protein CICLE_v10000311mg [Citrus clementina]
 gb|ESR47559.1| hypothetical protein CICLE_v10000311mg [Citrus clementina]
 gb|ESR47560.1| hypothetical protein CICLE_v10000311mg [Citrus clementina]
Length=581

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 58/66 (88%), Gaps = 1/66 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDGRK+S  YCSTVT++VFV +CLVGVWM+ SS+VVPV++ E+SS E+ +++
Sbjct  1    MAMGKYSRVDGRKSS-GYCSTVTVVVFVGLCLVGVWMLMSSTVVPVRDPELSSGEAISEV  59

Query  540  KTQVNE  557
            K +V+E
Sbjct  60   KQRVSE  65



>ref|XP_006434317.1| hypothetical protein CICLE_v10000311mg [Citrus clementina]
 ref|XP_006434318.1| hypothetical protein CICLE_v10000311mg [Citrus clementina]
 gb|ESR47557.1| hypothetical protein CICLE_v10000311mg [Citrus clementina]
 gb|ESR47558.1| hypothetical protein CICLE_v10000311mg [Citrus clementina]
Length=808

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 58/66 (88%), Gaps = 1/66 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDGRK+S  YCSTVT++VFV +CLVGVWM+ SS+VVPV++ E+SS E+ +++
Sbjct  1    MAMGKYSRVDGRKSS-GYCSTVTVVVFVGLCLVGVWMLMSSTVVPVRDPELSSGEAISEV  59

Query  540  KTQVNE  557
            K +V+E
Sbjct  60   KQRVSE  65



>ref|XP_006472883.1| PREDICTED: probable methyltransferase PMT25-like [Citrus sinensis]
Length=808

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 58/66 (88%), Gaps = 1/66 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDGRK+S  YCSTVT++VFV +CLVGVWM+ SS+VVPV++ E+SS E+ +++
Sbjct  1    MAMGKYSRVDGRKSS-GYCSTVTVVVFVGLCLVGVWMLMSSTVVPVRDPELSSGEAISEV  59

Query  540  KTQVNE  557
            K +V+E
Sbjct  60   KQRVSE  65



>ref|XP_011078779.1| PREDICTED: probable methyltransferase PMT26 [Sesamum indicum]
Length=817

 Score = 92.0 bits (227),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 53/66 (80%), Gaps = 1/66 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKYSRVDGR+ S  YCSTV+I+V VA+CLVGVWMMTSSS VP QNS+V SQE+   +
Sbjct  1    MALGKYSRVDGRRTSSGYCSTVSIVVVVALCLVGVWMMTSSSTVPGQNSDV-SQENNNGV  59

Query  540  KTQVNE  557
            K  V E
Sbjct  60   KAHVAE  65



>gb|KJB29131.1| hypothetical protein B456_005G086100 [Gossypium raimondii]
Length=589

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 63/92 (68%), Gaps = 4/92 (4%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+ KYSRVDGRK+S +YCST  I+VFVA CLVG+WM  SSSVVP++NS++SSQE++ + 
Sbjct  1    MAMAKYSRVDGRKSS-SYCSTAVIVVFVAFCLVGIWMFMSSSVVPLENSDLSSQETRNEA  59

Query  540  KTQVNE---SNESDTGXHESNNASDESNTSDG  626
            K  + E       DT    S +A+ E  T  G
Sbjct  60   KQTLQEGVSKQFDDTSGDISEDATREGGTMPG  91



>gb|KJB29129.1| hypothetical protein B456_005G086100 [Gossypium raimondii]
Length=686

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 63/92 (68%), Gaps = 4/92 (4%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+ KYSRVDGRK+S +YCST  I+VFVA CLVG+WM  SSSVVP++NS++SSQE++ + 
Sbjct  1    MAMAKYSRVDGRKSS-SYCSTAVIVVFVAFCLVGIWMFMSSSVVPLENSDLSSQETRNEA  59

Query  540  KTQVNE---SNESDTGXHESNNASDESNTSDG  626
            K  + E       DT    S +A+ E  T  G
Sbjct  60   KQTLQEGVSKQFDDTSGDISEDATREGGTMPG  91



>gb|KJB29130.1| hypothetical protein B456_005G086100 [Gossypium raimondii]
Length=858

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 63/92 (68%), Gaps = 4/92 (4%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+ KYSRVDGRK+S +YCST  I+VFVA CLVG+WM  SSSVVP++NS++SSQE++ + 
Sbjct  1    MAMAKYSRVDGRKSS-SYCSTAVIVVFVAFCLVGIWMFMSSSVVPLENSDLSSQETRNEA  59

Query  540  KTQVNE---SNESDTGXHESNNASDESNTSDG  626
            K  + E       DT    S +A+ E  T  G
Sbjct  60   KQTLQEGVSKQFDDTSGDISEDATREGGTMPG  91



>gb|KJB29128.1| hypothetical protein B456_005G086100 [Gossypium raimondii]
 gb|KJB29132.1| hypothetical protein B456_005G086100 [Gossypium raimondii]
Length=821

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 63/92 (68%), Gaps = 4/92 (4%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+ KYSRVDGRK+S +YCST  I+VFVA CLVG+WM  SSSVVP++NS++SSQE++ + 
Sbjct  1    MAMAKYSRVDGRKSS-SYCSTAVIVVFVAFCLVGIWMFMSSSVVPLENSDLSSQETRNEA  59

Query  540  KTQVNE---SNESDTGXHESNNASDESNTSDG  626
            K  + E       DT    S +A+ E  T  G
Sbjct  60   KQTLQEGVSKQFDDTSGDISEDATREGGTMPG  91



>gb|KHG21530.1| hypothetical protein F383_05601 [Gossypium arboreum]
Length=810

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 63/92 (68%), Gaps = 4/92 (4%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+ KYSRVDGRK+S +YCST  I+VFVA CLVG+WM  SSSVVP++NS++SSQE++ + 
Sbjct  1    MAMAKYSRVDGRKSS-SYCSTAVIVVFVAFCLVGIWMFMSSSVVPLENSDLSSQETRNEA  59

Query  540  KTQVNE---SNESDTGXHESNNASDESNTSDG  626
            K  + E       DT    S +A+ E  T  G
Sbjct  60   KQTLQEGVSKQFDDTSGDISEDATREGGTIPG  91



>dbj|BAC43570.1| putative ankyrin [Arabidopsis thaliana]
Length=202

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA  +Y+R+D R+ S NYCSTVT++VFVA+CLVG+WMMTSSSV P QN +  S ++K  +
Sbjct  1    MAQPRYTRIDNRRPSSNYCSTVTVVVFVALCLVGIWMMTSSSVGPAQNVDEVSLDNKDGI  60

Query  540  KTQV  551
            K Q+
Sbjct  61   KKQM  64



>ref|XP_003526869.1| PREDICTED: probable methyltransferase PMT26-like isoform X1 [Glycine 
max]
 ref|XP_006581774.1| PREDICTED: probable methyltransferase PMT26-like isoform X2 [Glycine 
max]
Length=806

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 56/63 (89%), Gaps = 2/63 (3%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKY+RVDGR++S ++CSTVT++VFVA+CLVGVWMMTSSSVVPV+N +  +QE+K  +
Sbjct  1    MALGKYARVDGRRSS-SWCSTVTVVVFVALCLVGVWMMTSSSVVPVRNGD-EAQENKNQV  58

Query  540  KTQ  548
            K Q
Sbjct  59   KEQ  61



>gb|KHN09623.1| Putative methyltransferase PMT26 [Glycine soja]
Length=806

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 56/63 (89%), Gaps = 2/63 (3%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKY+RVDGR++S ++CSTVT++VFVA+CLVGVWMMTSSSVVPV+N +  +QE+K  +
Sbjct  1    MALGKYARVDGRRSS-SWCSTVTVVVFVALCLVGVWMMTSSSVVPVRNGD-EAQENKNQV  58

Query  540  KTQ  548
            K Q
Sbjct  59   KEQ  61



>ref|XP_003523221.1| PREDICTED: probable methyltransferase PMT26-like isoform X1 [Glycine 
max]
 ref|XP_006578784.1| PREDICTED: probable methyltransferase PMT26-like isoform X2 [Glycine 
max]
 gb|KHN31166.1| Putative methyltransferase PMT26 [Glycine soja]
Length=810

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 65/88 (74%), Gaps = 3/88 (3%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKY+RVDGR++S ++CSTVT+++FVA+CLVGVWMMTSSSVVPV+N +  +QE+K  +
Sbjct  1    MALGKYARVDGRRSS-SWCSTVTVVMFVALCLVGVWMMTSSSVVPVRNGD-EAQENKNQV  58

Query  540  KTQVNESNESDTGXHESNNASDESNTSD  623
            K Q  E  E+ +    SN    E N  D
Sbjct  59   KEQA-EVKEAVSEVSNSNTRQFEDNPGD  85



>ref|XP_010546331.1| PREDICTED: probable methyltransferase PMT26 [Tarenaya hassleriana]
Length=838

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA G+YSR+D R++S +YCSTVT++VFVA+CLVG+WMMTSSSV PV+N +  S E+K  +
Sbjct  1    MAQGRYSRIDNRRSSSSYCSTVTVVVFVALCLVGIWMMTSSSVGPVENVDEVSLENKDGM  60

Query  540  KTQVN  554
            K Q+N
Sbjct  61   KKQLN  65



>gb|KJB48928.1| hypothetical protein B456_008G094300 [Gossypium raimondii]
Length=688

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 62/94 (66%), Gaps = 15/94 (16%)
 Frame = +3

Query  360  MALGKYSRVDG------RKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQ  521
            MALGKYSRVD       RK+S +YCSTVTI+VFV +CLVG+WM+TSSSVVPVQ    S++
Sbjct  1    MALGKYSRVDNNNNNNNRKSSSSYCSTVTIVVFVGLCLVGIWMLTSSSVVPVQTGNGSAE  60

Query  522  ESKTDLKTQVNESNESDTGXHESNNASDESNTSD  623
            E K  ++ QV       T     NN  D SNTSD
Sbjct  61   EKKNQVEDQV-------TPVSSDNN--DSSNTSD  85



>gb|KJB48927.1| hypothetical protein B456_008G094300 [Gossypium raimondii]
 gb|KJB48929.1| hypothetical protein B456_008G094300 [Gossypium raimondii]
 gb|KJB48930.1| hypothetical protein B456_008G094300 [Gossypium raimondii]
Length=813

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 63/94 (67%), Gaps = 15/94 (16%)
 Frame = +3

Query  360  MALGKYSRVDG------RKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQ  521
            MALGKYSRVD       RK+S +YCSTVTI+VFV +CLVG+WM+TSSSVVPVQ    S++
Sbjct  1    MALGKYSRVDNNNNNNNRKSSSSYCSTVTIVVFVGLCLVGIWMLTSSSVVPVQTGNGSAE  60

Query  522  ESKTDLKTQVNESNESDTGXHESNNASDESNTSD  623
            E K  ++ QV            S++ +D SNTSD
Sbjct  61   EKKNQVEDQVTPV---------SSDNNDSSNTSD  85



>ref|XP_006394213.1| hypothetical protein EUTSA_v10003654mg [Eutrema salsugineum]
 gb|ESQ31499.1| hypothetical protein EUTSA_v10003654mg [Eutrema salsugineum]
Length=831

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 58/85 (68%), Gaps = 0/85 (0%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA  +Y+R+D R+ S NYCSTVT++VFVA+CLVG+WMMTSSSV P QN +V S ++K  +
Sbjct  1    MAQPRYTRIDNRRPSSNYCSTVTVVVFVALCLVGIWMMTSSSVGPAQNVDVVSLDNKDGI  60

Query  540  KTQVNESNESDTGXHESNNASDESN  614
            K Q +   E   G    + +S+  N
Sbjct  61   KKQSSPPAEEGNGQKFEDASSETPN  85



>ref|XP_010521110.1| PREDICTED: probable methyltransferase PMT26 [Tarenaya hassleriana]
 ref|XP_010521118.1| PREDICTED: probable methyltransferase PMT26 [Tarenaya hassleriana]
Length=861

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 59/83 (71%), Gaps = 1/83 (1%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA G+YSR+D R+ S +YCSTVT++VFVA+CLVGVWMMTSSS  P QN +  S E+K  +
Sbjct  1    MAQGRYSRIDNRRPSSSYCSTVTVVVFVALCLVGVWMMTSSSDGPSQNVDEVSLENKDGM  60

Query  540  KTQVN-ESNESDTGXHESNNASD  605
            K Q+N  +++  +  +E  N  D
Sbjct  61   KKQLNPPADDGGSQPYEDKNGGD  83



>ref|XP_002864883.1| hypothetical protein ARALYDRAFT_496597 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41142.1| hypothetical protein ARALYDRAFT_496597 [Arabidopsis lyrata subsp. 
lyrata]
Length=821

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA  +Y+R+D R+ S NYCSTVT++VFVA+CLVG+WMMTSSSV P QN +  S ++K  +
Sbjct  1    MAQPRYTRIDNRRPSSNYCSTVTVVVFVALCLVGIWMMTSSSVGPAQNVDEVSLDNKDGI  60

Query  540  KTQVNESNESDTGXHESNNASDESN  614
            K Q+    E   G    + + D  N
Sbjct  61   KKQMTPPTEEGNGQKFEDASGDTPN  85



>gb|KHN34092.1| Putative methyltransferase PMT26 [Glycine soja]
Length=849

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 63/91 (69%), Gaps = 3/91 (3%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA  KY+R+D  K   +YCSTVTI+VFVA+CL G+WMMTSSSV PVQN +V SQE+ +++
Sbjct  1    MAQAKYTRIDNNKRPSSYCSTVTIVVFVALCLFGIWMMTSSSVTPVQNVDV-SQENNSEV  59

Query  540  KTQVNESNESDTGXHESNNA--SDESNTSDG  626
            K Q  + + +++   E N    S+++   DG
Sbjct  60   KEQATDPSNNNSQQFEDNRGDLSEDATKGDG  90



>ref|XP_006580338.1| PREDICTED: probable methyltransferase PMT26-like isoform X1 [Glycine 
max]
 ref|XP_006580339.1| PREDICTED: probable methyltransferase PMT26-like isoform X2 [Glycine 
max]
Length=831

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 63/91 (69%), Gaps = 3/91 (3%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA  KY+R+D  K   +YCSTVTI+VFVA+CL G+WMMTSSSV PVQN +V SQE+ +++
Sbjct  1    MAQAKYTRIDNNKRPSSYCSTVTIVVFVALCLFGIWMMTSSSVTPVQNVDV-SQENNSEV  59

Query  540  KTQVNESNESDTGXHESNNA--SDESNTSDG  626
            K Q  + + +++   E N    S+++   DG
Sbjct  60   KEQATDPSNNNSQQFEDNRGDLSEDATKGDG  90



>ref|XP_002307464.2| hypothetical protein POPTR_0005s20670g [Populus trichocarpa]
 gb|EEE94460.2| hypothetical protein POPTR_0005s20670g [Populus trichocarpa]
Length=826

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 62/92 (67%), Gaps = 6/92 (7%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+K+S NYCST+T++VFVA+CLVG WM  SSSV  VQNS+ SSQE   D+
Sbjct  1    MAMGKYSRVDGKKSS-NYCSTITVVVFVALCLVGAWMFMSSSVS-VQNSDSSSQEKVNDV  58

Query  540  KTQVNESN----ESDTGXHESNNASDESNTSD  623
            K    E+N    E   G    +   ++ NT D
Sbjct  59   KRVAGENNSKQFEDSPGDLPDDATKEDGNTVD  90



>ref|XP_010277710.1| PREDICTED: probable methyltransferase PMT24 [Nelumbo nucifera]
Length=866

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 67/101 (66%), Gaps = 14/101 (14%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA GK +RVD R++S  YCSTVT++ FVA+CLVGVWMM SS+VVPVQN ++SS E+  ++
Sbjct  1    MAFGKNARVDSRRSSSTYCSTVTLVAFVALCLVGVWMMASSNVVPVQNIDMSSSETNNEV  60

Query  540  KTQVNESN---ESDTG---------XHESNNASDESNTSDG  626
            K QV ES+   E   G          + +NN  DES T DG
Sbjct  61   K-QVTESSAQFEDSPGDLPEDSVKRDNSANNLQDESKT-DG  99



>ref|XP_006281931.1| hypothetical protein CARUB_v10028139mg [Capsella rubella]
 gb|EOA14829.1| hypothetical protein CARUB_v10028139mg [Capsella rubella]
Length=817

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 59/88 (67%), Gaps = 1/88 (1%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA  +Y+R+D R+ S NYCSTVT++VFVA+CLVG+WMMTSSSV P QN +  S ++K  +
Sbjct  1    MAQPRYTRIDNRRPSSNYCSTVTVVVFVALCLVGIWMMTSSSVGPAQNVDEVSLDNKDGI  60

Query  540  KTQVNESNESDTGXHESNNASDESNTSD  623
            K Q+    E   G  + + AS E+   D
Sbjct  61   KKQMTPPAEDGNG-QKFDGASGETPNED  87



>ref|XP_004503920.1| PREDICTED: probable methyltransferase PMT26-like isoform X1 [Cicer 
arietinum]
 ref|XP_004503921.1| PREDICTED: probable methyltransferase PMT26-like isoform X2 [Cicer 
arietinum]
Length=819

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 53/61 (87%), Gaps = 1/61 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA  KY+R+D +++  +YCSTVTI+VFVA+CLVG+WMMTSSSVVPVQN +  SQE+K+++
Sbjct  1    MAQAKYTRIDNKRSPSSYCSTVTIVVFVALCLVGLWMMTSSSVVPVQNVD-ESQETKSEV  59

Query  540  K  542
            K
Sbjct  60   K  60



>ref|XP_010270332.1| PREDICTED: probable methyltransferase PMT26 isoform X2 [Nelumbo 
nucifera]
Length=807

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 56/67 (84%), Gaps = 1/67 (1%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA GK +R D R++S +YCSTVTIIVFVA+CLVGVWMMTSSSVVPVQ  + SSQ++ T++
Sbjct  1    MAFGKNARADSRRSSSSYCSTVTIIVFVALCLVGVWMMTSSSVVPVQRVDTSSQDTNTEV  60

Query  540  KTQVNES  560
            K QV ES
Sbjct  61   K-QVTES  66



>ref|XP_010270331.1| PREDICTED: probable methyltransferase PMT26 isoform X1 [Nelumbo 
nucifera]
Length=808

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 56/67 (84%), Gaps = 1/67 (1%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA GK +R D R++S +YCSTVTIIVFVA+CLVGVWMMTSSSVVPVQ  + SSQ++ T++
Sbjct  1    MAFGKNARADSRRSSSSYCSTVTIIVFVALCLVGVWMMTSSSVVPVQRVDTSSQDTNTEV  60

Query  540  KTQVNES  560
            K QV ES
Sbjct  61   K-QVTES  66



>ref|XP_002520274.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF42060.1| ATP binding protein, putative [Ricinus communis]
Length=802

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 61/89 (69%), Gaps = 2/89 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDGRK+S +Y ST+ ++VFVA+CLVGVWM+ SS+V PVQNS   SQE+  ++
Sbjct  1    MAMGKYSRVDGRKSS-SYFSTIAVVVFVALCLVGVWMLMSSTVAPVQNSNSPSQETVNEV  59

Query  540  KTQVNESNESDTGXHESNNASDESNTSDG  626
            K Q    N S      S +  +++   DG
Sbjct  60   K-QTGSENTSKQFEDSSGDLPEDATKEDG  87



>emb|CDP04655.1| unnamed protein product [Coffea canephora]
Length=766

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 48/54 (89%), Gaps = 1/54 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQ  521
            MALGKYSRVDGRK+S NYCSTVTI+VFVA+CLVGVWMMTSSS   V NSE SS+
Sbjct  1    MALGKYSRVDGRKSSTNYCSTVTIVVFVALCLVGVWMMTSSSNKNV-NSESSSK  53



>ref|NP_201208.2| putative methyltransferase PMT26 [Arabidopsis thaliana]
 sp|Q8L7V3.1|PMTQ_ARATH RecName: Full=Probable methyltransferase PMT26 [Arabidopsis thaliana]
 gb|AAM78114.1| AT5g64030/MBM17_13 [Arabidopsis thaliana]
 gb|AAO23578.1| At5g64030/MBM17_13 [Arabidopsis thaliana]
 gb|AED97831.1| putative methyltransferase PMT26 [Arabidopsis thaliana]
Length=829

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA  +Y+R+D R+ S NYCSTVT++VFVA+CLVG+WMMTSSSV P QN +  S ++K  +
Sbjct  1    MAQPRYTRIDNRRPSSNYCSTVTVVVFVALCLVGIWMMTSSSVGPAQNVDEVSLDNKDGI  60

Query  540  KTQVNESNESDTG  578
            K Q+    E   G
Sbjct  61   KKQMTPPAEEGNG  73



>dbj|BAB10271.1| ankyrin-like protein [Arabidopsis thaliana]
Length=786

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA  +Y+R+D R+ S NYCSTVT++VFVA+CLVG+WMMTSSSV P QN +  S ++K  +
Sbjct  1    MAQPRYTRIDNRRPSSNYCSTVTVVVFVALCLVGIWMMTSSSVGPAQNVDEVSLDNKDGI  60

Query  540  KTQVNESNESDTG  578
            K Q+    E   G
Sbjct  61   KKQMTPPAEEGNG  73



>ref|XP_009355841.1| PREDICTED: probable methyltransferase PMT26 [Pyrus x bretschneideri]
 ref|XP_009355842.1| PREDICTED: probable methyltransferase PMT26 [Pyrus x bretschneideri]
Length=820

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 52/62 (84%), Gaps = 2/62 (3%)
 Frame = +3

Query  369  GKYSRVDGRKASPNY--CSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDLK  542
            GKY+RVD R+ S     CSTVT++VFVA+CLVGVWMMTSSSVVP+QN +V ++E+K++LK
Sbjct  5    GKYTRVDNRRPSSGSGCCSTVTVVVFVALCLVGVWMMTSSSVVPIQNVDVPTEENKSELK  64

Query  543  TQ  548
             Q
Sbjct  65   EQ  66



>ref|XP_011006302.1| PREDICTED: probable methyltransferase PMT24 isoform X1 [Populus 
euphratica]
Length=826

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 61/92 (66%), Gaps = 6/92 (7%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+KAS NYCST++++VFVA+CLVG WM  SSSV  VQNS+ SSQE   D+
Sbjct  1    MAMGKYSRVDGKKAS-NYCSTISVVVFVALCLVGAWMFMSSSVS-VQNSDSSSQEKVNDV  58

Query  540  KTQVNESN----ESDTGXHESNNASDESNTSD  623
                 E+N    E   G    +   ++ NT D
Sbjct  59   NRVAGENNSKQFEDSAGDLPDDAIKEDGNTVD  90



>ref|XP_011006303.1| PREDICTED: probable methyltransferase PMT24 isoform X2 [Populus 
euphratica]
Length=812

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 61/92 (66%), Gaps = 6/92 (7%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+KAS NYCST++++VFVA+CLVG WM  SSSV  VQNS+ SSQE   D+
Sbjct  1    MAMGKYSRVDGKKAS-NYCSTISVVVFVALCLVGAWMFMSSSVS-VQNSDSSSQEKVNDV  58

Query  540  KTQVNESN----ESDTGXHESNNASDESNTSD  623
                 E+N    E   G    +   ++ NT D
Sbjct  59   NRVAGENNSKQFEDSAGDLPDDAIKEDGNTVD  90



>gb|KHG22120.1| hypothetical protein F383_28461 [Gossypium arboreum]
Length=834

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 52/67 (78%), Gaps = 1/67 (1%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA GKYSRVDGRK+S +YCS  TI+VF+  CLVG+WM  SSS+VPV+NSE  S E+  ++
Sbjct  1    MATGKYSRVDGRKSS-SYCSIATIVVFLIFCLVGIWMFMSSSIVPVKNSEFLSMETGNEM  59

Query  540  KTQVNES  560
            K  +++S
Sbjct  60   KQTLSKS  66



>ref|XP_002300957.2| hypothetical protein POPTR_0002s07640g [Populus trichocarpa]
 gb|ABK94843.1| unknown [Populus trichocarpa]
 gb|EEE80230.2| hypothetical protein POPTR_0002s07640g [Populus trichocarpa]
Length=817

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 47/55 (85%), Gaps = 2/55 (4%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQE  524
            M +GKYSRVDGRK+S NYCST T++VFVA+CLVG WM  SSS VPVQNS+ SSQE
Sbjct  1    MPMGKYSRVDGRKSS-NYCSTTTVVVFVALCLVGAWMFISSS-VPVQNSDPSSQE  53



>ref|XP_006584650.1| PREDICTED: probable methyltransferase PMT26-like isoform X1 [Glycine 
max]
 ref|XP_006584651.1| PREDICTED: probable methyltransferase PMT26-like isoform X2 [Glycine 
max]
 ref|XP_006584652.1| PREDICTED: probable methyltransferase PMT26-like isoform X3 [Glycine 
max]
Length=842

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 60/89 (67%), Gaps = 3/89 (3%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPN-YCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTD  536
            MA  KY+R+D     P+ YCSTVTI+VFVA+CL G+WMMTSSSV PVQN +V SQE+  +
Sbjct  1    MAQAKYTRIDNNNKRPSSYCSTVTIVVFVALCLFGIWMMTSSSVTPVQNVDV-SQENNNE  59

Query  537  LKTQVNESNESDTGXHESNNASDESNTSD  623
            +K Q +E+ E  T    +N+   E N  D
Sbjct  60   VKEQ-SEAKEQPTDPSNNNSQQFEDNRGD  87



>ref|XP_008394173.1| PREDICTED: probable methyltransferase PMT26 isoform X1 [Malus 
domestica]
 ref|XP_008394174.1| PREDICTED: probable methyltransferase PMT26 isoform X1 [Malus 
domestica]
Length=820

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 2/62 (3%)
 Frame = +3

Query  369  GKYSRVDGRKASP--NYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDLK  542
            GKY+RVD R+ S     CSTVT+ VFVA+CLVGVWMMTSSSVVP+QN +V ++ESK++LK
Sbjct  5    GKYTRVDNRRPSSASGCCSTVTVGVFVALCLVGVWMMTSSSVVPIQNVDVPTEESKSELK  64

Query  543  TQ  548
             Q
Sbjct  65   EQ  66



>ref|XP_010444329.1| PREDICTED: probable methyltransferase PMT26 [Camelina sativa]
Length=822

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 62/90 (69%), Gaps = 3/90 (3%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA  +Y+R+D R+ S NYCSTVT++VFVA+CLVG+WMMTSSSV P Q+ E  S ++K  +
Sbjct  1    MAQPRYTRIDNRRPSSNYCSTVTVVVFVALCLVGIWMMTSSSVGPAQSVEEVSLDNKDVI  60

Query  540  KTQVN--ESNESDTGXHESNNASDESNTSD  623
            K Q+    + E + G  +S +AS E+   D
Sbjct  61   KKQMTPPPAEEGNNG-QKSEDASGETPNED  89



>ref|XP_008394175.1| PREDICTED: probable methyltransferase PMT26 isoform X2 [Malus 
domestica]
Length=807

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 2/62 (3%)
 Frame = +3

Query  369  GKYSRVDGRKASP--NYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDLK  542
            GKY+RVD R+ S     CSTVT+ VFVA+CLVGVWMMTSSSVVP+QN +V ++ESK++LK
Sbjct  5    GKYTRVDNRRPSSASGCCSTVTVGVFVALCLVGVWMMTSSSVVPIQNVDVPTEESKSELK  64

Query  543  TQ  548
             Q
Sbjct  65   EQ  66



>ref|XP_010484172.1| PREDICTED: probable methyltransferase PMT26 [Camelina sativa]
 ref|XP_010484174.1| PREDICTED: probable methyltransferase PMT26 [Camelina sativa]
Length=821

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 62/90 (69%), Gaps = 3/90 (3%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA  +Y+R+D R+ S NYCSTVT++VFVA+CLVG+WMMTSSSV P Q+ +  S ++K  +
Sbjct  1    MAQPRYTRIDNRRPSSNYCSTVTVVVFVALCLVGIWMMTSSSVGPAQSFDEVSLDNKDGI  60

Query  540  KTQVN--ESNESDTGXHESNNASDESNTSD  623
            K Q+    + E + G  +S +AS E+   D
Sbjct  61   KKQMTPPPAEEGNNG-QKSEDASGETPNED  89



>ref|XP_010461320.1| PREDICTED: probable methyltransferase PMT26 [Camelina sativa]
Length=819

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 61/90 (68%), Gaps = 2/90 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA  +Y+R+D R+ S NYCSTVT++VFVA+CLVG+WMMTSSSV P Q+ +  S ++K  +
Sbjct  1    MAQPRYTRIDNRRPSSNYCSTVTVVVFVALCLVGIWMMTSSSVGPAQSVDEVSLDNKDGI  60

Query  540  KTQVNESNESDTGX--HESNNASDESNTSD  623
            K Q+     ++ G    +S ++S E+   D
Sbjct  61   KKQMTPPPPAEEGNNGQKSEDSSGETPNED  90



>gb|KJB59346.1| hypothetical protein B456_009G250600 [Gossypium raimondii]
 gb|KJB59347.1| hypothetical protein B456_009G250600 [Gossypium raimondii]
Length=833

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 52/68 (76%), Gaps = 1/68 (1%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA GKYSRVDGRK+S +YCS  TI+VFV  CLVG+WM  SSS+VPV+NSE  S E+  ++
Sbjct  1    MATGKYSRVDGRKSS-SYCSLATIVVFVIFCLVGIWMFMSSSIVPVKNSEFLSVETGNEV  59

Query  540  KTQVNESN  563
            K  ++ S+
Sbjct  60   KQTLSRSD  67



>gb|KJB40479.1| hypothetical protein B456_007G066000 [Gossypium raimondii]
Length=899

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 58/87 (67%), Gaps = 5/87 (6%)
 Frame = +3

Query  360  MALGKYSRVDGRK-ASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTD  536
            MALG+Y+RVD     S +YCSTVTI++F+ +CLVG+WM+TSS VVPVQN +  ++E K  
Sbjct  1    MALGRYNRVDNNNNKSSSYCSTVTIVIFMGLCLVGIWMITSSWVVPVQNGDDPAEEKKNQ  60

Query  537  LKTQVN----ESNESDTGXHESNNASD  605
            LK QV     +SN+ D      +  +D
Sbjct  61   LKDQVETVIVDSNDRDNKPQFEDKPND  87



>gb|KHG04009.1| hypothetical protein F383_29196 [Gossypium arboreum]
Length=770

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 58/87 (67%), Gaps = 5/87 (6%)
 Frame = +3

Query  360  MALGKYSRVDGRK-ASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTD  536
            MALG+Y+RVD     S +YCSTVTI++F+ +CLVG+WM+TSS VVPVQN +  ++E K  
Sbjct  1    MALGRYNRVDNNNNKSSSYCSTVTIVIFMGLCLVGIWMITSSWVVPVQNGDDPAEEKKNQ  60

Query  537  LKTQVN----ESNESDTGXHESNNASD  605
            LK QV     +SN+ D      +  +D
Sbjct  61   LKDQVETVIVDSNDRDNKPQFEDKRND  87



>gb|KDP39437.1| hypothetical protein JCGZ_03719 [Jatropha curcas]
Length=850

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA GKY+R+D R+   NYC+TVT++VFVA+C VGVWMMTSSS+VP Q+ +V +QE+  ++
Sbjct  1    MATGKYTRIDARRQPTNYCTTVTVVVFVALCFVGVWMMTSSSIVPGQSVDVPAQENNNEV  60

Query  540  KTQVNESNESDTGXHE  587
            K QV ES ES+T   E
Sbjct  61   KEQVTESKESNTKQFE  76



>ref|XP_010674444.1| PREDICTED: probable methyltransferase PMT26 [Beta vulgaris subsp. 
vulgaris]
Length=811

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 54/65 (83%), Gaps = 2/65 (3%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMT-SSSVVPVQNSEVSSQESKTD  536
            MALG+Y+RVDG+K+S NYCSTVT++VFVA+CLVGVWMMT SSS  P Q+ ++  ++ KT+
Sbjct  1    MALGRYTRVDGKKSS-NYCSTVTVVVFVALCLVGVWMMTSSSSDSPPQDIDLPQEKQKTE  59

Query  537  LKTQV  551
            +K  V
Sbjct  60   VKPDV  64



>gb|KHG06416.1| hypothetical protein F383_32222 [Gossypium arboreum]
Length=820

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 58/92 (63%), Gaps = 13/92 (14%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPN----YCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQES  527
            MALGKYSRVD    +      YCSTVTI+VFV +CLVG+WM+TSSSVVPV+    S++E 
Sbjct  1    MALGKYSRVDNNNNNRKSSSSYCSTVTIVVFVGLCLVGIWMLTSSSVVPVETGNGSAEEK  60

Query  528  KTDLKTQVNESNESDTGXHESNNASDESNTSD  623
            K  ++ QV       T     NN  D SNTSD
Sbjct  61   KNQVEDQV-------TPVTSDNN--DSSNTSD  83



>ref|XP_008371671.1| PREDICTED: probable methyltransferase PMT26 [Malus domestica]
Length=502

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 51/64 (80%), Gaps = 2/64 (3%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDGRK+S N CST +++VFVA CL+GVWM+  S+VVP+QN   SS+E+  ++
Sbjct  1    MAVGKYSRVDGRKSS-NCCSTTSLVVFVAFCLIGVWMLM-STVVPIQNQGSSSEETMDEV  58

Query  540  KTQV  551
              QV
Sbjct  59   NRQV  62



>ref|XP_008345949.1| PREDICTED: probable methyltransferase PMT26 [Malus domestica]
Length=497

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 51/64 (80%), Gaps = 2/64 (3%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDGRK+S N CST +++VFVA CL+GVWM+  S+VVP+QN   SS+E+  ++
Sbjct  1    MAVGKYSRVDGRKSS-NCCSTTSLVVFVAFCLIGVWMLM-STVVPIQNQGSSSEETMDEV  58

Query  540  KTQV  551
              QV
Sbjct  59   NRQV  62



>gb|AAP72961.1| putative ankyrin-like protein [Lactuca sativa]
Length=721

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 59/106 (56%), Gaps = 22/106 (21%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA GKYSRVDG+K+S   CST TI+V   VCL+GVWM  S+SV P QN ++ +Q SKT+ 
Sbjct  1    MAQGKYSRVDGKKSS---CSTATIVVVFGVCLIGVWMFMSTSVAPGQNQDLPAQHSKTES  57

Query  540  KTQV-------------------NESNESDTGXHESNNASDESNTS  620
            K +V                     SNE +    E+ N +DE  TS
Sbjct  58   KAKVSTNPSPLFEDNSGDLPEDEKTSNEEEPSKIEAENTNDEEPTS  103



>ref|XP_009150474.1| PREDICTED: probable methyltransferase PMT26 [Brassica rapa]
Length=975

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA  +Y+R+D R+ S NYCSTVT++VFVA+CLVG+WMMTSS V P QN +  S ++   +
Sbjct  1    MAQVRYTRLDNRRPSSNYCSTVTVVVFVALCLVGIWMMTSSYVGPAQNVDEVSLDTNDGI  60

Query  540  KTQVNESNE  566
            K Q+    E
Sbjct  61   KKQMTPPAE  69



>emb|CDY39830.1| BnaC02g42880D [Brassica napus]
Length=772

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 53/74 (72%), Gaps = 1/74 (1%)
 Frame = +3

Query  360  MALGKYSRVDG-RKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTD  536
            MA  +Y+R+D  R+ S +YCSTVTI+VFVA+CLVG+WMMTSSS+ P Q+ +V   ++K  
Sbjct  1    MAQPRYTRIDNTRRPSSSYCSTVTIVVFVALCLVGIWMMTSSSLGPDQSVDVVPLDNKDG  60

Query  537  LKTQVNESNESDTG  578
            +K Q+    E D G
Sbjct  61   IKNQMTPPAEEDRG  74



>ref|XP_003630288.1| Ankyrin-like protein [Medicago truncatula]
 gb|AET04764.1| methyltransferase PMT26-like protein, putative [Medicago truncatula]
Length=826

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 51/74 (69%), Gaps = 7/74 (9%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQN------SEVSSQ  521
            MA  +YSR+D +++  +YCSTVTI+VFVA+CLVG+WMMT SSVVPVQN      +EV  Q
Sbjct  1    MAQARYSRIDNKRSPSSYCSTVTIVVFVALCLVGLWMMT-SSVVPVQNVDESTKNEVKGQ  59

Query  522  ESKTDLKTQVNESN  563
                D  T +  SN
Sbjct  60   SEAKDQATDITNSN  73



>ref|XP_009360657.1| PREDICTED: probable methyltransferase PMT24 [Pyrus x bretschneideri]
Length=805

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 50/64 (78%), Gaps = 2/64 (3%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDGRK+S N CS  +++VFVA CL+GVWM+  S+VVP+QN   SS+E+  D+
Sbjct  1    MAVGKYSRVDGRKSS-NCCSKTSLVVFVAFCLIGVWMLM-STVVPIQNQGSSSEETMDDV  58

Query  540  KTQV  551
              QV
Sbjct  59   NRQV  62



>ref|XP_008244575.1| PREDICTED: probable methyltransferase PMT24 [Prunus mume]
Length=815

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 51/63 (81%), Gaps = 2/63 (3%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDGR+ S N CST +++VFVA CLVGVWM+  S+VVP+QN + SS+E+  ++
Sbjct  1    MAVGKYSRVDGRR-SLNCCSTTSLVVFVAFCLVGVWMLM-STVVPIQNQDSSSEETVNEV  58

Query  540  KTQ  548
            K Q
Sbjct  59   KRQ  61



>ref|XP_007159858.1| hypothetical protein PHAVU_002G273700g [Phaseolus vulgaris]
 gb|ESW31852.1| hypothetical protein PHAVU_002G273700g [Phaseolus vulgaris]
Length=832

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 60/88 (68%), Gaps = 6/88 (7%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPN-YCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTD  536
            MA  KYSR+D  K S + Y STVTI+VFVA+CL G+WMMTSSSVVPVQN +V SQ++K +
Sbjct  1    MAQAKYSRIDNNKRSASSYFSTVTIVVFVALCLFGIWMMTSSSVVPVQNVDV-SQDNKNE  59

Query  537  LKTQVNESNESDTGXHESNNASDESNTS  620
            ++ Q     +S+        A+D SN S
Sbjct  60   VQDQSGVIEQSEG----KKQATDPSNKS  83



>ref|XP_007199628.1| hypothetical protein PRUPE_ppa001750mg [Prunus persica]
 gb|EMJ00827.1| hypothetical protein PRUPE_ppa001750mg [Prunus persica]
Length=771

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 53/70 (76%), Gaps = 2/70 (3%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDGR+ S N CST +++VFVA CLVGVWM+  S+VVP+QN + SS+E+  ++
Sbjct  1    MAVGKYSRVDGRR-SLNCCSTTSLVVFVAFCLVGVWMLM-STVVPIQNQDSSSEETVNEV  58

Query  540  KTQVNESNES  569
            K Q     +S
Sbjct  59   KWQTTTDKDS  68



>emb|CDX84478.1| BnaC03g50220D [Brassica napus]
Length=840

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 50/73 (68%), Gaps = 2/73 (3%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQN--SEVSSQESKT  533
            MA  +Y+R+D R+ S NYCSTVT++VFVA+CLVG+WMMTSS V P QN   E + Q+S+ 
Sbjct  1    MAQVRYTRLDNRRPSSNYCSTVTVVVFVALCLVGIWMMTSSYVGPAQNVDEEGNVQKSED  60

Query  534  DLKTQVNESNESD  572
                  NE  + D
Sbjct  61   SAGETPNEEKKGD  73



>ref|XP_009366818.1| PREDICTED: probable methyltransferase PMT24 [Pyrus x bretschneideri]
 ref|XP_009366819.1| PREDICTED: probable methyltransferase PMT24 [Pyrus x bretschneideri]
Length=805

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 50/63 (79%), Gaps = 2/63 (3%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDGRK S N CST +++VFVA CL+GVWM+  S+VVP+QN   SS+E+  ++
Sbjct  1    MAVGKYSRVDGRK-SWNCCSTTSLVVFVAFCLIGVWMLM-STVVPIQNQGSSSEETVDEV  58

Query  540  KTQ  548
            K Q
Sbjct  59   KRQ  61



>ref|XP_009130433.1| PREDICTED: probable methyltransferase PMT26 [Brassica rapa]
 ref|XP_009130434.1| PREDICTED: probable methyltransferase PMT26 [Brassica rapa]
Length=764

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 61/91 (67%), Gaps = 3/91 (3%)
 Frame = +3

Query  360  MALGKYSRVDG-RKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTD  536
            MA  +Y+R+D  R+ + +YCSTVTI+VFVA+CLVG+WMMTSSS+ P Q+ +V   ++K  
Sbjct  1    MAQPRYTRIDNTRRPASSYCSTVTIVVFVALCLVGIWMMTSSSLGPDQSVDVVPLDNKDG  60

Query  537  LKTQVNESNES--DTGXHESNNASDESNTSD  623
            +K Q+    ++  +T   E     DES++ +
Sbjct  61   IKNQMTPPEDAAGETPKEEKKGDGDESSSKE  91



>emb|CDY31339.1| BnaA02g34020D [Brassica napus]
Length=764

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 60/91 (66%), Gaps = 3/91 (3%)
 Frame = +3

Query  360  MALGKYSRVDG-RKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTD  536
            MA  +Y+R+D  R+ + +YCSTVTI+VFVA+CLVG+WMMTSSS+ P Q+ +V   ++K  
Sbjct  1    MAQPRYTRIDNTRRPASSYCSTVTIVVFVALCLVGIWMMTSSSLGPDQSVDVVPLDNKDG  60

Query  537  LKTQVN--ESNESDTGXHESNNASDESNTSD  623
            +K Q+   E    +T   E     DES++ +
Sbjct  61   IKNQMTPPEDAAGETPKEEKKGDGDESSSKE  91



>ref|XP_009410679.1| PREDICTED: probable methyltransferase PMT26 [Musa acuminata subsp. 
malaccensis]
Length=797

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 50/67 (75%), Gaps = 3/67 (4%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA G+ SR D R+ S +YCST+T++VFVA+CLVG WMMTSS++ P   +EV S  +K+D+
Sbjct  1    MAFGRSSRTDTRRTSSSYCSTMTLVVFVALCLVGAWMMTSSAMAP---AEVPSSATKSDM  57

Query  540  KTQVNES  560
              +V+ +
Sbjct  58   SDKVSRT  64



>ref|XP_009414612.1| PREDICTED: probable methyltransferase PMT24 [Musa acuminata subsp. 
malaccensis]
Length=817

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 63/89 (71%), Gaps = 7/89 (8%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA G+ SR+DGR  S + CST TI+VFVA+CLVGVWMMTSS+V+PV   E++  +S+T+ 
Sbjct  1    MAFGRSSRLDGRGTS-SLCSTTTIVVFVALCLVGVWMMTSSTVIPV---EMADTQSETND  56

Query  540  KTQVNESNESDTGXHESNNASDESNTSDG  626
            K   ++S   +   + S + +++S +SDG
Sbjct  57   KVAKSDSRSFE---NRSGDVTNDSTSSDG  82



>ref|XP_009383568.1| PREDICTED: probable methyltransferase PMT26 [Musa acuminata subsp. 
malaccensis]
Length=883

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 58/77 (75%), Gaps = 8/77 (10%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSS-VVPVQNSEVSSQESKTD  536
            MA  + + +D R++S ++CSTVT++ F+A+CLVGVWMMTSSS VVP+   ++SS ESK+D
Sbjct  1    MAFRRSAMMDARRSS-SHCSTVTLVAFIALCLVGVWMMTSSSTVVPI---DMSSPESKSD  56

Query  537  LKTQVNESNESDTGXHE  587
            +K QV   +E+D G  E
Sbjct  57   MKQQV---SETDRGPRE  70



>ref|XP_010469377.1| PREDICTED: probable methyltransferase PMT25 [Camelina sativa]
Length=779

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 1/85 (1%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+K+S +Y  TVTI++ +++CLVG WM TSS   P  + + SS E+  D+
Sbjct  1    MAMGKYSRVDGKKSS-SYGLTVTIVLVISLCLVGAWMFTSSWSAPADSVDYSSSETAKDV  59

Query  540  KTQVNESNESDTGXHESNNASDESN  614
            +       + + G  +  N SDE N
Sbjct  60   EPVTKNDLKKEEGDRDQKNFSDEKN  84



>gb|KJB71369.1| hypothetical protein B456_011G118900 [Gossypium raimondii]
Length=1015

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 50/71 (70%), Gaps = 7/71 (10%)
 Frame = +3

Query  360  MALGKYSRVD-------GRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSS  518
            MALGKY RVD        R +S +Y STVTI+VFV +CLVG+WMMTSSSV+P QN +  +
Sbjct  1    MALGKYGRVDYNNNANGRRSSSSSYGSTVTIVVFVGLCLVGIWMMTSSSVIPDQNVDDVA  60

Query  519  QESKTDLKTQV  551
             E KTDL  QV
Sbjct  61   HEKKTDLDDQV  71



>ref|XP_004289881.1| PREDICTED: probable methyltransferase PMT24 [Fragaria vesca subsp. 
vesca]
Length=797

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 59/85 (69%), Gaps = 5/85 (6%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+K S N CST +++VFVA CLVGVWM+ SS+ VP+Q   +S++E+  D 
Sbjct  1    MAMGKYSRVDGKK-SLNCCSTTSLVVFVAFCLVGVWMLMSSA-VPIQTQSLSTEENLADK  58

Query  540  KTQVNESNE---SDTGXHESNNASD  605
             ++  E +    S++   E +N SD
Sbjct  59   SSKQYEDSSGGLSESVTIEDDNGSD  83



>ref|XP_010509773.1| PREDICTED: probable methyltransferase PMT25 [Camelina sativa]
Length=771

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 52/85 (61%), Gaps = 1/85 (1%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+K+S +Y  TVTI++ + +CLVG WM TSS   P  + + SS ++  D+
Sbjct  1    MAMGKYSRVDGKKSS-SYGLTVTIVLVIFLCLVGAWMFTSSWSAPADSVDYSSSDTAKDV  59

Query  540  KTQVNESNESDTGXHESNNASDESN  614
            +         D G  +  N SDE N
Sbjct  60   EPVTKNDLRKDEGDRDQKNFSDEKN  84



>gb|KHG15143.1| hypothetical protein F383_09666 [Gossypium arboreum]
Length=891

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 50/71 (70%), Gaps = 7/71 (10%)
 Frame = +3

Query  360  MALGKYSRVD-------GRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSS  518
            MALGKY RVD        R +S +Y STVTI+VFV +CLVG+WMMTSSSV+P QN +  +
Sbjct  1    MALGKYGRVDYNNNANGRRSSSSSYGSTVTIVVFVGLCLVGIWMMTSSSVIPDQNVDDVA  60

Query  519  QESKTDLKTQV  551
             E KTDL  QV
Sbjct  61   HEKKTDLDDQV  71



>ref|XP_006578949.1| PREDICTED: probable methyltransferase PMT26-like isoform X1 [Glycine 
max]
 ref|XP_006578950.1| PREDICTED: probable methyltransferase PMT26-like isoform X2 [Glycine 
max]
Length=834

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 61/90 (68%), Gaps = 7/90 (8%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNS--EVSSQESKT  533
            MALGK SR +GRK S NYCSTV++ VFVA CLVGVW++  SS+VP+QNS  +VS  ++  
Sbjct  1    MALGKNSRGEGRKLS-NYCSTVSVAVFVAFCLVGVWIVM-SSIVPIQNSVIQVSETDTIN  58

Query  534  DLKTQVNESNESDTGXHESNNASDESNTSD  623
            D+K   N +++S      S + S+ES   D
Sbjct  59   DVK---NVASDSKQFEDRSGDISEESTQGD  85



>ref|XP_010501645.1| PREDICTED: probable methyltransferase PMT24, partial [Camelina 
sativa]
Length=721

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 52/85 (61%), Gaps = 1/85 (1%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+K+S  Y  T+TI++ V++CLVG WM  SS   P ++ + SS E+  D+
Sbjct  1    MAMGKYSRVDGKKSS-GYGLTITIVLIVSLCLVGAWMFMSSWSAPTESIDFSSSETSKDV  59

Query  540  KTQVNESNESDTGXHESNNASDESN  614
            +T      +SD     S    DE N
Sbjct  60   ETTTKSDFKSDEVDRGSKTFPDEKN  84



>ref|XP_006410572.1| hypothetical protein EUTSA_v10016285mg [Eutrema salsugineum]
 ref|XP_006410573.1| hypothetical protein EUTSA_v10016285mg [Eutrema salsugineum]
 gb|ESQ52025.1| hypothetical protein EUTSA_v10016285mg [Eutrema salsugineum]
 gb|ESQ52026.1| hypothetical protein EUTSA_v10016285mg [Eutrema salsugineum]
Length=771

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+K+S +Y  T+TI++ V++CLVG WM  SS   P  ++  SS ++  D+
Sbjct  1    MAMGKYSRVDGKKSS-SYGLTITIVLVVSLCLVGAWMFMSSWSAPADSAVYSSSDTGKDV  59

Query  540  KTQVNESNESDTGXHESNNASDESNTS  620
            +         + G  E  N SDE N +
Sbjct  60   EPATKNEVSKEEGDQEPKNFSDEKNEA  86



>ref|XP_010460728.1| PREDICTED: probable methyltransferase PMT24 [Camelina sativa]
 ref|XP_010460729.1| PREDICTED: probable methyltransferase PMT24 [Camelina sativa]
Length=764

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 51/85 (60%), Gaps = 1/85 (1%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+K+S  Y  T+TI++ V +CLVG WM  SS   P ++ + SS E+  D+
Sbjct  1    MAMGKYSRVDGKKSS-GYGLTITIVLIVTLCLVGAWMFMSSWSAPTESIDFSSSETSKDV  59

Query  540  KTQVNESNESDTGXHESNNASDESN  614
            +T      +SD     S    DE N
Sbjct  60   ETTTKSDFKSDEVDRGSKTFPDEKN  84



>ref|XP_010413759.1| PREDICTED: probable methyltransferase PMT25 [Camelina sativa]
Length=779

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 53/85 (62%), Gaps = 1/85 (1%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+K+S +Y  TVTI++ +++CLVG WM TSS   P  + + SS +   D+
Sbjct  1    MAMGKYSRVDGKKSS-SYGLTVTIVLVISLCLVGAWMFTSSWSAPADSVDYSSSDIAKDV  59

Query  540  KTQVNESNESDTGXHESNNASDESN  614
            +       + + G  +  N SDE N
Sbjct  60   EPVTKNDLKKEEGDRDQKNFSDEKN  84



>ref|XP_007137499.1| hypothetical protein PHAVU_009G132000g [Phaseolus vulgaris]
 gb|ESW09493.1| hypothetical protein PHAVU_009G132000g [Phaseolus vulgaris]
Length=833

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 57/89 (64%), Gaps = 7/89 (8%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            M LGK SR +GRK S NYCSTV+I VFVA CLVGVW++  S++VP+QNS +   E+  D+
Sbjct  1    MVLGKNSRGEGRKLS-NYCSTVSIAVFVAFCLVGVWIVM-STIVPIQNSVIPVSETLNDV  58

Query  540  KTQVNESNESDTGXHESNNASDESNTSDG  626
            K     + +SDT   E  +      +++G
Sbjct  59   K-----NVQSDTKQFEERSGDIPEESTEG  82



>gb|EPS72711.1| hypothetical protein M569_02048, partial [Genlisea aurea]
Length=80

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +3

Query  369  GKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDLKTQ  548
            G +SRVDGRK+S NYCSTVT+ VFVAVCLVGVW+ TSSSV P Q  +  S E K D+KT 
Sbjct  1    GNFSRVDGRKSSSNYCSTVTVTVFVAVCLVGVWVFTSSSVTPFQTLD-GSDEPKNDVKTS  59

Query  549  VNESN  563
            V   N
Sbjct  60   VTGDN  64



>ref|XP_010930722.1| PREDICTED: probable methyltransferase PMT26 [Elaeis guineensis]
Length=887

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 47/63 (75%), Gaps = 3/63 (5%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQE--SKT  533
            MA G+  R D R++S + CST T+IVFVA+CLVGVWMMTSS+VVPV  S   S++  S+T
Sbjct  1    MAFGRSPRTDNRRSS-SQCSTATLIVFVALCLVGVWMMTSSTVVPVDMSSSGSKQQVSQT  59

Query  534  DLK  542
            D K
Sbjct  60   DSK  62



>ref|XP_010112029.1| putative methyltransferase PMT24 [Morus notabilis]
 gb|EXC32448.1| putative methyltransferase PMT24 [Morus notabilis]
Length=739

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 59/89 (66%), Gaps = 2/89 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGKY+RV+GRK+S N CST++++VFVA CLVG+W+  SS+V      EV S ++  + 
Sbjct  1    MALGKYTRVEGRKSS-NCCSTISVVVFVAFCLVGIWVFMSSTVPDEDQEEVPSLDNTVND  59

Query  540  KTQVNESNESDTGXHESNNASDESNTSDG  626
             T+ +   + +    E + + DES TS+G
Sbjct  60   VTKQHVVADDNPKQFE-DTSGDESQTSEG  87



>dbj|BAH19463.1| AT1G29470 [Arabidopsis thaliana]
Length=154

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+K+S  Y  T+TI++ V++CLVG WM  SS   P ++ + S+ E   D+
Sbjct  1    MAMGKYSRVDGKKSS-GYGLTITIVLIVSLCLVGAWMFMSSWSAPTESIDFSANERTKDV  59

Query  540  KT  545
             T
Sbjct  60   DT  61



>ref|XP_010478312.1| PREDICTED: probable methyltransferase PMT24 isoform X1 [Camelina 
sativa]
 ref|XP_010478313.1| PREDICTED: probable methyltransferase PMT24 isoform X2 [Camelina 
sativa]
 ref|XP_010478314.1| PREDICTED: probable methyltransferase PMT24 isoform X3 [Camelina 
sativa]
Length=769

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 54/85 (64%), Gaps = 1/85 (1%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+G+YSRVDG+K+S  Y  T+TI++ V++CLVG WM  SS   P ++ + SS E+  D+
Sbjct  1    MAMGRYSRVDGKKSS-GYGLTITIVLIVSLCLVGAWMFMSSWSAPTESIDFSSSETSKDV  59

Query  540  KTQVNESNESDTGXHESNNASDESN  614
            +T      +S+     S + SDE N
Sbjct  60   ETTTKSDFKSEEVDRGSKSFSDEKN  84



>ref|XP_008781596.1| PREDICTED: probable methyltransferase PMT26 [Phoenix dactylifera]
Length=886

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 47/63 (75%), Gaps = 3/63 (5%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQE--SKT  533
            MA G+  R+D R+ S + CST T++VFVA+CLVGVWMMTSS+VVPV  S   S++  S+T
Sbjct  1    MAFGRSPRMDNRRPS-SQCSTATLVVFVALCLVGVWMMTSSTVVPVDMSSSGSKQRVSQT  59

Query  534  DLK  542
            D K
Sbjct  60   DSK  62



>ref|XP_008783335.1| PREDICTED: probable methyltransferase PMT26 [Phoenix dactylifera]
Length=807

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 51/68 (75%), Gaps = 3/68 (4%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA GK SR D R+ S ++CST TI+VFVA+CLVGVWMMTSS+V PV   E+S   SK+D 
Sbjct  1    MAFGKSSRADARRTSSSFCSTTTIVVFVALCLVGVWMMTSSTVTPV---EMSPPSSKSDA  57

Query  540  KTQVNESN  563
            K QV E++
Sbjct  58   KDQVPETD  65



>emb|CDY43782.1| BnaA06g23180D [Brassica napus]
Length=799

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSS  482
            MA  +Y+R+D R+ S NYCSTVT++VFVA+CLVG+WMMTSS
Sbjct  1    MAQVRYTRLDNRRPSSNYCSTVTVVVFVALCLVGIWMMTSS  41



>ref|XP_002893569.1| hypothetical protein ARALYDRAFT_473159 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69828.1| hypothetical protein ARALYDRAFT_473159 [Arabidopsis lyrata subsp. 
lyrata]
Length=771

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 52/85 (61%), Gaps = 1/85 (1%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+K+S  Y  T+TI++ V++CLVG WM  SS   P ++ + S+ E   D+
Sbjct  1    MAMGKYSRVDGKKSS-GYGLTITIVLIVSLCLVGAWMFMSSWSAPTESIDFSANERTKDV  59

Query  540  KTQVNESNESDTGXHESNNASDESN  614
             T      +S+     S + SDE N
Sbjct  60   DTTTKSDFKSEEVDRGSKSFSDEKN  84



>ref|XP_006415572.1| hypothetical protein EUTSA_v10006884mg [Eutrema salsugineum]
 gb|ESQ33925.1| hypothetical protein EUTSA_v10006884mg [Eutrema salsugineum]
Length=761

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+K+S  Y  T+TI++FV++CLVG WM  SS   P ++ + S+ E+  D+
Sbjct  1    MAMGKYSRVDGKKSS-GYGLTITIVLFVSLCLVGAWMFMSSWSAPTESVDFSATETTKDV  59

Query  540  KT  545
            +T
Sbjct  60   ET  61



>ref|XP_006303155.1| hypothetical protein CARUB_v10008372mg [Capsella rubella]
 ref|XP_006303156.1| hypothetical protein CARUB_v10008372mg [Capsella rubella]
 gb|EOA36053.1| hypothetical protein CARUB_v10008372mg [Capsella rubella]
 gb|EOA36054.1| hypothetical protein CARUB_v10008372mg [Capsella rubella]
Length=767

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 52/85 (61%), Gaps = 1/85 (1%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+K+S  Y  T+TI++ V++CLVG WM  SS   P ++ + S+ E+  D+
Sbjct  1    MAMGKYSRVDGKKSS-GYGLTITIVLIVSLCLVGAWMFMSSWSAPTESIDFSASETSKDV  59

Query  540  KTQVNESNESDTGXHESNNASDESN  614
            +T      +S+     S    DE N
Sbjct  60   ETSTKSDFKSEEVDRGSKTFPDEKN  84



>ref|XP_010911089.1| PREDICTED: probable methyltransferase PMT26 [Elaeis guineensis]
 ref|XP_010911096.1| PREDICTED: probable methyltransferase PMT26 [Elaeis guineensis]
Length=799

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 51/68 (75%), Gaps = 3/68 (4%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA GK SR D R+ S ++CST TI+VFVA+CLVGVWMMTSS+V PV   ++S   SK+D 
Sbjct  1    MAFGKSSRADARRTSSSFCSTTTIVVFVALCLVGVWMMTSSTVTPV---DMSPPSSKSDA  57

Query  540  KTQVNESN  563
            K QV E++
Sbjct  58   KDQVPETD  65



>ref|XP_006847154.1| hypothetical protein AMTR_s00017p00240980 [Amborella trichopoda]
 gb|ERN08735.1| hypothetical protein AMTR_s00017p00240980 [Amborella trichopoda]
Length=850

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 57/95 (60%), Gaps = 6/95 (6%)
 Frame = +3

Query  360  MALGKYSR--VDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKT  533
            MALGK  R  VD R +S +YCSTVT++VFV +CLVGVWMMTSS+V PVQ   +S  + + 
Sbjct  1    MALGKNPRGGVDRRSSSSSYCSTVTLVVFVGLCLVGVWMMTSSAVGPVQRVNLSPTDPEP  60

Query  534  DLKTQVNESN--ESDTGXHE--SNNASDESNTSDG  626
             +  Q  +     SDT   E    +  D++   DG
Sbjct  61   KITEQEKDQRVAASDTQTFEDTPGDLPDDAIQGDG  95



>ref|XP_003527960.1| PREDICTED: probable methyltransferase PMT26-like [Glycine max]
Length=835

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 45/58 (78%), Gaps = 2/58 (3%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKT  533
            MALGK S+  GRK S NYCSTV++ VFVA CLVGVW++  SS+VP+QNS +   E++T
Sbjct  1    MALGKNSQGKGRKLS-NYCSTVSVAVFVAFCLVGVWIVL-SSIVPIQNSVIQVSETET  56



>ref|XP_002881329.1| hypothetical protein ARALYDRAFT_482372 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57588.1| hypothetical protein ARALYDRAFT_482372 [Arabidopsis lyrata subsp. 
lyrata]
Length=773

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 50/83 (60%), Gaps = 1/83 (1%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+K+S  Y  T+TI++ +++CLVG WM  SSS  P  +   SS ++  D+
Sbjct  1    MAMGKYSRVDGKKSS-TYGLTITIVLLLSLCLVGAWMFMSSSSAPANSVGYSSSDTAKDV  59

Query  540  KTQVNESNESDTGXHESNNASDE  608
            +         + G  +  N SDE
Sbjct  60   EPVTKNDLSKEEGDRDPKNFSDE  82



>ref|XP_010908928.1| PREDICTED: probable methyltransferase PMT26 [Elaeis guineensis]
Length=800

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 52/71 (73%), Gaps = 3/71 (4%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA GK SR D R+ S ++CST TI+VFVA+CLVG+WMMTSS V P++   +S   SK+D+
Sbjct  1    MAFGKASRTDARRTSSSFCSTTTIVVFVALCLVGIWMMTSSIVNPLEMFPLS---SKSDV  57

Query  540  KTQVNESNESD  572
            K QV E++  D
Sbjct  58   KDQVPETDSKD  68



>dbj|BAE99079.1| hypothetical protein [Arabidopsis thaliana]
Length=770

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 54/87 (62%), Gaps = 6/87 (7%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+K+S  Y  T+TI++ V++CLVG WM  SS   P ++ + S+ E   D+
Sbjct  1    MAMGKYSRVDGKKSS-GYGLTITIVLIVSLCLVGAWMFMSSWSAPTESIDFSANERTKDV  59

Query  540  KTQVNE--SNESDTGXHESNNASDESN  614
             T  ++  S E D G   S +  DE N
Sbjct  60   DTTKSDFKSEEVDRG---SKSFPDEKN  83



>ref|NP_174240.2| putative methyltransferase PMT24 [Arabidopsis thaliana]
 ref|NP_001031109.1| putative methyltransferase PMT24 [Arabidopsis thaliana]
 sp|Q6NPR7.1|PMTO_ARATH RecName: Full=Probable methyltransferase PMT24 [Arabidopsis thaliana]
 gb|AAR23721.1| At1g29470 [Arabidopsis thaliana]
 gb|AEE31093.1| putative methyltransferase PMT24 [Arabidopsis thaliana]
 gb|AEE31094.1| putative methyltransferase PMT24 [Arabidopsis thaliana]
Length=770

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 54/87 (62%), Gaps = 6/87 (7%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+K+S  Y  T+TI++ V++CLVG WM  SS   P ++ + S+ E   D+
Sbjct  1    MAMGKYSRVDGKKSS-GYGLTITIVLIVSLCLVGAWMFMSSWSAPTESIDFSANERTKDV  59

Query  540  KTQVNE--SNESDTGXHESNNASDESN  614
             T  ++  S E D G   S +  DE N
Sbjct  60   DTTKSDFKSEEVDRG---SKSFPDEKN  83



>ref|NP_180977.1| putative methyltransferase PMT25 [Arabidopsis thaliana]
 ref|NP_001031477.1| putative methyltransferase PMT25 [Arabidopsis thaliana]
 sp|Q0WT31.2|PMTP_ARATH RecName: Full=Probable methyltransferase PMT25 [Arabidopsis thaliana]
 gb|AAC27406.1| unknown protein [Arabidopsis thaliana]
 gb|AEC08950.1| putative methyltransferase PMT25 [Arabidopsis thaliana]
 gb|AEC08951.1| putative methyltransferase PMT25 [Arabidopsis thaliana]
Length=770

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 53/90 (59%), Gaps = 14/90 (16%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQE-----  524
            MA+GKYSRVDG+K+S +Y  T+TI++ +++CLVG WM  SS   P  ++  SS +     
Sbjct  1    MAMGKYSRVDGKKSS-SYGLTITIVLLLSLCLVGTWMFMSSWSAPADSAGYSSTDTAKDV  59

Query  525  SKTDLKTQVNESNESDTGXHESNNASDESN  614
            SK DL+ +         G  +  N SDE N
Sbjct  60   SKNDLRKE--------EGDRDPKNFSDEKN  81



>dbj|BAE99717.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAH20160.1| AT2G34300 [Arabidopsis thaliana]
Length=770

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 53/90 (59%), Gaps = 14/90 (16%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQE-----  524
            MA+GKYSRVDG+K+S +Y  T+TI++ +++CLVG WM  SS   P  ++  SS +     
Sbjct  1    MAMGKYSRVDGKKSS-SYGLTITIVLLLSLCLVGTWMFMSSWSAPADSAGYSSTDTAKDV  59

Query  525  SKTDLKTQVNESNESDTGXHESNNASDESN  614
            SK DL+ +         G  +  N SDE N
Sbjct  60   SKNDLRKE--------EGDRDPKNFSDEKN  81



>ref|XP_010533385.1| PREDICTED: probable methyltransferase PMT24 [Tarenaya hassleriana]
Length=783

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 57/91 (63%), Gaps = 9/91 (10%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQE-----  524
            MA+GKYSRVDG+K+S +Y  T+T+++FV++CLVG WM  SSS    ++ ++ S+E     
Sbjct  1    MAMGKYSRVDGKKSS-SYGLTITVLLFVSLCLVGAWMFMSSSSATDESVDLPSRETTKDV  59

Query  525  --SKTDLKTQVNESNESDTGXHESNNASDES  611
              S TD   +V    +SD G +E N    ES
Sbjct  60   ERSTTDFTEEVVSKKDSD-GKNEENEVLTES  89



>emb|CDX94669.1| BnaC07g09890D [Brassica napus]
Length=749

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+K+S  Y  T+TI++ V++CLVG WM  SS   P ++ + SS ++  D+
Sbjct  1    MAMGKYSRVDGKKSS-GYGLTITIVLVVSLCLVGAWMFMSSWSAPTESVDFSSNQTPKDV  59

Query  540  KT  545
            +T
Sbjct  60   ET  61



>ref|XP_006295874.1| hypothetical protein CARUB_v10025004mg [Capsella rubella]
 gb|EOA28772.1| hypothetical protein CARUB_v10025004mg [Capsella rubella]
Length=777

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 51/85 (60%), Gaps = 1/85 (1%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+K+S ++  T+TI+V +++CLVG WM  SS   P  + + SS  +  D+
Sbjct  1    MAMGKYSRVDGKKSS-SHGLTITIVVILSLCLVGAWMFMSSWSAPADSVDYSSSNTAKDV  59

Query  540  KTQVNESNESDTGXHESNNASDESN  614
            ++        + G  +    SDE N
Sbjct  60   ESVTKNDLRKEEGDRDQKTFSDEKN  84



>ref|NP_001140988.1| uncharacterized protein LOC100273067 [Zea mays]
 gb|ACF85115.1| unknown [Zea mays]
 gb|AFW84364.1| hypothetical protein ZEAMMB73_169809 [Zea mays]
 gb|AFW84365.1| hypothetical protein ZEAMMB73_169809 [Zea mays]
Length=343

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 39/52 (75%), Gaps = 5/52 (10%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPN-----YCSTVTIIVFVAVCLVGVWMMTSSSVVPVQ  500
            MA G+  ++DGR+ S +     +C+T T+++FVA+CLVG WMMTSS+V P++
Sbjct  1    MAFGRGGKMDGRRPSSSSSSSSFCTTTTVVLFVALCLVGAWMMTSSTVFPLE  52



>ref|XP_010547883.1| PREDICTED: probable methyltransferase PMT26 [Tarenaya hassleriana]
Length=706

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MAL + SR+D R+    YCST +I+VFVA+ LVGVWMMTS S V V   +  S E K + 
Sbjct  1    MALVRNSRMDNRRYLSGYCSTGSIVVFVALGLVGVWMMTSQSSVGVTTFDEQSLEKKGEA  60

Query  540  KTQVNESNESDTG  578
            K QV  S +   G
Sbjct  61   KEQVTPSTKDSRG  73



>emb|CDY33300.1| BnaA01g19670D [Brassica napus]
Length=239

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 38/47 (81%), Gaps = 1/47 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQ  500
            MA GK  R + R +S +Y ST+T++VFVA+C++GVWM++S+S++P Q
Sbjct  1    MAFGK-GRGNKRSSSTSYASTITMVVFVALCVIGVWMLSSNSIIPPQ  46



>ref|XP_006290554.1| hypothetical protein CARUB_v10016641mg [Capsella rubella]
 gb|EOA23452.1| hypothetical protein CARUB_v10016641mg [Capsella rubella]
Length=967

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 56/84 (67%), Gaps = 6/84 (7%)
 Frame = +3

Query  357  RMALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSE-----VSSQ  521
            +MA GK  R + R ++ +Y ST+T+I+FVA+C++GVWM++S+SV+P Q ++     V S+
Sbjct  52   KMAFGK-GRGNKRTSTSSYASTITMIIFVALCVIGVWMLSSNSVIPPQITQGSTRTVVSE  110

Query  522  ESKTDLKTQVNESNESDTGXHESN  593
              ++DL    N ++E +    ES+
Sbjct  111  TERSDLSASSNSNDEPEPTKQESD  134



>ref|XP_010412715.1| PREDICTED: probable methyltransferase PMT27 [Camelina sativa]
 ref|XP_010412717.1| PREDICTED: probable methyltransferase PMT27 [Camelina sativa]
Length=467

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 38/47 (81%), Gaps = 1/47 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQ  500
            MA GK  R + R ++ +Y ST+T+I+FVA+C++GVWM++S+SV+P Q
Sbjct  1    MAFGK-GRGNKRASTSSYASTITMIIFVALCVIGVWMLSSNSVIPPQ  46



>ref|XP_004502550.1| PREDICTED: probable methyltransferase PMT26-like [Cicer arietinum]
Length=782

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 47/67 (70%), Gaps = 2/67 (3%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA GK SR DGR  S NYCSTV + VFVA CLVG+W++  SS+VPVQ+S +   ++  ++
Sbjct  1    MAPGKNSRGDGRNLS-NYCSTVPVAVFVAFCLVGIWIVM-SSIVPVQDSVMQVSDTIIEV  58

Query  540  KTQVNES  560
            +   N++
Sbjct  59   QNIANQT  65



>ref|XP_009102852.1| PREDICTED: probable methyltransferase PMT24 [Brassica rapa]
Length=750

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 45/63 (71%), Gaps = 2/63 (3%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNS-EVSSQESKTD  536
            MA+GKYSRVDG+K+S  Y  T+TI++ V++CLVG WM  SS   P + S + SS ++  D
Sbjct  1    MAMGKYSRVDGKKSS-GYGLTITIVLVVSLCLVGAWMFMSSWSAPTEESVDFSSTQTPKD  59

Query  537  LKT  545
            ++T
Sbjct  60   VET  62



>gb|AAG51752.1|AC068667_31 unknown protein; 55790-52851 [Arabidopsis thaliana]
Length=768

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +3

Query  366  LGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDLKT  545
            +GKYSRVDG+K+S  Y  T+TI++ V++CLVG WM  SS   P ++ + S+ E   D+ T
Sbjct  1    MGKYSRVDGKKSS-GYGLTITIVLIVSLCLVGAWMFMSSWSAPTESIDFSANERTKDVDT  59

Query  546  QVNE--SNESDTGXHESNNASDESN  614
              ++  S E D G   S +  DE N
Sbjct  60   TKSDFKSEEVDRG---SKSFPDEKN  81



>ref|XP_008805853.1| PREDICTED: probable methyltransferase PMT26 [Phoenix dactylifera]
 ref|XP_008805854.1| PREDICTED: probable methyltransferase PMT26 [Phoenix dactylifera]
Length=806

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 52/71 (73%), Gaps = 3/71 (4%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MALGK SR D R+ S ++ ST TI+VFVA+CLVG+WMMTSS+V P+  S  S   SK++ 
Sbjct  1    MALGKGSRADSRRTSSSFRSTTTIVVFVALCLVGIWMMTSSTVTPLGMSPPS---SKSNA  57

Query  540  KTQVNESNESD  572
            K QV+E++  D
Sbjct  58   KGQVSETDSKD  68



>ref|XP_002876067.1| hypothetical protein ARALYDRAFT_485459 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52326.1| hypothetical protein ARALYDRAFT_485459 [Arabidopsis lyrata subsp. 
lyrata]
Length=134

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 52/88 (59%), Gaps = 8/88 (9%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA G+  R + R ++ +Y ST+T+++FVA+C+ GVWM++S+SV+P Q ++ S+       
Sbjct  1    MAFGR-GRGNKRTSTSSYASTITMVIFVALCVFGVWMLSSNSVIPPQITQGST-------  52

Query  540  KTQVNESNESDTGXHESNNASDESNTSD  623
            +T V E+  SD     + N   E    D
Sbjct  53   RTAVAETERSDVSVSSNGNDEPEPTKQD  80



>emb|CDX90190.1| BnaA08g17940D [Brassica napus]
Length=687

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKT-D  536
            MA+G+YSRVDG+K+S ++  T+TI++ V++ LVG WM  SS   P ++ + SS ++ T D
Sbjct  1    MAMGRYSRVDGKKSSSSFGLTITIVLIVSLSLVGAWMFMSSWSAPTESIDFSSSQTTTKD  60

Query  537  LKTQ-----VNESNESDTGXHESNN  596
            ++T       NE NE      ESN 
Sbjct  61   VETTSKSDFTNEKNEETEVVTESNQ  85



>emb|CDY26534.1| BnaC01g23650D [Brassica napus]
Length=767

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 54/83 (65%), Gaps = 6/83 (7%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSE-----VSSQE  524
            MA GK  R + R +S +Y ST+T++VFVA+C++GVWM++S+S++P Q S+     V S+ 
Sbjct  1    MAFGK-GRGNKRSSSTSYASTITMVVFVALCVIGVWMLSSNSIIPPQISQANTRTVISET  59

Query  525  SKTDLKTQVNESNESDTGXHESN  593
             + D+    N ++E +    ES+
Sbjct  60   ERADVSASSNGNDEPEPTRQESD  82



>ref|XP_010426649.1| PREDICTED: probable methyltransferase PMT27 [Camelina sativa]
Length=914

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 56/83 (67%), Gaps = 10/83 (12%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA GK  R + R ++ +Y ST+T+I+FVA+C++GVWM++S+SV+P Q ++ S+       
Sbjct  1    MAFGK-GRGNKRASTSSYASTITMIIFVALCVIGVWMLSSNSVIPPQITQGST-------  52

Query  540  KTQVNESNESDTGXHESNNASDE  608
            +T V+E+  SD     S+N +DE
Sbjct  53   RTVVSETERSDVSA--SSNGNDE  73



>gb|ADK88116.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88117.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88119.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88120.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88121.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88122.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88123.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88124.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88125.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88126.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88127.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88128.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88129.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88130.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88131.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88132.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88133.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88134.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88135.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88136.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88137.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88138.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
 gb|ADK88139.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
Length=69

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 48/71 (68%), Gaps = 8/71 (11%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA G+  R + R ++ +Y ST+T+++FVA+C+ GVWM++S+SV+P Q ++ S+       
Sbjct  1    MAFGR-GRGNKRTSTSSYASTITMVIFVALCVFGVWMLSSNSVIPPQITQGST-------  52

Query  540  KTQVNESNESD  572
            +T V E+  SD
Sbjct  53   RTAVAETERSD  63



>ref|XP_010515490.1| PREDICTED: probable methyltransferase PMT27 [Camelina sativa]
Length=912

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 56/83 (67%), Gaps = 10/83 (12%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA GK  R + R ++ +Y ST+T+I+FVA+C++GVWM++S+SV+P Q ++ S+       
Sbjct  1    MAFGK-GRGNKRASTSSYASTITMIIFVALCVIGVWMLSSNSVIPPQITQGST-------  52

Query  540  KTQVNESNESDTGXHESNNASDE  608
            +T V+E+  SD     S+N +DE
Sbjct  53   RTVVSETERSDVSA--SSNGNDE  73



>ref|XP_010503787.1| PREDICTED: probable methyltransferase PMT27 [Camelina sativa]
Length=913

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 58/88 (66%), Gaps = 10/88 (11%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA GK  R + R ++ +Y ST+T+I+FVA+C++GVWM++S+SV+P Q ++ S+       
Sbjct  1    MAFGK-GRGNKRASTSSYASTITMIIFVALCVIGVWMLSSNSVIPPQITQGST-------  52

Query  540  KTQVNESNESDTGXHESNNASDESNTSD  623
            +T V+E+  SD     S+N +DE   ++
Sbjct  53   RTVVSETERSDVSA--SSNGNDEPEPTN  78



>ref|XP_009149307.1| PREDICTED: probable methyltransferase PMT27 [Brassica rapa]
Length=902

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 54/83 (65%), Gaps = 6/83 (7%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSE-----VSSQE  524
            MA GK  R + R +S +Y ST+T++VFVA+C++GVWM++S+S++P Q S+     V S+ 
Sbjct  1    MAFGK-GRGNKRSSSTSYASTITMVVFVALCVIGVWMLSSNSIIPPQISQANTRTVISET  59

Query  525  SKTDLKTQVNESNESDTGXHESN  593
             + D+    N ++E +    ES+
Sbjct  60   ERADVSASSNGNDEPEPTRQESD  82



>gb|ACN28572.1| unknown [Zea mays]
 gb|AFW84363.1| hypothetical protein ZEAMMB73_169809 [Zea mays]
Length=792

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 39/52 (75%), Gaps = 5/52 (10%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPN-----YCSTVTIIVFVAVCLVGVWMMTSSSVVPVQ  500
            MA G+  ++DGR+ S +     +C+T T+++FVA+CLVG WMMTSS+V P++
Sbjct  1    MAFGRGGKMDGRRPSSSSSSSSFCTTTTVVLFVALCLVGAWMMTSSTVFPLE  52



>ref|XP_009109665.1| PREDICTED: probable methyltransferase PMT24 [Brassica rapa]
 ref|XP_009109666.1| PREDICTED: probable methyltransferase PMT24 [Brassica rapa]
Length=682

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 48/78 (62%), Gaps = 9/78 (12%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQE-----  524
            MA+G+YSRVDG+K+S ++  T+TI++ V++ LVG WM  SS   P ++ + SS +     
Sbjct  1    MAMGRYSRVDGKKSSSSFGLTITIVLIVSLSLVGAWMFMSSWSAPTESIDFSSSQTTTKD  60

Query  525  ----SKTDLKTQVNESNE  566
                SK+D   + NE  E
Sbjct  61   VETTSKSDFTNEKNEETE  78



>ref|XP_009115236.1| PREDICTED: probable methyltransferase PMT24 isoform X1 [Brassica 
rapa]
Length=753

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+K+S  Y  T+TI++ V++ +VG WM  SS   P ++ + SS ++  D+
Sbjct  1    MAMGKYSRVDGKKSS-GYGLTITIVLIVSLSMVGAWMFMSSWSAPTESIDFSSSQTTKDV  59

Query  540  KT  545
            +T
Sbjct  60   ET  61



>emb|CDY48339.1| BnaA09g26820D [Brassica napus]
Length=756

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+K+S  Y  T+TI++ V++ +VG WM  SS   P ++ + SS ++  D+
Sbjct  1    MAMGKYSRVDGKKSS-GYGLTITIVLIVSLSMVGAWMFMSSWSAPTESIDFSSSQTTKDV  59

Query  540  KT  545
            +T
Sbjct  60   ET  61



>ref|XP_010527657.1| PREDICTED: probable methyltransferase PMT24 [Tarenaya hassleriana]
Length=790

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 32/38 (84%), Gaps = 1/38 (3%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMM  473
            MA+GKYSRVDGRK+S NY  T+T+++FV++CL G WM 
Sbjct  1    MAMGKYSRVDGRKSS-NYGLTITVVMFVSLCLFGAWMF  37



>emb|CDX99828.1| BnaC05g22500D [Brassica napus]
Length=750

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+K+S  Y  T+TI++ V++ +VG WM  SS   P ++ + SS ++  D+
Sbjct  1    MAMGKYSRVDGKKSS-GYGLTITIVLIVSLSMVGAWMFMSSWSAPTESIDFSSSQTTKDV  59

Query  540  KT  545
            +T
Sbjct  60   ET  61



>ref|XP_009115237.1| PREDICTED: probable methyltransferase PMT24 isoform X2 [Brassica 
rapa]
Length=725

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+K+S  Y  T+TI++ V++ +VG WM  SS   P ++ + SS ++  D+
Sbjct  1    MAMGKYSRVDGKKSS-GYGLTITIVLIVSLSMVGAWMFMSSWSAPTESIDFSSSQTTKDV  59

Query  540  KT  545
            +T
Sbjct  60   ET  61



>emb|CDY44314.1| BnaA07g07980D [Brassica napus]
Length=744

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNS  506
            MA+GKYSRVDG+K+S  Y  T+TI++ V++CLVG WM  SS   P + S
Sbjct  1    MAMGKYSRVDGKKSS-GYGLTITIVLAVSLCLVGAWMFMSSWSAPTEES  48



>gb|KHN36073.1| Putative methyltransferase PMT27 [Glycine soja]
Length=796

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 52/85 (61%), Gaps = 5/85 (6%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVP--VQNSEVSSQESKT  533
            MAL +  +   + +SP+Y ST+TI+VF+A+C+ GVWM+TS+SVVP   Q+ E +S  +  
Sbjct  1    MALFQTRK---KSSSPSYVSTLTILVFIALCVFGVWMLTSNSVVPPQTQSDEDTSTRTAI  57

Query  534  DLKTQVNESNESDTGXHESNNASDE  608
            D     N+   S    HE+ + S E
Sbjct  58   DTSATTNDELSSSEDSHETTSKSGE  82



>ref|XP_003516560.1| PREDICTED: probable methyltransferase PMT27-like [Glycine max]
Length=796

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 52/85 (61%), Gaps = 5/85 (6%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVP--VQNSEVSSQESKT  533
            MAL +  +   + +SP+Y ST+TI+VF+A+C+ GVWM+TS+SVVP   Q+ E +S  +  
Sbjct  1    MALFQTRK---KSSSPSYVSTLTILVFIALCVFGVWMLTSNSVVPPQTQSDEDTSTRTAI  57

Query  534  DLKTQVNESNESDTGXHESNNASDE  608
            D     N+   S    HE+ + S E
Sbjct  58   DTSATTNDELSSSEDSHETTSKSGE  82



>gb|ADK88118.1| AtIII19x5-like protein, partial [Arabidopsis halleri]
Length=69

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 48/71 (68%), Gaps = 8/71 (11%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA G+  R + R ++ +Y ST+T+++FVA+C+ GVWM++S+SV+P Q ++ S++ +    
Sbjct  1    MAFGR-GRGNKRTSTSSYASTITMVIFVALCVFGVWMLSSNSVIPPQITQGSTRPA----  55

Query  540  KTQVNESNESD  572
               V E+  SD
Sbjct  56   ---VAETERSD  63



>ref|XP_006403957.1| hypothetical protein EUTSA_v10010109mg [Eutrema salsugineum]
 gb|ESQ45410.1| hypothetical protein EUTSA_v10010109mg [Eutrema salsugineum]
Length=914

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 54/83 (65%), Gaps = 9/83 (11%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA GK  R + R ++ +Y ST+T+++FVA+C++GVWM++S+SV+P Q +  S+       
Sbjct  1    MAFGK-GRGNKRSSTTSYASTITMVIFVALCVIGVWMLSSNSVIPPQITGAST-------  52

Query  540  KTQVNESNESDTGXHESNNASDE  608
            +T + E+  SD     S+N +DE
Sbjct  53   RTAIAETERSDV-VSASSNGNDE  74



>ref|XP_010557710.1| PREDICTED: probable methyltransferase PMT27 [Tarenaya hassleriana]
Length=868

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 48/69 (70%), Gaps = 7/69 (10%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GK +R + R A+ +Y STVT ++FVA+C++GVWM++S+SV P Q +  S++ +    
Sbjct  1    MAVGK-TRGNKRSATTSYASTVTTVIFVALCVIGVWMLSSNSVTPPQITRASTRTAS---  56

Query  540  KTQVNESNE  566
               V ESNE
Sbjct  57   ---VTESNE  62



>emb|CDY66721.1| BnaC03g76010D, partial [Brassica napus]
Length=529

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQES  527
            MA+G+YSRVDG K+S ++  T+TI++ V++ LVG WM  SS   P ++ + SS ++
Sbjct  1    MAMGRYSRVDGNKSSSSFGLTITIVLIVSLSLVGAWMFMSSWSAPTESIDFSSSQA  56



>gb|KEH35375.1| methyltransferase PMT26-like protein, putative [Medicago truncatula]
Length=755

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 46/68 (68%), Gaps = 3/68 (4%)
 Frame = +3

Query  360  MALGKYSRV-DGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTD  536
            MAL K SR  DGR +S NYCST  + VFVA CLVG+W +  SS+VP+Q+S +   E+  +
Sbjct  1    MALVKNSRGGDGRNSS-NYCSTFPVAVFVAFCLVGIW-IAMSSIVPLQDSVMEVSETINE  58

Query  537  LKTQVNES  560
            +K   N++
Sbjct  59   VKNIANQT  66



>ref|XP_009143789.1| PREDICTED: probable methyltransferase PMT25 [Brassica rapa]
Length=762

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 56/91 (62%), Gaps = 8/91 (9%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+K+S +Y  T+TI++ V++CLVG WM TSS      ++  SS ++  D+
Sbjct  1    MAMGKYSRVDGKKSS-SYGLTITIVLVVSLCLVGTWMFTSSWSASDDSAGYSSTDTAKDV  59

Query  540  KT-------QVNESNESDTGXHESNNASDES  611
             +       +  E NES +  ++  N  +ES
Sbjct  60   DSVTKNVAEEKKEDNESVSENNQVKNDPEES  90



>emb|CDY17234.1| BnaA05g09540D [Brassica napus]
Length=762

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 56/91 (62%), Gaps = 8/91 (9%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDL  539
            MA+GKYSRVDG+K+S +Y  T+TI++ V++CLVG WM TSS      ++  SS ++  D+
Sbjct  1    MAMGKYSRVDGKKSS-SYGLTITIVLVVSLCLVGTWMFTSSWSASDDSAGYSSTDTAKDV  59

Query  540  KT-------QVNESNESDTGXHESNNASDES  611
             +       +  E NES +  ++  N  +ES
Sbjct  60   DSVTKNVAEEKKEDNESVSENNQVKNDPEES  90



>ref|XP_009411900.1| PREDICTED: probable methyltransferase PMT26 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009411901.1| PREDICTED: probable methyltransferase PMT26 [Musa acuminata subsp. 
malaccensis]
Length=750

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 48/87 (55%), Gaps = 2/87 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSE-VSSQESKTD  536
            MA G+  + + R++S +YC   TI+VFVA+C VG+WM++S ++VPV  S  V   E K  
Sbjct  1    MAFGRNMQTNNRRSS-SYCLKTTILVFVALCFVGIWMLSSLNIVPVDLSYLVPKSEFKDK  59

Query  537  LKTQVNESNESDTGXHESNNASDESNT  617
                  +   SD     S +A +  NT
Sbjct  60   FSMPFGDKLGSDNDGLASGDAKNTENT  86



>ref|NP_190676.1| putative methyltransferase PMT27 [Arabidopsis thaliana]
 sp|Q9SD39.1|PMTR_ARATH RecName: Full=Probable methyltransferase PMT27 [Arabidopsis thaliana]
 emb|CAB62629.1| putative protein [Arabidopsis thaliana]
 gb|AEE78746.1| putative methyltransferase PMT27 [Arabidopsis thaliana]
Length=895

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 55/83 (66%), Gaps = 6/83 (7%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQES----  527
            MA G+  R + R ++ +Y ST+T+++FVA+C+ GVWM++S+SV+P Q ++ S++ +    
Sbjct  1    MAFGR-GRGNKRTSTSSYASTITMVIFVALCVFGVWMLSSNSVIPPQITQGSTRAAVAET  59

Query  528  -KTDLKTQVNESNESDTGXHESN  593
             ++D+    N ++E +    ES+
Sbjct  60   ERSDVSASSNGNDEPEPTKQESD  82



>gb|ABA96619.1| dehydration-responsive protein, putative [Oryza sativa Japonica 
Group]
Length=990

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 36/50 (72%), Gaps = 8/50 (16%)
 Frame = +3

Query  372  KYSRVDG--------RKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPV  497
            +Y R+DG        R++SP+ CST TI++FVA+CLVG WMM+S+  VP+
Sbjct  8    RYQRLDGNGGGGGGGRRSSPSSCSTATIVLFVALCLVGAWMMSSTGNVPM  57



>gb|EAZ19833.1| hypothetical protein OsJ_35417 [Oryza sativa Japonica Group]
Length=990

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 36/50 (72%), Gaps = 8/50 (16%)
 Frame = +3

Query  372  KYSRVDG--------RKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPV  497
            +Y R+DG        R++SP+ CST TI++FVA+CLVG WMM+S+  VP+
Sbjct  8    RYQRLDGNGGGGGGGRRSSPSSCSTATIVLFVALCLVGAWMMSSTGNVPM  57



>emb|CDX84330.1| BnaC04g10920D [Brassica napus]
Length=713

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 33/39 (85%), Gaps = 1/39 (3%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMT  476
            MA+GKYSRVDG+K+S +Y  T+TI++ V++CLVG WM T
Sbjct  1    MAMGKYSRVDGKKSS-SYGLTITIVLIVSLCLVGTWMFT  38



>gb|EAY82457.1| hypothetical protein OsI_37674 [Oryza sativa Indica Group]
Length=932

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 36/50 (72%), Gaps = 8/50 (16%)
 Frame = +3

Query  372  KYSRVDG--------RKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPV  497
            +Y R+DG        R++SP+ CST TI++FVA+CLVG WMM+S+  VP+
Sbjct  8    RYQRLDGNGGGGGGGRRSSPSSCSTATIVLFVALCLVGAWMMSSTGNVPM  57



>ref|XP_009115787.1| PREDICTED: probable methyltransferase PMT27 [Brassica rapa]
Length=898

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 42/54 (78%), Gaps = 1/54 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQ  521
            MA GK  R + R ++ +Y ST+T++VFVA+C+VGVWM++++S +P Q ++ +++
Sbjct  1    MAFGK-GRGNKRTSTSSYASTITMVVFVALCVVGVWMLSTNSFIPSQITQATTR  53



>ref|XP_006828886.1| hypothetical protein AMTR_s00001p00185010 [Amborella trichopoda]
 gb|ERM96302.1| hypothetical protein AMTR_s00001p00185010 [Amborella trichopoda]
Length=918

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +3

Query  411  YCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDLKTQVNES  560
            YCST+T+ +FV  CL+GVWM+TSS+V P Q    +    + + +TQV+ S
Sbjct  17   YCSTITMTMFVCFCLLGVWMLTSSAVAPGQRGGFAQSTIRKETRTQVSSS  66



>ref|XP_010679252.1| PREDICTED: probable methyltransferase PMT26 [Beta vulgaris subsp. 
vulgaris]
Length=788

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 59/111 (53%), Gaps = 25/111 (23%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPV--------------  497
            MA G+Y+RVDGRK+S NYCSTV I+V V+ CL+G WM  SSS  P               
Sbjct  1    MATGRYTRVDGRKSS-NYCSTVVIVVIVSACLIGAWMTMSSSADPAGAVGISLGLSKDVK  59

Query  498  --QNSEVSSQESKTD--------LKTQVNESNESDTGXHESNNASDESNTS  620
              + SE SS+E + +        LK  V++++E D    ES+    +  +S
Sbjct  60   QPKMSEKSSKEFEDNSGDLPEDGLKGNVDQASERDENSGESSQEEKQERSS  110



>ref|XP_006365916.1| PREDICTED: probable methyltransferase PMT24-like [Solanum tuberosum]
Length=768

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 39/54 (72%), Gaps = 2/54 (4%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSV-VPVQNSEVSS  518
            MA G YS   GRK+S ++CS +T++ F+ +  VG+WM+ SSS  + +QNSE+SS
Sbjct  1    MAGGSYSHSGGRKSS-DFCSKLTVVTFLGISCVGIWMLISSSFSITLQNSEISS  53



>ref|XP_010063906.1| PREDICTED: probable methyltransferase PMT25 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010063907.1| PREDICTED: probable methyltransferase PMT25 isoform X2 [Eucalyptus 
grandis]
 gb|KCW71194.1| hypothetical protein EUGRSUZ_F04285 [Eucalyptus grandis]
Length=825

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 48/87 (55%), Gaps = 3/87 (3%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWM-MTSSSVVPVQNSEVSSQESKTD  536
            MA G     D RK SPNYCS ++++VFVA  L  +W+ + SSS  PV+N  +  QE+ + 
Sbjct  1    MASGNIRLFDVRK-SPNYCSRISLVVFVAFSLFAIWIFLPSSSTFPVENPNLLYQENDS-  58

Query  537  LKTQVNESNESDTGXHESNNASDESNT  617
            L  +VN  +  +T     +   D+  T
Sbjct  59   LGHRVNNGSLGNTQIQSQDVPDDDKRT  85



>ref|NP_001045015.1| Os01g0883900 [Oryza sativa Japonica Group]
 dbj|BAF06929.1| Os01g0883900 [Oryza sativa Japonica Group]
 dbj|BAG94735.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99723.1| unnamed protein product [Oryza sativa Japonica Group]
Length=806

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 41/49 (84%), Gaps = 2/49 (4%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPN--YCSTVTIIVFVAVCLVGVWMMTSSSVVPVQ  500
            MA G+ S++DGR++SP+   C+T T++VFVA+CLVG WMMTSS++ P++
Sbjct  1    MAFGRGSKMDGRRSSPSSSLCTTTTVVVFVALCLVGAWMMTSSTIFPLE  49



>ref|XP_010679267.1| PREDICTED: probable methyltransferase PMT26 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010679271.1| PREDICTED: probable methyltransferase PMT26 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010679275.1| PREDICTED: probable methyltransferase PMT26 [Beta vulgaris subsp. 
vulgaris]
Length=669

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSS  485
            MALG+Y+RVDG+  SPN+C  + I+ FV+ CL+  WM  SSS
Sbjct  1    MALGRYARVDGQN-SPNHCLVICIVGFVSTCLMAAWMTMSSS  41



>ref|XP_007158605.1| hypothetical protein PHAVU_002G166600g [Phaseolus vulgaris]
 gb|ESW30599.1| hypothetical protein PHAVU_002G166600g [Phaseolus vulgaris]
Length=828

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 32/43 (74%), Gaps = 3/43 (7%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSV  488
            MAL K  +   R +SP+Y ST+TI VF+A+C+ GVWM+TS SV
Sbjct  1    MALFKTRK---RSSSPSYVSTLTIFVFIALCVFGVWMLTSKSV  40



>tpg|DAA38926.1| TPA: hypothetical protein ZEAMMB73_582749 [Zea mays]
Length=939

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = +3

Query  408  NYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDLKTQVNESNESDTGXHE  587
            ++CST T +VFVA+CL+G+WM++S   VP   S  S +  K+D+K + +  + ++T   +
Sbjct  13   SFCSTATFVVFVALCLLGMWMISSPENVPSAISLSSEKVVKSDVKEEDSSIDATNTVKQD  72

Query  588  SNNASDESNTSDG  626
            S N   E+ T  G
Sbjct  73   SANVVSEATTDGG  85



>ref|XP_008669787.1| PREDICTED: probable methyltransferase PMT26 [Zea mays]
 ref|XP_008669788.1| PREDICTED: probable methyltransferase PMT26 [Zea mays]
Length=906

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 44/72 (61%), Gaps = 0/72 (0%)
 Frame = +3

Query  411  YCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDLKTQVNESNESDTGXHES  590
            +CST T +VFVA+CL+G+WM++S   VP   S  S +  K+D+K + +  + ++T   +S
Sbjct  14   FCSTATFVVFVALCLLGMWMISSPENVPSAISLSSEKVVKSDVKEEDSSIDATNTVKQDS  73

Query  591  NNASDESNTSDG  626
             N   E+ T  G
Sbjct  74   ANVVSEATTDGG  85



>ref|XP_003580900.1| PREDICTED: probable methyltransferase PMT26 [Brachypodium distachyon]
Length=716

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/52 (52%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = +3

Query  360  MALGKYSRVDGRKA---SPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNS  506
            MALG ++R+D R+    S +YCS  T++VFVA+CLVGVWM +S  V P   S
Sbjct  1    MALG-HTRLDVRRLQQHSSSYCSATTVVVFVALCLVGVWMASSMLVTPADFS  51



>ref|XP_010271514.1| PREDICTED: probable methyltransferase PMT27 [Nelumbo nucifera]
Length=983

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  411  YCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTD  536
            Y ST+T+++FVA C++G+WM+TSS+++P Q++  S+  S  D
Sbjct  42   YVSTITVVIFVASCVIGLWMLTSSTLIPRQSTRTSNDISSAD  83



>ref|XP_004237701.1| PREDICTED: probable methyltransferase PMT24 [Solanum lycopersicum]
Length=768

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 38/54 (70%), Gaps = 2/54 (4%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSV-VPVQNSEVSS  518
            MA   YS   GRK+S ++CS +T++ F+ +  +G+WM+ SSS  + +QNSE+SS
Sbjct  1    MAGESYSHSGGRKSS-DFCSKLTVVTFLGISCIGIWMLISSSFSITLQNSEISS  53



>ref|XP_007046783.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOX90940.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=920

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQ  500
            MA+G  SR + R +S +Y ST+T +VFV +C+ GVWM+TS+SV P Q
Sbjct  1    MAIGGKSRSNKRSSSVSYASTITTVVFVTLCVFGVWMLTSNSVAPPQ  47



>ref|XP_010263954.1| PREDICTED: probable methyltransferase PMT27 [Nelumbo nucifera]
Length=934

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 35/47 (74%), Gaps = 3/47 (6%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQ  500
            MA GK +R   R  S +Y STVT+++F+A+C++G+WM+T SS +P Q
Sbjct  1    MAFGK-ARSSKRSPS-SYTSTVTMVIFIAICVIGLWMLT-SSFIPRQ  44



>gb|EEC67819.1| hypothetical protein OsI_35396 [Oryza sativa Indica Group]
Length=902

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 26/73 (36%), Positives = 38/73 (52%), Gaps = 7/73 (10%)
 Frame = +3

Query  393  RKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQNSEVSSQESKTDLKTQVNESNESD  572
            +K   + CST T++VFVA+CLVG+WM++S   +P   + VS        K  V    E D
Sbjct  8    QKQRSSLCSTATVVVFVALCLVGLWMISSPETIPAAAANVSK-------KPDVVAVKEED  60

Query  573  TGXHESNNASDES  611
            +    +NN    S
Sbjct  61   SSLDATNNVKQNS  73



>ref|XP_004170954.1| PREDICTED: LOW QUALITY PROTEIN: probable methyltransferase PMT27-like, 
partial [Cucumis sativus]
Length=611

 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWMMTSSSVVPVQ  500
            MALG+        +S +Y STVT +VF+A+C++GVWM+TS+S VP Q
Sbjct  1    MALGRPRSSKRSSSSSSYASTVTTVVFLALCVLGVWMLTSNSAVPPQ  47



>ref|XP_010906388.1| PREDICTED: probable methyltransferase PMT24 [Elaeis guineensis]
Length=955

 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 3/47 (6%)
 Frame = +3

Query  363  ALGKYSRVDGRKASPNYCST---VTIIVFVAVCLVGVWMMTSSSVVP  494
             LGK SRV  R +S +  ST   VTI+VFVA+C++GVWM+ SSS++P
Sbjct  3    GLGKNSRVGKRYSSSSAGSTSYYVTIVVFVALCILGVWMLASSSIIP  49



>ref|XP_010063908.1| PREDICTED: probable methyltransferase PMT25 [Eucalyptus grandis]
 ref|XP_010063909.1| PREDICTED: probable methyltransferase PMT25 [Eucalyptus grandis]
 gb|KCW71195.1| hypothetical protein EUGRSUZ_F04286 [Eucalyptus grandis]
 gb|KCW71196.1| hypothetical protein EUGRSUZ_F04286 [Eucalyptus grandis]
Length=810

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 37/56 (66%), Gaps = 2/56 (4%)
 Frame = +3

Query  360  MALGKYSRVDGRKASPNYCSTVTIIVFVAVCLVGVWM-MTSSSVVPVQNSEVSSQE  524
            MA G +S  D RK+S N+CS + ++VFVA  L  +W+ + SS+  PVQN ++  QE
Sbjct  1    MASGNWSLSDVRKSS-NHCSRLAVVVFVAFSLSAIWIFLPSSTTFPVQNPDLLHQE  55



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250