BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS060H08

Length=622
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002515516.1|  grr1, plant, putative                              134   7e-33   Ricinus communis
gb|KHG28503.1|  EIN3-binding F-box 1 -like protein                      126   9e-30   Gossypium arboreum [tree cotton]
gb|KJB55011.1|  hypothetical protein B456_009G058000                    125   1e-29   Gossypium raimondii
ref|XP_002324298.2|  hypothetical protein POPTR_0018s01710g             125   1e-29   Populus trichocarpa [western balsam poplar]
gb|KDP33594.1|  hypothetical protein JCGZ_07165                         125   1e-29   Jatropha curcas
ref|XP_011036551.1|  PREDICTED: EIN3-binding F-box protein 1-like       124   4e-29   Populus euphratica
ref|XP_011016246.1|  PREDICTED: EIN3-binding F-box protein 1-like       123   8e-29   Populus euphratica
ref|XP_007161212.1|  hypothetical protein PHAVU_001G051300g             123   9e-29   Phaseolus vulgaris [French bean]
ref|XP_008466405.1|  PREDICTED: EIN3-binding F-box protein 1 isof...    122   2e-28   
ref|XP_003544614.1|  PREDICTED: EIN3-binding F-box protein 1-like...    122   2e-28   Glycine max [soybeans]
ref|NP_001281254.1|  EIN3-binding F-box protein 1-like                  121   3e-28   Cucumis sativus [cucumbers]
gb|KCW81401.1|  hypothetical protein EUGRSUZ_C02778                     120   1e-27   Eucalyptus grandis [rose gum]
ref|XP_010048972.1|  PREDICTED: LOW QUALITY PROTEIN: EIN3-binding...    120   1e-27   Eucalyptus grandis [rose gum]
ref|XP_011039690.1|  PREDICTED: EIN3-binding F-box protein 1-like       118   4e-27   Populus euphratica
ref|XP_010102671.1|  EIN3-binding F-box protein 1                       117   1e-26   
gb|KHN33913.1|  EIN3-binding F-box protein 1                            117   2e-26   Glycine soja [wild soybean]
ref|XP_002308665.2|  grr1 family protein                                116   2e-26   
ref|XP_002285126.1|  PREDICTED: EIN3-binding F-box protein 1-like       116   3e-26   Vitis vinifera
ref|XP_010250120.1|  PREDICTED: EIN3-binding F-box protein 1-like       116   4e-26   Nelumbo nucifera [Indian lotus]
ref|XP_008394083.1|  PREDICTED: EIN3-binding F-box protein 1-like       112   4e-25   
ref|XP_009355743.1|  PREDICTED: EIN3-binding F-box protein 1-like       112   4e-25   Pyrus x bretschneideri [bai li]
ref|XP_010048202.1|  PREDICTED: EIN3-binding F-box protein 1-like       111   1e-24   
ref|XP_010254418.1|  PREDICTED: EIN3-binding F-box protein 1-like       110   2e-24   Nelumbo nucifera [Indian lotus]
emb|CBI21043.3|  unnamed protein product                                110   3e-24   Vitis vinifera
ref|XP_004173614.1|  PREDICTED: EIN3-binding F-box protein 1-like       108   9e-24   
ref|XP_004498740.1|  PREDICTED: EIN3-binding F-box protein 1-like       108   9e-24   Cicer arietinum [garbanzo]
ref|XP_009376923.1|  PREDICTED: EIN3-binding F-box protein 1-like       108   1e-23   Pyrus x bretschneideri [bai li]
ref|XP_007225116.1|  hypothetical protein PRUPE_ppa002673mg             108   1e-23   Prunus persica
ref|XP_008365190.1|  PREDICTED: EIN3-binding F-box protein 1-like...    108   2e-23   
ref|XP_008378375.1|  PREDICTED: EIN3-binding F-box protein 1-like...    108   2e-23   
gb|AFT92041.1|  EIN3 binding F-box 1                                    108   2e-23   Malus domestica [apple tree]
ref|XP_008466407.1|  PREDICTED: EIN3-binding F-box protein 1 isof...    108   2e-23   
ref|XP_011081561.1|  PREDICTED: EIN3-binding F-box protein 1-like       106   7e-23   Sesamum indicum [beniseed]
ref|XP_008347724.1|  PREDICTED: EIN3-binding F-box protein 1-like       100   8e-23   
ref|XP_006450435.1|  hypothetical protein CICLE_v10007708mg             105   1e-22   Citrus clementina [clementine]
ref|XP_004291457.1|  PREDICTED: EIN3-binding F-box protein 1-like       105   2e-22   Fragaria vesca subsp. vesca
ref|XP_008219497.1|  PREDICTED: LOW QUALITY PROTEIN: EIN3-binding...    104   4e-22   Prunus mume [ume]
gb|KJB82811.1|  hypothetical protein B456_013G215000                    103   5e-22   Gossypium raimondii
ref|XP_003588766.1|  Ein3-binding f-box protein                         103   5e-22   Medicago truncatula
ref|XP_004138725.1|  PREDICTED: EIN3-binding F-box protein 1-like       102   2e-21   Cucumis sativus [cucumbers]
ref|XP_007011864.1|  EIN3-binding F box protein 1                       102   2e-21   
ref|XP_003603398.1|  Ein3-binding f-box protein                         101   5e-21   
gb|AES73649.2|  EIN3-binding F-box-like protein                         101   5e-21   Medicago truncatula
ref|XP_002285249.2|  PREDICTED: EIN3-binding F-box protein 1-like       100   8e-21   Vitis vinifera
ref|XP_003522614.1|  PREDICTED: EIN3-binding F-box protein 1-like...    100   9e-21   Glycine max [soybeans]
ref|XP_006483363.1|  PREDICTED: EIN3-binding F-box protein 1-like       100   1e-20   Citrus sinensis [apfelsine]
ref|XP_009614726.1|  PREDICTED: EIN3-binding F-box protein 1-like       100   1e-20   Nicotiana tomentosiformis
gb|EYU20264.1|  hypothetical protein MIMGU_mgv1a002548mg              99.8    2e-20   Erythranthe guttata [common monkey flower]
ref|XP_008445218.1|  PREDICTED: EIN3-binding F-box protein 1          99.8    2e-20   Cucumis melo [Oriental melon]
ref|XP_009801071.1|  PREDICTED: EIN3-binding F-box protein 1          99.4    2e-20   Nicotiana sylvestris
emb|CAN82790.1|  hypothetical protein VITISV_030601                   99.4    2e-20   Vitis vinifera
ref|XP_009376911.1|  PREDICTED: EIN3-binding F-box protein 1-like     97.1    1e-19   Pyrus x bretschneideri [bai li]
gb|KJB65824.1|  hypothetical protein B456_010G114900                  95.9    3e-19   Gossypium raimondii
emb|CBI28209.3|  unnamed protein product                              95.5    4e-19   Vitis vinifera
ref|XP_002880682.1|  ein3-binding F box protein 1                     95.5    4e-19   
gb|KJB65823.1|  hypothetical protein B456_010G114900                  95.5    5e-19   Gossypium raimondii
ref|XP_006364926.1|  PREDICTED: EIN3-binding F-box protein 1-like     94.4    1e-18   Solanum tuberosum [potatoes]
ref|XP_008365191.1|  PREDICTED: EIN3-binding F-box protein 1-like...  94.4    1e-18   
ref|XP_008378376.1|  PREDICTED: EIN3-binding F-box protein 1-like...  94.4    1e-18   
gb|KHN07078.1|  EIN3-binding F-box protein 1                          93.6    2e-18   Glycine soja [wild soybean]
ref|XP_010429542.1|  PREDICTED: EIN3-binding F-box protein 1          93.6    2e-18   Camelina sativa [gold-of-pleasure]
ref|XP_002524506.1|  grr1, plant, putative                            93.6    2e-18   Ricinus communis
gb|KHG15742.1|  EIN3-binding F-box 1 -like protein                    92.8    4e-18   Gossypium arboreum [tree cotton]
ref|XP_007137020.1|  hypothetical protein PHAVU_009G093200g           91.7    9e-18   Phaseolus vulgaris [French bean]
ref|XP_010555012.1|  PREDICTED: EIN3-binding F-box protein 2-like     91.3    1e-17   Tarenaya hassleriana [spider flower]
ref|XP_006293838.1|  hypothetical protein CARUB_v10022822mg           91.3    1e-17   Capsella rubella
gb|EYU32346.1|  hypothetical protein MIMGU_mgv1a002758mg              90.9    2e-17   Erythranthe guttata [common monkey flower]
ref|XP_010472548.1|  PREDICTED: EIN3-binding F-box protein 1          90.5    2e-17   Camelina sativa [gold-of-pleasure]
ref|NP_001234864.1|  EIN3-binding F-box protein 2                     90.1    3e-17   
ref|NP_565597.1|  EIN3-binding F-box protein 1                        88.6    9e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010541601.1|  PREDICTED: EIN3-binding F-box protein 2          88.2    1e-16   Tarenaya hassleriana [spider flower]
ref|XP_011069870.1|  PREDICTED: EIN3-binding F-box protein 1          87.4    3e-16   Sesamum indicum [beniseed]
ref|XP_010696236.1|  PREDICTED: EIN3-binding F-box protein 1          87.4    3e-16   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB27084.1|  hypothetical protein B456_004G276800                  86.3    6e-16   Gossypium raimondii
ref|XP_010417316.1|  PREDICTED: EIN3-binding F-box protein 1-like     85.9    8e-16   Camelina sativa [gold-of-pleasure]
ref|XP_008792024.1|  PREDICTED: EIN3-binding F-box protein 1-like     85.1    1e-15   
ref|XP_009381112.1|  PREDICTED: EIN3-binding F-box protein 1-like     84.7    2e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010907280.1|  PREDICTED: EIN3-binding F-box protein 1-like     84.0    4e-15   Elaeis guineensis
ref|XP_010907279.1|  PREDICTED: EIN3-binding F-box protein 1-like     83.6    5e-15   Elaeis guineensis
ref|XP_007136869.1|  hypothetical protein PHAVU_009G080700g           82.8    8e-15   Phaseolus vulgaris [French bean]
ref|XP_008362900.1|  PREDICTED: EIN3-binding F-box protein 1-like     82.8    9e-15   
ref|XP_008805623.1|  PREDICTED: EIN3-binding F-box protein 1-like     82.8    1e-14   Phoenix dactylifera
ref|XP_009419280.1|  PREDICTED: EIN3-binding F-box protein 1-like     82.4    1e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010526214.1|  PREDICTED: EIN3-binding F-box protein 1-like     81.6    3e-14   Tarenaya hassleriana [spider flower]
emb|CAN83761.1|  hypothetical protein VITISV_043743                   81.3    3e-14   Vitis vinifera
ref|XP_002325221.1|  hypothetical protein POPTR_0018s13070g           80.9    3e-14   
gb|KFK32577.1|  hypothetical protein AALP_AA6G261300                  80.9    4e-14   Arabis alpina [alpine rockcress]
ref|XP_009364023.1|  PREDICTED: EIN3-binding F-box protein 1-like     80.9    4e-14   Pyrus x bretschneideri [bai li]
ref|NP_001234858.1|  EIN3-binding F-box protein 1                     80.9    4e-14   Solanum lycopersicum
ref|XP_011017769.1|  PREDICTED: EIN3-binding F-box protein 1-like     80.9    5e-14   Populus euphratica
gb|KHG14715.1|  EIN3-binding F-box 1 -like protein                    80.5    5e-14   Gossypium arboreum [tree cotton]
ref|XP_007013466.1|  Ein3-binding f-box protein 4                     80.5    5e-14   
gb|KJB54023.1|  hypothetical protein B456_009G017100                  80.5    6e-14   Gossypium raimondii
ref|XP_006345227.1|  PREDICTED: EIN3-binding F-box protein 1-like     80.1    6e-14   Solanum tuberosum [potatoes]
ref|XP_008337284.1|  PREDICTED: EIN3-binding F-box protein 1-like     80.1    7e-14   
gb|KDP32417.1|  hypothetical protein JCGZ_13342                       80.1    8e-14   Jatropha curcas
ref|XP_008457494.1|  PREDICTED: EIN3-binding F-box protein 1-like     79.7    1e-13   Cucumis melo [Oriental melon]
ref|XP_006842065.1|  hypothetical protein AMTR_s00078p00046140        79.0    2e-13   Amborella trichopoda
ref|XP_009397481.1|  PREDICTED: EIN3-binding F-box protein 1-like     79.0    2e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011020134.1|  PREDICTED: EIN3-binding F-box protein 1-like     78.6    2e-13   Populus euphratica
ref|XP_004139306.1|  PREDICTED: EIN3-binding F-box protein 1-like     78.6    3e-13   Cucumis sativus [cucumbers]
ref|XP_009368857.1|  PREDICTED: EIN3-binding F-box protein 1-like     78.2    4e-13   Pyrus x bretschneideri [bai li]
ref|XP_002308982.2|  hypothetical protein POPTR_0006s06770g           77.8    4e-13   
ref|XP_008805624.1|  PREDICTED: EIN3-binding F-box protein 1-like     77.4    6e-13   Phoenix dactylifera
ref|XP_010048082.1|  PREDICTED: EIN3-binding F-box protein 1-like     77.0    9e-13   Eucalyptus grandis [rose gum]
emb|CDP10419.1|  unnamed protein product                              76.6    1e-12   Coffea canephora [robusta coffee]
ref|XP_002874252.1|  ein3-binding F box protein 2                     76.6    1e-12   
ref|XP_010493788.1|  PREDICTED: EIN3-binding F-box protein 2-like     75.5    2e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010454859.1|  PREDICTED: EIN3-binding F-box protein 2          75.5    2e-12   Camelina sativa [gold-of-pleasure]
ref|XP_006287278.1|  hypothetical protein CARUB_v10000473mg           75.1    3e-12   Capsella rubella
ref|XP_011078374.1|  PREDICTED: EIN3-binding F-box protein 1-like     75.1    4e-12   Sesamum indicum [beniseed]
gb|AFU61111.1|  F-box protein                                         74.3    5e-12   Capsicum annuum
ref|XP_007155011.1|  hypothetical protein PHAVU_003G165500g           74.3    6e-12   Phaseolus vulgaris [French bean]
gb|KHG24906.1|  EIN3-binding F-box 1 -like protein                    73.9    7e-12   Gossypium arboreum [tree cotton]
ref|XP_010525963.1|  PREDICTED: EIN3-binding F-box protein 1-like     73.9    8e-12   Tarenaya hassleriana [spider flower]
emb|CDX76980.1|  BnaC04g37750D                                        73.6    9e-12   
ref|XP_006405190.1|  hypothetical protein EUTSA_v10000087mg           73.6    1e-11   Eutrema salsugineum [saltwater cress]
gb|AEK81539.1|  EIN3 binding F-box 1                                  73.6    1e-11   Dianthus caryophyllus [carnation]
ref|XP_010047961.1|  PREDICTED: EIN3-binding F-box protein 1-like     73.6    1e-11   Eucalyptus grandis [rose gum]
ref|XP_006394785.1|  hypothetical protein EUTSA_v10003828mg           73.2    1e-11   Eutrema salsugineum [saltwater cress]
ref|XP_009758784.1|  PREDICTED: EIN3-binding F-box protein 1-like     72.8    2e-11   Nicotiana sylvestris
gb|ACB59221.1|  F-box protein                                         72.4    3e-11   Brassica oleracea
ref|XP_009625259.1|  PREDICTED: EIN3-binding F-box protein 1-like     72.0    3e-11   Nicotiana tomentosiformis
dbj|BAH20224.1|  AT2G25490                                            71.2    5e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003549759.1|  PREDICTED: EIN3-binding F-box protein 1-like     71.2    6e-11   Glycine max [soybeans]
ref|XP_003542675.1|  PREDICTED: EIN3-binding F-box protein 1-like     70.9    7e-11   Glycine max [soybeans]
gb|KCW80001.1|  hypothetical protein EUGRSUZ_C01334                   70.9    8e-11   Eucalyptus grandis [rose gum]
ref|XP_006358273.1|  PREDICTED: EIN3-binding F-box protein 1-like     70.5    1e-10   Solanum tuberosum [potatoes]
ref|XP_004287307.1|  PREDICTED: EIN3-binding F-box protein 1-like     70.5    1e-10   Fragaria vesca subsp. vesca
ref|XP_004508488.1|  PREDICTED: EIN3-binding F-box protein 2-like     70.1    1e-10   Cicer arietinum [garbanzo]
ref|XP_010687976.1|  PREDICTED: EIN3-binding F-box protein 2-like     70.1    2e-10   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_197917.1|  EIN3-binding F-box protein 2                        69.3    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009151059.1|  PREDICTED: EIN3-binding F-box protein 2          69.3    3e-10   Brassica rapa
emb|CDX88173.1|  BnaA06g27640D                                        69.3    3e-10   
ref|XP_004242782.1|  PREDICTED: EIN3-binding F-box protein 1-like     68.6    4e-10   Solanum lycopersicum
ref|XP_009388655.1|  PREDICTED: EIN3-binding F-box protein 1-like     68.2    5e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006475854.1|  PREDICTED: EIN3-binding F-box protein 2-like     68.2    6e-10   
ref|XP_006450916.1|  hypothetical protein CICLE_v10007739mg           68.2    6e-10   
ref|XP_009111664.1|  PREDICTED: EIN3-binding F-box protein 2-like     67.8    8e-10   Brassica rapa
ref|XP_010086585.1|  hypothetical protein L484_002248                 67.8    9e-10   Morus notabilis
gb|KDO80236.1|  hypothetical protein CISIN_1g006749mg                 67.4    1e-09   Citrus sinensis [apfelsine]
gb|KJB07737.1|  hypothetical protein B456_001G042600                  67.0    2e-09   Gossypium raimondii
gb|EYU23011.1|  hypothetical protein MIMGU_mgv1a002803mg              66.6    2e-09   Erythranthe guttata [common monkey flower]
ref|XP_010421385.1|  PREDICTED: EIN3-binding F-box protein 2-like     66.2    3e-09   Camelina sativa [gold-of-pleasure]
ref|XP_009607234.1|  PREDICTED: EIN3-binding F-box protein 2-like     65.1    6e-09   Nicotiana tomentosiformis
emb|CDX87090.1|  BnaC09g04050D                                        64.7    7e-09   
emb|CDY35358.1|  BnaA04g14890D                                        64.7    8e-09   Brassica napus [oilseed rape]
ref|XP_009140675.1|  PREDICTED: EIN3-binding F-box protein 1          64.7    8e-09   Brassica rapa
ref|XP_007138419.1|  hypothetical protein PHAVU_009G207300g           64.3    1e-08   Phaseolus vulgaris [French bean]
emb|CDY19807.1|  BnaA09g04600D                                        63.9    1e-08   Brassica napus [oilseed rape]
emb|CDX80503.1|  BnaC07g29410D                                        63.9    2e-08   
ref|XP_009403463.1|  PREDICTED: EIN3-binding F-box protein 1-like     62.8    3e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009791397.1|  PREDICTED: EIN3-binding F-box protein 2-like     62.0    5e-08   Nicotiana sylvestris
ref|XP_003522913.1|  PREDICTED: EIN3-binding F-box protein 1-like     62.0    6e-08   Glycine max [soybeans]
ref|XP_007204219.1|  hypothetical protein PRUPE_ppa003009mg           61.6    8e-08   
gb|EPS63879.1|  f-box family protein                                  60.5    2e-07   Genlisea aurea
gb|ABK25485.1|  unknown                                               57.8    1e-06   Picea sitchensis
gb|KJB07621.1|  hypothetical protein B456_001G033400                  57.4    2e-06   Gossypium raimondii
ref|XP_010533156.1|  PREDICTED: EIN3-binding F-box protein 1-like     57.4    2e-06   Tarenaya hassleriana [spider flower]
gb|AES91540.2|  EIN3-binding F-box-like protein                       57.0    3e-06   Medicago truncatula
ref|XP_010541915.1|  PREDICTED: EIN3-binding F-box protein 1-like     55.1    1e-05   Tarenaya hassleriana [spider flower]
gb|KEH32122.1|  EIN3-binding F-box-like protein                       55.1    1e-05   Medicago truncatula
gb|KEH32121.1|  EIN3-binding F-box-like protein                       55.1    1e-05   Medicago truncatula
ref|XP_003609344.1|  Ein3-binding f-box protein                       55.1    1e-05   
emb|CDP13515.1|  unnamed protein product                              52.4    1e-05   Coffea canephora [robusta coffee]
ref|XP_004150592.1|  PREDICTED: EIN3-binding F-box protein 1-like     53.5    3e-05   Cucumis sativus [cucumbers]
ref|XP_003609343.1|  Ein3-binding f-box protein                       53.5    4e-05   
gb|EPS63568.1|  ein3-binding f-box protein 3                          52.8    6e-05   Genlisea aurea
ref|XP_002526343.1|  grr1, plant, putative                            49.3    2e-04   
ref|XP_008443991.1|  PREDICTED: EIN3-binding F-box protein 1-like     50.8    3e-04   Cucumis melo [Oriental melon]



>ref|XP_002515516.1| grr1, plant, putative [Ricinus communis]
 gb|EEF46965.1| grr1, plant, putative [Ricinus communis]
Length=651

 Score =   134 bits (338),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 63/83 (76%), Positives = 69/83 (83%), Gaps = 6/83 (7%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MSKL  F+G DDFCP      +P +  LFLSLGH VDVYFPSRKRSRINAPFVFSGE+ +
Sbjct  1    MSKLCGFAGDDDFCPGGSIYTNPKELGLFLSLGHHVDVYFPSRKRSRINAPFVFSGERFE  60

Query  550  EKKQASIEVLPDECLFEIFRRLP  618
            +KKQASIEVLPDECLFEIFRRLP
Sbjct  61   KKKQASIEVLPDECLFEIFRRLP  83



>gb|KHG28503.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=652

 Score =   126 bits (316),  Expect = 9e-30, Method: Composition-based stats.
 Identities = 61/83 (73%), Positives = 67/83 (81%), Gaps = 7/83 (8%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MSKL  FSG DDFCP      +P +S LFLSLG  VDVYFPSRKRSRI+APFVFSGE+ +
Sbjct  1    MSKLFSFSGTDDFCPGGSMYPNPKESSLFLSLGRHVDVYFPSRKRSRISAPFVFSGERFE  60

Query  550  EKKQASIEVLPDECLFEIFRRLP  618
            +KK  SIEVLPDECLFEIFRRLP
Sbjct  61   QKK-PSIEVLPDECLFEIFRRLP  82



>gb|KJB55011.1| hypothetical protein B456_009G058000 [Gossypium raimondii]
Length=652

 Score =   125 bits (315),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 61/83 (73%), Positives = 67/83 (81%), Gaps = 7/83 (8%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MSKL  FSG DDFCP      +P +S LFLSLG  VDVYFPSRKRSRI+APFVFSGE+ +
Sbjct  1    MSKLFSFSGTDDFCPGGSIYTNPKESSLFLSLGRHVDVYFPSRKRSRISAPFVFSGERFE  60

Query  550  EKKQASIEVLPDECLFEIFRRLP  618
            +KK  SIEVLPDECLFEIFRRLP
Sbjct  61   QKK-PSIEVLPDECLFEIFRRLP  82



>ref|XP_002324298.2| hypothetical protein POPTR_0018s01710g [Populus trichocarpa]
 gb|EEF02863.2| hypothetical protein POPTR_0018s01710g [Populus trichocarpa]
Length=646

 Score =   125 bits (314),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 59/83 (71%), Positives = 68/83 (82%), Gaps = 6/83 (7%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MSK+ EF+G +DFCP      +P +  LFLSLG  VDVYFPSRKRSRI+APFVFS E+ +
Sbjct  1    MSKVFEFAGENDFCPGGPIYTNPKEPSLFLSLGLPVDVYFPSRKRSRISAPFVFSEERFE  60

Query  550  EKKQASIEVLPDECLFEIFRRLP  618
            +KKQASIEVLPDECLFEIFRRLP
Sbjct  61   QKKQASIEVLPDECLFEIFRRLP  83



>gb|KDP33594.1| hypothetical protein JCGZ_07165 [Jatropha curcas]
Length=645

 Score =   125 bits (314),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 58/83 (70%), Positives = 66/83 (80%), Gaps = 6/83 (7%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MSKL  F+G DDFCP      +P ++ L LSLG  VDVYFPSRKRSRI+APFV  GE+ +
Sbjct  1    MSKLFGFAGDDDFCPGGPIYANPKEASLLLSLGRHVDVYFPSRKRSRISAPFVLVGERFE  60

Query  550  EKKQASIEVLPDECLFEIFRRLP  618
            +KKQASIEVLPDECLFEIFRRLP
Sbjct  61   QKKQASIEVLPDECLFEIFRRLP  83



>ref|XP_011036551.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   124 bits (311),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 58/83 (70%), Positives = 68/83 (82%), Gaps = 6/83 (7%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MS++ EF+G +DFCP      +P +  LFLSLG  VDVYFPSRKRSRI+APFVFS E+ +
Sbjct  1    MSQVFEFAGENDFCPGGPIYTNPKEPSLFLSLGLPVDVYFPSRKRSRISAPFVFSEERFE  60

Query  550  EKKQASIEVLPDECLFEIFRRLP  618
            +KKQASIEVLPDECLFEIFRRLP
Sbjct  61   QKKQASIEVLPDECLFEIFRRLP  83



>ref|XP_011016246.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   123 bits (308),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 57/83 (69%), Positives = 68/83 (82%), Gaps = 6/83 (7%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MS++ EF+G +DFCP      +P +  LFLSLG  VDVYFPSRKRSRI+APFVF+ E+ +
Sbjct  1    MSQVFEFAGENDFCPGGPIYTNPKEPSLFLSLGLPVDVYFPSRKRSRISAPFVFTEERFE  60

Query  550  EKKQASIEVLPDECLFEIFRRLP  618
            +KKQASIEVLPDECLFEIFRRLP
Sbjct  61   QKKQASIEVLPDECLFEIFRRLP  83



>ref|XP_007161212.1| hypothetical protein PHAVU_001G051300g [Phaseolus vulgaris]
 gb|ESW33206.1| hypothetical protein PHAVU_001G051300g [Phaseolus vulgaris]
Length=643

 Score =   123 bits (308),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 56/83 (67%), Positives = 65/83 (78%), Gaps = 6/83 (7%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MSK+L FSGGDDFCP      +P ++  FL LG QVDVYFP RKRSR+NAPFVF GE  +
Sbjct  1    MSKVLGFSGGDDFCPGGSLYANPKEASFFLPLGPQVDVYFPPRKRSRVNAPFVFDGEWFE  60

Query  550  EKKQASIEVLPDECLFEIFRRLP  618
            +K++ SIE LPDECLFEIFRRLP
Sbjct  61   QKQKTSIESLPDECLFEIFRRLP  83



>ref|XP_008466405.1| PREDICTED: EIN3-binding F-box protein 1 isoform X1 [Cucumis melo]
 ref|XP_008466406.1| PREDICTED: EIN3-binding F-box protein 1 isoform X1 [Cucumis melo]
Length=640

 Score =   122 bits (305),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 57/82 (70%), Positives = 62/82 (76%), Gaps = 6/82 (7%)
 Frame = +1

Query  388  MSKLLEFSGGDDFC------PSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MSKL  FSG +DFC      P+P DS LFLSL H VDVYFP RKRSRI APFVF GE+V+
Sbjct  1    MSKLFAFSGSEDFCTGGSIYPNPKDSSLFLSLPHHVDVYFPPRKRSRITAPFVFGGEEVE  60

Query  550  EKKQASIEVLPDECLFEIFRRL  615
             K   SIE+LPDECLFEIFRRL
Sbjct  61   SKANVSIEILPDECLFEIFRRL  82



>ref|XP_003544614.1| PREDICTED: EIN3-binding F-box protein 1-like isoform 1 [Glycine 
max]
 gb|KHN13750.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=644

 Score =   122 bits (305),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 56/83 (67%), Positives = 65/83 (78%), Gaps = 6/83 (7%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MSK+L FSG DDFCP      +P ++  FLSLG QVDVYFP RKRSR+NAPFVF GE  +
Sbjct  1    MSKVLGFSGVDDFCPMGSIYANPKEASFFLSLGPQVDVYFPPRKRSRVNAPFVFDGEWFE  60

Query  550  EKKQASIEVLPDECLFEIFRRLP  618
            +K++ SIE LPDECLFEIFRRLP
Sbjct  61   QKQKTSIEALPDECLFEIFRRLP  83



>ref|NP_001281254.1| EIN3-binding F-box protein 1-like [Cucumis sativus]
 gb|AHZ89385.1| EIN3-binding-Fbox protein 1 [Cucumis sativus]
 gb|KGN60100.1| Grr1 [Cucumis sativus]
Length=640

 Score =   121 bits (304),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 57/82 (70%), Positives = 62/82 (76%), Gaps = 6/82 (7%)
 Frame = +1

Query  388  MSKLLEFSGGDDFC------PSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MSKL  FSG +DFC      P+P DS LFLSL H VDVYFP RKRSRI APFVF GE+V+
Sbjct  1    MSKLFAFSGSEDFCTGGSIYPNPKDSSLFLSLPHHVDVYFPPRKRSRITAPFVFGGEEVE  60

Query  550  EKKQASIEVLPDECLFEIFRRL  615
             K   SIE+LPDECLFEIFRRL
Sbjct  61   SKANVSIEILPDECLFEIFRRL  82



>gb|KCW81401.1| hypothetical protein EUGRSUZ_C02778 [Eucalyptus grandis]
Length=635

 Score =   120 bits (300),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 54/83 (65%), Positives = 68/83 (82%), Gaps = 6/83 (7%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MSK+ EF+G  DFCP      +P ++ LFLSLG  VD+YFP+ KRSRI+APFVFSG+++ 
Sbjct  1    MSKVFEFTGDGDFCPGGSLYPNPKETSLFLSLGRHVDLYFPTCKRSRISAPFVFSGDQLK  60

Query  550  EKKQASIEVLPDECLFEIFRRLP  618
            +KK+ASI+VLPDECLFEIFRRLP
Sbjct  61   QKKKASIDVLPDECLFEIFRRLP  83



>ref|XP_010048972.1| PREDICTED: LOW QUALITY PROTEIN: EIN3-binding F-box protein 1-like 
[Eucalyptus grandis]
Length=653

 Score =   120 bits (300),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 54/83 (65%), Positives = 68/83 (82%), Gaps = 6/83 (7%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MSK+ EF+G  DFCP      +P ++ LFLSLG  VD+YFP+ KRSRI+APFVFSG+++ 
Sbjct  1    MSKVFEFTGDGDFCPGGSLYPNPKETSLFLSLGRHVDLYFPTCKRSRISAPFVFSGDQLK  60

Query  550  EKKQASIEVLPDECLFEIFRRLP  618
            +KK+ASI+VLPDECLFEIFRRLP
Sbjct  61   QKKKASIDVLPDECLFEIFRRLP  83



>ref|XP_011039690.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   118 bits (296),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 56/83 (67%), Positives = 67/83 (81%), Gaps = 6/83 (7%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCPS-PM-----DSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MSK+  F+G +DFCP  P+     +  LFLS+G  VDVYFPSRKRSRI+APFVF+ E+ +
Sbjct  1    MSKVFGFAGENDFCPGGPIYTNHKEQNLFLSIGRPVDVYFPSRKRSRISAPFVFTEERFE  60

Query  550  EKKQASIEVLPDECLFEIFRRLP  618
            +KKQASIEVLPDECLFEIFRRLP
Sbjct  61   QKKQASIEVLPDECLFEIFRRLP  83



>ref|XP_010102671.1| EIN3-binding F-box protein 1 [Morus notabilis]
 gb|EXC46038.1| EIN3-binding F-box protein 1 [Morus notabilis]
Length=697

 Score =   117 bits (293),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 54/73 (74%), Positives = 62/73 (85%), Gaps = 6/73 (8%)
 Frame = +1

Query  418  DDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQASIEVL  579
            DDFCP      +P DS LFLSLG+ VDVYFPSRKRSRI+APFVFS E++ +KK+ASI+VL
Sbjct  60   DDFCPGGPIYSNPKDSSLFLSLGNHVDVYFPSRKRSRISAPFVFSEERLQKKKKASIDVL  119

Query  580  PDECLFEIFRRLP  618
            PDECLFEIFRRLP
Sbjct  120  PDECLFEIFRRLP  132



>gb|KHN33913.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=644

 Score =   117 bits (292),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 53/83 (64%), Positives = 62/83 (75%), Gaps = 6/83 (7%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MSK+L FSG DDFCP      +P ++  FL LG QVDVYFP RKRSR+N PFVF GE  +
Sbjct  1    MSKVLGFSGVDDFCPMGSIYANPKEASFFLPLGPQVDVYFPPRKRSRVNTPFVFDGEWFE  60

Query  550  EKKQASIEVLPDECLFEIFRRLP  618
            +K + S+E LPDECLFEIFRRLP
Sbjct  61   QKPKTSVEALPDECLFEIFRRLP  83



>ref|XP_002308665.2| grr1 family protein [Populus trichocarpa]
 gb|EEE92188.2| grr1 family protein [Populus trichocarpa]
Length=646

 Score =   116 bits (290),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 55/83 (66%), Positives = 66/83 (80%), Gaps = 6/83 (7%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCPS-PM-----DSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MSK+  F+G +DFCP  P+     +  LFLS+G  VDVYFPSRKRSRI+APFVF+ E+ +
Sbjct  1    MSKVFGFAGENDFCPGGPIYTNHKEQNLFLSIGRPVDVYFPSRKRSRISAPFVFTEERFE  60

Query  550  EKKQASIEVLPDECLFEIFRRLP  618
            +KKQASIE LPDECLFEIFRRLP
Sbjct  61   QKKQASIEFLPDECLFEIFRRLP  83



>ref|XP_002285126.1| PREDICTED: EIN3-binding F-box protein 1-like [Vitis vinifera]
Length=667

 Score =   116 bits (290),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 54/83 (65%), Positives = 64/83 (77%), Gaps = 6/83 (7%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MSKL +++G D FCP      +  DS LFLSLG  VDVYFP RKRSRI+APFV SG+K +
Sbjct  1    MSKLFDYTGNDAFCPGGSIYSNIKDSSLFLSLGRHVDVYFPPRKRSRISAPFVVSGDKFE  60

Query  550  EKKQASIEVLPDECLFEIFRRLP  618
            +K+Q SI+VLPDECLFEI RRLP
Sbjct  61   QKEQVSIDVLPDECLFEILRRLP  83



>ref|XP_010250120.1| PREDICTED: EIN3-binding F-box protein 1-like [Nelumbo nucifera]
Length=671

 Score =   116 bits (290),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 54/83 (65%), Positives = 63/83 (76%), Gaps = 6/83 (7%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            M  L+ ++G +DFC       +PMDS L LSLG  VDVY P RKRSRI APFVF G+K +
Sbjct  1    MRTLVNYAGDEDFCSGGSLYANPMDSSLLLSLGPHVDVYCPPRKRSRITAPFVFRGDKFE  60

Query  550  EKKQASIEVLPDECLFEIFRRLP  618
            +KKQ+SIEVLPDECLFEIFRRLP
Sbjct  61   QKKQSSIEVLPDECLFEIFRRLP  83



>ref|XP_008394083.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
 ref|XP_008352056.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=646

 Score =   112 bits (281),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 54/82 (66%), Positives = 64/82 (78%), Gaps = 7/82 (9%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP-----SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  552
            MSKLL FSG DDFCP     +P ++ LFLSLGH  DV FP RKRSRI+APFVFSG + + 
Sbjct  1    MSKLLGFSGKDDFCPGGIYTNPKEAGLFLSLGHHADVLFPPRKRSRISAPFVFSGGRFE-  59

Query  553  KKQASIEVLPDECLFEIFRRLP  618
             K+ SI+VLPDECLFEIF+R+P
Sbjct  60   -KEVSIDVLPDECLFEIFKRIP  80



>ref|XP_009355743.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=646

 Score =   112 bits (281),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 54/82 (66%), Positives = 64/82 (78%), Gaps = 7/82 (9%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP-----SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  552
            MSKLL FSG DDFCP     +P ++ LFLSLGH  DV FP RKRSRI+APFVFSG + + 
Sbjct  1    MSKLLGFSGKDDFCPGGIYTNPKEAGLFLSLGHHADVLFPPRKRSRISAPFVFSGGRFE-  59

Query  553  KKQASIEVLPDECLFEIFRRLP  618
             K+ SI+VLPDECLFEIF+R+P
Sbjct  60   -KEVSIDVLPDECLFEIFKRIP  80



>ref|XP_010048202.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
 gb|KCW80383.1| hypothetical protein EUGRSUZ_C01744 [Eucalyptus grandis]
Length=643

 Score =   111 bits (278),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 53/83 (64%), Positives = 65/83 (78%), Gaps = 6/83 (7%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MSK+L F+GG+DF        SP ++ LFLSLG+ VDVYFP  KRSRI+APFVFS +  +
Sbjct  1    MSKVLRFTGGEDFYSGRSIYQSPKEANLFLSLGNHVDVYFPPSKRSRISAPFVFSEDLFE  60

Query  550  EKKQASIEVLPDECLFEIFRRLP  618
            +K+Q +IEVLPDECLFEIFRRLP
Sbjct  61   QKRQDTIEVLPDECLFEIFRRLP  83



>ref|XP_010254418.1| PREDICTED: EIN3-binding F-box protein 1-like [Nelumbo nucifera]
Length=673

 Score =   110 bits (276),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 52/83 (63%), Positives = 63/83 (76%), Gaps = 6/83 (7%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            M  L+ ++G +DFC       +PMDS L LSLG  VDVY P RKRSRI+APFVF  +K +
Sbjct  1    MPTLVNYAGDEDFCSGGSLYANPMDSSLLLSLGPHVDVYCPPRKRSRISAPFVFRCDKFE  60

Query  550  EKKQASIEVLPDECLFEIFRRLP  618
            ++KQ+SIEVLPDECLFEIFRRLP
Sbjct  61   QQKQSSIEVLPDECLFEIFRRLP  83



>emb|CBI21043.3| unnamed protein product [Vitis vinifera]
Length=610

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 63/83 (76%), Gaps = 6/83 (7%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCPSP------MDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MSKL +++G D FCP         DS LFLSLG  VDVYFP RKRSRI+APFV SG+K +
Sbjct  1    MSKLFDYTGNDAFCPGGSIYSNIKDSSLFLSLGRHVDVYFPPRKRSRISAPFVVSGDKFE  60

Query  550  EKKQASIEVLPDECLFEIFRRLP  618
            +K+Q SI+VLPDECLFEI RRLP
Sbjct  61   QKEQVSIDVLPDECLFEILRRLP  83



>ref|XP_004173614.1| PREDICTED: EIN3-binding F-box protein 1-like, partial [Cucumis 
sativus]
Length=631

 Score =   108 bits (271),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 49/71 (69%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +1

Query  403  EFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQASIEVLP  582
            +F  G    P+P DS LFLSL H VDVYFP RKRSRI APFVF GE+V+ K   SIE+LP
Sbjct  3    DFCTGGSIYPNPKDSSLFLSLPHHVDVYFPPRKRSRITAPFVFGGEEVESKANVSIEILP  62

Query  583  DECLFEIFRRL  615
            DECLFEIFRRL
Sbjct  63   DECLFEIFRRL  73



>ref|XP_004498740.1| PREDICTED: EIN3-binding F-box protein 1-like [Cicer arietinum]
Length=641

 Score =   108 bits (271),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 51/84 (61%), Positives = 62/84 (74%), Gaps = 7/84 (8%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCPS------PMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MS++  FSG D+FCPS      P ++  F SLGHQVD YFP +KRSR++ PFVF GE   
Sbjct  1    MSQVFGFSG-DNFCPSGSIYTNPKEASFFPSLGHQVDAYFPPQKRSRVSVPFVFDGEWFT  59

Query  550  EKKQASIEVLPDECLFEIFRRLPV  621
            +K++ SIE LPDECLFEIFRRLPV
Sbjct  60   QKQKTSIESLPDECLFEIFRRLPV  83



>ref|XP_009376923.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score =   108 bits (270),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 61/82 (74%), Gaps = 6/82 (7%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCPSPM-----DSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  552
            MSKLL FSG DDFCP  +     ++ L LSLGH  DV FP RKRSRI+APF+FSG    E
Sbjct  1    MSKLLGFSGKDDFCPGGIYTNLKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYF-E  59

Query  553  KKQASIEVLPDECLFEIFRRLP  618
            KK+ SI VLPDECLFEIF+R+P
Sbjct  60   KKEVSINVLPDECLFEIFKRIP  81



>ref|XP_007225116.1| hypothetical protein PRUPE_ppa002673mg [Prunus persica]
 gb|EMJ26315.1| hypothetical protein PRUPE_ppa002673mg [Prunus persica]
Length=646

 Score =   108 bits (270),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 51/83 (61%), Positives = 61/83 (73%), Gaps = 6/83 (7%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MSKLL F+G DDFCP      +P +  LFLS G+  DV+F  RKRSRI+ PFVFS E  +
Sbjct  1    MSKLLGFAGNDDFCPGGSIYTNPKEPSLFLSRGNHADVFFTPRKRSRISGPFVFSEEGFE  60

Query  550  EKKQASIEVLPDECLFEIFRRLP  618
            +KK  SI+VLPDECLFEIF+RLP
Sbjct  61   QKKPVSIDVLPDECLFEIFKRLP  83



>ref|XP_008365190.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X1 [Malus 
domestica]
Length=646

 Score =   108 bits (269),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 52/82 (63%), Positives = 61/82 (74%), Gaps = 7/82 (9%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP-----SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  552
            MSKLL FSG DDFCP     +P ++ L LSLGH  DV FP RKRSRI+APF+FSG   + 
Sbjct  1    MSKLLGFSGKDDFCPGGIYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFE-  59

Query  553  KKQASIEVLPDECLFEIFRRLP  618
             K+ SI VLPDECLFEIF+R+P
Sbjct  60   -KEVSINVLPDECLFEIFKRIP  80



>ref|XP_008378375.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X1 [Malus 
domestica]
Length=646

 Score =   108 bits (269),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 52/82 (63%), Positives = 61/82 (74%), Gaps = 7/82 (9%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP-----SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  552
            MSKLL FSG DDFCP     +P ++ L LSLGH  DV FP RKRSRI+APF+FSG   + 
Sbjct  1    MSKLLGFSGKDDFCPGGIYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFE-  59

Query  553  KKQASIEVLPDECLFEIFRRLP  618
             K+ SI VLPDECLFEIF+R+P
Sbjct  60   -KEVSINVLPDECLFEIFKRIP  80



>gb|AFT92041.1| EIN3 binding F-box 1 [Malus domestica]
Length=646

 Score =   108 bits (269),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 52/82 (63%), Positives = 61/82 (74%), Gaps = 7/82 (9%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP-----SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  552
            MSKLL FSG DDFCP     +P ++ L LSLGH  DV FP RKRSRI+APF+FSG   + 
Sbjct  1    MSKLLGFSGKDDFCPGGIYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFE-  59

Query  553  KKQASIEVLPDECLFEIFRRLP  618
             K+ SI VLPDECLFEIF+R+P
Sbjct  60   -KEVSINVLPDECLFEIFKRIP  80



>ref|XP_008466407.1| PREDICTED: EIN3-binding F-box protein 1 isoform X2 [Cucumis melo]
Length=690

 Score =   108 bits (269),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 49/71 (69%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +1

Query  403  EFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQASIEVLP  582
            +F  G    P+P DS LFLSL H VDVYFP RKRSRI APFVF GE+V+ K   SIE+LP
Sbjct  62   DFCTGGSIYPNPKDSSLFLSLPHHVDVYFPPRKRSRITAPFVFGGEEVESKANVSIEILP  121

Query  583  DECLFEIFRRL  615
            DECLFEIFRRL
Sbjct  122  DECLFEIFRRL  132



>ref|XP_011081561.1| PREDICTED: EIN3-binding F-box protein 1-like [Sesamum indicum]
Length=669

 Score =   106 bits (265),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 51/83 (61%), Positives = 60/83 (72%), Gaps = 9/83 (11%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MSK+ +F G  DFCP      +P ++ LFL LG  VDVYFP RKRSRI+APFV SG    
Sbjct  1    MSKVFDFGGDSDFCPGGFLYQNPKEAGLFLPLGSHVDVYFPPRKRSRISAPFVVSGVA--  58

Query  550  EKKQASIEVLPDECLFEIFRRLP  618
             K+Q SIE+LPDECLFE+FRRLP
Sbjct  59   -KQQPSIEILPDECLFEVFRRLP  80



>ref|XP_008347724.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=150

 Score =   100 bits (249),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 61/82 (74%), Gaps = 7/82 (9%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP-----SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  552
            MSKLL FSG DDFCP     +P ++ L LSLGH  DV FP RKRSRI+APF+FSG   + 
Sbjct  1    MSKLLGFSGKDDFCPGGIYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFE-  59

Query  553  KKQASIEVLPDECLFEIFRRLP  618
             K+ SI VLPDECLFEIF+R+P
Sbjct  60   -KEVSINVLPDECLFEIFKRIP  80



>ref|XP_006450435.1| hypothetical protein CICLE_v10007708mg [Citrus clementina]
 gb|ESR63675.1| hypothetical protein CICLE_v10007708mg [Citrus clementina]
Length=645

 Score =   105 bits (263),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 61/82 (74%), Gaps = 7/82 (9%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MSKL   SG DDFCP      +P +S L L LG  VD+YF +RKRSRI+APFV+S E+  
Sbjct  1    MSKLFALSGSDDFCPGGPIYPNPKESGLLLPLGPNVDIYFRARKRSRISAPFVYSEERF-  59

Query  550  EKKQASIEVLPDECLFEIFRRL  615
            E+KQ SIEVLPDECLFEIFRRL
Sbjct  60   EQKQVSIEVLPDECLFEIFRRL  81



>ref|XP_004291457.1| PREDICTED: EIN3-binding F-box protein 1-like [Fragaria vesca 
subsp. vesca]
Length=645

 Score =   105 bits (262),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 62/83 (75%), Gaps = 6/83 (7%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MSKL  F+G DDFCP      +P ++  FLSLG +VD+Y+P  KRSR +APFVF+ E  +
Sbjct  1    MSKLFGFAGSDDFCPGGSIYENPKEAGRFLSLGRRVDLYYPPSKRSRNSAPFVFNQESFE  60

Query  550  EKKQASIEVLPDECLFEIFRRLP  618
            + KQ SI+VLP+ECLFEIF+RLP
Sbjct  61   QNKQVSIDVLPEECLFEIFKRLP  83



>ref|XP_008219497.1| PREDICTED: LOW QUALITY PROTEIN: EIN3-binding F-box protein 1-like 
[Prunus mume]
Length=630

 Score =   104 bits (259),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 50/83 (60%), Positives = 59/83 (71%), Gaps = 6/83 (7%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MSKLL   G DDFCP      +P +  LFLSLG+  DV+F  RKRSRI+  FVFS E  +
Sbjct  1    MSKLLGLPGNDDFCPGGSIYTNPKEPSLFLSLGNHADVFFTPRKRSRISGTFVFSEEGFE  60

Query  550  EKKQASIEVLPDECLFEIFRRLP  618
            +KK  SI+VLPDECLFEIF+RLP
Sbjct  61   QKKPVSIDVLPDECLFEIFKRLP  83



>gb|KJB82811.1| hypothetical protein B456_013G215000 [Gossypium raimondii]
Length=639

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 61/83 (73%), Gaps = 7/83 (8%)
 Frame = +1

Query  388  MSKLLEFSGGDDF------CPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MSKL  FSG D+F       P+P +S LF SLGH VDVYFP  KRSRI+ P V SGE+V 
Sbjct  1    MSKLFSFSGSDNFFPGGSIYPNPKESSLFFSLGHHVDVYFPHHKRSRISPPIVCSGERV-  59

Query  550  EKKQASIEVLPDECLFEIFRRLP  618
            EKK  SIE+LPDECLFEIFRRLP
Sbjct  60   EKKNPSIEILPDECLFEIFRRLP  82



>ref|XP_003588766.1| Ein3-binding f-box protein [Medicago truncatula]
 gb|AES59017.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=643

 Score =   103 bits (258),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 63/83 (76%), Gaps = 6/83 (7%)
 Frame = +1

Query  388  MSKLLEFSGGDDFC-----PSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  552
            MS++  FSG D+FC      +P ++  FLSLG QVDVY+P +KRSR++ PFVF GE  ++
Sbjct  1    MSQVFGFSG-DNFCHGGLYTNPKEANFFLSLGPQVDVYYPPQKRSRVSVPFVFDGEWFEQ  59

Query  553  KKQASIEVLPDECLFEIFRRLPV  621
            K++ SIE LPDECLFEIFRRLPV
Sbjct  60   KQKTSIESLPDECLFEIFRRLPV  82



>ref|XP_004138725.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 ref|XP_004160764.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 gb|KGN62950.1| hypothetical protein Csa_2G381760 [Cucumis sativus]
Length=646

 Score =   102 bits (254),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 49/72 (68%), Positives = 58/72 (81%), Gaps = 2/72 (3%)
 Frame = +1

Query  403  EFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQASIEVLP  582
            +F  G    P+P D+ LFLSLG QVDVY+P RKRSR++APFV SGE +  KK+ASIEVLP
Sbjct  14   DFFPGAPIYPNPKDTSLFLSLGRQVDVYYPLRKRSRVSAPFVPSGEIL--KKEASIEVLP  71

Query  583  DECLFEIFRRLP  618
            DECLFEIF+RLP
Sbjct  72   DECLFEIFKRLP  83



>ref|XP_007011864.1| EIN3-binding F box protein 1 [Theobroma cacao]
 gb|EOY29483.1| EIN3-binding F box protein 1 [Theobroma cacao]
Length=696

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 60/75 (80%), Gaps = 7/75 (9%)
 Frame = +1

Query  412  GGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQASIE  573
            G DDFCP      +P +S  FLSLGH VDVYFP RK+SRI+APFVFSGE+ ++KK  SI+
Sbjct  56   GSDDFCPGGSIYPNPKESSHFLSLGHHVDVYFPLRKKSRISAPFVFSGERFEQKK-PSID  114

Query  574  VLPDECLFEIFRRLP  618
            VLPDECLFEIFRRLP
Sbjct  115  VLPDECLFEIFRRLP  129



>ref|XP_003603398.1| Ein3-binding f-box protein, partial [Medicago truncatula]
Length=627

 Score =   101 bits (251),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 51/84 (61%), Positives = 58/84 (69%), Gaps = 7/84 (8%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEK-V  546
            MSK+L F+GGDDFC       +P ++ LFLSLG Q   Y P +KRSR N PF FSGEK  
Sbjct  1    MSKVLSFTGGDDFCTGRSMYLNPKEASLFLSLGRQEYAYRPLQKRSRFNVPFDFSGEKWF  60

Query  547  DEKKQASIEVLPDECLFEIFRRLP  618
            D K + SIE LPDECLFEI RRLP
Sbjct  61   DLKPETSIETLPDECLFEILRRLP  84



>gb|AES73649.2| EIN3-binding F-box-like protein [Medicago truncatula]
Length=641

 Score =   101 bits (251),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 51/84 (61%), Positives = 58/84 (69%), Gaps = 7/84 (8%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEK-V  546
            MSK+L F+GGDDFC       +P ++ LFLSLG Q   Y P +KRSR N PF FSGEK  
Sbjct  1    MSKVLSFTGGDDFCTGRSMYLNPKEASLFLSLGRQEYAYRPLQKRSRFNVPFDFSGEKWF  60

Query  547  DEKKQASIEVLPDECLFEIFRRLP  618
            D K + SIE LPDECLFEI RRLP
Sbjct  61   DLKPETSIETLPDECLFEILRRLP  84



>ref|XP_002285249.2| PREDICTED: EIN3-binding F-box protein 1-like [Vitis vinifera]
Length=663

 Score =   100 bits (249),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 47/85 (55%), Positives = 61/85 (72%), Gaps = 6/85 (7%)
 Frame = +1

Query  382  VPMSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEK  543
            +PMS L+ +SG DDF P      +PMDS L +S+G  +DVY P RKRSRI AP++F    
Sbjct  1    MPMSTLVNYSGDDDFYPGGSFYINPMDSGLLVSIGSCMDVYCPPRKRSRITAPYIFRENN  60

Query  544  VDEKKQASIEVLPDECLFEIFRRLP  618
            ++ +K+ SI+VLPDECLFEI RRLP
Sbjct  61   LELEKRPSIDVLPDECLFEILRRLP  85



>ref|XP_003522614.1| PREDICTED: EIN3-binding F-box protein 1-like isoform 1 [Glycine 
max]
 gb|KHN08132.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=636

 Score =   100 bits (249),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 57/83 (69%), Gaps = 6/83 (7%)
 Frame = +1

Query  388  MSKLLEFSGGDDFC------PSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MSK+  F+G DDF       P+P +  LFLSLG QVDVY P +KRSR + PF  SGE  +
Sbjct  1    MSKVFSFTGNDDFYHGGPIYPNPKEPCLFLSLGRQVDVYLPLQKRSRFSVPFDISGEWFE  60

Query  550  EKKQASIEVLPDECLFEIFRRLP  618
            +K + SIE LPDECLFEI RRLP
Sbjct  61   QKPKTSIESLPDECLFEILRRLP  83



>ref|XP_006483363.1| PREDICTED: EIN3-binding F-box protein 1-like [Citrus sinensis]
 gb|KDO61730.1| hypothetical protein CISIN_1g006426mg [Citrus sinensis]
Length=645

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 61/82 (74%), Gaps = 7/82 (9%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MSKL   SG DDFCP      +P +S L L LG  VDVYF +RKRSRI+APFV+S E+  
Sbjct  1    MSKLFALSGSDDFCPGGPIYPNPKESGLLLPLGPNVDVYFRARKRSRISAPFVYSEERF-  59

Query  550  EKKQASIEVLPDECLFEIFRRL  615
            E+KQ SIEVLPDECLFEIFRRL
Sbjct  60   EQKQVSIEVLPDECLFEIFRRL  81



>ref|XP_009614726.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana tomentosiformis]
Length=669

 Score =   100 bits (248),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 51/82 (62%), Positives = 60/82 (73%), Gaps = 9/82 (11%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MSK+  FSG + FCP      SP +S LFLSLGH VDVYFP  KRSRI AP +F+ EK  
Sbjct  1    MSKVFNFSGDEAFCPGRALYPSPKESSLFLSLGHHVDVYFPPCKRSRITAPIIFT-EK--  57

Query  550  EKKQASIEVLPDECLFEIFRRL  615
            +KK  SI+VLPDECLFE+FRR+
Sbjct  58   QKKLPSIDVLPDECLFEVFRRV  79



>gb|EYU20264.1| hypothetical protein MIMGU_mgv1a002548mg [Erythranthe guttata]
Length=660

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 48/82 (59%), Positives = 60/82 (73%), Gaps = 9/82 (11%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCPS------PMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MS++++FSG + FCPS      P +S  FLSLG  V+VYF  RKRSRI APF+ SGE   
Sbjct  1    MSQVVDFSGDNSFCPSAFLYQNPKESSQFLSLGSHVNVYFTPRKRSRITAPFIVSGEP--  58

Query  550  EKKQASIEVLPDECLFEIFRRL  615
             K++ SIE+LPDECLFE+FRRL
Sbjct  59   -KQKPSIEILPDECLFEVFRRL  79



>ref|XP_008445218.1| PREDICTED: EIN3-binding F-box protein 1 [Cucumis melo]
Length=646

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 50/84 (60%), Positives = 65/84 (77%), Gaps = 8/84 (10%)
 Frame = +1

Query  388  MSKLLEFS--GGDDFCPSPM-----DSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKV  546
            M+K+  F+    +DF P+P+     D+ LFLSLG  VDVY+P RKRSR++AP+V SGE +
Sbjct  1    MAKIFGFTLKESEDFFPAPIYPNPKDTSLFLSLGPHVDVYYPLRKRSRVSAPYVPSGE-I  59

Query  547  DEKKQASIEVLPDECLFEIFRRLP  618
             +KK+ASIEVLPDECLFEIF+RLP
Sbjct  60   LKKKEASIEVLPDECLFEIFKRLP  83



>ref|XP_009801071.1| PREDICTED: EIN3-binding F-box protein 1 [Nicotiana sylvestris]
Length=669

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 50/82 (61%), Positives = 59/82 (72%), Gaps = 9/82 (11%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MSK+  FSG D FCP      SP +S LFLSLGH VDVYFP  KRSR+ AP +F+ EK  
Sbjct  1    MSKVFNFSGDDAFCPGGALYPSPKESSLFLSLGHHVDVYFPPCKRSRVTAPIIFT-EK--  57

Query  550  EKKQASIEVLPDECLFEIFRRL  615
            +KK  SI+VLPDECLFE+ RR+
Sbjct  58   QKKLPSIDVLPDECLFEVLRRV  79



>emb|CAN82790.1| hypothetical protein VITISV_030601 [Vitis vinifera]
Length=718

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 56/75 (75%), Gaps = 6/75 (8%)
 Frame = +1

Query  412  GGDDFCPSP------MDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQASIE  573
            G D FCP         DS LFLSLG  VDVYFP RKRSRI+APFV SG+K ++K+Q SI+
Sbjct  109  GNDAFCPGGSIYSNIKDSSLFLSLGRHVDVYFPPRKRSRISAPFVVSGDKFEQKEQVSID  168

Query  574  VLPDECLFEIFRRLP  618
            VLPDECLFEI RRLP
Sbjct  169  VLPDECLFEILRRLP  183



>ref|XP_009376911.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=651

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 46/76 (61%), Positives = 55/76 (72%), Gaps = 6/76 (8%)
 Frame = +1

Query  406  FSGGDDFCPSPM-----DSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQASI  570
             +G DDFCP  +     ++ L LSLGH  DV FP RKRSRI+APF+FSG    EKK+ SI
Sbjct  11   LAGKDDFCPGGIYTNLKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYF-EKKEVSI  69

Query  571  EVLPDECLFEIFRRLP  618
             VLPDECLFEIF+R+P
Sbjct  70   NVLPDECLFEIFKRIP  85



>gb|KJB65824.1| hypothetical protein B456_010G114900 [Gossypium raimondii]
Length=651

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 52/83 (63%), Positives = 58/83 (70%), Gaps = 9/83 (11%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MSKL  FSG DDFCP      +  +S LFL      DVYFP  KR RI+APFVF+G K +
Sbjct  1    MSKLFAFSGSDDFCPGGSIYPNLKESSLFLYPNQ--DVYFPPCKRYRISAPFVFAGGKFE  58

Query  550  EKKQASIEVLPDECLFEIFRRLP  618
            +KK  SIEVLPDECLFEIFRRLP
Sbjct  59   QKK-PSIEVLPDECLFEIFRRLP  80



>emb|CBI28209.3| unnamed protein product [Vitis vinifera]
Length=546

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 61/85 (72%), Gaps = 6/85 (7%)
 Frame = +1

Query  382  VPMSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEK  543
            +PMS L+ +SG DDF P      +PMDS L +S+G  +DVY P RKRSRI AP++F    
Sbjct  1    MPMSTLVNYSGDDDFYPGGSFYINPMDSGLLVSIGSCMDVYCPPRKRSRITAPYIFRENN  60

Query  544  VDEKKQASIEVLPDECLFEIFRRLP  618
            ++ +K+ SI+VLPDECLFEI RRLP
Sbjct  61   LELEKRPSIDVLPDECLFEILRRLP  85



>ref|XP_002880682.1| ein3-binding F box protein 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56941.1| ein3-binding F box protein 1 [Arabidopsis lyrata subsp. lyrata]
Length=629

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 50/83 (60%), Positives = 58/83 (70%), Gaps = 9/83 (11%)
 Frame = +1

Query  388  MSKLLEFSGGDDFC------PSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MS++  F+G +DF       P+P D+ L LSLG  VDVYFP  KRSR+ AP VFSG    
Sbjct  1    MSQIYSFAGENDFYRRGAIYPNPKDASLLLSLGSFVDVYFPPSKRSRVVAPTVFSGF---  57

Query  550  EKKQASIEVLPDECLFEIFRRLP  618
            EKK  SI+VLPDECLFEIFRRLP
Sbjct  58   EKKPVSIDVLPDECLFEIFRRLP  80



>gb|KJB65823.1| hypothetical protein B456_010G114900 [Gossypium raimondii]
Length=672

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 52/83 (63%), Positives = 58/83 (70%), Gaps = 9/83 (11%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MSKL  FSG DDFCP      +  +S LFL      DVYFP  KR RI+APFVF+G K +
Sbjct  1    MSKLFAFSGSDDFCPGGSIYPNLKESSLFLYPNQ--DVYFPPCKRYRISAPFVFAGGKFE  58

Query  550  EKKQASIEVLPDECLFEIFRRLP  618
            +KK  SIEVLPDECLFEIFRRLP
Sbjct  59   QKK-PSIEVLPDECLFEIFRRLP  80



>ref|XP_006364926.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=669

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 48/82 (59%), Positives = 58/82 (71%), Gaps = 9/82 (11%)
 Frame = +1

Query  388  MSKLLEFSGGDDFC------PSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MSK+  FSG D F       PSP +S LFLSLG+ VDVYFP  KRSR+  PFVF+ +K  
Sbjct  1    MSKVFNFSGDDAFYHGGAVYPSPKESSLFLSLGNHVDVYFPPCKRSRVAVPFVFTEKK--  58

Query  550  EKKQASIEVLPDECLFEIFRRL  615
             +K +SI+VLPDECLFE+ RRL
Sbjct  59   -QKLSSIDVLPDECLFEVLRRL  79



>ref|XP_008365191.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X2 [Malus 
domestica]
Length=694

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 44/72 (61%), Positives = 53/72 (74%), Gaps = 7/72 (10%)
 Frame = +1

Query  418  DDFCP-----SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQASIEVLP  582
            DDFCP     +P ++ L LSLGH  DV FP RKRSRI+APF+FSG   +  K+ SI VLP
Sbjct  59   DDFCPGGIYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFE--KEVSINVLP  116

Query  583  DECLFEIFRRLP  618
            DECLFEIF+R+P
Sbjct  117  DECLFEIFKRIP  128



>ref|XP_008378376.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X2 [Malus 
domestica]
Length=694

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 44/72 (61%), Positives = 53/72 (74%), Gaps = 7/72 (10%)
 Frame = +1

Query  418  DDFCP-----SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQASIEVLP  582
            DDFCP     +P ++ L LSLGH  DV FP RKRSRI+APF+FSG   +  K+ SI VLP
Sbjct  59   DDFCPGGIYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFE--KEVSINVLP  116

Query  583  DECLFEIFRRLP  618
            DECLFEIF+R+P
Sbjct  117  DECLFEIFKRIP  128



>gb|KHN07078.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=635

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 47/82 (57%), Positives = 56/82 (68%), Gaps = 8/82 (10%)
 Frame = +1

Query  397  LLEFSGGDDFC------PSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKK  558
            +L FSG DDF       P+P +  LFLSLG QVDVY P +KRSR + PF  SGE  ++K+
Sbjct  1    MLGFSGNDDFYHGGPIYPNPKEPCLFLSLGRQVDVYLPLQKRSRFSVPFDISGEWFEQKQ  60

Query  559  --QASIEVLPDECLFEIFRRLP  618
              + SIE LPDECLFEI RRLP
Sbjct  61   KPKTSIESLPDECLFEILRRLP  82



>ref|XP_010429542.1| PREDICTED: EIN3-binding F-box protein 1 [Camelina sativa]
Length=636

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 58/83 (70%), Gaps = 9/83 (11%)
 Frame = +1

Query  388  MSKLLEFSGGDDFC------PSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MS++  F+G ++F       P+P D+ L LSLG  VDVYFP  KRSR+ AP VFS     
Sbjct  1    MSQIYSFAGENEFYRRGAIYPNPKDASLLLSLGSYVDVYFPPSKRSRVVAPTVFSAF---  57

Query  550  EKKQASIEVLPDECLFEIFRRLP  618
            E+KQ SI+VLPDECLFEIFRRLP
Sbjct  58   EEKQVSIDVLPDECLFEIFRRLP  80



>ref|XP_002524506.1| grr1, plant, putative [Ricinus communis]
 gb|EEF37946.1| grr1, plant, putative [Ricinus communis]
Length=648

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 42/82 (51%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +1

Query  373  PAVVPMSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  552
            PA+V  S   EF  G   C +PMD   + S+G  VD Y P  KR+RI++PF+F   + ++
Sbjct  2    PALVNYSGDDEFYSGGSLCANPMDLGRYYSIGSHVDAYSPPCKRARISSPFLFGSSEFEQ  61

Query  553  KKQASIEVLPDECLFEIFRRLP  618
             KQ SI+VLPDECLFEIFRR+P
Sbjct  62   NKQPSIDVLPDECLFEIFRRIP  83



>gb|KHG15742.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=651

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 57/83 (69%), Gaps = 9/83 (11%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MSKL  FSG DDFCP      +  +S LF       DVYFP  KR R+++PFVF+G K +
Sbjct  1    MSKLFAFSGSDDFCPGGSIYPNRKESSLFFYPNQ--DVYFPPCKRCRVSSPFVFAGGKFE  58

Query  550  EKKQASIEVLPDECLFEIFRRLP  618
            +KK  SIE+LPDECLFEIFRRLP
Sbjct  59   QKK-PSIEILPDECLFEIFRRLP  80



>ref|XP_007137020.1| hypothetical protein PHAVU_009G093200g [Phaseolus vulgaris]
 gb|ESW09014.1| hypothetical protein PHAVU_009G093200g [Phaseolus vulgaris]
Length=643

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 48/84 (57%), Positives = 56/84 (67%), Gaps = 8/84 (10%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MS++  FSG DDFCP      +P +  LFLSLG  VD YFP +KRSR++  F  + E  D
Sbjct  1    MSQVFSFSGNDDFCPGGRIYPNPKEPCLFLSLGRSVD-YFPLQKRSRVSVSFDINREWFD  59

Query  550  EKKQ-ASIEVLPDECLFEIFRRLP  618
            E KQ  SIE LPDECLFEI RRLP
Sbjct  60   EPKQKTSIESLPDECLFEILRRLP  83



>ref|XP_010555012.1| PREDICTED: EIN3-binding F-box protein 2-like [Tarenaya hassleriana]
Length=624

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 46/77 (60%), Positives = 54/77 (70%), Gaps = 6/77 (8%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQAS  567
            MS L  FSG +DF P      L+LS G Q+DVY+P+ KRSRI AP +FSG    E+ Q S
Sbjct  1    MSGLFRFSGDEDFFPG---GSLYLSPGSQIDVYYPAHKRSRIAAPAIFSGF---EQNQVS  54

Query  568  IEVLPDECLFEIFRRLP  618
            I+VLPDECLFEIFR LP
Sbjct  55   IDVLPDECLFEIFRCLP  71



>ref|XP_006293838.1| hypothetical protein CARUB_v10022822mg [Capsella rubella]
 gb|EOA26736.1| hypothetical protein CARUB_v10022822mg [Capsella rubella]
Length=628

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 57/83 (69%), Gaps = 9/83 (11%)
 Frame = +1

Query  388  MSKLLEFSGGDDFC------PSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MS++  F+G ++F       P+P D+ L LSLG  VDVYFP  KRSR+ AP VFS     
Sbjct  1    MSQIYSFAGENEFYRRGAIYPNPKDASLLLSLGSFVDVYFPPSKRSRVVAPTVFSSF---  57

Query  550  EKKQASIEVLPDECLFEIFRRLP  618
            EKK  SI+VLPDECLFEIFRRLP
Sbjct  58   EKKPVSIDVLPDECLFEIFRRLP  80



>gb|EYU32346.1| hypothetical protein MIMGU_mgv1a002758mg [Erythranthe guttata]
Length=640

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 45/77 (58%), Positives = 57/77 (74%), Gaps = 3/77 (4%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQAS  567
            MS++ +FS    FCP+  DS L  +LG +VD+YF  RKRSRI+APF+ +G+K   K Q+S
Sbjct  1    MSEVFDFSDVHTFCPNSKDSNLSFTLGSRVDMYFLQRKRSRISAPFI-AGKK--SKMQSS  57

Query  568  IEVLPDECLFEIFRRLP  618
            IE LPDECLFEI RRLP
Sbjct  58   IEALPDECLFEILRRLP  74



>ref|XP_010472548.1| PREDICTED: EIN3-binding F-box protein 1 [Camelina sativa]
Length=631

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 47/83 (57%), Positives = 57/83 (69%), Gaps = 9/83 (11%)
 Frame = +1

Query  388  MSKLLEFSGGDDFC------PSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MS++  F+G ++F       P+P D+ L LSLG  VDVYFP  KRSR+ AP VFS     
Sbjct  1    MSQIYSFAGENEFYRRGAIYPNPKDASLLLSLGSYVDVYFPPSKRSRVVAPTVFSAF---  57

Query  550  EKKQASIEVLPDECLFEIFRRLP  618
            E+K  SI+VLPDECLFEIFRRLP
Sbjct  58   EEKPVSIDVLPDECLFEIFRRLP  80



>ref|NP_001234864.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
 gb|ABC24972.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
 gb|ACS44349.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
Length=665

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 47/78 (60%), Positives = 55/78 (71%), Gaps = 5/78 (6%)
 Frame = +1

Query  388  MSKLLEFSG--GDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQ  561
            MSK+  FSG  G    PSP +S LFLSL + VDVYFP  KRSR+  PFVFS +K    K 
Sbjct  1    MSKVFNFSGDHGGTVYPSPKESSLFLSLRNHVDVYFPPCKRSRVAVPFVFSEKK---HKL  57

Query  562  ASIEVLPDECLFEIFRRL  615
            +SI+VLPDECLFE+ RRL
Sbjct  58   SSIDVLPDECLFEVLRRL  75



>ref|NP_565597.1| EIN3-binding F-box protein 1 [Arabidopsis thaliana]
 sp|Q9SKK0.1|EBF1_ARATH RecName: Full=EIN3-binding F-box protein 1; AltName: Full=F-box/LRR-repeat 
protein 6 [Arabidopsis thaliana]
 gb|AAD20708.1| F-box protein family, AtFBL6 [Arabidopsis thaliana]
 gb|AAL60026.1| putative F-box protein family, AtFBL6 [Arabidopsis thaliana]
 gb|AAM14272.1| unknown protein [Arabidopsis thaliana]
 emb|CAE75864.1| F-box protein [Arabidopsis thaliana]
 gb|AEC07708.1| EIN3-binding F-box protein 1 [Arabidopsis thaliana]
Length=628

 Score = 88.6 bits (218),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 46/82 (56%), Positives = 55/82 (67%), Gaps = 9/82 (11%)
 Frame = +1

Query  388  MSKLLEFSGGDDFC------PSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MS++  F+G +DF       P+P D+ L LSLG   DVYFP  KRSR+ AP +FS     
Sbjct  1    MSQIFSFAGENDFYRRGAIYPNPKDASLLLSLGSFADVYFPPSKRSRVVAPTIFSAF---  57

Query  550  EKKQASIEVLPDECLFEIFRRL  615
            EKK  SI+VLPDECLFEIFRRL
Sbjct  58   EKKPVSIDVLPDECLFEIFRRL  79



>ref|XP_010541601.1| PREDICTED: EIN3-binding F-box protein 2 [Tarenaya hassleriana]
Length=624

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 45/77 (58%), Positives = 54/77 (70%), Gaps = 6/77 (8%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQAS  567
            MS L  FSG + + P      + LS G  + VY+P+RKRSRI+AP +FSG    E+ QAS
Sbjct  1    MSGLFRFSGDEGYFPG---GSMCLSPGSNIGVYYPARKRSRISAPSLFSGF---ERNQAS  54

Query  568  IEVLPDECLFEIFRRLP  618
            IEVLPDECLFEIFRRLP
Sbjct  55   IEVLPDECLFEIFRRLP  71



>ref|XP_011069870.1| PREDICTED: EIN3-binding F-box protein 1 [Sesamum indicum]
Length=666

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 58/82 (71%), Gaps = 8/82 (10%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP-----SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  552
            MS++ +F     FCP     +P  S LFL LG+ VDVYF  RKRSRI+APFV SGE    
Sbjct  1    MSEVFDFKAVGKFCPGGFLTNPKVSSLFLPLGNHVDVYFLPRKRSRISAPFVVSGEP---  57

Query  553  KKQASIEVLPDECLFEIFRRLP  618
            ++Q SI+VLPDECLFE+FRRLP
Sbjct  58   EQQPSIDVLPDECLFEVFRRLP  79



>ref|XP_010696236.1| PREDICTED: EIN3-binding F-box protein 1 [Beta vulgaris subsp. 
vulgaris]
Length=641

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 44/85 (52%), Positives = 62/85 (73%), Gaps = 9/85 (11%)
 Frame = +1

Query  388  MSKLLEFSGGDDFC------PSPMDSILFLSLG--HQVDVYFPSRKRSRINAPFVFSGEK  543
            MS++ +FSG ++F        +P ++  FLSLG  + VDVYFP+ KR+RI+AP V  GE 
Sbjct  1    MSQIFDFSGNEEFYHGGSIYSNPKEAGSFLSLGIVNHVDVYFPN-KRARISAPLVPGGES  59

Query  544  VDEKKQASIEVLPDECLFEIFRRLP  618
            +++KKQ S++VLPDECL+EI RRLP
Sbjct  60   LEQKKQVSLDVLPDECLYEILRRLP  84



>gb|KJB27084.1| hypothetical protein B456_004G276800 [Gossypium raimondii]
Length=636

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 42/82 (51%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +1

Query  373  PAVVPMSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  552
            PA+V      +F  G  F  +  D     S+  QVDVY+P RKR+RI APFV      ++
Sbjct  2    PALVNYGGDDDFYSGGSFYTNSTDLGRLCSISSQVDVYYPPRKRARITAPFVVGETLFEQ  61

Query  553  KKQASIEVLPDECLFEIFRRLP  618
             KQASI+VLPDECLFEIF+RLP
Sbjct  62   SKQASIDVLPDECLFEIFKRLP  83



>ref|XP_010417316.1| PREDICTED: EIN3-binding F-box protein 1-like [Camelina sativa]
Length=632

 Score = 85.9 bits (211),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 47/84 (56%), Positives = 56/84 (67%), Gaps = 10/84 (12%)
 Frame = +1

Query  388  MSKLLEFSGGDDFC------PSPMDSILFLSLGHQVDVYFPSRKRSRINAP-FVFSGEKV  546
            MS++  F+G ++F       P+P D+ L LSLG  VDVYFP  KRSR+ AP  VFS    
Sbjct  1    MSQIYSFAGENEFYRRGAIYPNPKDASLLLSLGSYVDVYFPPSKRSRVVAPTTVFSAF--  58

Query  547  DEKKQASIEVLPDECLFEIFRRLP  618
             EKK  S +VLPDECLFEIFRRLP
Sbjct  59   -EKKPVSFDVLPDECLFEIFRRLP  81



>ref|XP_008792024.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=673

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 45/79 (57%), Positives = 52/79 (66%), Gaps = 10/79 (13%)
 Frame = +1

Query  412  GGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFS-GEKVDEKKQ---  561
            G DD C       + MDS   LS+   VDV+FP RKRSRI APF+F  GEK  EK++   
Sbjct  21   GTDDLCSVGPLISNLMDSSCLLSIASNVDVFFPPRKRSRITAPFIFKGGEKGAEKQKQQP  80

Query  562  ASIEVLPDECLFEIFRRLP  618
             SI+VLPDECLFEI RRLP
Sbjct  81   CSIDVLPDECLFEILRRLP  99



>ref|XP_009381112.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=650

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 46/82 (56%), Positives = 54/82 (66%), Gaps = 5/82 (6%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAP--FVFSG-EKVDEKK  558
            M+ L+ + GGDD CP    S  FLS G  VDVY P RKR+R+ AP  F F G E+V  +K
Sbjct  1    MAALVNYGGGDDLCPLFPGSSRFLSPGRNVDVYCPPRKRARVIAPLGFSFRGREEVAAEK  60

Query  559  QA--SIEVLPDECLFEIFRRLP  618
            Q   SI+ LPDECLFEI RRLP
Sbjct  61   QQPRSIDTLPDECLFEILRRLP  82



>ref|XP_010907280.1| PREDICTED: EIN3-binding F-box protein 1-like [Elaeis guineensis]
Length=662

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 46/88 (52%), Positives = 54/88 (61%), Gaps = 11/88 (13%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFS-GEKV  546
            M  L+ + G DD C       + MDS   LSL   VDV+ P RKRSR+ APF+F  GEK 
Sbjct  1    MPALVNYGGTDDLCSVGPLISNLMDSSRLLSLTPNVDVFCPPRKRSRVTAPFIFKGGEKQ  60

Query  547  DEKKQ----ASIEVLPDECLFEIFRRLP  618
              +KQ     SI+VLPDECLFEI RRLP
Sbjct  61   GAEKQKQQSCSIDVLPDECLFEILRRLP  88



>ref|XP_010907279.1| PREDICTED: EIN3-binding F-box protein 1-like [Elaeis guineensis]
Length=662

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 46/88 (52%), Positives = 54/88 (61%), Gaps = 11/88 (13%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFS-GEKV  546
            M  L+ + G DD C       + MDS   LSL   VDV+ P RKRSR+ APF+F  GEK 
Sbjct  1    MPALVNYGGTDDLCSVGPLISNLMDSSRLLSLTPNVDVFCPPRKRSRVTAPFIFKGGEKK  60

Query  547  DEKKQ----ASIEVLPDECLFEIFRRLP  618
              +KQ     SI+VLPDECLFEI RRLP
Sbjct  61   GAEKQKQQPCSIDVLPDECLFEILRRLP  88



>ref|XP_007136869.1| hypothetical protein PHAVU_009G080700g [Phaseolus vulgaris]
 gb|ESW08863.1| hypothetical protein PHAVU_009G080700g [Phaseolus vulgaris]
Length=601

 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 56/85 (66%), Gaps = 8/85 (9%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MS++  FSG DDFCP      +P +  LFLSLG  VD YF  +KRSR++  F  + E  D
Sbjct  1    MSQVFSFSGNDDFCPGGRIYPNPKEPCLFLSLGRSVD-YFSLQKRSRVSVSFDINREWFD  59

Query  550  EKKQ-ASIEVLPDECLFEIFRRLPV  621
            E+KQ  SIE LPDECLFEI RRLP 
Sbjct  60   EQKQEISIESLPDECLFEILRRLPA  84



>ref|XP_008362900.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=647

 Score = 82.8 bits (203),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 41/82 (50%), Positives = 52/82 (63%), Gaps = 6/82 (7%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            M  L+ +SG DDF P      +PMD    LS+G  VDVY P  KR+RI++ F       +
Sbjct  1    MPALVNYSGDDDFYPGGSFYSNPMDLGCLLSMGSHVDVYCPPSKRARISSQFASGRSDFE  60

Query  550  EKKQASIEVLPDECLFEIFRRL  615
            + K+ SI+VLPDECLFEIFRRL
Sbjct  61   QVKKPSIDVLPDECLFEIFRRL  82



>ref|XP_008805623.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=660

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 50/87 (57%), Positives = 57/87 (66%), Gaps = 10/87 (11%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCPSP------MDSILFLSLGHQVDVYFPSRKRSRINAPFVFS-GEKV  546
            M  L+++ G DD CP+       MDS L LSL   VDV+ P RKRSR+ APFVF  GEK 
Sbjct  1    MPALVKYGGSDDLCPAGPLFSNLMDSSLLLSLAPNVDVFCPPRKRSRVTAPFVFKGGEKG  60

Query  547  DEK---KQASIEVLPDECLFEIFRRLP  618
             EK   K  SI+VLPDECLFEI RRLP
Sbjct  61   AEKPKQKLCSIDVLPDECLFEILRRLP  87



>ref|XP_009419280.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=654

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 48/85 (56%), Positives = 58/85 (68%), Gaps = 8/85 (9%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCPSPM-----DSILFLSLGHQVDVYFPSRKRSRINAPFVF-SGEKV-  546
            M+ L+++ G DD CP P      DS L LSLG + DVY P  KR R+ AP +F +GEKV 
Sbjct  1    MAALVKYGGNDDICPGPFYSNLTDSSLLLSLGQKADVYGPPCKRYRVTAPLIFRAGEKVI  60

Query  547  DEKKQA-SIEVLPDECLFEIFRRLP  618
            DE+KQ  SI+ LPDECLFEI RRLP
Sbjct  61   DEEKQPRSIDTLPDECLFEILRRLP  85



>ref|XP_010526214.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=641

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 44/83 (53%), Positives = 58/83 (70%), Gaps = 9/83 (11%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MS++  F+G  DFCP      +P ++ L LSLG  VDVYFP RK+SR++AP V    +  
Sbjct  1    MSEIFSFAGESDFCPRGSIYPNPKETSLLLSLGSLVDVYFPPRKKSRVSAPLV---ARAF  57

Query  550  EKKQASIEVLPDECLFEIFRRLP  618
            E++  SI+VLPDECLFEIFRR+P
Sbjct  58   EQEPVSIDVLPDECLFEIFRRMP  80



>emb|CAN83761.1| hypothetical protein VITISV_043743 [Vitis vinifera]
Length=669

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 36/60 (60%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  439  MDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQASIEVLPDECLFEIFRRLP  618
            MDS L +S+G  +DVY P RKRSRI AP++F    ++ +K+ SI+VLPDECLFEI RRLP
Sbjct  1    MDSGLLVSIGSCMDVYCPPRKRSRITAPYIFRENNLELEKRPSIDVLPDECLFEILRRLP  60



>ref|XP_002325221.1| hypothetical protein POPTR_0018s13070g [Populus trichocarpa]
 gb|EEF03786.1| hypothetical protein POPTR_0018s13070g [Populus trichocarpa]
Length=632

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 40/82 (49%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +1

Query  373  PAVVPMSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  552
            PA+V  S   E   G     +  D     S+G +VDVY P+ KR+RI+APF+F     ++
Sbjct  2    PALVNYSGDDEIYSGGSLYANSSDLGRLYSIGSRVDVYSPACKRARISAPFLFGSSGFEQ  61

Query  553  KKQASIEVLPDECLFEIFRRLP  618
             K+ SIEVLPDECLFEIFRR+P
Sbjct  62   NKRPSIEVLPDECLFEIFRRVP  83



>gb|KFK32577.1| hypothetical protein AALP_AA6G261300 [Arabis alpina]
Length=630

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 44/82 (54%), Positives = 53/82 (65%), Gaps = 9/82 (11%)
 Frame = +1

Query  388  MSKLLEFSGGDDFC------PSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MS++  FSG +DF       P+P D  L LSLG  VD YFP  KRSR+ AP  +S     
Sbjct  1    MSQIFSFSGENDFYRRGVTYPNPKDVNLLLSLGSLVDCYFPPCKRSRVVAPSRYSAF---  57

Query  550  EKKQASIEVLPDECLFEIFRRL  615
            E+K  SI+VLP+ECLFEIFRRL
Sbjct  58   EEKPVSIDVLPEECLFEIFRRL  79



>ref|XP_009364023.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 40/82 (49%), Positives = 51/82 (62%), Gaps = 6/82 (7%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            M  L+ + G DDF P      +PMD    LS+G  VDVY P  KR+RI++ F   G   +
Sbjct  1    MPALVNYCGDDDFYPGGSFYSNPMDLGCLLSMGAHVDVYCPPSKRARISSQFASGGSDFE  60

Query  550  EKKQASIEVLPDECLFEIFRRL  615
            + K+ SI+ LPDECLFEIFRRL
Sbjct  61   QVKKPSIDDLPDECLFEIFRRL  82



>ref|NP_001234858.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ABB89717.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ABC24971.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ACS44350.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
Length=637

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 45/82 (55%), Positives = 50/82 (61%), Gaps = 7/82 (9%)
 Frame = +1

Query  373  PAVVPMSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  552
            P +V  S   EF  G  FC +  D  L LSLGH  DVY P RKR+RI+ PFV      D 
Sbjct  2    PTLVNYSGDDEFYSGGSFCSA--DLGLMLSLGH-ADVYCPPRKRARISGPFVVE----DR  54

Query  553  KKQASIEVLPDECLFEIFRRLP  618
             K  S+EVLPDECLFEI RRLP
Sbjct  55   SKDPSLEVLPDECLFEILRRLP  76



>ref|XP_011017769.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=655

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 40/82 (49%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +1

Query  373  PAVVPMSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  552
            PA+V  S   E   G  F  +  D     S+G +VDVY P+ KR+RI+APF+F     ++
Sbjct  2    PALVNYSGDDEIYSGGSFYANSSDLGRLYSIGPRVDVYSPACKRARISAPFLFGSSGFEQ  61

Query  553  KKQASIEVLPDECLFEIFRRLP  618
              + SIEVLPDECLFEIFRR+P
Sbjct  62   NTRPSIEVLPDECLFEIFRRVP  83



>gb|KHG14715.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=645

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 52/81 (64%), Gaps = 0/81 (0%)
 Frame = +1

Query  373  PAVVPMSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  552
            PA+V  S   +F  G  F  +  D     S+  QVDVY P RKR+RI+APF F   +V++
Sbjct  2    PALVNYSGDDDFYNGGSFYTNSTDLGRLCSISSQVDVYCPPRKRTRISAPFHFGEAEVEQ  61

Query  553  KKQASIEVLPDECLFEIFRRL  615
             KQ SI+VLPDECL EIF+R+
Sbjct  62   NKQPSIDVLPDECLVEIFKRI  82



>ref|XP_007013466.1| Ein3-binding f-box protein 4 [Theobroma cacao]
 gb|EOY31085.1| Ein3-binding f-box protein 4 [Theobroma cacao]
Length=692

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 37/72 (51%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = +1

Query  403  EFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQASIEVLP  582
            +F  G  F  +  D     S+  QVDVY P RKR+RI APF+F   + ++ KQ SI+VLP
Sbjct  59   DFYSGGSFYTNSTDLGRLCSISSQVDVYCPPRKRARICAPFLFGETEFEQNKQPSIDVLP  118

Query  583  DECLFEIFRRLP  618
            +ECLFEIF+RLP
Sbjct  119  EECLFEIFKRLP  130



>gb|KJB54023.1| hypothetical protein B456_009G017100 [Gossypium raimondii]
Length=645

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 52/81 (64%), Gaps = 0/81 (0%)
 Frame = +1

Query  373  PAVVPMSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  552
            PA+V  S   +F  G  F  +  D     S+  QVDVY P RKR+RI+APF F   +V++
Sbjct  2    PALVNYSGDDDFYNGGSFYTNSTDLGRLCSISFQVDVYCPPRKRTRISAPFHFGEAEVEQ  61

Query  553  KKQASIEVLPDECLFEIFRRL  615
             KQ SI+VLPDECL EIF+R+
Sbjct  62   NKQPSIDVLPDECLVEIFKRI  82



>ref|XP_006345227.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=637

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 44/82 (54%), Positives = 50/82 (61%), Gaps = 7/82 (9%)
 Frame = +1

Query  373  PAVVPMSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  552
            P +V  S   EF  G  FC +  D  L LSLGH  DVY P RKR+RI+ PFV      D 
Sbjct  2    PTLVNYSGDDEFYSGGSFCSA--DLGLMLSLGH-ADVYCPPRKRARISGPFVVE----DR  54

Query  553  KKQASIEVLPDECLFEIFRRLP  618
             K  S+E+LPDECLFEI RRLP
Sbjct  55   SKDPSLEILPDECLFEILRRLP  76



>ref|XP_008337284.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=647

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 40/82 (49%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            M  L+ +SG DDF P      +PMD    LS+G  VDVY P  KR+RI++ +       +
Sbjct  1    MPALVNYSGDDDFYPGGSFYSNPMDLGCLLSMGSHVDVYCPPSKRARISSQYASGRSDFE  60

Query  550  EKKQASIEVLPDECLFEIFRRL  615
            + K  SI VLPDECLFEIFRRL
Sbjct  61   QIKNPSINVLPDECLFEIFRRL  82



>gb|KDP32417.1| hypothetical protein JCGZ_13342 [Jatropha curcas]
Length=651

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 38/82 (46%), Positives = 50/82 (61%), Gaps = 4/82 (5%)
 Frame = +1

Query  373  PAVVPMSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  552
            P +V  S   EF  G   C + M      S+G  VD+Y P  KR+R ++PF+F     ++
Sbjct  2    PTLVNYSGDDEFYAGGSLCTNSM----LYSIGSLVDIYSPPCKRARTSSPFLFGSSDFEQ  57

Query  553  KKQASIEVLPDECLFEIFRRLP  618
             KQ SI+VLPDECLFEIFRR+P
Sbjct  58   NKQPSIDVLPDECLFEIFRRIP  79



>ref|XP_008457494.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis melo]
Length=657

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 39/82 (48%), Positives = 49/82 (60%), Gaps = 6/82 (7%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            M  L+ + G D++ P      SPMD   FL     VD+YF   KR+RI AP VF G + +
Sbjct  1    MPALVNYGGDDEYYPGGSFYSSPMDLDAFLPTSSHVDLYFRPSKRARIGAPVVFGGREFE  60

Query  550  EKKQASIEVLPDECLFEIFRRL  615
            ++   SIE LPDECLFEIFR L
Sbjct  61   QECTPSIEALPDECLFEIFRHL  82



>ref|XP_006842065.1| hypothetical protein AMTR_s00078p00046140 [Amborella trichopoda]
 gb|ERN03740.1| hypothetical protein AMTR_s00078p00046140 [Amborella trichopoda]
Length=649

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 52/81 (64%), Gaps = 5/81 (6%)
 Frame = +1

Query  388  MSKLLEFSGGDD-----FCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  552
            MS L+++SG D      +    MDS LFLSL   +DVY P RKRSR+ APFV      + 
Sbjct  1    MSTLVKYSGDDRHGGPLYSSGLMDSSLFLSLAPNLDVYCPPRKRSRVTAPFVLWENNTNF  60

Query  553  KKQASIEVLPDECLFEIFRRL  615
            +++ S++ LPDECLFEI RR+
Sbjct  61   QRKPSLDNLPDECLFEILRRV  81



>ref|XP_009397481.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=652

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 47/85 (55%), Positives = 56/85 (66%), Gaps = 8/85 (9%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCPS-PM-----DSILFLSLGHQVDVYFPSRKRSRINAPFVF-SGEKV  546
            M+ L+   G DD CP  P+     DS L LSL   VDVY P RKR R+ AP +F +GEK+
Sbjct  1    MAALVNRRGNDDICPGGPLFSNLVDSSLLLSLTRNVDVYCPPRKRPRVTAPLIFRAGEKI  60

Query  547  -DEKKQASIEVLPDECLFEIFRRLP  618
             DEK Q SI+ LP+ECLFEI RRLP
Sbjct  61   ADEKLQRSIDTLPEECLFEILRRLP  85



>ref|XP_011020134.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=656

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 39/83 (47%), Positives = 52/83 (63%), Gaps = 6/83 (7%)
 Frame = +1

Query  388  MSKLLEFSGGDD------FCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            M  L+ +SG D+      F  +P D     S+   VDVY P+ KR+RI+ PF+F     +
Sbjct  1    MPTLVNYSGDDEIYSGGSFYTNPSDLGRLYSIVSNVDVYSPACKRARISTPFLFESSGFE  60

Query  550  EKKQASIEVLPDECLFEIFRRLP  618
            + K+ SIEVLPDECLFEIFRR+P
Sbjct  61   QNKRPSIEVLPDECLFEIFRRVP  83



>ref|XP_004139306.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 ref|XP_004169733.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 gb|KGN60684.1| Grr1 [Cucumis sativus]
Length=661

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 38/82 (46%), Positives = 49/82 (60%), Gaps = 6/82 (7%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            M  L+ + G D++ P      SPMD   FL     VD+YF   KR+RI +P VF G + +
Sbjct  1    MPALVNYGGDDEYYPGGSFYSSPMDLDAFLPTSSHVDLYFHPSKRARIGSPVVFGGREFE  60

Query  550  EKKQASIEVLPDECLFEIFRRL  615
            ++   SIE LPDECLFEIFR L
Sbjct  61   QECTPSIEALPDECLFEIFRHL  82



>ref|XP_009368857.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 40/82 (49%), Positives = 49/82 (60%), Gaps = 6/82 (7%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            M  L+  SG DDF P      +PMD    LS+G  VDVY P  KR+RI++ +       +
Sbjct  1    MPALVNSSGDDDFYPGGSFYSNPMDLGCLLSMGSHVDVYCPPSKRARISSQYASGRSDFE  60

Query  550  EKKQASIEVLPDECLFEIFRRL  615
            + K  SI VLPDECLFEIFRRL
Sbjct  61   QVKNPSINVLPDECLFEIFRRL  82



>ref|XP_002308982.2| hypothetical protein POPTR_0006s06770g [Populus trichocarpa]
 gb|EEE92505.2| hypothetical protein POPTR_0006s06770g [Populus trichocarpa]
Length=656

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 39/83 (47%), Positives = 52/83 (63%), Gaps = 6/83 (7%)
 Frame = +1

Query  388  MSKLLEFSGGDD------FCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            M  L+ +SG D+      F  +P D     S+   VDVY P+ KR+RI+APF+F     +
Sbjct  1    MPTLVNYSGDDEIYSGGSFYTNPSDLGRLYSIVSNVDVYSPACKRARISAPFLFESSGFE  60

Query  550  EKKQASIEVLPDECLFEIFRRLP  618
            +  + SIEVLPDECLFEIFRR+P
Sbjct  61   QNMRPSIEVLPDECLFEIFRRVP  83



>ref|XP_008805624.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=660

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 47/87 (54%), Positives = 55/87 (63%), Gaps = 10/87 (11%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCPSP------MDSILFLSLGHQVDVYFPSRKRSRINAPFVFS-GEKV  546
            M  L+++ G DD CP+       MDS L LSL   VDV+ P RKRSR+ APF+F  GE  
Sbjct  1    MPALVKYGGSDDLCPAGPLFSNLMDSSLLLSLAPNVDVFCPPRKRSRVTAPFIFKGGENG  60

Query  547  DEK---KQASIEVLPDECLFEIFRRLP  618
             EK   K  SI+VLPDECLFEI R LP
Sbjct  61   AEKPKQKLCSIDVLPDECLFEILRWLP  87



>ref|XP_010048082.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
 gb|KCW80181.1| hypothetical protein EUGRSUZ_C01524 [Eucalyptus grandis]
Length=657

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 35/82 (43%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +1

Query  373  PAVVPMSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  552
            P +V      +F GG   C S +D     S+G  +D+Y+P  KR+RI  P+  S  + + 
Sbjct  2    PTLVNYGGEDQFFGGGSLCTSSIDLDRLYSMGSSMDIYYPPHKRARICGPYAVSSYEYEG  61

Query  553  KKQASIEVLPDECLFEIFRRLP  618
            ++ +SI  LPDECLFEIFRRLP
Sbjct  62   ERPSSIGELPDECLFEIFRRLP  83



>emb|CDP10419.1| unnamed protein product [Coffea canephora]
Length=628

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 40/83 (48%), Positives = 51/83 (61%), Gaps = 11/83 (13%)
 Frame = +1

Query  388  MSKLLEFSGGDDF------CPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            M  L+ + G DDF      C +  DS L LS+    DVY P RKRSR++AP+       +
Sbjct  1    MPALVNYGGDDDFYTGRSICSA--DSGLVLSIA---DVYCPPRKRSRVSAPYAVDSRLFN  55

Query  550  EKKQASIEVLPDECLFEIFRRLP  618
            +++  SIE LPDECLFEIFRRLP
Sbjct  56   KERNPSIETLPDECLFEIFRRLP  78



>ref|XP_002874252.1| ein3-binding F box protein 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50511.1| ein3-binding F box protein 2 [Arabidopsis lyrata subsp. lyrata]
Length=590

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 52/77 (68%), Gaps = 5/77 (6%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQAS  567
            MS +  FSG +DF      S ++LS G    VYFP+RKR RI AP VFSG    E+KQ S
Sbjct  1    MSGIFRFSGDEDFFLG--GSSMYLSPGSCPGVYFPARKRLRIAAPSVFSGF---EEKQTS  55

Query  568  IEVLPDECLFEIFRRLP  618
            I+VLPDECLFEI RRLP
Sbjct  56   IDVLPDECLFEILRRLP  72



>ref|XP_010493788.1| PREDICTED: EIN3-binding F-box protein 2-like [Camelina sativa]
Length=622

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 44/77 (57%), Positives = 50/77 (65%), Gaps = 5/77 (6%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQAS  567
            MS +  FSG +DF      S+  LS G    VYFP+RKR RI A  VFSG    E+KQ S
Sbjct  1    MSGIFGFSGDEDFFLG--GSMHNLSPGSCPGVYFPARKRLRIAATSVFSGF---EQKQTS  55

Query  568  IEVLPDECLFEIFRRLP  618
            I+VLPDECLFEI RRLP
Sbjct  56   IDVLPDECLFEILRRLP  72



>ref|XP_010454859.1| PREDICTED: EIN3-binding F-box protein 2 [Camelina sativa]
Length=622

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 44/77 (57%), Positives = 50/77 (65%), Gaps = 5/77 (6%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQAS  567
            MS +  FSG +DF      S+  LS G    VYFP+RKR RI A  VFSG    E+KQ S
Sbjct  1    MSGIFGFSGDEDFFLG--GSMHNLSPGSCPGVYFPARKRLRIAATSVFSGF---EEKQTS  55

Query  568  IEVLPDECLFEIFRRLP  618
            I+VLPDECLFEI RRLP
Sbjct  56   IDVLPDECLFEILRRLP  72



>ref|XP_006287278.1| hypothetical protein CARUB_v10000473mg [Capsella rubella]
 gb|EOA20176.1| hypothetical protein CARUB_v10000473mg [Capsella rubella]
Length=621

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 51/77 (66%), Gaps = 6/77 (8%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQAS  567
            MS +  FSG +DF    +   ++LS G    VYFP+ KR RI AP VFSG    E+KQ S
Sbjct  1    MSGIFGFSGDEDF---FLGGSMYLSPGSCPGVYFPAHKRLRIAAPSVFSGF---EQKQTS  54

Query  568  IEVLPDECLFEIFRRLP  618
            I+VLPDECLFEI RRLP
Sbjct  55   IDVLPDECLFEILRRLP  71



>ref|XP_011078374.1| PREDICTED: EIN3-binding F-box protein 1-like [Sesamum indicum]
Length=647

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 40/84 (48%), Positives = 51/84 (61%), Gaps = 10/84 (12%)
 Frame = +1

Query  388  MSKLLEFSGGDDF-------CPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKV  546
            M  L+   G DDF       C    DS +  S+   V++Y P RKRSRI+ P++ S   +
Sbjct  1    MPALVNIRGDDDFYSEGGSLCSG--DSGVVFSISSHVEIYCPPRKRSRISGPYIVS-RNL  57

Query  547  DEKKQASIEVLPDECLFEIFRRLP  618
             E K+ SI+VLPDECLFEIFRRLP
Sbjct  58   FEDKRPSIDVLPDECLFEIFRRLP  81



>gb|AFU61111.1| F-box protein [Capsicum annuum]
Length=637

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 43/82 (52%), Positives = 49/82 (60%), Gaps = 7/82 (9%)
 Frame = +1

Query  373  PAVVPMSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  552
            PA+V  S   E   G  FC +  D  L LSLGH  +VY P RKRSRI+ PFV      D 
Sbjct  2    PALVNYSGDDELYSGGSFCSA--DLGLMLSLGH-AEVYCPPRKRSRISGPFVVE----DR  54

Query  553  KKQASIEVLPDECLFEIFRRLP  618
             K  S++ LPDECLFEI RRLP
Sbjct  55   SKGPSLDDLPDECLFEILRRLP  76



>ref|XP_007155011.1| hypothetical protein PHAVU_003G165500g [Phaseolus vulgaris]
 gb|ESW27005.1| hypothetical protein PHAVU_003G165500g [Phaseolus vulgaris]
Length=639

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 39/83 (47%), Positives = 51/83 (61%), Gaps = 4/83 (5%)
 Frame = +1

Query  373  PAVVPMSKLLEFSGGDDFCPSPMD-SILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            PA+V  S   E   G  FCPSPM+   L+ ++G  +D+Y+P  KRSR     + + E   
Sbjct  2    PALVNYSGDDELYPGGSFCPSPMELGRLYSTIGSNLDLYYPPNKRSR---SILEAIEGEQ  58

Query  550  EKKQASIEVLPDECLFEIFRRLP  618
              ++  IEVLPDECLFEIFRRLP
Sbjct  59   HYQEPGIEVLPDECLFEIFRRLP  81



>gb|KHG24906.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=641

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 49/79 (62%), Gaps = 2/79 (3%)
 Frame = +1

Query  388  MSKLLEFSGGDDFC--PSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQ  561
            M  L+ +SG DDF    + ++     S+  Q DVY+P  KR RI+APF+F     ++ KQ
Sbjct  1    MPALVNYSGDDDFFIRKNSIELGRLCSISSQADVYWPPHKRVRISAPFLFRETDFEQNKQ  60

Query  562  ASIEVLPDECLFEIFRRLP  618
             SI  LP EC+FEIF+RLP
Sbjct  61   PSINDLPGECIFEIFKRLP  79



>ref|XP_010525963.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=640

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 42/83 (51%), Positives = 55/83 (66%), Gaps = 9/83 (11%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MS++   +G + FCP      +P ++ L LSLG  VD YFP  KR+R++AP  FS   V 
Sbjct  1    MSEIFSIAGENGFCPRGSIYPNPKEASLLLSLGSLVDAYFPPCKRTRVSAPTAFS---VF  57

Query  550  EKKQASIEVLPDECLFEIFRRLP  618
            E+   SI+VLPDECLFE+FRRLP
Sbjct  58   EQDPVSIDVLPDECLFEVFRRLP  80



>emb|CDX76980.1| BnaC04g37750D [Brassica napus]
Length=599

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 56/81 (69%), Gaps = 6/81 (7%)
 Frame = +1

Query  388  MSKLLEFSGGDDF---CPSPMDSILFLSLGHQVDVYFPSRKRSRI-NAPFVFSGEKVDEK  555
            MS++  F+G  +F     +P ++ +FLSLG  VD Y+P  KRSR+  AP +FS    +E+
Sbjct  1    MSQIYSFAGESEFYRRGSNPKEANIFLSLGSLVDCYYPPCKRSRVVAAPSLFSA--FEEE  58

Query  556  KQASIEVLPDECLFEIFRRLP  618
            K  SI+VLPDECLFEIFRRLP
Sbjct  59   KPVSIDVLPDECLFEIFRRLP  79



>ref|XP_006405190.1| hypothetical protein EUTSA_v10000087mg [Eutrema salsugineum]
 gb|ESQ46643.1| hypothetical protein EUTSA_v10000087mg [Eutrema salsugineum]
Length=633

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 43/86 (50%), Positives = 54/86 (63%), Gaps = 12/86 (14%)
 Frame = +1

Query  388  MSKLLEFSGGDDFC------PSPMDSILFLSLGHQVDV-YFPSRKRSRI--NAPFVFSGE  540
            MS++  F+G +DF       P+P ++ L LSL   VD  Y+P  KRSR+   AP +FS  
Sbjct  1    MSQIFSFAGENDFYRRGAIYPNPKEANLLLSLTSLVDCCYYPPCKRSRVVATAPSLFSAF  60

Query  541  KVDEKKQASIEVLPDECLFEIFRRLP  618
               E K  SI+VLPDECLFEIFRRLP
Sbjct  61   ---EAKPVSIDVLPDECLFEIFRRLP  83



>gb|AEK81539.1| EIN3 binding F-box 1 [Dianthus caryophyllus]
Length=625

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 35/72 (49%), Positives = 42/72 (58%), Gaps = 9/72 (13%)
 Frame = +1

Query  403  EFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQASIEVLP  582
            E  GG    PS M           VDVY P  KR R+NAPFV  G   ++  ++SI VLP
Sbjct  13   ELYGGRSSNPSAMS---------HVDVYGPPNKRQRVNAPFVLWGSNPEQNTRSSINVLP  63

Query  583  DECLFEIFRRLP  618
            DEC+FE+FRRLP
Sbjct  64   DECMFEVFRRLP  75



>ref|XP_010047961.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
Length=654

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 35/82 (43%), Positives = 48/82 (59%), Gaps = 3/82 (4%)
 Frame = +1

Query  373  PAVVPMSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  552
            P +V      +F GG   C S +D     S+G  +D+Y+P  KR+RI  P+  S  + + 
Sbjct  2    PTLVNYGGEDQFFGGGSLCTSSID---LYSMGSSMDIYYPPHKRARICGPYAVSSYEYEG  58

Query  553  KKQASIEVLPDECLFEIFRRLP  618
            +  +SI  LPDECLFEIFRRLP
Sbjct  59   EHPSSIGELPDECLFEIFRRLP  80



>ref|XP_006394785.1| hypothetical protein EUTSA_v10003828mg [Eutrema salsugineum]
 gb|ESQ32071.1| hypothetical protein EUTSA_v10003828mg [Eutrema salsugineum]
Length=621

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 49/77 (64%), Gaps = 6/77 (8%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQAS  567
            MS +  FSG +DF P      + LS G    VYFP+RKR RI AP V  G    E+KQ S
Sbjct  1    MSGIFRFSGDEDFFPGGS---MHLSPGSCPGVYFPARKRLRIAAPSVQIGF---EQKQTS  54

Query  568  IEVLPDECLFEIFRRLP  618
            IEVLPDECLFEI RRLP
Sbjct  55   IEVLPDECLFEILRRLP  71



>ref|XP_009758784.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana sylvestris]
Length=645

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 41/81 (51%), Positives = 48/81 (59%), Gaps = 7/81 (9%)
 Frame = +1

Query  373  PAVVPMSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  552
            P +V  S   EF  G   C +  D  L LSLGH   VY P RKR+RI+ PF+      + 
Sbjct  2    PTLVNYSGDDEFYSGGSLCSA--DLGLMLSLGH-AQVYCPLRKRARISGPFIIE----ER  54

Query  553  KKQASIEVLPDECLFEIFRRL  615
             K  SIE+LPDECLFEIFRRL
Sbjct  55   TKNPSIEILPDECLFEIFRRL  75



>gb|ACB59221.1| F-box protein [Brassica oleracea]
Length=629

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 38/70 (54%), Positives = 45/70 (64%), Gaps = 3/70 (4%)
 Frame = +1

Query  406  FSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQASIEVLPD  585
            F+ G  +  +P D+ L LSL    DVYFP  KR R+  P +FS     EKK  SI+VLPD
Sbjct  13   FTVGAQYTRNPKDASLLLSLISFGDVYFPPSKRQRVVLPTLFSAF---EKKPVSIDVLPD  69

Query  586  ECLFEIFRRL  615
            ECLFEIFRRL
Sbjct  70   ECLFEIFRRL  79



>ref|XP_009625259.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana tomentosiformis]
Length=646

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 43/82 (52%), Positives = 51/82 (62%), Gaps = 9/82 (11%)
 Frame = +1

Query  373  PAVVPMSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  552
            P +V  S   EF  G   C +  D  L LSLGH   VY P RK++RI+ PFV     V+E
Sbjct  2    PTLVNYSGDDEFYSGGSLCSA--DLGLMLSLGH-AQVYCPLRKKARISGPFV-----VEE  53

Query  553  K-KQASIEVLPDECLFEIFRRL  615
            + K  SIE+LPDECLFEIFRRL
Sbjct  54   RTKNPSIEILPDECLFEIFRRL  75



>dbj|BAH20224.1| AT2G25490 [Arabidopsis thaliana]
Length=604

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 42/59 (71%), Gaps = 3/59 (5%)
 Frame = +1

Query  442  DSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQASIEVLPDECLFEIFRRLP  618
            D+ L LSLG   DVYFP  KRSR+ AP +FS     EKK  SI+VLPDECLFEIFRRL 
Sbjct  1    DASLLLSLGSFADVYFPPSKRSRVVAPTIFSAF---EKKPVSIDVLPDECLFEIFRRLS  56



>ref|XP_003549759.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN15084.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=639

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 38/84 (45%), Positives = 51/84 (61%), Gaps = 6/84 (7%)
 Frame = +1

Query  373  PAVVPMSKLLEFSGGDDFCPSPMD-SILFLSLGHQVDVYFPSRKRSRINAPFVFSG-EKV  546
            PA+V  S   E   G  FCP+P++   L+ ++G  +DVY+P  KR R     +F   E+ 
Sbjct  2    PALVNYSGDDELYPGGSFCPNPVELGRLYTTIGSNLDVYYPPTKRPRS----IFEAIERE  57

Query  547  DEKKQASIEVLPDECLFEIFRRLP  618
               ++  IEVLPDECLFEIFRRLP
Sbjct  58   QYYQEPGIEVLPDECLFEIFRRLP  81



>ref|XP_003542675.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN47145.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=639

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 38/84 (45%), Positives = 50/84 (60%), Gaps = 6/84 (7%)
 Frame = +1

Query  373  PAVVPMSKLLEFSGGDDFCPSPMD-SILFLSLGHQVDVYFPSRKRSRINAPFVFSG-EKV  546
            PA+V  S   E   G  FCP+PM+   L+ ++G  +D+Y+P  KR R     +F   E+ 
Sbjct  2    PALVNYSGDDELYPGGSFCPNPMELGRLYTTIGSNLDMYYPPTKRPRS----IFEAIERE  57

Query  547  DEKKQASIEVLPDECLFEIFRRLP  618
               +   IEVLPDECLFEIFRRLP
Sbjct  58   QYYQDPGIEVLPDECLFEIFRRLP  81



>gb|KCW80001.1| hypothetical protein EUGRSUZ_C01334 [Eucalyptus grandis]
Length=584

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 48/83 (58%), Gaps = 3/83 (4%)
 Frame = +1

Query  370  FPAVVPMSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
             P +V      +F GG   C S +D     S+G  +D+Y+P  KR+RI  P+  S  + +
Sbjct  1    MPTLVNYGGEDQFFGGGSLCTSSID---LYSMGSSMDIYYPPHKRARICGPYAVSSYEYE  57

Query  550  EKKQASIEVLPDECLFEIFRRLP  618
             +  +SI  LPDECLFEIFRRLP
Sbjct  58   GEHPSSIGELPDECLFEIFRRLP  80



>ref|XP_006358273.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=642

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 42/83 (51%), Positives = 54/83 (65%), Gaps = 15/83 (18%)
 Frame = +1

Query  388  MSKLLEFSGGDDF------CPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MS L+ +SG ++F      C +  D  L L+LGH  D+Y P  KR+RI+ PFV     V+
Sbjct  1    MSTLVNYSGDNEFYSGGSLCSA--DLGLMLALGH-ADIYCPVSKRARISGPFV-----VE  52

Query  550  EK-KQASIEVLPDECLFEIFRRL  615
            E+ K  SIEVLP+ECLFEIFRRL
Sbjct  53   ERTKNPSIEVLPNECLFEIFRRL  75



>ref|XP_004287307.1| PREDICTED: EIN3-binding F-box protein 1-like [Fragaria vesca 
subsp. vesca]
Length=640

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 37/83 (45%), Positives = 50/83 (60%), Gaps = 10/83 (12%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCPS-------PMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKV  546
            M  L+ +SG D+F          PMD    LS+G      +P  KR+RI++ F   G   
Sbjct  1    MPTLVNYSGDDEFYSGGSCYSSSPMDLGCLLSVGSNA---YPPSKRARISSQFDIRGSSF  57

Query  547  DEKKQASIEVLPDECLFEIFRRL  615
            +++K+ASIEVLP+ECLFEIFRRL
Sbjct  58   EQEKKASIEVLPEECLFEIFRRL  80



>ref|XP_004508488.1| PREDICTED: EIN3-binding F-box protein 2-like [Cicer arietinum]
Length=639

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 47/79 (59%), Gaps = 2/79 (3%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCPS-PMD-SILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQ  561
            M  L+  SG D+  P   MD      ++   VDVY    KR+RI+APF F   +  +  +
Sbjct  1    MPALVNSSGDDEMYPGGSMDLGGCLYTISSNVDVYCSPTKRARISAPFTFGAVEHKQDHK  60

Query  562  ASIEVLPDECLFEIFRRLP  618
             S+E+LPDECLFEIFRRLP
Sbjct  61   PSVEILPDECLFEIFRRLP  79



>ref|XP_010687976.1| PREDICTED: EIN3-binding F-box protein 2-like [Beta vulgaris subsp. 
vulgaris]
Length=615

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +1

Query  484  YFPSRKRSRINAPFVFSGEKVDEKKQASIEVLPDECLFEIFRRLP  618
            ++PS KR+RINAPFV  G++ +++K++SI VLPDECLFEIFR LP
Sbjct  19   FYPSCKRARINAPFVLWGQESEQEKRSSINVLPDECLFEIFRHLP  63



>ref|NP_197917.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 sp|Q708Y0.1|EBF2_ARATH RecName: Full=EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 gb|AAR27072.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 emb|CAE75865.1| F-box protein [Arabidopsis thaliana]
 dbj|BAE99835.1| leucine-rich repeats containing protein [Arabidopsis thaliana]
 gb|AED93429.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
Length=623

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 37/77 (48%), Positives = 49/77 (64%), Gaps = 6/77 (8%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQAS  567
            MS +  FSG +D     +   ++LS G    VY+P+RKR R+ A   +SG    E+KQ S
Sbjct  1    MSGIFRFSGDEDCL---LGGSMYLSPGSCPGVYYPARKRLRVAATSFYSGF---EEKQTS  54

Query  568  IEVLPDECLFEIFRRLP  618
            I+VLP+ECLFEI RRLP
Sbjct  55   IDVLPEECLFEILRRLP  71



>ref|XP_009151059.1| PREDICTED: EIN3-binding F-box protein 2 [Brassica rapa]
Length=622

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 39/77 (51%), Positives = 46/77 (60%), Gaps = 1/77 (1%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQAS  567
            MS +   SG D+F      S + LS G    VY P+RKR R+ A    S     E+KQAS
Sbjct  1    MSGIFRVSGDDEFFTGGGGSSMHLSPGSCPGVYLPARKRLRVTAAAT-SFYSSFEEKQAS  59

Query  568  IEVLPDECLFEIFRRLP  618
            I+VLPDECLFEI RRLP
Sbjct  60   IQVLPDECLFEILRRLP  76



>emb|CDX88173.1| BnaA06g27640D [Brassica napus]
Length=622

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 39/77 (51%), Positives = 46/77 (60%), Gaps = 1/77 (1%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQAS  567
            MS +   SG D+F      S + LS G    VY P+RKR R+ A    S     E+KQAS
Sbjct  1    MSGIFRVSGDDEFFTGGGGSSMHLSPGSCPGVYLPARKRLRVTAAAT-SFYSSFEEKQAS  59

Query  568  IEVLPDECLFEIFRRLP  618
            I+VLPDECLFEI RRLP
Sbjct  60   IQVLPDECLFEILRRLP  76



>ref|XP_004242782.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum lycopersicum]
Length=641

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 40/83 (48%), Positives = 54/83 (65%), Gaps = 15/83 (18%)
 Frame = +1

Query  388  MSKLLEFSGGDDF------CPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  549
            MS L+ +SG ++F      C +  D  L L+LGH  D+Y P  KR+RI+ PF+     V+
Sbjct  1    MSTLVNYSGDNEFYSGGSLCSA--DLGLILALGH-ADIYCPVSKRARISGPFI-----VE  52

Query  550  EK-KQASIEVLPDECLFEIFRRL  615
            E+ K  SIE+LP+ECLFEIFRRL
Sbjct  53   ERTKNPSIELLPNECLFEIFRRL  75



>ref|XP_009388655.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=655

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 51/86 (59%), Gaps = 9/86 (10%)
 Frame = +1

Query  388  MSKLLEFSGGDDFC------PSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGE-KV  546
            M+ L+   G DD C       + +DS L LSL   VDVY  SRKR R+ AP  F  E KV
Sbjct  1    MAALVNRGGSDDICHGGSLFSNLVDSSLLLSLSRNVDVYCSSRKRPRVTAPLAFRAEKKV  60

Query  547  DEKKQA--SIEVLPDECLFEIFRRLP  618
              KKQ   SI+ LPDECLFEI RRLP
Sbjct  61   AYKKQQPRSIDSLPDECLFEILRRLP  86



>ref|XP_006475854.1| PREDICTED: EIN3-binding F-box protein 2-like [Citrus sinensis]
Length=729

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 46/81 (57%), Gaps = 11/81 (14%)
 Frame = +1

Query  376  AVVPMSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEK  555
            A   M  L+ + G D F           S+G  VD Y P RKR+R++A F     + + +
Sbjct  94   ASATMPALVNYRGDDLF-----------SIGSHVDAYCPPRKRARLSAQFASGETEFEFE  142

Query  556  KQASIEVLPDECLFEIFRRLP  618
             Q SI+VLPDECL+EIFRRLP
Sbjct  143  NQPSIDVLPDECLYEIFRRLP  163



>ref|XP_006450916.1| hypothetical protein CICLE_v10007739mg [Citrus clementina]
 gb|ESR64156.1| hypothetical protein CICLE_v10007739mg [Citrus clementina]
 gb|KDO80237.1| hypothetical protein CISIN_1g006749mg [Citrus sinensis]
Length=632

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 34/77 (44%), Positives = 45/77 (58%), Gaps = 11/77 (14%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQAS  567
            M  L+ + G D F           S+G  VD Y P RKR+R++A F     + + + Q S
Sbjct  1    MPALVNYRGDDLF-----------SIGSHVDAYCPPRKRARLSAQFASGETEFEFENQPS  49

Query  568  IEVLPDECLFEIFRRLP  618
            I+VLPDECL+EIFRRLP
Sbjct  50   IDVLPDECLYEIFRRLP  66



>ref|XP_009111664.1| PREDICTED: EIN3-binding F-box protein 2-like [Brassica rapa]
Length=616

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 47/77 (61%), Gaps = 6/77 (8%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQAS  567
            MS +  FSG ++F        ++LS G    VY P RKR R+ AP ++S      +KQ S
Sbjct  1    MSGIFSFSGDEEFFNGGS---MYLSTGSCSGVYLPPRKRLRVAAPSLYSSF---NQKQTS  54

Query  568  IEVLPDECLFEIFRRLP  618
            IEVLPDECLFEI RRLP
Sbjct  55   IEVLPDECLFEILRRLP  71



>ref|XP_010086585.1| hypothetical protein L484_002248 [Morus notabilis]
 gb|EXB21298.1| hypothetical protein L484_002248 [Morus notabilis]
Length=642

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 33/76 (43%), Positives = 46/76 (61%), Gaps = 2/76 (3%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQAS  567
            M  L+ +SG D+F      S    S+   VD+Y P  KR+RI+APF   G   ++ ++ S
Sbjct  1    MPTLVNYSGDDEFYSG--GSCSPYSIASHVDLYCPPSKRARISAPFALEGSFFEQAEKPS  58

Query  568  IEVLPDECLFEIFRRL  615
            I+VLPDECLFEI R +
Sbjct  59   IDVLPDECLFEILRHV  74



>gb|KDO80236.1| hypothetical protein CISIN_1g006749mg [Citrus sinensis]
Length=631

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +1

Query  454  FLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQASIEVLPDECLFEIFRRLP  618
              S+G  VD Y P RKR+R++A F     + + + Q SI+VLPDECL+EIFRRLP
Sbjct  11   LFSIGSHVDAYCPPRKRARLSAQFASGETEFEFENQPSIDVLPDECLYEIFRRLP  65



>gb|KJB07737.1| hypothetical protein B456_001G042600 [Gossypium raimondii]
 gb|KJB07738.1| hypothetical protein B456_001G042600 [Gossypium raimondii]
Length=641

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 49/79 (62%), Gaps = 2/79 (3%)
 Frame = +1

Query  388  MSKLLEFSGGDDFC--PSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQ  561
            M  L+ +SG D+F    + ++     S+  Q DVY+P  KR RI+APF+F     ++ KQ
Sbjct  1    MPALVNYSGDDEFFIRKNSIELGRLCSISSQADVYWPPHKRVRISAPFLFRETDFEQNKQ  60

Query  562  ASIEVLPDECLFEIFRRLP  618
             SI  LP EC+FEIF+RLP
Sbjct  61   PSINDLPGECIFEIFKRLP  79



>gb|EYU23011.1| hypothetical protein MIMGU_mgv1a002803mg [Erythranthe guttata]
Length=636

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 35/80 (44%), Positives = 42/80 (53%), Gaps = 4/80 (5%)
 Frame = +1

Query  388  MSKLLEFSGGDDF----CPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEK  555
            M  L+ + G DDF         DS L  S+G   +VY P RKRSRI  P       + + 
Sbjct  1    MPALVNYRGDDDFNSIRSSCSGDSGLVFSIGSHAEVYCPPRKRSRIAGPCTLGATLLADD  60

Query  556  KQASIEVLPDECLFEIFRRL  615
            K  SI+ LPDECLFEIF  L
Sbjct  61   KTPSIDTLPDECLFEIFTHL  80



>ref|XP_010421385.1| PREDICTED: EIN3-binding F-box protein 2-like [Camelina sativa]
Length=618

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 36/46 (78%), Gaps = 3/46 (7%)
 Frame = +1

Query  481  VYFPSRKRSRINAPFVFSGEKVDEKKQASIEVLPDECLFEIFRRLP  618
            VYFP+RKR RI A  VFSG    E+KQ SI+VLPDECLFEI RRLP
Sbjct  26   VYFPARKRLRIAATSVFSGF---EQKQTSIDVLPDECLFEILRRLP  68



>ref|XP_009607234.1| PREDICTED: EIN3-binding F-box protein 2-like [Nicotiana tomentosiformis]
Length=637

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 36/82 (44%), Positives = 42/82 (51%), Gaps = 18/82 (22%)
 Frame = +1

Query  373  PAVVPMSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  552
            P +V  S   EF  G  FC +              +VY P RKR RI+ PFV      D 
Sbjct  2    PTLVNYSGDDEFYSGGPFCSA--------------EVYCPPRKRVRISGPFVVE----DR  43

Query  553  KKQASIEVLPDECLFEIFRRLP  618
             K  S+E+LPDECLFEI RRLP
Sbjct  44   SKDPSLEILPDECLFEILRRLP  65



>emb|CDX87090.1| BnaC09g04050D [Brassica napus]
Length=616

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 45/77 (58%), Gaps = 6/77 (8%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQAS  567
            MS +  FSG +DF        + LS G    VY P RKR R+ AP  +S      +KQ S
Sbjct  1    MSGIFSFSGDEDF---FNGGTMHLSPGSCPGVYLPPRKRLRVAAPSPYS---AFNQKQTS  54

Query  568  IEVLPDECLFEIFRRLP  618
            IEVLPDECLFEI RRLP
Sbjct  55   IEVLPDECLFEILRRLP  71



>emb|CDY35358.1| BnaA04g14890D [Brassica napus]
Length=623

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 56/82 (68%), Gaps = 9/82 (11%)
 Frame = +1

Query  388  MSKLLEFSGGDDF---CPSPMDSILFLSLGHQVDVYFPSRKRSRI--NAPFVFSGEKVDE  552
            MS++  F+G  +F     +P ++ +FLSL   VD Y+P  KRSR+   AP +FS  + +E
Sbjct  1    MSQIYSFAGESEFYRRGSNPKEANIFLSL---VDCYYPPCKRSRVVAAAPSLFSAFE-EE  56

Query  553  KKQASIEVLPDECLFEIFRRLP  618
            +K  SI++LPDECLFEIFRRLP
Sbjct  57   EKPVSIDLLPDECLFEIFRRLP  78



>ref|XP_009140675.1| PREDICTED: EIN3-binding F-box protein 1 [Brassica rapa]
Length=622

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 56/82 (68%), Gaps = 9/82 (11%)
 Frame = +1

Query  388  MSKLLEFSGGDDF---CPSPMDSILFLSLGHQVDVYFPSRKRSRI--NAPFVFSGEKVDE  552
            MS++  F+G  +F     +P ++ +FLSL   VD Y+P  KRSR+   AP +FS  + +E
Sbjct  1    MSQIYSFAGESEFYRRGSNPKEANIFLSL---VDCYYPPCKRSRVVAAAPSLFSAFE-EE  56

Query  553  KKQASIEVLPDECLFEIFRRLP  618
            +K  SI++LPDECLFEIFRRLP
Sbjct  57   EKPVSIDLLPDECLFEIFRRLP  78



>ref|XP_007138419.1| hypothetical protein PHAVU_009G207300g [Phaseolus vulgaris]
 gb|ESW10413.1| hypothetical protein PHAVU_009G207300g [Phaseolus vulgaris]
Length=650

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 34/83 (41%), Positives = 51/83 (61%), Gaps = 7/83 (8%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCPSP------MDSILFLSLGHQVDVYFPS-RKRSRINAPFVFSGEKV  546
            M  L+ +SG D+  P        +D     +LG  V+ Y+ +  KR+RINAP +F   ++
Sbjct  1    MPALVNYSGDDELYPGASFGQNLIDLGRMCTLGSSVEGYYCTPNKRARINAPDIFETLRL  60

Query  547  DEKKQASIEVLPDECLFEIFRRL  615
             + ++ +IEVLP+ECLFEIFRRL
Sbjct  61   RKDQKPAIEVLPNECLFEIFRRL  83



>emb|CDY19807.1| BnaA09g04600D [Brassica napus]
Length=616

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 47/77 (61%), Gaps = 6/77 (8%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQAS  567
            MS +  F+G ++F        ++LS G    VY P RKR R++ P ++S      +KQ S
Sbjct  1    MSGIFSFNGDEEFFNGGS---MYLSPGSCSGVYLPPRKRLRVSTPSLYSSF---NQKQTS  54

Query  568  IEVLPDECLFEIFRRLP  618
            IEVLPDECLFEI RRLP
Sbjct  55   IEVLPDECLFEILRRLP  71



>emb|CDX80503.1| BnaC07g29410D [Brassica napus]
Length=621

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 45/77 (58%), Gaps = 1/77 (1%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQAS  567
            MS +   SG D+F      S + LS G    VY P+RKR R+ +    S     E+KQ S
Sbjct  1    MSGIFRISGDDEFFTGGGSS-MHLSPGSCPGVYLPARKRLRVASAAATSFYSSFEEKQTS  59

Query  568  IEVLPDECLFEIFRRLP  618
            I+VLPDECLFEI RRLP
Sbjct  60   IQVLPDECLFEILRRLP  76



>ref|XP_009403463.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=654

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 42/85 (49%), Positives = 51/85 (60%), Gaps = 8/85 (9%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKV-  546
            M+ L+  +G DD  P      + MDS L LSL +  D Y P  KR RI +    +GEK  
Sbjct  1    MAALVNCAGNDDIGPGGPLFSNLMDSSLLLSLTYNFDAYCPPSKRYRITSLICKAGEKTA  60

Query  547  DEKKQA-SIEVLPDECLFEIFRRLP  618
            DEK+Q  SI+ LPDECLFEI RRLP
Sbjct  61   DEKQQPRSIDTLPDECLFEILRRLP  85



>ref|XP_009791397.1| PREDICTED: EIN3-binding F-box protein 2-like [Nicotiana sylvestris]
Length=637

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 42/81 (52%), Gaps = 18/81 (22%)
 Frame = +1

Query  373  PAVVPMSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  552
            P +V  S   EF  G  FC +              +VY P RKR RI++PFV      D 
Sbjct  2    PTLVNHSGDDEFYSGGPFCSA--------------EVYCPPRKRVRISSPFVVE----DR  43

Query  553  KKQASIEVLPDECLFEIFRRL  615
             K  S+E+LPDECLFEI RRL
Sbjct  44   SKDPSLEILPDECLFEILRRL  64



>ref|XP_003522913.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN36400.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=650

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 39/86 (45%), Positives = 52/86 (60%), Gaps = 13/86 (15%)
 Frame = +1

Query  388  MSKLLEFSGGDD------FCPSPMDSILFLSLGHQVDVYF--PSRKRSRINA--PFVFSG  537
            M  L+ +SG D+      FC +P+D     + G  VD Y+  PS KR+RINA   F F G
Sbjct  1    MPTLVNYSGDDELYHGGSFCQNPIDLGRLCTYGSIVDEYYYTPS-KRARINALDAFEFLG  59

Query  538  EKVDEKKQASIEVLPDECLFEIFRRL  615
             + D+K   +I+VLPDECLFE+FR L
Sbjct  60   REQDQK--PTIDVLPDECLFEVFRWL  83



>ref|XP_007204219.1| hypothetical protein PRUPE_ppa003009mg [Prunus persica]
 gb|EMJ05418.1| hypothetical protein PRUPE_ppa003009mg [Prunus persica]
Length=612

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 40/59 (68%), Gaps = 3/59 (5%)
 Frame = +1

Query  439  MDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQASIEVLPDECLFEIFRRL  615
            MD    LS+G    VY+P  KR+R ++ F F G   ++ ++ SIEVLPDECLFEIFRRL
Sbjct  1    MDLGCLLSIGS---VYYPPSKRARKDSQFAFEGSDFEQVRKPSIEVLPDECLFEIFRRL  56



>gb|EPS63879.1| f-box family protein, partial [Genlisea aurea]
Length=680

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 38/81 (47%), Positives = 46/81 (57%), Gaps = 8/81 (10%)
 Frame = +1

Query  388  MSKLLEFSG-----GDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  552
            MSK+L + G          P    S  F   G+  + Y   RKR RI+APFV +G +V  
Sbjct  14   MSKVLGYGGVCEHQAGMLFPRSDYSDTFFPFGNHFESYSLQRKRCRISAPFV-AGREV--  70

Query  553  KKQASIEVLPDECLFEIFRRL  615
            K   SIE+LPDECLFEIFRRL
Sbjct  71   KLLPSIEILPDECLFEIFRRL  91



>gb|ABK25485.1| unknown [Picea sitchensis]
Length=535

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 47/82 (57%), Gaps = 4/82 (5%)
 Frame = +1

Query  388  MSKLLEFSGGDDFC----PSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEK  555
            M  L+ F G +DF        +D+ LFLSL  +++V  P RKR R N    F   K  ++
Sbjct  1    MPTLVSFRGDEDFGGPKFSGRVDTDLFLSLAPRMEVLCPPRKRLRGNVTIPFRETKPKQE  60

Query  556  KQASIEVLPDECLFEIFRRLPV  621
            ++  I +LPDECLFEIFR LP 
Sbjct  61   QKDLISMLPDECLFEIFRCLPA  82



>gb|KJB07621.1| hypothetical protein B456_001G033400 [Gossypium raimondii]
Length=613

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 36/47 (77%), Gaps = 5/47 (11%)
 Frame = +1

Query  475  VDVYFPSRKRSRINAPFVFSGEKVDEKKQASIEVLPDECLFEIFRRL  615
            +DVYFP  KRSR +A    SGEK ++KK  SIEVLPDECLFEIFR L
Sbjct  1    MDVYFPLSKRSRTSA----SGEKFEQKK-PSIEVLPDECLFEIFRWL  42



>ref|XP_010533156.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=632

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/52 (50%), Positives = 36/52 (69%), Gaps = 6/52 (12%)
 Frame = +1

Query  463  LGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQASIEVLPDECLFEIFRRLP  618
            +G+ VDVY+P  KR+R+      S  + +   ++SIE+LPDECLFEI RRLP
Sbjct  33   VGNNVDVYYPPGKRARL------SESEPEATDRSSIEILPDECLFEILRRLP  78



>gb|AES91540.2| EIN3-binding F-box-like protein [Medicago truncatula]
Length=633

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 41/74 (55%), Gaps = 8/74 (11%)
 Frame = +1

Query  409  SGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFS----GEKVDEKKQASIEV  576
            SG D+  P         ++   VDV+    KR+RI+APF F       +  +  + SIE 
Sbjct  8    SGNDELHPGCRG----YTISSNVDVHCSPTKRTRISAPFTFGPLPRALEHGQDLKPSIES  63

Query  577  LPDECLFEIFRRLP  618
            LPDECLFEIFRRLP
Sbjct  64   LPDECLFEIFRRLP  77



>ref|XP_010541915.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=637

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 28/71 (39%), Positives = 41/71 (58%), Gaps = 1/71 (1%)
 Frame = +1

Query  409  SGGDDFCPSPMDSILFLSLGHQVDVYF-PSRKRSRINAPFVFSGEKVDEKKQASIEVLPD  585
            + G   C + ++    L  G    VY+ P  KR+RI++  +    + +  +Q SIE+LPD
Sbjct  15   NAGGSICKTQLNLGKLLYTGDNAGVYYYPPNKRARISSSVLSVESETEVSEQQSIEILPD  74

Query  586  ECLFEIFRRLP  618
            ECLFEI RRLP
Sbjct  75   ECLFEILRRLP  85



>gb|KEH32122.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=684

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  478  DVYFPSRKRSRINAPFVFSGEKVDEKKQASIEVLPDECLFEIFRRLP  618
            DV+    KR RI+ PF F   + ++  + +IEVL DECLFEIFRRLP
Sbjct  26   DVHCSPTKRPRISVPFSFGALEHEQDLKPTIEVLLDECLFEIFRRLP  72



>gb|KEH32121.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=688

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  478  DVYFPSRKRSRINAPFVFSGEKVDEKKQASIEVLPDECLFEIFRRLP  618
            DV+    KR RI+ PF F   + ++  + +IEVL DECLFEIFRRLP
Sbjct  30   DVHCSPTKRPRISVPFSFGALEHEQDLKPTIEVLLDECLFEIFRRLP  76



>ref|XP_003609344.1| Ein3-binding f-box protein [Medicago truncatula]
 gb|AES91541.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=739

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  478  DVYFPSRKRSRINAPFVFSGEKVDEKKQASIEVLPDECLFEIFRRLP  618
            DV+    KR RI+ PF F   + ++  + +IEVL DECLFEIFRRLP
Sbjct  81   DVHCSPTKRPRISVPFSFGALEHEQDLKPTIEVLLDECLFEIFRRLP  127



>emb|CDP13515.1| unnamed protein product [Coffea canephora]
Length=143

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 45/81 (56%), Gaps = 7/81 (9%)
 Frame = +2

Query  389  CLSSLNSVVVMIFAL------VPWTQFSFCPLAIKWMCIFLLARGLASMLPLYLVEKKST  550
            CL  L SVV   F+L      +P +Q  F PL + WMC F LARGL SM  ++LVE KS 
Sbjct  44   CLKCLISVVTRTFSLGGRYTQIPRSQICFYPLDLMWMCFFHLARGLVSMPHMFLVE-KSL  102

Query  551  RRNRLRLKSSPMNVSLRFSDV  613
              +   LK   MN SLR S V
Sbjct  103  SGSSPPLKFFQMNASLRSSGV  123



>ref|XP_004150592.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
Length=614

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 45/77 (58%), Gaps = 5/77 (6%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCPSPMDSI-LFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQA  564
            M  LL ++G D+F P+ M+    FL +  +++V F   KR R N    F G+      + 
Sbjct  1    MPTLLNYTGDDEFHPTSMEDFPCFLPISSRINVCFQPNKRFRTNLKIPFLGDDT----KP  56

Query  565  SIEVLPDECLFEIFRRL  615
            SI+ LPDECLFEIF+RL
Sbjct  57   SIDDLPDECLFEIFKRL  73



>ref|XP_003609343.1| Ein3-binding f-box protein [Medicago truncatula]
Length=1052

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 41/74 (55%), Gaps = 8/74 (11%)
 Frame = +1

Query  409  SGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFS----GEKVDEKKQASIEV  576
            SG D+  P         ++   VDV+    KR+RI+APF F       +  +  + SIE 
Sbjct  8    SGNDELHPGCRG----YTISSNVDVHCSPTKRTRISAPFTFGPLPRALEHGQDLKPSIES  63

Query  577  LPDECLFEIFRRLP  618
            LPDECLFEIFRRLP
Sbjct  64   LPDECLFEIFRRLP  77



>gb|EPS63568.1| ein3-binding f-box protein 3, partial [Genlisea aurea]
Length=596

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (7%)
 Frame = +1

Query  481  VYFPSRKRSRINAPFVFSGEKVDEKKQASIEVLPDECLFEIFRRLP  618
            VY   RKR R+NAPFV S E    K   SI+ LPDECLFEI RRLP
Sbjct  1    VYSLQRKRCRVNAPFVASREF---KLPPSIDALPDECLFEILRRLP  43



>ref|XP_002526343.1| grr1, plant, putative [Ricinus communis]
 gb|EEF36014.1| grr1, plant, putative [Ricinus communis]
Length=127

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +1

Query  469  HQVDVYFPSRKRSRINAPFVFSGEKVDEK  555
            HQVDVY PSRKRSRINAPFVF+G+    +
Sbjct  14   HQVDVYSPSRKRSRINAPFVFNGKSYSRR  42



>ref|XP_008443991.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis melo]
Length=614

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 44/77 (57%), Gaps = 5/77 (6%)
 Frame = +1

Query  388  MSKLLEFSGGDDFCPSPMDSI-LFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQA  564
            M  LL ++G D+F P+ M+    FL +  +++V F   KR R N    F  +  +     
Sbjct  1    MPTLLNYTGDDEFHPTSMEDFPCFLPVSSRINVCFQPNKRVRANLKIPFRRDDTNP----  56

Query  565  SIEVLPDECLFEIFRRL  615
            SI+ LPDECLFEIF+RL
Sbjct  57   SIDDLPDECLFEIFKRL  73



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 883751467950