BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS060B11

Length=636
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010325421.1|  PREDICTED: uncharacterized protein LOC101264...    137   7e-33   Solanum lycopersicum
emb|CDP09782.1|  unnamed protein product                                134   2e-32   Coffea canephora [robusta coffee]
ref|XP_006358895.1|  PREDICTED: uncharacterized protein LOC102587...    134   9e-32   Solanum tuberosum [potatoes]
ref|XP_004245626.1|  PREDICTED: uncharacterized protein LOC101264...    132   5e-31   Solanum lycopersicum
ref|XP_010325420.1|  PREDICTED: uncharacterized protein LOC101264...    131   5e-31   Solanum lycopersicum
ref|XP_006358894.1|  PREDICTED: uncharacterized protein LOC102587...    130   1e-30   Solanum tuberosum [potatoes]
ref|XP_006358896.1|  PREDICTED: uncharacterized protein LOC102587...    130   1e-30   Solanum tuberosum [potatoes]
ref|XP_008238911.1|  PREDICTED: uncharacterized protein LOC103337528    125   2e-29   
ref|XP_007209689.1|  hypothetical protein PRUPE_ppa012392mg             117   3e-29   
ref|XP_009589209.1|  PREDICTED: uncharacterized protein LOC104086...    125   7e-29   Nicotiana tomentosiformis
ref|XP_009589208.1|  PREDICTED: uncharacterized protein LOC104086...    125   8e-29   Nicotiana tomentosiformis
ref|XP_009782390.1|  PREDICTED: uncharacterized protein LOC104231...    124   2e-28   Nicotiana sylvestris
ref|XP_009782391.1|  PREDICTED: uncharacterized protein LOC104231...    124   2e-28   Nicotiana sylvestris
ref|XP_009782392.1|  PREDICTED: uncharacterized protein LOC104231...    124   2e-28   Nicotiana sylvestris
ref|XP_004143925.1|  PREDICTED: uncharacterized protein LOC101223188    121   7e-28   Cucumis sativus [cucumbers]
ref|XP_008437228.1|  PREDICTED: uncharacterized protein LOC103482...    120   9e-28   Cucumis melo [Oriental melon]
ref|XP_008437229.1|  PREDICTED: transcriptional regulator ATRX ho...    119   3e-27   Cucumis melo [Oriental melon]
ref|XP_008437227.1|  PREDICTED: uncharacterized protein LOC103482...    119   3e-27   Cucumis melo [Oriental melon]
ref|XP_008351681.1|  PREDICTED: uncharacterized protein LOC103415104    116   4e-26   
ref|XP_008392616.1|  PREDICTED: uncharacterized protein LOC103454798    116   6e-26   
ref|XP_009375787.1|  PREDICTED: uncharacterized protein LOC103964...    116   9e-26   
ref|XP_009375788.1|  PREDICTED: methyl-CpG-binding domain-contain...    115   9e-26   Pyrus x bretschneideri [bai li]
ref|XP_011072316.1|  PREDICTED: uncharacterized protein LOC105157...    113   3e-25   Sesamum indicum [beniseed]
ref|XP_011072312.1|  PREDICTED: uncharacterized protein LOC105157...    110   3e-24   Sesamum indicum [beniseed]
ref|XP_011463824.1|  PREDICTED: uncharacterized protein LOC101312...    110   8e-24   Fragaria vesca subsp. vesca
ref|XP_011463825.1|  PREDICTED: uncharacterized protein LOC101312...    110   8e-24   Fragaria vesca subsp. vesca
gb|KDP25474.1|  hypothetical protein JCGZ_20630                         109   1e-23   Jatropha curcas
ref|XP_010661051.1|  PREDICTED: methyl-CpG-binding domain-contain...    108   1e-23   Vitis vinifera
gb|KDO55594.1|  hypothetical protein CISIN_1g0013392mg                  103   5e-23   Citrus sinensis [apfelsine]
ref|XP_009369054.1|  PREDICTED: uncharacterized protein LOC103958513    107   6e-23   
ref|XP_007040167.1|  Uncharacterized protein TCM_016211                 104   6e-22   
gb|KDO55591.1|  hypothetical protein CISIN_1g0013392mg                99.4    2e-21   Citrus sinensis [apfelsine]
ref|XP_006440582.1|  hypothetical protein CICLE_v10018609mg             102   4e-21   Citrus clementina [clementine]
ref|XP_006440583.1|  hypothetical protein CICLE_v10018609mg             102   5e-21   
ref|XP_006477436.1|  PREDICTED: uncharacterized protein LOC102622266    100   1e-20   
ref|XP_010089148.1|  Methyl-CpG-binding domain-containing protein 5   94.0    4e-20   
ref|XP_010676507.1|  PREDICTED: uncharacterized protein LOC104892...  97.1    3e-19   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010676508.1|  PREDICTED: uncharacterized protein LOC104892...  93.6    3e-18   
gb|KJB39637.1|  hypothetical protein B456_007G022700                  93.6    3e-18   Gossypium raimondii
ref|XP_010676506.1|  PREDICTED: uncharacterized protein LOC104892...  93.6    4e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010255467.1|  PREDICTED: uncharacterized protein LOC104596...  89.0    7e-17   Nelumbo nucifera [Indian lotus]
ref|XP_010255468.1|  PREDICTED: uncharacterized protein LOC104596...  89.0    8e-17   Nelumbo nucifera [Indian lotus]
ref|XP_008796736.1|  PREDICTED: uncharacterized protein LOC103712...  84.3    4e-15   Phoenix dactylifera
ref|XP_008796738.1|  PREDICTED: uncharacterized protein LOC103712...  84.3    4e-15   Phoenix dactylifera
ref|XP_007158477.1|  hypothetical protein PHAVU_002G155600g           84.3    4e-15   Phaseolus vulgaris [French bean]
ref|XP_007158476.1|  hypothetical protein PHAVU_002G155600g           84.3    4e-15   Phaseolus vulgaris [French bean]
ref|XP_007158475.1|  hypothetical protein PHAVU_002G155600g           84.3    4e-15   Phaseolus vulgaris [French bean]
ref|XP_007158478.1|  hypothetical protein PHAVU_002G155600g           84.3    5e-15   Phaseolus vulgaris [French bean]
ref|XP_008796735.1|  PREDICTED: uncharacterized protein LOC103712...  83.2    7e-15   Phoenix dactylifera
ref|XP_008796742.1|  PREDICTED: uncharacterized protein LOC103712...  83.2    8e-15   Phoenix dactylifera
ref|XP_008796737.1|  PREDICTED: uncharacterized protein LOC103712...  83.2    8e-15   Phoenix dactylifera
ref|XP_010918513.1|  PREDICTED: methyl-CpG-binding domain-contain...  77.8    3e-13   
ref|XP_006827729.1|  hypothetical protein AMTR_s00009p00261370        77.0    1e-12   Amborella trichopoda
ref|XP_006440581.1|  hypothetical protein CICLE_v10018609mg           73.9    1e-11   Citrus clementina [clementine]
gb|KDO55595.1|  hypothetical protein CISIN_1g0013392mg                71.2    1e-11   Citrus sinensis [apfelsine]
gb|KEH21030.1|  methyl-CpG-binding domain protein                     73.9    1e-11   Medicago truncatula
ref|XP_006580605.1|  PREDICTED: uncharacterized protein LOC100782433  73.6    2e-11   Glycine max [soybeans]
gb|KHN23667.1|  Methyl-CpG-binding domain-containing protein 13       73.6    2e-11   Glycine soja [wild soybean]
ref|XP_003532403.1|  PREDICTED: methyl-CpG-binding domain-contain...  72.4    3e-11   Glycine max [soybeans]
gb|KHN16846.1|  Methyl-CpG-binding domain-containing protein 13       72.4    3e-11   Glycine soja [wild soybean]
ref|XP_008796741.1|  PREDICTED: uncharacterized protein LOC103712...  70.5    1e-10   Phoenix dactylifera
ref|XP_008796743.1|  PREDICTED: uncharacterized protein LOC103712...  70.5    1e-10   Phoenix dactylifera
ref|XP_008796740.1|  PREDICTED: uncharacterized protein LOC103712...  69.7    2e-10   Phoenix dactylifera
ref|XP_010685755.1|  PREDICTED: uncharacterized protein LOC104900109  66.6    2e-10   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007160033.1|  hypothetical protein PHAVU_002G287000g           70.1    2e-10   Phaseolus vulgaris [French bean]
gb|EYU25079.1|  hypothetical protein MIMGU_mgv11b021680mg             68.6    2e-10   Erythranthe guttata [common monkey flower]
ref|XP_008791903.1|  PREDICTED: uncharacterized protein LOC103708650  69.3    3e-10   Phoenix dactylifera
emb|CBI34715.3|  unnamed protein product                              68.6    5e-10   Vitis vinifera
ref|XP_010661055.1|  PREDICTED: methyl-CpG-binding domain-contain...  67.8    7e-10   Vitis vinifera
ref|XP_010661063.1|  PREDICTED: methyl-CpG-binding domain-contain...  67.4    1e-09   Vitis vinifera
ref|XP_010273135.1|  PREDICTED: methyl-CpG-binding domain-contain...  67.4    1e-09   Nelumbo nucifera [Indian lotus]
ref|XP_002509754.1|  hypothetical protein RCOM_1685990                66.6    2e-09   
ref|XP_009760427.1|  PREDICTED: methyl-CpG-binding domain-contain...  65.9    3e-09   Nicotiana sylvestris
ref|XP_011076193.1|  PREDICTED: methyl-CpG-binding domain-contain...  65.5    5e-09   
ref|XP_009364396.1|  PREDICTED: methyl-CpG-binding domain-contain...  62.8    8e-09   Pyrus x bretschneideri [bai li]
ref|XP_010934848.1|  PREDICTED: uncharacterized protein LOC105054...  64.7    9e-09   Elaeis guineensis
ref|XP_010934849.1|  PREDICTED: uncharacterized protein LOC105054...  64.7    9e-09   
ref|XP_010934847.1|  PREDICTED: uncharacterized protein LOC105054...  64.3    1e-08   
emb|CDP05220.1|  unnamed protein product                              64.3    1e-08   Coffea canephora [robusta coffee]
ref|XP_010934846.1|  PREDICTED: uncharacterized protein LOC105054...  64.3    1e-08   Elaeis guineensis
ref|XP_008357235.1|  PREDICTED: methyl-CpG-binding domain-contain...  62.4    1e-08   Malus domestica [apple tree]
ref|XP_004503754.1|  PREDICTED: uncharacterized protein LOC101511357  64.3    1e-08   Cicer arietinum [garbanzo]
ref|XP_010918514.1|  PREDICTED: methyl-CpG-binding domain-contain...  63.2    2e-08   
ref|XP_010533702.1|  PREDICTED: uncharacterized protein LOC104809...  62.8    2e-08   Tarenaya hassleriana [spider flower]
ref|XP_010533701.1|  PREDICTED: uncharacterized protein LOC104809...  62.8    3e-08   Tarenaya hassleriana [spider flower]
ref|XP_010533700.1|  PREDICTED: uncharacterized protein LOC104809...  62.8    3e-08   Tarenaya hassleriana [spider flower]
ref|XP_009418270.1|  PREDICTED: uncharacterized protein LOC103998...  61.6    3e-08   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK40518.1|  hypothetical protein AALP_AA2G006300                  62.8    4e-08   Arabis alpina [alpine rockcress]
gb|KFK40519.1|  hypothetical protein AALP_AA2G006300                  62.4    4e-08   Arabis alpina [alpine rockcress]
ref|XP_009345985.1|  PREDICTED: methyl-CpG-binding domain-contain...  59.7    1e-07   Pyrus x bretschneideri [bai li]
ref|XP_009345984.1|  PREDICTED: methyl-CpG-binding domain-contain...  59.7    1e-07   Pyrus x bretschneideri [bai li]
ref|XP_009595657.1|  PREDICTED: methyl-CpG-binding domain-contain...  60.8    1e-07   Nicotiana tomentosiformis
ref|XP_009353664.1|  PREDICTED: methyl-CpG-binding domain-contain...  58.9    2e-07   Pyrus x bretschneideri [bai li]
ref|XP_011084407.1|  PREDICTED: methyl-CpG-binding domain-contain...  58.9    5e-07   Sesamum indicum [beniseed]
ref|XP_002276814.3|  PREDICTED: methyl-CpG-binding domain-contain...  58.2    1e-06   Vitis vinifera
gb|KHN35006.1|  hypothetical protein glysoja_004772                   55.8    1e-06   Glycine soja [wild soybean]
ref|XP_006353332.1|  PREDICTED: methyl-CpG-binding domain-contain...  57.8    2e-06   Solanum tuberosum [potatoes]
ref|XP_004234378.1|  PREDICTED: methyl-CpG-binding domain-contain...  57.4    2e-06   Solanum lycopersicum
gb|KJB39638.1|  hypothetical protein B456_007G022700                  56.6    4e-06   Gossypium raimondii
emb|CBI31785.3|  unnamed protein product                              56.2    5e-06   Vitis vinifera
ref|XP_009390529.1|  PREDICTED: uncharacterized protein LOC103976...  56.2    5e-06   
ref|XP_010662494.1|  PREDICTED: uncharacterized protein LOC100263...  56.2    5e-06   Vitis vinifera
ref|XP_009390518.1|  PREDICTED: uncharacterized protein LOC103976...  56.2    5e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390512.1|  PREDICTED: uncharacterized protein LOC103976...  56.2    5e-06   
ref|XP_010255469.1|  PREDICTED: uncharacterized protein LOC104596...  55.8    7e-06   Nelumbo nucifera [Indian lotus]
ref|XP_008378256.1|  PREDICTED: uncharacterized protein LOC103441353  55.8    8e-06   
ref|XP_006369523.1|  hypothetical protein POPTR_0001s24690g           52.8    1e-05   
ref|XP_006369524.1|  hypothetical protein POPTR_0001s24690g           53.1    1e-05   
ref|XP_002314180.1|  methyl-CpG-binding domain-containing family ...  53.9    1e-05   
emb|CAN74037.1|  hypothetical protein VITISV_023406                   55.1    1e-05   Vitis vinifera
ref|XP_005196854.1|  PREDICTED: methyl-CpG-binding domain protein...  52.4    1e-05   
ref|XP_008223622.1|  PREDICTED: methyl-CpG-binding domain-contain...  53.9    1e-05   Prunus mume [ume]
ref|XP_011042705.1|  PREDICTED: methyl-CpG-binding domain-contain...  53.5    1e-05   Populus euphratica
emb|CBI16126.3|  unnamed protein product                              52.8    2e-05   Vitis vinifera
ref|XP_008234128.1|  PREDICTED: methyl-CpG-binding domain-contain...  54.3    2e-05   Prunus mume [ume]
ref|XP_002299872.1|  methyl-CpG-binding domain-containing family ...  53.1    2e-05   Populus trichocarpa [western balsam poplar]
ref|XP_002532846.1|  DNA binding protein, putative                    53.1    3e-05   
emb|CDX80274.1|  BnaC09g34680D                                        53.9    3e-05   
ref|XP_002283682.1|  PREDICTED: uncharacterized protein LOC100243225  52.8    3e-05   Vitis vinifera
gb|EEE60561.1|  hypothetical protein OsJ_13923                        53.1    4e-05   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ29862.1|  hypothetical protein OsJ_13921                        53.5    4e-05   Oryza sativa Japonica Group [Japonica rice]
emb|CDY59223.1|  BnaCnng34510D                                        52.8    4e-05   Brassica napus [oilseed rape]
emb|CDY48687.1|  BnaC02g09990D                                        52.8    4e-05   Brassica napus [oilseed rape]
ref|XP_009371320.1|  PREDICTED: methyl-CpG-binding domain-contain...  53.5    4e-05   Pyrus x bretschneideri [bai li]
ref|XP_009371318.1|  PREDICTED: methyl-CpG-binding domain-contain...  53.5    4e-05   Pyrus x bretschneideri [bai li]
gb|KCW52682.1|  hypothetical protein EUGRSUZ_J02050                   52.4    5e-05   Eucalyptus grandis [rose gum]
pdb|2KY8|A  Chain A, Solution Structure And Dynamic Analysis Of C...  49.7    6e-05   Gallus gallus [bantam]
emb|CDY53445.1|  BnaA02g07070D                                        52.0    7e-05   Brassica napus [oilseed rape]
emb|CAE04540.2|  OSJNBa0040D17.8                                      52.4    8e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010866106.1|  PREDICTED: methyl-CpG-binding domain protein...  52.0    8e-05   
ref|XP_010866107.1|  PREDICTED: methyl-CpG-binding domain protein...  52.0    8e-05   
gb|KGN65724.1|  hypothetical protein Csa_1G522010                     52.4    8e-05   Cucumis sativus [cucumbers]
emb|CBI16127.3|  unnamed protein product                              50.1    8e-05   Vitis vinifera
emb|CAN80675.1|  hypothetical protein VITISV_003810                   52.4    9e-05   Vitis vinifera
ref|XP_010033125.1|  PREDICTED: methyl-CpG-binding domain-contain...  52.0    9e-05   Eucalyptus grandis [rose gum]
gb|KDP34493.1|  hypothetical protein JCGZ_11043                       51.6    9e-05   Jatropha curcas
ref|XP_007038658.1|  Methyl-CPG-binding domain protein 13, putati...  52.4    9e-05   
gb|AFW57954.1|  methyl-binding domain MBD113 protein                  52.4    1e-04   
ref|XP_003632148.1|  PREDICTED: methyl-CpG-binding domain-contain...  52.0    1e-04   Vitis vinifera
ref|XP_009126698.1|  PREDICTED: methyl-CpG-binding domain-contain...  51.6    1e-04   Brassica rapa
ref|XP_008113313.1|  PREDICTED: LOW QUALITY PROTEIN: methyl-CpG-b...  52.0    1e-04   
emb|CDQ84332.1|  unnamed protein product                              51.6    1e-04   Oncorhynchus mykiss
ref|XP_011015295.1|  PREDICTED: methyl-CpG-binding domain-contain...  50.8    1e-04   Populus euphratica
ref|XP_008690446.1|  PREDICTED: methyl-CpG-binding domain protein 2   51.6    1e-04   Ursus maritimus [white bear]
gb|ERE82588.1|  methyl-CpG-binding domain protein 2                   51.6    1e-04   Cricetulus griseus [Chinese hamsters]
ref|XP_010581337.1|  PREDICTED: methyl-CpG-binding domain protein 2   51.6    1e-04   Haliaeetus leucocephalus
gb|AGJ83088.1|  methyl-CpG-binding domain protein 2/3                 50.1    1e-04   Apostichopus japonicus
ref|XP_007626931.1|  PREDICTED: methyl-CpG-binding domain protein...  51.6    1e-04   
ref|XP_010869972.1|  PREDICTED: methyl-CpG-binding domain protein...  51.6    1e-04   Esox lucius
ref|XP_006269717.1|  PREDICTED: methyl-CpG-binding domain protein 2   51.6    1e-04   
ref|XP_008662320.1|  PREDICTED: LOC542207 isoform X3                  52.0    1e-04   Zea mays [maize]
ref|XP_004422606.1|  PREDICTED: methyl-CpG-binding domain protein 2   51.6    1e-04   
ref|XP_011217316.1|  PREDICTED: methyl-CpG-binding domain protein 2   51.6    1e-04   
ref|XP_007434720.1|  PREDICTED: methyl-CpG-binding domain protein 2   51.2    1e-04   
emb|CDQ72293.1|  unnamed protein product                              51.6    1e-04   Oncorhynchus mykiss
ref|XP_010959650.1|  PREDICTED: methyl-CpG-binding domain protein 2   51.2    1e-04   Camelus bactrianus [camel]
ref|XP_008164256.1|  PREDICTED: methyl-CpG-binding domain protein 2   51.6    1e-04   Chrysemys picta bellii
ref|XP_005323113.1|  PREDICTED: methyl-CpG-binding domain protein 2   51.2    1e-04   
ref|XP_004616197.1|  PREDICTED: methyl-CpG-binding domain protein 2   51.2    1e-04   Sorex araneus [Eurasian shrew]
ref|XP_005586721.1|  PREDICTED: methyl-CpG-binding domain protein...  51.2    1e-04   Macaca fascicularis [crab eating macaque]
emb|CDY33033.1|  BnaA10g12390D                                        51.6    2e-04   Brassica napus [oilseed rape]
gb|ELK05599.1|  Methyl-CpG-binding domain protein 2                   51.2    2e-04   Pteropus alecto
ref|XP_006060281.1|  PREDICTED: methyl-CpG-binding domain protein 2   51.6    2e-04   
ref|XP_008275709.1|  PREDICTED: methyl-CpG-binding domain protein...  51.2    2e-04   Stegastes partitus
ref|XP_004552809.1|  PREDICTED: methyl-CpG-binding domain protein...  51.2    2e-04   Maylandia zebra
ref|XP_010751459.1|  PREDICTED: methyl-CpG-binding domain protein...  50.8    2e-04   
ref|XP_010373660.1|  PREDICTED: methyl-CpG-binding domain protein 2   51.2    2e-04   Rhinopithecus roxellana
ref|XP_010731400.1|  PREDICTED: methyl-CpG-binding domain protein...  51.2    2e-04   Larimichthys crocea [croceine croaker]
ref|XP_004826347.1|  PREDICTED: methyl-CpG-binding domain protein...  51.2    2e-04   
ref|XP_008662316.1|  PREDICTED: LOC542207 isoform X1                  51.6    2e-04   
ref|XP_007121352.1|  PREDICTED: methyl-CpG-binding domain protein 2   51.2    2e-04   
ref|XP_007252124.1|  PREDICTED: methyl-CpG-binding domain protein...  51.2    2e-04   
ref|XP_010731391.1|  PREDICTED: methyl-CpG-binding domain protein...  51.2    2e-04   
ref|XP_004067747.1|  PREDICTED: methyl-CpG-binding domain protein...  51.2    2e-04   Oryzias latipes [Japanese rice fish]
ref|XP_008512879.1|  PREDICTED: methyl-CpG-binding domain protein 2   51.2    2e-04   Equus przewalskii [Przewalski horse]
ref|XP_005994716.1|  PREDICTED: methyl-CpG-binding domain protein...  51.2    2e-04   Latimeria chalumnae
emb|CAG01351.1|  unnamed protein product                              51.2    2e-04   Tetraodon nigroviridis
gb|EFB26811.1|  hypothetical protein PANDA_002637                     51.2    2e-04   Ailuropoda melanoleuca
ref|XP_008336893.1|  PREDICTED: methyl-CpG-binding domain protein...  51.2    2e-04   
ref|XP_004703164.1|  PREDICTED: methyl-CpG-binding domain protein 2   51.2    2e-04   
ref|XP_008405369.1|  PREDICTED: methyl-CpG-binding domain protein...  51.2    2e-04   Poecilia reticulata
ref|XP_005795658.1|  PREDICTED: methyl-CpG-binding domain protein...  51.2    2e-04   
ref|XP_007569227.1|  PREDICTED: methyl-CpG-binding domain protein...  51.2    2e-04   Poecilia formosa
ref|XP_006205872.1|  PREDICTED: methyl-CpG-binding domain protein 2   51.2    2e-04   Vicugna pacos
gb|EEE60563.1|  hypothetical protein OsJ_13925                        51.2    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009635713.1|  PREDICTED: methyl-CpG-binding domain protein 2   51.2    2e-04   Egretta garzetta
ref|XP_007933750.1|  PREDICTED: methyl-CpG-binding domain protein 2   51.2    2e-04   Orycteropus afer afer
ref|XP_005008631.1|  PREDICTED: LOW QUALITY PROTEIN: methyl-CpG b...  51.2    2e-04   Cavia porcellus [guinea pig]
ref|XP_004561977.1|  PREDICTED: methyl-CpG-binding domain protein...  50.8    2e-04   Maylandia zebra
ref|XP_011453190.1|  PREDICTED: methyl-CpG-binding domain protein...  50.8    2e-04   Crassostrea gigas
ref|XP_005917072.1|  PREDICTED: methyl-CpG-binding domain protein...  50.8    2e-04   Haplochromis burtoni
ref|XP_006891817.1|  PREDICTED: methyl-CpG-binding domain protein 2   50.8    2e-04   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_004654676.1|  PREDICTED: methyl-CpG-binding domain protein 2   50.8    2e-04   
ref|XP_005373227.1|  PREDICTED: methyl-CpG-binding domain protein 2   51.2    2e-04   
ref|NP_001012403.1|  methyl-CpG-binding domain protein 2              50.8    2e-04   Gallus gallus [bantam]
ref|XP_003440292.2|  PREDICTED: methyl-CpG-binding domain protein...  50.8    2e-04   Oreochromis niloticus
ref|NP_997933.1|  methyl-CpG-binding domain protein 2                 50.8    2e-04   Danio rerio [leopard danio]
ref|XP_004379351.1|  PREDICTED: methyl-CpG-binding domain protein 2   50.8    2e-04   
ref|XP_007080650.1|  PREDICTED: methyl-CpG-binding domain protein 2   50.8    2e-04   Panthera tigris altaica
ref|XP_006837625.1|  PREDICTED: methyl-CpG-binding domain protein 2   50.8    2e-04   Chrysochloris asiatica
ref|XP_008146572.1|  PREDICTED: methyl-CpG-binding domain protein 2   50.8    2e-04   
ref|XP_004294545.1|  PREDICTED: methyl-CpG-binding domain-contain...  50.1    2e-04   Fragaria vesca subsp. vesca
ref|XP_004623785.1|  PREDICTED: methyl-CpG-binding domain protein 2   50.8    2e-04   Octodon degus
ref|XP_008950946.1|  PREDICTED: methyl-CpG-binding domain protein 2   50.8    2e-04   
ref|XP_004579733.1|  PREDICTED: methyl-CpG-binding domain protein 2   50.8    3e-04   Ochotona princeps [southern American pika]
ref|XP_008322590.1|  PREDICTED: methyl-CpG-binding domain protein 2   50.8    3e-04   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_005356460.1|  PREDICTED: methyl-CpG-binding domain protein 2   50.8    3e-04   
ref|XP_010751457.1|  PREDICTED: methyl-CpG-binding domain protein...  50.8    3e-04   Larimichthys crocea [croceine croaker]
ref|XP_004168988.1|  PREDICTED: methyl-CpG-binding domain-contain...  50.1    3e-04   
ref|XP_006970190.1|  PREDICTED: methyl-CpG-binding domain protein 2   50.8    3e-04   Peromyscus maniculatus bairdii
ref|XP_007519298.1|  PREDICTED: LOW QUALITY PROTEIN: methyl-CpG-b...  50.8    3e-04   Erinaceus europaeus [common hedgehog]
ref|XP_006143513.1|  PREDICTED: methyl-CpG-binding domain protein 2   50.8    3e-04   
ref|XP_011453189.1|  PREDICTED: methyl-CpG-binding domain protein...  50.4    3e-04   Crassostrea gigas
ref|XP_004684067.1|  PREDICTED: methyl-CpG-binding domain protein 2   50.8    3e-04   Condylura cristata
ref|XP_006920149.1|  PREDICTED: methyl-CpG-binding domain protein 2   50.8    3e-04   
ref|XP_007972158.1|  PREDICTED: methyl-CpG-binding domain protein 2   50.8    3e-04   Chlorocebus sabaeus
ref|XP_003914441.1|  PREDICTED: methyl-CpG-binding domain protein...  50.8    3e-04   Papio anubis [baboon]
ref|XP_001082249.1|  PREDICTED: methyl-CpG-binding domain protein 2   50.8    3e-04   
ref|XP_005074763.1|  PREDICTED: methyl-CpG-binding domain protein 2   50.8    3e-04   
ref|NP_003918.1|  methyl-CpG-binding domain protein 2 isoform 1       50.8    3e-04   Homo sapiens [man]
ref|XP_004059488.1|  PREDICTED: methyl-CpG-binding domain protein 2   50.8    3e-04   Gorilla gorilla gorilla [lowland gorilla]
ref|XP_010585404.1|  PREDICTED: methyl-CpG-binding domain protein 2   50.8    3e-04   Loxodonta africana [African bush elephant]
ref|XP_010751454.1|  PREDICTED: methyl-CpG-binding domain protein...  50.8    3e-04   Larimichthys crocea [croceine croaker]
ref|XP_001362190.1|  PREDICTED: methyl-CpG-binding domain protein 2   50.8    3e-04   Monodelphis domestica
ref|XP_004405899.1|  PREDICTED: LOW QUALITY PROTEIN: methyl-CpG-b...  50.8    3e-04   Odobenus rosmarus divergens
ref|XP_004855231.1|  PREDICTED: methyl-CpG-binding domain protein 2   50.8    3e-04   Heterocephalus glaber [naked mole rat]
ref|NP_001108497.1|  methyl-CpG-binding domain protein 2              50.8    3e-04   Rattus norvegicus [brown rat]
ref|XP_001499825.2|  PREDICTED: methyl-CpG-binding domain protein 2   50.8    3e-04   
ref|XP_007471726.1|  PREDICTED: methyl-CpG-binding domain protein 2   50.8    3e-04   Lipotes vexillifer [baiji]
ref|XP_005809830.1|  PREDICTED: methyl-CpG-binding domain protein...  50.4    3e-04   Xiphophorus maculatus
ref|XP_008457481.1|  PREDICTED: methyl-CpG-binding domain-contain...  50.4    3e-04   
ref|NP_034903.2|  methyl-CpG-binding domain protein 2                 50.8    3e-04   Mus musculus [mouse]
gb|AAC68872.1|  methyl-CpG binding protein MBD2                       50.8    3e-04   Mus musculus [mouse]
gb|EDM14791.1|  rCG46680, isoform CRA_b                               50.8    3e-04   Rattus norvegicus [brown rat]
ref|XP_004459900.1|  PREDICTED: methyl-CpG-binding domain protein...  50.8    3e-04   Dasypus novemcinctus
emb|CAF91173.1|  unnamed protein product                              50.4    3e-04   Tetraodon nigroviridis
ref|XP_008400582.1|  PREDICTED: methyl-CpG-binding domain protein...  50.4    3e-04   Poecilia reticulata
ref|XP_004266158.1|  PREDICTED: methyl-CpG-binding domain protein 2   50.8    3e-04   Orcinus orca [Orca]
gb|AAH71531.1|  Methyl-CpG binding domain protein 3a                  50.4    3e-04   Danio rerio [leopard danio]
ref|XP_005674618.1|  PREDICTED: LOW QUALITY PROTEIN: methyl-CpG b...  50.1    3e-04   
ref|XP_003965116.1|  PREDICTED: methyl-CpG-binding domain protein...  50.4    3e-04   Takifugu rubripes [tiger puffer]
ref|NP_997934.1|  methyl-CpG-binding domain protein 3                 50.4    3e-04   Danio rerio [leopard danio]
ref|XP_007575083.1|  PREDICTED: methyl-CpG-binding domain protein 2   50.4    4e-04   Poecilia formosa
ref|XP_010751455.1|  PREDICTED: methyl-CpG-binding domain protein...  50.4    4e-04   
ref|XP_007192116.1|  PREDICTED: methyl-CpG-binding domain protein 2   50.4    4e-04   
ref|XP_004084660.1|  PREDICTED: methyl-CpG-binding domain protein...  50.1    4e-04   
ref|XP_009432315.1|  PREDICTED: methyl-CpG-binding domain protein...  50.4    4e-04   
ref|XP_008301772.1|  PREDICTED: methyl-CpG-binding domain protein...  50.1    4e-04   Stegastes partitus
ref|XP_010751451.1|  PREDICTED: methyl-CpG-binding domain protein...  50.1    4e-04   
ref|XP_004561978.1|  PREDICTED: methyl-CpG-binding domain protein...  50.1    4e-04   Maylandia zebra
ref|XP_010751456.1|  PREDICTED: methyl-CpG-binding domain protein...  50.1    5e-04   
ref|XP_010751458.1|  PREDICTED: methyl-CpG-binding domain protein...  49.7    5e-04   
gb|AAC68874.1|  testis specific methyl-CpG binding protein MBD2       49.7    5e-04   Mus musculus [mouse]
ref|XP_006525775.1|  PREDICTED: methyl-CpG-binding domain protein...  49.7    5e-04   
ref|XP_002713528.2|  PREDICTED: methyl-CpG-binding domain protein 2   50.4    5e-04   Oryctolagus cuniculus [domestic rabbit]
ref|XP_003788528.1|  PREDICTED: methyl-CpG-binding domain protein 2   50.1    5e-04   
ref|NP_200746.1|  methyl-CpG-binding domain-containing protein 6      49.7    5e-04   Arabidopsis thaliana [mouse-ear cress]
gb|KFK27470.1|  hypothetical protein AALP_AA8G387500                  49.7    5e-04   Arabis alpina [alpine rockcress]
ref|XP_006400967.1|  hypothetical protein EUTSA_v10014530mg           49.7    6e-04   Eutrema salsugineum [saltwater cress]
ref|XP_010455539.1|  PREDICTED: methyl-CpG-binding domain-contain...  49.7    6e-04   Camelina sativa [gold-of-pleasure]
gb|KFK27467.1|  hypothetical protein AALP_AA8G387100                  48.9    6e-04   Arabis alpina [alpine rockcress]
gb|KJB67647.1|  hypothetical protein B456_010G201900                  48.1    7e-04   Gossypium raimondii
gb|EDM14790.1|  rCG46680, isoform CRA_a                               49.3    7e-04   Rattus norvegicus [brown rat]
ref|XP_005103642.1|  PREDICTED: methyl-CpG-binding domain protein 2   49.3    7e-04   Aplysia californica
ref|XP_010264450.1|  PREDICTED: uncharacterized protein LOC104602...  49.3    8e-04   Nelumbo nucifera [Indian lotus]
ref|XP_010264451.1|  PREDICTED: uncharacterized protein LOC104602...  49.3    9e-04   Nelumbo nucifera [Indian lotus]
gb|KJB55876.1|  hypothetical protein B456_009G099200                  48.9    0.001   Gossypium raimondii
ref|XP_002864630.1|  hypothetical protein ARALYDRAFT_919168           48.9    0.001   Arabidopsis lyrata subsp. lyrata
ref|XP_002866351.1|  methyl-CpG-binding domain 7                      48.9    0.001   
ref|XP_011360638.1|  PREDICTED: methyl-CpG-binding domain protein 2   49.3    0.001   



>ref|XP_010325421.1| PREDICTED: uncharacterized protein LOC101264354 isoform X3 [Solanum 
lycopersicum]
Length=1846

 Score =   137 bits (344),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 87/212 (41%), Positives = 113/212 (53%), Gaps = 31/212 (15%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRA  210
            M    SP+  P GW+E VKV  GRK+KYYTN   GKKFYSKK+V  Y+K K       +A
Sbjct  1    MAVEDSPDWPPPGWTEDVKVSKGRKIKYYTNGETGKKFYSKKEVARYLKTKDTCDDVTQA  60

Query  211  IAQRETRHSERNTNSQS--------------------------SKTAANPDKSPEWLPPG  312
            +  +    SE N +                             S+T   P+ S EWLPPG
Sbjct  61   MNIQGKSFSENNVSDMDNQDGSFAKDNGSQMDNQDNCCSENNVSQTVGKPNNSHEWLPPG  120

Query  313  WTVEEKTRMSGVSHGQTYMCYIDP-FGRRFYSKPEVSRHLKTMNCNGPIGVGEEKKSNIE  489
            W VE KTR SG   G +Y  YIDP  G +FYSKPEVS++LKTM  N   G G+     IE
Sbjct  121  WIVELKTRKSGSHAGLSYKVYIDPSTGSKFYSKPEVSKYLKTMKQNNIAGEGQ--TPGIE  178

Query  490  EPSCNKV--SQNEKATGGQSHTSRKLRSGMGK  579
            E S +K+  SQ+ +  G QS T+++ +SG+ +
Sbjct  179  EGSFSKLKASQDFEEVGEQSCTTKRKKSGITR  210



>emb|CDP09782.1| unnamed protein product [Coffea canephora]
Length=819

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 89/141 (63%), Gaps = 1/141 (1%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRA  210
            MV GKSP+ LP GW EHVKV NGRK+KYYT+   G KFYSKK VI +++ K   +G   +
Sbjct  1    MVHGKSPDELPPGWKEHVKVSNGRKIKYYTDDVTGLKFYSKKRVINFVQTKDACQGTPHS  60

Query  211  IAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF-  387
            ++  + + S   T +  S+     + S EWLP GW +E + R SG + G  Y  Y+DP  
Sbjct  61   VSDHDLKSSCSKTEASPSQVVVEKNSSLEWLPQGWIIESRYRKSGATAGSVYKTYVDPLT  120

Query  388  GRRFYSKPEVSRHLKTMNCNG  450
            G +FYSKP+V ++L+++N N 
Sbjct  121  GSKFYSKPQVMQYLESVNFNA  141



>ref|XP_006358895.1| PREDICTED: uncharacterized protein LOC102587100 isoform X2 [Solanum 
tuberosum]
Length=1805

 Score =   134 bits (336),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 86/212 (41%), Positives = 112/212 (53%), Gaps = 31/212 (15%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRA  210
            M    SP+  P GW+E VKV NGRK+KYYTN   GKKFYSKK+V  Y+  K       +A
Sbjct  1    MAVVDSPDWPPPGWTEDVKVSNGRKIKYYTNGQTGKKFYSKKEVARYLNTKDTCDDVTQA  60

Query  211  IAQRETRHSERN--------------------------TNSQSSKTAANPDKSPEWLPPG  312
            +  +    SE N                          + +  S+    P+ S EWLPPG
Sbjct  61   MTIQGKNCSENNVSHMDNQDESFSKDNVSQMDNLDKSCSENNVSEAVGRPNNSHEWLPPG  120

Query  313  WTVEEKTRMSGVSHGQTYMCYIDP-FGRRFYSKPEVSRHLKTMNCNGPIGVGEEKKSNIE  489
            W VE KTR SG   G  Y  YIDP  G +FYSKPEVS++LKTM  N   G G+     IE
Sbjct  121  WIVELKTRKSGSHAGTPYKVYIDPSTGSKFYSKPEVSKYLKTMKQNNITGEGQ--IPGIE  178

Query  490  EPSCNKV--SQNEKATGGQSHTSRKLRSGMGK  579
            E S +K+  SQ+ +  G QS T+++ +SG+ +
Sbjct  179  EGSFSKLKASQDFEEVGEQSCTTKRKKSGITR  210



>ref|XP_004245626.1| PREDICTED: uncharacterized protein LOC101264354 isoform X1 [Solanum 
lycopersicum]
Length=1886

 Score =   132 bits (331),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 83/208 (40%), Positives = 106/208 (51%), Gaps = 29/208 (14%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRA  210
            M    SP+  P GW+E VKV  GRK+KYYTN   GKKFYSKK+V  Y+K K       +A
Sbjct  1    MAVEDSPDWPPPGWTEDVKVSKGRKIKYYTNGETGKKFYSKKEVARYLKTKDTCDDVTQA  60

Query  211  IAQRETRHSERNTNSQS--------------------------SKTAANPDKSPEWLPPG  312
            +  +    SE N +                             S+T   P+ S EWLPPG
Sbjct  61   MNIQGKSFSENNVSDMDNQDGSFAKDNGSQMDNQDNCCSENNVSQTVGKPNNSHEWLPPG  120

Query  313  WTVEEKTRMSGVSHGQTYMCYIDP-FGRRFYSKPEVSRHLKTMNCNGPIGVGEEKKSNIE  489
            W VE KTR SG   G +Y  YIDP  G +FYSKPEVS++LKTM  N   G G+       
Sbjct  121  WIVELKTRKSGSHAGLSYKVYIDPSTGSKFYSKPEVSKYLKTMKQNNIAGEGQTHGDGEI  180

Query  490  EPSCNKVSQNEKAT--GGQSHTSRKLRS  567
              +  K S++ K    GGQ+  S++L+S
Sbjct  181  STTNQKKSEDPKIIRGGGQTRKSKRLKS  208



>ref|XP_010325420.1| PREDICTED: uncharacterized protein LOC101264354 isoform X2 [Solanum 
lycopersicum]
Length=1852

 Score =   131 bits (330),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 83/208 (40%), Positives = 106/208 (51%), Gaps = 29/208 (14%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRA  210
            M    SP+  P GW+E VKV  GRK+KYYTN   GKKFYSKK+V  Y+K K       +A
Sbjct  1    MAVEDSPDWPPPGWTEDVKVSKGRKIKYYTNGETGKKFYSKKEVARYLKTKDTCDDVTQA  60

Query  211  IAQRETRHSERNTNSQS--------------------------SKTAANPDKSPEWLPPG  312
            +  +    SE N +                             S+T   P+ S EWLPPG
Sbjct  61   MNIQGKSFSENNVSDMDNQDGSFAKDNGSQMDNQDNCCSENNVSQTVGKPNNSHEWLPPG  120

Query  313  WTVEEKTRMSGVSHGQTYMCYIDP-FGRRFYSKPEVSRHLKTMNCNGPIGVGEEKKSNIE  489
            W VE KTR SG   G +Y  YIDP  G +FYSKPEVS++LKTM  N   G G+       
Sbjct  121  WIVELKTRKSGSHAGLSYKVYIDPSTGSKFYSKPEVSKYLKTMKQNNIAGEGQTHGDGEI  180

Query  490  EPSCNKVSQNEKAT--GGQSHTSRKLRS  567
              +  K S++ K    GGQ+  S++L+S
Sbjct  181  STTNQKKSEDPKIIRGGGQTRKSKRLKS  208



>ref|XP_006358894.1| PREDICTED: uncharacterized protein LOC102587100 isoform X1 [Solanum 
tuberosum]
Length=1845

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 83/208 (40%), Positives = 105/208 (50%), Gaps = 29/208 (14%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRA  210
            M    SP+  P GW+E VKV NGRK+KYYTN   GKKFYSKK+V  Y+  K       +A
Sbjct  1    MAVVDSPDWPPPGWTEDVKVSNGRKIKYYTNGQTGKKFYSKKEVARYLNTKDTCDDVTQA  60

Query  211  IAQRETRHSERN--------------------------TNSQSSKTAANPDKSPEWLPPG  312
            +  +    SE N                          + +  S+    P+ S EWLPPG
Sbjct  61   MTIQGKNCSENNVSHMDNQDESFSKDNVSQMDNLDKSCSENNVSEAVGRPNNSHEWLPPG  120

Query  313  WTVEEKTRMSGVSHGQTYMCYIDP-FGRRFYSKPEVSRHLKTMNCNGPIGVGEEKKSNIE  489
            W VE KTR SG   G  Y  YIDP  G +FYSKPEVS++LKTM  N   G G+       
Sbjct  121  WIVELKTRKSGSHAGTPYKVYIDPSTGSKFYSKPEVSKYLKTMKQNNITGEGQIHGDGEV  180

Query  490  EPSCNKVSQNEKAT--GGQSHTSRKLRS  567
              S  K S++ K    GGQ+  S++L+S
Sbjct  181  SSSNQKTSEDSKNIRGGGQTRKSKRLKS  208



>ref|XP_006358896.1| PREDICTED: uncharacterized protein LOC102587100 isoform X3 [Solanum 
tuberosum]
Length=1801

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 83/208 (40%), Positives = 105/208 (50%), Gaps = 29/208 (14%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRA  210
            M    SP+  P GW+E VKV NGRK+KYYTN   GKKFYSKK+V  Y+  K       +A
Sbjct  1    MAVVDSPDWPPPGWTEDVKVSNGRKIKYYTNGQTGKKFYSKKEVARYLNTKDTCDDVTQA  60

Query  211  IAQRETRHSERN--------------------------TNSQSSKTAANPDKSPEWLPPG  312
            +  +    SE N                          + +  S+    P+ S EWLPPG
Sbjct  61   MTIQGKNCSENNVSHMDNQDESFSKDNVSQMDNLDKSCSENNVSEAVGRPNNSHEWLPPG  120

Query  313  WTVEEKTRMSGVSHGQTYMCYIDP-FGRRFYSKPEVSRHLKTMNCNGPIGVGEEKKSNIE  489
            W VE KTR SG   G  Y  YIDP  G +FYSKPEVS++LKTM  N   G G+       
Sbjct  121  WIVELKTRKSGSHAGTPYKVYIDPSTGSKFYSKPEVSKYLKTMKQNNITGEGQIHGDGEV  180

Query  490  EPSCNKVSQNEKAT--GGQSHTSRKLRS  567
              S  K S++ K    GGQ+  S++L+S
Sbjct  181  SSSNQKTSEDSKNIRGGGQTRKSKRLKS  208



>ref|XP_008238911.1| PREDICTED: uncharacterized protein LOC103337528 [Prunus mume]
Length=623

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 87/138 (63%), Gaps = 6/138 (4%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  207
            MVA  SP+ LPAGW+   +V K GRK+++YTN   GK F+SK DV+C++K+   + G   
Sbjct  1    MVAKSSPDWLPAGWAVQFRVQKTGRKIEFYTNLETGKNFFSKDDVMCHIKMASTNGGN--  58

Query  208  AIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF  387
               Q  T H++ ++    S+   N  + PEWLP GW VE +TR +GV  G+ Y CYIDP 
Sbjct  59   --PQPTTLHNQHHSEEIPSQLVVNTTEYPEWLPKGWKVEVRTRKTGVHVGKEYKCYIDPS  116

Query  388  GR-RFYSKPEVSRHLKTM  438
                FYSKPEV R+LKT+
Sbjct  117  TESSFYSKPEVFRYLKTV  134



>ref|XP_007209689.1| hypothetical protein PRUPE_ppa012392mg [Prunus persica]
 gb|EMJ10888.1| hypothetical protein PRUPE_ppa012392mg [Prunus persica]
Length=171

 Score =   117 bits (294),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 86/138 (62%), Gaps = 6/138 (4%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  207
            MVA  SP+ LPAGW+   +V K GRK+++YTN   GK F+SK DV+ ++K+   + G   
Sbjct  1    MVAKSSPDWLPAGWAVQFRVQKTGRKIEFYTNLETGKNFFSKDDVMRHIKMASTNGGN--  58

Query  208  AIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF  387
               Q  T H++ ++    S+   N  + PEWLP GW VE +TR +GV  G+ Y CYIDP 
Sbjct  59   --PQPTTLHNQHHSEKIPSQLVVNTTEYPEWLPKGWKVEVRTRKTGVHVGKEYKCYIDPS  116

Query  388  GR-RFYSKPEVSRHLKTM  438
                FYSKPEV R+LKT+
Sbjct  117  TECSFYSKPEVFRYLKTV  134



>ref|XP_009589209.1| PREDICTED: uncharacterized protein LOC104086600 isoform X2 [Nicotiana 
tomentosiformis]
Length=1739

 Score =   125 bits (314),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 82/215 (38%), Positives = 105/215 (49%), Gaps = 27/215 (13%)
 Frame = +1

Query  31   MVAGKSPEPLPA-GWSEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  207
            M  G SP   P  GW+E VK+ +GRK KYYTN   GKKFYSKK+V  YM  K       +
Sbjct  1    MTVGDSPADWPPPGWTEDVKITSGRKTKYYTNVETGKKFYSKKEVTRYMNTKDTCHDVTQ  60

Query  208  AIAQ--------------RETRHSERNTNSQS-----------SKTAANPDKSPEWLPPG  312
             + Q              ++   SE N +  +           S+      KSPEWLP G
Sbjct  61   VLNQDKSSSQNNVSQMNHQDKSFSENNVSQMNYQDRSCSENNVSQIVEETKKSPEWLPAG  120

Query  313  WTVEEKTRMSGVSHGQTYMCYIDP-FGRRFYSKPEVSRHLKTMNCNGPIGVGEEKKSNIE  489
            W VE + R SG   G  Y  YIDP  G +FYS+PEVS++LKTM  N   G  +   +   
Sbjct  121  WIVELRNRKSGSHAGLAYKVYIDPSTGNKFYSRPEVSKYLKTMKQNNIAGEEQIHGTGEV  180

Query  490  EPSCNKVSQNEKATGGQSHTSRKLRSGMGKQPSDI  594
              S  K S+N K  GGQS  S++ +S   +   DI
Sbjct  181  SSSNQKASENSKDIGGQSRISKRQKSDGDRPSHDI  215



>ref|XP_009589208.1| PREDICTED: uncharacterized protein LOC104086600 isoform X1 [Nicotiana 
tomentosiformis]
Length=2010

 Score =   125 bits (314),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 82/215 (38%), Positives = 105/215 (49%), Gaps = 27/215 (13%)
 Frame = +1

Query  31   MVAGKSPEPLPA-GWSEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  207
            M  G SP   P  GW+E VK+ +GRK KYYTN   GKKFYSKK+V  YM  K       +
Sbjct  1    MTVGDSPADWPPPGWTEDVKITSGRKTKYYTNVETGKKFYSKKEVTRYMNTKDTCHDVTQ  60

Query  208  AIAQ--------------RETRHSERNTNSQS-----------SKTAANPDKSPEWLPPG  312
             + Q              ++   SE N +  +           S+      KSPEWLP G
Sbjct  61   VLNQDKSSSQNNVSQMNHQDKSFSENNVSQMNYQDRSCSENNVSQIVEETKKSPEWLPAG  120

Query  313  WTVEEKTRMSGVSHGQTYMCYIDP-FGRRFYSKPEVSRHLKTMNCNGPIGVGEEKKSNIE  489
            W VE + R SG   G  Y  YIDP  G +FYS+PEVS++LKTM  N   G  +   +   
Sbjct  121  WIVELRNRKSGSHAGLAYKVYIDPSTGNKFYSRPEVSKYLKTMKQNNIAGEEQIHGTGEV  180

Query  490  EPSCNKVSQNEKATGGQSHTSRKLRSGMGKQPSDI  594
              S  K S+N K  GGQS  S++ +S   +   DI
Sbjct  181  SSSNQKASENSKDIGGQSRISKRQKSDGDRPSHDI  215



>ref|XP_009782390.1| PREDICTED: uncharacterized protein LOC104231139 isoform X1 [Nicotiana 
sylvestris]
Length=1884

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 85/221 (38%), Positives = 107/221 (48%), Gaps = 39/221 (18%)
 Frame = +1

Query  31   MVAGKSPEPLPA-GWSEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  207
            M  G SP   P  GW+E VK+ +GRK KYYT+   GKKFYSKK+V  YM  K       +
Sbjct  1    MTVGDSPADWPPPGWTEDVKITSGRKTKYYTHVETGKKFYSKKEVTRYMNTKDTCHDVAQ  60

Query  208  AIAQ--------------RETRHSERNTNSQS-----------SKTAANPDKSPEWLPPG  312
             + Q              ++   SE N +  +           S+      KSPEWLP G
Sbjct  61   VLNQDKSSTENNVSQMNHQDKSFSENNVSQMNYQDRSCSENNVSQIVEETKKSPEWLPAG  120

Query  313  WTVEEKTRMSGVSHGQTYMCYIDP-FGRRFYSKPEVSRHLKTMNCNGPI------GVGEE  471
            W VE KTR SG + G  Y  YIDP  G +FYS+PEVS++LKTM  N         G GE 
Sbjct  121  WIVELKTRKSGSNAGLAYKVYIDPSTGNKFYSRPEVSKYLKTMKQNDITGEEQIHGTGEV  180

Query  472  KKSNIEEPSCNKVSQNEKATGGQSHTSRKLRSGMGKQPSDI  594
              SN       K S+N K  GG S  S++ +S   +   DI
Sbjct  181  SSSN------QKASENSKDIGGLSRISKRQKSDGNRPSHDI  215



>ref|XP_009782391.1| PREDICTED: uncharacterized protein LOC104231139 isoform X2 [Nicotiana 
sylvestris]
Length=1881

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 85/221 (38%), Positives = 107/221 (48%), Gaps = 39/221 (18%)
 Frame = +1

Query  31   MVAGKSPEPLPA-GWSEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  207
            M  G SP   P  GW+E VK+ +GRK KYYT+   GKKFYSKK+V  YM  K       +
Sbjct  1    MTVGDSPADWPPPGWTEDVKITSGRKTKYYTHVETGKKFYSKKEVTRYMNTKDTCHDVAQ  60

Query  208  AIAQ--------------RETRHSERNTNSQS-----------SKTAANPDKSPEWLPPG  312
             + Q              ++   SE N +  +           S+      KSPEWLP G
Sbjct  61   VLNQDKSSTENNVSQMNHQDKSFSENNVSQMNYQDRSCSENNVSQIVEETKKSPEWLPAG  120

Query  313  WTVEEKTRMSGVSHGQTYMCYIDP-FGRRFYSKPEVSRHLKTMNCNGPI------GVGEE  471
            W VE KTR SG + G  Y  YIDP  G +FYS+PEVS++LKTM  N         G GE 
Sbjct  121  WIVELKTRKSGSNAGLAYKVYIDPSTGNKFYSRPEVSKYLKTMKQNDITGEEQIHGTGEV  180

Query  472  KKSNIEEPSCNKVSQNEKATGGQSHTSRKLRSGMGKQPSDI  594
              SN       K S+N K  GG S  S++ +S   +   DI
Sbjct  181  SSSN------QKASENSKDIGGLSRISKRQKSDGNRPSHDI  215



>ref|XP_009782392.1| PREDICTED: uncharacterized protein LOC104231139 isoform X3 [Nicotiana 
sylvestris]
Length=1613

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 82/215 (38%), Positives = 106/215 (49%), Gaps = 27/215 (13%)
 Frame = +1

Query  31   MVAGKSPEPLPA-GWSEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  207
            M  G SP   P  GW+E VK+ +GRK KYYT+   GKKFYSKK+V  YM  K       +
Sbjct  1    MTVGDSPADWPPPGWTEDVKITSGRKTKYYTHVETGKKFYSKKEVTRYMNTKDTCHDVAQ  60

Query  208  AIAQ--------------RETRHSERNTNSQS-----------SKTAANPDKSPEWLPPG  312
             + Q              ++   SE N +  +           S+      KSPEWLP G
Sbjct  61   VLNQDKSSTENNVSQMNHQDKSFSENNVSQMNYQDRSCSENNVSQIVEETKKSPEWLPAG  120

Query  313  WTVEEKTRMSGVSHGQTYMCYIDP-FGRRFYSKPEVSRHLKTMNCNGPIGVGEEKKSNIE  489
            W VE KTR SG + G  Y  YIDP  G +FYS+PEVS++LKTM  N   G  +   +   
Sbjct  121  WIVELKTRKSGSNAGLAYKVYIDPSTGNKFYSRPEVSKYLKTMKQNDITGEEQIHGTGEV  180

Query  490  EPSCNKVSQNEKATGGQSHTSRKLRSGMGKQPSDI  594
              S  K S+N K  GG S  S++ +S   +   DI
Sbjct  181  SSSNQKASENSKDIGGLSRISKRQKSDGNRPSHDI  215



>ref|XP_004143925.1| PREDICTED: uncharacterized protein LOC101223188 [Cucumis sativus]
 ref|XP_004159962.1| PREDICTED: uncharacterized protein LOC101226976 [Cucumis sativus]
 gb|KGN50128.1| hypothetical protein Csa_5G154900 [Cucumis sativus]
Length=853

 Score =   121 bits (304),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 85/138 (62%), Gaps = 8/138 (6%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  207
            MVA  SP+ LP+GW+   KV K GRK+++YTN  NGK FY K DVI Y+K   + +    
Sbjct  1    MVAKGSPDWLPSGWTVQYKVQKTGRKIRFYTNLENGKSFYYKDDVIGYIKSTQSQK----  56

Query  208  AIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF  387
              +Q  +R  +  + +   +     ++ PEWLP GW VE +TRMSG + G  Y CYIDP 
Sbjct  57   --SQPTSRGVKTQSGNSPLQLTVKSNEHPEWLPAGWKVESRTRMSGSNVGAVYKCYIDPV  114

Query  388  -GRRFYSKPEVSRHLKTM  438
               RFYSKPEV RHL+T+
Sbjct  115  TDSRFYSKPEVFRHLRTV  132



>ref|XP_008437228.1| PREDICTED: uncharacterized protein LOC103482721 isoform X2 [Cucumis 
melo]
Length=634

 Score =   120 bits (301),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 86/138 (62%), Gaps = 9/138 (7%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  207
            MVA  SP+ LP+GW+   KV K GRK+++YTN   GK FY K DV+ Y+K   +++ Q  
Sbjct  1    MVAKGSPDWLPSGWTVQYKVQKTGRKIRFYTNLETGKSFYYKDDVLGYIK---STQSQKS  57

Query  208  AIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF  387
                R  +    N+  Q+ K+    ++ PEWLP GW VE +TRMSG + G  Y CYIDP 
Sbjct  58   QPTSRGIKTQSGNSPVQTVKS----NEHPEWLPAGWKVESRTRMSGSNVGAVYKCYIDPV  113

Query  388  -GRRFYSKPEVSRHLKTM  438
               RFYSKPEV RHL+T+
Sbjct  114  TDSRFYSKPEVFRHLRTV  131



>ref|XP_008437229.1| PREDICTED: transcriptional regulator ATRX homolog isoform X3 
[Cucumis melo]
Length=628

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 87/140 (62%), Gaps = 12/140 (9%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQ--  201
            MVA  SP+ LP+GW+   KV K GRK+++YTN   GK FY K DV+ Y+K   + + Q  
Sbjct  1    MVAKGSPDWLPSGWTVQYKVQKTGRKIRFYTNLETGKSFYYKDDVLGYIKSTQSQKSQPT  60

Query  202  NRAIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYID  381
            +R I  +       + NS   +T  + ++ PEWLP GW VE +TRMSG + G  Y CYID
Sbjct  61   SRGIKTQ-------SGNSPVQQTVKS-NEHPEWLPAGWKVESRTRMSGSNVGAVYKCYID  112

Query  382  PF-GRRFYSKPEVSRHLKTM  438
            P    RFYSKPEV RHL+T+
Sbjct  113  PVTDSRFYSKPEVFRHLRTV  132



>ref|XP_008437227.1| PREDICTED: uncharacterized protein LOC103482721 isoform X1 [Cucumis 
melo]
Length=635

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 87/140 (62%), Gaps = 12/140 (9%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQ--  201
            MVA  SP+ LP+GW+   KV K GRK+++YTN   GK FY K DV+ Y+K   + + Q  
Sbjct  1    MVAKGSPDWLPSGWTVQYKVQKTGRKIRFYTNLETGKSFYYKDDVLGYIKSTQSQKSQPT  60

Query  202  NRAIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYID  381
            +R I  +       + NS   +T  + ++ PEWLP GW VE +TRMSG + G  Y CYID
Sbjct  61   SRGIKTQ-------SGNSPVQQTVKS-NEHPEWLPAGWKVESRTRMSGSNVGAVYKCYID  112

Query  382  PF-GRRFYSKPEVSRHLKTM  438
            P    RFYSKPEV RHL+T+
Sbjct  113  PVTDSRFYSKPEVFRHLRTV  132



>ref|XP_008351681.1| PREDICTED: uncharacterized protein LOC103415104 [Malus domestica]
Length=746

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 87/139 (63%), Gaps = 8/139 (6%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQN-  204
            MVA  SP+ LP GWS   +  K GRK+++YT+   GKKF+SK D + Y+K++ N+RG+  
Sbjct  1    MVARSSPDWLPPGWSVQSRSQKRGRKIEFYTHLETGKKFFSKDDAMRYIKMQ-NTRGEKP  59

Query  205  RAIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDP  384
            +        HSE       S+   +P + PEWLP GW VE +TR SGV  G+ Y CYIDP
Sbjct  60   QPTLVNIPDHSEE----VPSQLEVDPTECPEWLPNGWKVELRTRQSGVQVGKEYKCYIDP  115

Query  385  FGR-RFYSKPEVSRHLKTM  438
             G   FYSKPEV R+LKT+
Sbjct  116  SGECTFYSKPEVFRYLKTV  134



>ref|XP_008392616.1| PREDICTED: uncharacterized protein LOC103454798 [Malus domestica]
Length=1228

 Score =   116 bits (291),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 87/139 (63%), Gaps = 8/139 (6%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQN-  204
            MVA  SP+ LP GWS   +  K GRK+++YT+   GKKF+SK D + Y+K++ N+RG+  
Sbjct  1    MVARSSPDWLPPGWSVQSRSQKRGRKIEFYTHLETGKKFFSKDDAMRYIKMQ-NTRGEKP  59

Query  205  RAIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDP  384
            +        HSE       S+   +P + PEWLP GW VE +TR SGV  G+ Y CYIDP
Sbjct  60   QPTLVNIPDHSEE----VPSQLEVDPTECPEWLPNGWKVELRTRQSGVQVGKEYKCYIDP  115

Query  385  FGR-RFYSKPEVSRHLKTM  438
             G   FYSKPEV R+LKT+
Sbjct  116  SGECTFYSKPEVFRYLKTV  134



>ref|XP_009375787.1| PREDICTED: uncharacterized protein LOC103964564 isoform X1 [Pyrus 
x bretschneideri]
Length=1224

 Score =   116 bits (290),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 84/138 (61%), Gaps = 6/138 (4%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  207
            MVA  SP+ LP GWS   +  K GRK+ +YT+   GKKF+SK D + Y+K++     + +
Sbjct  1    MVARSSPDWLPPGWSVQSRSQKRGRKIVFYTHLETGKKFFSKDDAMRYIKMQNTHGERPQ  60

Query  208  AIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF  387
                + + HSE       S+   +P + PEWLP GW VE +TR SGV  G+ Y CYIDPF
Sbjct  61   PTLVKISDHSEE----VPSQLEVDPMECPEWLPNGWKVELRTRQSGVQVGKEYKCYIDPF  116

Query  388  GR-RFYSKPEVSRHLKTM  438
                FYSKPEV R+LKT+
Sbjct  117  RECTFYSKPEVFRYLKTV  134



>ref|XP_009375788.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Pyrus x bretschneideri]
Length=1172

 Score =   115 bits (289),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 84/138 (61%), Gaps = 6/138 (4%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  207
            MVA  SP+ LP GWS   +  K GRK+ +YT+   GKKF+SK D + Y+K++     + +
Sbjct  1    MVARSSPDWLPPGWSVQSRSQKRGRKIVFYTHLETGKKFFSKDDAMRYIKMQNTHGERPQ  60

Query  208  AIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF  387
                + + HSE       S+   +P + PEWLP GW VE +TR SGV  G+ Y CYIDPF
Sbjct  61   PTLVKISDHSEE----VPSQLEVDPMECPEWLPNGWKVELRTRQSGVQVGKEYKCYIDPF  116

Query  388  GR-RFYSKPEVSRHLKTM  438
                FYSKPEV R+LKT+
Sbjct  117  RECTFYSKPEVFRYLKTV  134



>ref|XP_011072316.1| PREDICTED: uncharacterized protein LOC105157598 isoform X2 [Sesamum 
indicum]
Length=644

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 94/162 (58%), Gaps = 11/162 (7%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRA  210
            MVAGKSP+ LP G++E VK KNGRK+KYY N   G K++SKK+V+        +  +N  
Sbjct  1    MVAGKSPDWLPPGFTEKVKYKNGRKIKYYYNVATGAKYHSKKEVLSC------ATAENGL  54

Query  211  IAQRET---RHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYID  381
            +   ET    +S  ++N +        + SP WLP GWT+EEKTR SG   G  Y  Y D
Sbjct  55   LGTPETTKVNNSGLSSNKEVDTILDKTNDSPGWLPSGWTMEEKTRQSGSRKGSVYKVYTD  114

Query  382  -PFGRRFYSKPEVSRHLKTMNCNGPIGVGEEKKSNIEEPSCN  504
               G RFYS+  V+R+L T++ +  + V + K  N++EP  N
Sbjct  115  LSSGSRFYSRAAVTRYLNTVDHSNTVTV-QNKLDNVDEPVQN  155



>ref|XP_011072312.1| PREDICTED: uncharacterized protein LOC105157598 isoform X1 [Sesamum 
indicum]
Length=645

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 96/163 (59%), Gaps = 12/163 (7%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRA  210
            MVAGKSP+ LP G++E VK KNGRK+KYY N   G K++SKK+V+        +  +N  
Sbjct  1    MVAGKSPDWLPPGFTEKVKYKNGRKIKYYYNVATGAKYHSKKEVLSC------ATAENGL  54

Query  211  IAQRET---RHSERNTNSQ-SSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYI  378
            +   ET    +S  ++N +  ++     + SP WLP GWT+EEKTR SG   G  Y  Y 
Sbjct  55   LGTPETTKVNNSGLSSNKEVDTQILDKTNDSPGWLPSGWTMEEKTRQSGSRKGSVYKVYT  114

Query  379  D-PFGRRFYSKPEVSRHLKTMNCNGPIGVGEEKKSNIEEPSCN  504
            D   G RFYS+  V+R+L T++ +  + V + K  N++EP  N
Sbjct  115  DLSSGSRFYSRAAVTRYLNTVDHSNTVTV-QNKLDNVDEPVQN  156



>ref|XP_011463824.1| PREDICTED: uncharacterized protein LOC101312827 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=1030

 Score =   110 bits (275),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 80/142 (56%), Gaps = 16/142 (11%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKVKN-GRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  207
            MVA  SP+ LPAGWS   + +N GR+   Y     GKKF+SK DVI Y K   N   + +
Sbjct  1    MVAASSPDWLPAGWSVQFRAQNRGRRSVIYIELETGKKFFSKDDVIRYTKKTTNCGEEPK  60

Query  208  AIAQRETRHSERNTNSQSSKT----AANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCY  375
                        NT + SSK+     AN  + PEWLP GW VE +TR SGV  G+ Y CY
Sbjct  61   PT----------NTKNPSSKSHLQVVANTVEYPEWLPDGWKVELRTRKSGVQVGKEYKCY  110

Query  376  IDPFGR-RFYSKPEVSRHLKTM  438
            IDP     FYSKPEV RHL+T+
Sbjct  111  IDPSRECTFYSKPEVFRHLRTV  132



>ref|XP_011463825.1| PREDICTED: uncharacterized protein LOC101312827 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=1009

 Score =   110 bits (274),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 80/142 (56%), Gaps = 16/142 (11%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKVKN-GRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  207
            MVA  SP+ LPAGWS   + +N GR+   Y     GKKF+SK DVI Y K   N   + +
Sbjct  1    MVAASSPDWLPAGWSVQFRAQNRGRRSVIYIELETGKKFFSKDDVIRYTKKTTNCGEEPK  60

Query  208  AIAQRETRHSERNTNSQSSKT----AANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCY  375
                        NT + SSK+     AN  + PEWLP GW VE +TR SGV  G+ Y CY
Sbjct  61   PT----------NTKNPSSKSHLQVVANTVEYPEWLPDGWKVELRTRKSGVQVGKEYKCY  110

Query  376  IDPFGR-RFYSKPEVSRHLKTM  438
            IDP     FYSKPEV RHL+T+
Sbjct  111  IDPSRECTFYSKPEVFRHLRTV  132



>gb|KDP25474.1| hypothetical protein JCGZ_20630 [Jatropha curcas]
Length=1044

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 78/138 (57%), Gaps = 8/138 (6%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  207
            M A  SPE LP GW+    V K GRK+KYY N+  G+K++S  D I Y       RGQ  
Sbjct  1    MTAEYSPEELPHGWTVQFNVLKTGRKIKYYLNSGTGQKYFSTDDFIRYF------RGQGT  54

Query  208  AIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDP-  384
             + Q     S     S+  +     ++ PEWLP GW VE KTR SG + G+ Y CY+DP 
Sbjct  55   QLDQHHPSKSLIGLPSKKKQLIEYANERPEWLPNGWVVELKTRKSGDASGKVYKCYVDPS  114

Query  385  FGRRFYSKPEVSRHLKTM  438
             G +FYSKP V R+L+T+
Sbjct  115  TGCKFYSKPAVVRYLETI  132



>ref|XP_010661051.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X1 [Vitis vinifera]
Length=544

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 88/157 (56%), Gaps = 8/157 (5%)
 Frame = +1

Query  46   SPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRAIAQR  222
            SP+ +P GW+  VK+ KNGR VKYY N+  G+KF+SK D+I Y+K        ++ I   
Sbjct  5    SPDWIPEGWTVQVKLAKNGRNVKYYFNSKTGQKFFSKNDIIRYVKRGSIHCDTSQPINML  64

Query  223  ETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDP-FGRRF  399
              R S+        KT     K P+WLP GW +E KT+ SG   G+ Y CY+DP  G RF
Sbjct  65   NKRRSQNKIMPLGIKTK----KFPDWLPNGWILELKTQRSGSCVGKQYKCYLDPSTGYRF  120

Query  400  YSKPEVSRHLKTMNCNGPIGVGEEKKSNIEEPSCNKV  510
            YSKP+V R+LKT+  N       +KK     PS  KV
Sbjct  121  YSKPDVFRYLKTIKHNS--CTSRQKKVGPGMPSLGKV  155



>gb|KDO55594.1| hypothetical protein CISIN_1g0013392mg, partial [Citrus sinensis]
Length=273

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 94/156 (60%), Gaps = 21/156 (13%)
 Frame = +1

Query  34   VAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIK---------  183
            +A KS E LP  W+   KV KNGRK KYY N   G+KF+SK+D++ Y+K+K         
Sbjct  1    MAVKSEERLPTDWTAKFKVEKNGRKTKYYMNVRTGQKFFSKEDLLRYVKMKRTQLDEPSP  60

Query  184  GNSRGQ-------NRAIAQ---RETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKT  333
             +S G+       ++ +A+   +E   S+R++ ++S K   + +  P+WLP GW V+ KT
Sbjct  61   TSSHGKRHLENSSSKLVAKENKQENSRSKRHSENRSMKPVVDENNRPDWLPDGWVVDLKT  120

Query  334  RMSGVSHGQTYMCYIDPF-GRRFYSKPEVSRHLKTM  438
            R SG + G+ Y  YI+P  G +F+S PEV RHL+++
Sbjct  121  RKSGSAVGRQYKVYIEPITGCKFFSMPEVLRHLESV  156



>ref|XP_009369054.1| PREDICTED: uncharacterized protein LOC103958513 [Pyrus x bretschneideri]
Length=1208

 Score =   107 bits (268),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 85/139 (61%), Gaps = 8/139 (6%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVK-VKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQN-  204
            MVA  SP+ LP GWS   +  K GRK+++Y +   GKKF+SK D + ++K++ N+RG+  
Sbjct  1    MVAKSSPDWLPPGWSVQSRDQKRGRKIEFYIHLETGKKFFSKDDAVRFIKME-NTRGKKP  59

Query  205  RAIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDP  384
            +  + +   HSE       S+   +P + PEWLP GW VE + R SG   G+ Y CYIDP
Sbjct  60   QPTSVQIPNHSEE----VPSQLEVDPTEYPEWLPNGWKVELRIRQSGAQVGREYKCYIDP  115

Query  385  FGR-RFYSKPEVSRHLKTM  438
                 FYSKPEV R+LKT+
Sbjct  116  SRECTFYSKPEVFRYLKTV  134



>ref|XP_007040167.1| Uncharacterized protein TCM_016211 [Theobroma cacao]
 gb|EOY24668.1| Uncharacterized protein TCM_016211 [Theobroma cacao]
Length=1028

 Score =   104 bits (260),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 80/135 (59%), Gaps = 6/135 (4%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  207
            M A  SP+ LPAGW+   KV K GR++ +Y N   G+KF++K D+I Y K  G+++  + 
Sbjct  1    MTAKTSPDWLPAGWTLQFKVQKTGRRITHYVNLATGQKFFTKDDLIRYTKT-GSTKCDDL  59

Query  208  AIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDP-  384
                R+T+    N    S  TA N ++ PEWLP  W +E KTR SGV  G+ Y  YIDP 
Sbjct  60   QPTLRQTKMPPANG---SMDTAVNANERPEWLPKNWFMELKTRKSGVRIGKHYKIYIDPS  116

Query  385  FGRRFYSKPEVSRHL  429
             G RFYSK +V R L
Sbjct  117  TGSRFYSKLQVFRFL  131


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 64/137 (47%), Gaps = 15/137 (11%)
 Frame = +1

Query  37   AGKSPEPLPAGWSEHVK-----VKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQ  201
            A + PE LP  W   +K     V+ G+  K Y +   G +FYSK  V  ++         
Sbjct  81   ANERPEWLPKNWFMELKTRKSGVRIGKHYKIYIDPSTGSRFYSKLQVFRFL---------  131

Query  202  NRAIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYID  381
            N    +      ++  +  +S+      + PEWLP  W  E KT  SG   G++Y  Y+D
Sbjct  132  NHVEQKSSKPKQKKKVSHSTSEIVVKAHEHPEWLPKNWFTELKTYKSGAKFGKSYKIYVD  191

Query  382  P-FGRRFYSKPEVSRHL  429
            P  G RF+S+PEV R L
Sbjct  192  PSTGLRFHSRPEVFRFL  208



>gb|KDO55591.1| hypothetical protein CISIN_1g0013392mg, partial [Citrus sinensis]
 gb|KDO55592.1| hypothetical protein CISIN_1g0013392mg, partial [Citrus sinensis]
 gb|KDO55593.1| hypothetical protein CISIN_1g0013392mg, partial [Citrus sinensis]
Length=296

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/179 (36%), Positives = 92/179 (51%), Gaps = 44/179 (25%)
 Frame = +1

Query  34   VAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIK---------  183
            +A KS E LP  W+   KV KNGRK KYY N   G+KF+SK+D++ Y+K+K         
Sbjct  1    MAVKSEERLPTDWTAKFKVEKNGRKTKYYMNVRTGQKFFSKEDLLRYVKMKRTQLDEPSP  60

Query  184  GNSRG--------------QNRAIAQRETRHSE-------------------RNTNSQSS  264
             +S G              +N+    R  RHSE                   R++ + S+
Sbjct  61   TSSHGKRHLENSSSKLVAKENKQENSRSKRHSENRSMKPVAEENSHDNGHGKRHSENSST  120

Query  265  KTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF-GRRFYSKPEVSRHLKTM  438
            K   + +  P+WLP GW V+ KTR SG + G+ Y  YI+P  G +F+S PEV RHL+++
Sbjct  121  KPVVDENNRPDWLPDGWVVDLKTRKSGSAVGRQYKVYIEPITGCKFFSMPEVLRHLESV  179



>ref|XP_006440582.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
 gb|ESR53822.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
Length=1094

 Score =   102 bits (254),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 65/179 (36%), Positives = 92/179 (51%), Gaps = 44/179 (25%)
 Frame = +1

Query  34   VAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIK---------  183
            +A KS E LP  W+   KV KNGRK KYY N   G+KF+SK+D++ Y+K+K         
Sbjct  1    MAVKSEERLPTDWTAKFKVEKNGRKTKYYMNVRTGQKFFSKEDLLRYVKMKRTQLDEPSP  60

Query  184  GNSRG--------------QNRAIAQRETRHSE-------------------RNTNSQSS  264
             +S G              +N+    R  RHSE                   R++ + S+
Sbjct  61   TSSHGKRHLENSSSKLVAKENKQENSRSKRHSENRSMKPVAEENSHDNGHGKRHSENSST  120

Query  265  KTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF-GRRFYSKPEVSRHLKTM  438
            K   + +  P+WLP GW VE KTR SG + G+ Y  YI+P  G +F+S PEV RHL+++
Sbjct  121  KPVVDENNRPDWLPDGWVVELKTRKSGSAVGRQYKVYIEPITGCKFFSMPEVLRHLESV  179



>ref|XP_006440583.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
 gb|ESR53823.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
Length=1065

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 65/179 (36%), Positives = 92/179 (51%), Gaps = 44/179 (25%)
 Frame = +1

Query  34   VAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIK---------  183
            +A KS E LP  W+   KV KNGRK KYY N   G+KF+SK+D++ Y+K+K         
Sbjct  1    MAVKSEERLPTDWTAKFKVEKNGRKTKYYMNVRTGQKFFSKEDLLRYVKMKRTQLDEPSP  60

Query  184  GNSRG--------------QNRAIAQRETRHSE-------------------RNTNSQSS  264
             +S G              +N+    R  RHSE                   R++ + S+
Sbjct  61   TSSHGKRHLENSSSKLVAKENKQENSRSKRHSENRSMKPVAEENSHDNGHGKRHSENSST  120

Query  265  KTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF-GRRFYSKPEVSRHLKTM  438
            K   + +  P+WLP GW VE KTR SG + G+ Y  YI+P  G +F+S PEV RHL+++
Sbjct  121  KPVVDENNRPDWLPDGWVVELKTRKSGSAVGRQYKVYIEPITGCKFFSMPEVLRHLESV  179



>ref|XP_006477436.1| PREDICTED: uncharacterized protein LOC102622266 [Citrus sinensis]
Length=1096

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/179 (36%), Positives = 92/179 (51%), Gaps = 44/179 (25%)
 Frame = +1

Query  34   VAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIK---------  183
            +A KS E LP  W+   KV KNGRK KYY N   G+KF+SK+D++ Y+K+K         
Sbjct  1    MAVKSEERLPTDWTAKFKVEKNGRKTKYYMNVRTGQKFFSKEDLLRYVKMKRTQLDEPSP  60

Query  184  GNSRG--------------QNRAIAQRETRHSE-------------------RNTNSQSS  264
             +S G              +N+    R  RHSE                   R++ + S+
Sbjct  61   TSSHGKRHLENSSSKLVAKENKQENSRSKRHSENRSMKPVAEENSHDNGHGKRHSENSST  120

Query  265  KTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF-GRRFYSKPEVSRHLKTM  438
            K   + +  P+WLP GW V+ KTR SG + G+ Y  YI+P  G +F+S PEV RHL+++
Sbjct  121  KPVVDENNRPDWLPDGWVVDLKTRKSGSAVGRQYKVYIEPITGCKFFSMPEVLRHLESV  179



>ref|XP_010089148.1| Methyl-CpG-binding domain-containing protein 5 [Morus notabilis]
 gb|EXB37395.1| Methyl-CpG-binding domain-containing protein 5 [Morus notabilis]
Length=171

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 76/142 (54%), Gaps = 14/142 (10%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  207
            MVA  S + LP+GW+   KV K+GRKV  YTN   GK   SK +V   +    +   Q +
Sbjct  1    MVANDSSDWLPSGWTVQFKVLKSGRKVGIYTNTETGKIVLSKHEVFQLISAGSSCSTQPQ  60

Query  208  AIAQRETRHSERNTNSQSSKTAANP----DKSPEWLPPGWTVEEKTRMSGVSHGQTYMCY  375
                     S  + + Q+ +T   P    D  PEWLP GW VE +TR SG   G+ Y  Y
Sbjct  61   T--------SNTHVSLQAERTPLQPVNEKDLLPEWLPKGWKVEVRTRKSGTLAGKEYKSY  112

Query  376  IDPF-GRRFYSKPEVSRHLKTM  438
            IDP  G +FYSK EV R+LKT+
Sbjct  113  IDPLNGSKFYSKLEVLRYLKTV  134



>ref|XP_010676507.1| PREDICTED: uncharacterized protein LOC104892309 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=1021

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 66/189 (35%), Positives = 93/189 (49%), Gaps = 23/189 (12%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRA  210
            MV+ K  +  PAGW+   K+KNGRK KYY N    +KFYSK  V+ ++K    S  + + 
Sbjct  1    MVSRKKSDWPPAGWTVEFKIKNGRKTKYYINTKTHQKFYSKPAVLRFIKDGCVSNKKFQP  60

Query  211  IAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDP-F  387
            + +   + S      Q    A N     EWLP GW +E + R SG   G  Y C+IDP  
Sbjct  61   VIEHAKKKSSEKI--QHLVEANN----SEWLPSGWVMETRFRKSGARVGTEYKCFIDPST  114

Query  388  GRRFYSKPEVSRHLKTMNCNGPIGVGEEKKSNIEEPSCNKVSQNEKATGGQSHTSRKLRS  567
            G + +SKPEV R+L         G  + K+ N E       S  +K  GG  H+S K+  
Sbjct  115  GTKLFSKPEVLRYL---------GSEKTKQHNAE-------SSRQKDRGGSEHSSSKVVD  158

Query  568  GMGKQPSDI  594
             +  Q S++
Sbjct  159  RLSAQKSNL  167



>ref|XP_010676508.1| PREDICTED: uncharacterized protein LOC104892309 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=942

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 87/177 (49%), Gaps = 23/177 (13%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRA  210
            MV+ K  +  PAGW+   K+KNGRK KYY N    +KFYSK  V+ ++K    S  + + 
Sbjct  1    MVSRKKSDWPPAGWTVEFKIKNGRKTKYYINTKTHQKFYSKPAVLRFIKDGCVSNKKFQP  60

Query  211  IAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDP-F  387
            + +   + S      Q    A N     EWLP GW +E + R SG   G  Y C+IDP  
Sbjct  61   VIEHAKKKSSEKI--QHLVEANN----SEWLPSGWVMETRFRKSGARVGTEYKCFIDPST  114

Query  388  GRRFYSKPEVSRHLKTMNCNGPIGVGEEKKSNIEEPSCNKVSQNEKATGGQSHTSRK  558
            G + +SKPEV R+L         G  + K+ N E       S  +K  GG  H+S K
Sbjct  115  GTKLFSKPEVLRYL---------GSEKTKQHNAE-------SSRQKDRGGSEHSSSK  155



>gb|KJB39637.1| hypothetical protein B456_007G022700 [Gossypium raimondii]
Length=914

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 80/139 (58%), Gaps = 8/139 (6%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQ--  201
            M    SP+ LPAGW++  +  K GR++ +Y N   G+KF++K D+I Y K +  +  +  
Sbjct  1    MTEETSPDWLPAGWTQEFRFQKTGRRITHYVNLATGQKFFTKDDLIRYTKTETKTESKQY  60

Query  202  -NRAIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYI  378
             +R +  ++   ++ +TNSQ +  A   ++ PEWLP  W VE KT  SG   G+    Y+
Sbjct  61   DDRLLTLKQI--TKPSTNSQVN-AAVKENECPEWLPKNWFVEVKTHKSGEFIGKRVKIYV  117

Query  379  DP-FGRRFYSKPEVSRHLK  432
            DP  G RFYSKP V R LK
Sbjct  118  DPSTGLRFYSKPAVFRFLK  136



>ref|XP_010676506.1| PREDICTED: uncharacterized protein LOC104892309 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=1022

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 87/177 (49%), Gaps = 23/177 (13%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRA  210
            MV+ K  +  PAGW+   K+KNGRK KYY N    +KFYSK  V+ ++K    S  + + 
Sbjct  1    MVSRKKSDWPPAGWTVEFKIKNGRKTKYYINTKTHQKFYSKPAVLRFIKDGCVSNKKFQP  60

Query  211  IAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDP-F  387
            + +   + S      Q    A N     EWLP GW +E + R SG   G  Y C+IDP  
Sbjct  61   VIEHAKKKSSEKI--QHLVEANN----SEWLPSGWVMETRFRKSGARVGTEYKCFIDPST  114

Query  388  GRRFYSKPEVSRHLKTMNCNGPIGVGEEKKSNIEEPSCNKVSQNEKATGGQSHTSRK  558
            G + +SKPEV R+L         G  + K+ N E       S  +K  GG  H+S K
Sbjct  115  GTKLFSKPEVLRYL---------GSEKTKQHNAE-------SSRQKDRGGSEHSSSK  155



>ref|XP_010255467.1| PREDICTED: uncharacterized protein LOC104596134 isoform X1 [Nelumbo 
nucifera]
Length=577

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 92/184 (50%), Gaps = 26/184 (14%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNS-----  192
            M A KSP+ LP GW   VKV K G+K KYY +   G+KF SK  V+ Y++  G S     
Sbjct  1    MAAEKSPDWLPDGWVMDVKVRKTGQKDKYYIHLKTGRKFRSKDGVLRYIET-GESHNCMP  59

Query  193  ----RGQNRAIAQRE---TRHSERNTNSQSSKTAANP-----DKSPEWLPPGWTVEEKTR  336
                R  N   + ++   T  S+++  +  S+    P     + SP+WLP GW VE KTR
Sbjct  60   LQIERQANTCSSDKDVPNTCSSDKDMPNTCSRDKDMPLEMPMEDSPDWLPAGWVVEIKTR  119

Query  337  MSGVSHGQTYMCYIDPF-GRRFYSKPEVSRHLKTMNCNGPIGVGEEKKSNIEEPSCNKVS  513
              G   GQ Y CYI P  G R YSK +V R+L+    N       EK     + +C+ V 
Sbjct  120  RGGSKVGQKYKCYIAPITGCRLYSKRDVYRYLRYYASN------LEKDGTEMQSACDAVV  173

Query  514  QNEK  525
            ++ K
Sbjct  174  KDAK  177



>ref|XP_010255468.1| PREDICTED: uncharacterized protein LOC104596134 isoform X2 [Nelumbo 
nucifera]
Length=572

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 92/184 (50%), Gaps = 26/184 (14%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNS-----  192
            M A KSP+ LP GW   VKV K G+K KYY +   G+KF SK  V+ Y++  G S     
Sbjct  1    MAAEKSPDWLPDGWVMDVKVRKTGQKDKYYIHLKTGRKFRSKDGVLRYIET-GESHNCMP  59

Query  193  ----RGQNRAIAQRE---TRHSERNTNSQSSKTAANP-----DKSPEWLPPGWTVEEKTR  336
                R  N   + ++   T  S+++  +  S+    P     + SP+WLP GW VE KTR
Sbjct  60   LQIERQANTCSSDKDVPNTCSSDKDMPNTCSRDKDMPLEMPMEDSPDWLPAGWVVEIKTR  119

Query  337  MSGVSHGQTYMCYIDPF-GRRFYSKPEVSRHLKTMNCNGPIGVGEEKKSNIEEPSCNKVS  513
              G   GQ Y CYI P  G R YSK +V R+L+    N       EK     + +C+ V 
Sbjct  120  RGGSKVGQKYKCYIAPITGCRLYSKRDVYRYLRYYASN------LEKDGTEMQSACDAVV  173

Query  514  QNEK  525
            ++ K
Sbjct  174  KDAK  177



>ref|XP_008796736.1| PREDICTED: uncharacterized protein LOC103712110 isoform X2 [Phoenix 
dactylifera]
Length=694

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 63/193 (33%), Positives = 93/193 (48%), Gaps = 15/193 (8%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKVK-NGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  207
            M+A + PE LP GW   VK    G K   YT   + + F+SK++++ Y+  +     +  
Sbjct  1    MLAAERPEWLPEGWKMVVKTSMTGDKDVCYTCPTSSRTFHSKEEIMHYLNYE-----RVD  55

Query  208  AIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF  387
                + T     N +  + +    PD    WLP GW +E KTR SG   G+ Y CYIDP 
Sbjct  56   GYISKPTSCFGDNVHPLAEQIKDFPD----WLPAGWVLEFKTRKSGTHAGRQYKCYIDPV  111

Query  388  -GRRFYSKPEVSRHLKT-MNCNGPIGVGEEKKSNIEEPSCNKVSQNEKATGGQSHTSRKL  561
             G RFYSK EV R++K  M+CN          + + E +C+  SQ +   G +  T   +
Sbjct  112  TGFRFYSKNEVLRYIKDGMSCNPRAKRKRSVVTKVTENACSSTSQRK---GIKRSTMENV  168

Query  562  RSGMGKQPSDIGS  600
            RS +   P  + S
Sbjct  169  RSQIEYTPDGLPS  181



>ref|XP_008796738.1| PREDICTED: uncharacterized protein LOC103712110 isoform X4 [Phoenix 
dactylifera]
Length=692

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 63/193 (33%), Positives = 93/193 (48%), Gaps = 15/193 (8%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKVK-NGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  207
            M+A + PE LP GW   VK    G K   YT   + + F+SK++++ Y+  +     +  
Sbjct  1    MLAAERPEWLPEGWKMVVKTSMTGDKDVCYTCPTSSRTFHSKEEIMHYLNYE-----RVD  55

Query  208  AIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF  387
                + T     N +  + +    PD    WLP GW +E KTR SG   G+ Y CYIDP 
Sbjct  56   GYISKPTSCFGDNVHPLAEQIKDFPD----WLPAGWVLEFKTRKSGTHAGRQYKCYIDPV  111

Query  388  -GRRFYSKPEVSRHLKT-MNCNGPIGVGEEKKSNIEEPSCNKVSQNEKATGGQSHTSRKL  561
             G RFYSK EV R++K  M+CN          + + E +C+  SQ +   G +  T   +
Sbjct  112  TGFRFYSKNEVLRYIKDGMSCNPRAKRKRSVVTKVTENACSSTSQRK---GIKRSTMENV  168

Query  562  RSGMGKQPSDIGS  600
            RS +   P  + S
Sbjct  169  RSQIEYTPDGLPS  181



>ref|XP_007158477.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
 gb|ESW30471.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
Length=1004

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  250  NSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            NS   KTA   ++ PEWLP GW VE KTR SG + G  Y CYIDP G +FYSKPEV R+L
Sbjct  18   NSTKCKTAEKSNEHPEWLPDGWIVESKTRKSGANMGCGYKCYIDPTGCKFYSKPEVLRYL  77

Query  430  KTMNCN  447
            +T+N N
Sbjct  78   ETVNSN  83


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 72/154 (47%), Gaps = 27/154 (18%)
 Frame = +1

Query  49   PEPLPAGWSEHVKVKN-----GRKVKYYTNAPNGKKFYSKKDVICYMK-IKGNSRGQNRA  210
            PE LP GW    K +      G   K Y + P G KFYSK +V+ Y++ +  NS    + 
Sbjct  32   PEWLPDGWIVESKTRKSGANMGCGYKCYID-PTGCKFYSKPEVLRYLETVNSNSHSSKKE  90

Query  211  IAQRETRHSERNTNSQ--------------SSKTAANPD---KSP-EWLPPGWTVEEKTR  336
              ++     E++T                 S+    +PD   KSP E LPPGWT+E K R
Sbjct  91   KMRKSNDAVEKSTAEDLPPDQIADVKMKKSSNGYRIDPDTVEKSPVEDLPPGWTIEAKVR  150

Query  337  MSGVSHGQTYMCYIDPF-GRRFYSKPEVSRHLKT  435
              G  + +  + YIDP  G  F SK +  R++K+
Sbjct  151  KGGTGNRKD-LFYIDPVSGYVFRSKKDALRYVKS  183



>ref|XP_007158476.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
 gb|ESW30470.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
Length=927

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  250  NSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            NS   KTA   ++ PEWLP GW VE KTR SG + G  Y CYIDP G +FYSKPEV R+L
Sbjct  18   NSTKCKTAEKSNEHPEWLPDGWIVESKTRKSGANMGCGYKCYIDPTGCKFYSKPEVLRYL  77

Query  430  KTMNCN  447
            +T+N N
Sbjct  78   ETVNSN  83


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 64/216 (30%), Positives = 99/216 (46%), Gaps = 36/216 (17%)
 Frame = +1

Query  49   PEPLPAGWSEHVKVKN-----GRKVKYYTNAPNGKKFYSKKDVICYMK-IKGNSRGQNRA  210
            PE LP GW    K +      G   K Y + P G KFYSK +V+ Y++ +  NS    + 
Sbjct  32   PEWLPDGWIVESKTRKSGANMGCGYKCYID-PTGCKFYSKPEVLRYLETVNSNSHSSKKE  90

Query  211  IAQRETRHSERNTNSQ--------------SSKTAANPD---KSP-EWLPPGWTVEEKTR  336
              ++     E++T                 S+    +PD   KSP E LPPGWT+E K R
Sbjct  91   KMRKSNDAVEKSTAEDLPPDQIADVKMKKSSNGYRIDPDTVEKSPVEDLPPGWTIEAKVR  150

Query  337  MSGVSHGQTYMCYIDPF-GRRFYSKPEVSRHLKTMNCNGPIGVGEEKKSNIEEPSCNKVS  513
              G  + +  + YIDP  G  F SK +  R++K+ + +    +   K+ N +E   +KVS
Sbjct  151  KGGTGNRKD-LFYIDPVSGYVFRSKKDALRYVKSGDISA-CAIKPFKRQNQDE---DKVS  205

Query  514  QNEKATGGQSH-----TSRKLRSGMGKQPSDIGSSV  606
             ++K +  +       T  K+R G   +  D+ SS 
Sbjct  206  DSDKKSQVEDLPPGWITEAKVRKGGTGKKKDLQSST  241



>ref|XP_007158475.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
 gb|ESW30469.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
Length=959

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  250  NSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            NS   KTA   ++ PEWLP GW VE KTR SG + G  Y CYIDP G +FYSKPEV R+L
Sbjct  18   NSTKCKTAEKSNEHPEWLPDGWIVESKTRKSGANMGCGYKCYIDPTGCKFYSKPEVLRYL  77

Query  430  KTMNCN  447
            +T+N N
Sbjct  78   ETVNSN  83


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 72/154 (47%), Gaps = 27/154 (18%)
 Frame = +1

Query  49   PEPLPAGWSEHVKVKN-----GRKVKYYTNAPNGKKFYSKKDVICYMK-IKGNSRGQNRA  210
            PE LP GW    K +      G   K Y + P G KFYSK +V+ Y++ +  NS    + 
Sbjct  32   PEWLPDGWIVESKTRKSGANMGCGYKCYID-PTGCKFYSKPEVLRYLETVNSNSHSSKKE  90

Query  211  IAQRETRHSERNTNSQ--------------SSKTAANPD---KSP-EWLPPGWTVEEKTR  336
              ++     E++T                 S+    +PD   KSP E LPPGWT+E K R
Sbjct  91   KMRKSNDAVEKSTAEDLPPDQIADVKMKKSSNGYRIDPDTVEKSPVEDLPPGWTIEAKVR  150

Query  337  MSGVSHGQTYMCYIDPF-GRRFYSKPEVSRHLKT  435
              G  + +  + YIDP  G  F SK +  R++K+
Sbjct  151  KGGTGNRKD-LFYIDPVSGYVFRSKKDALRYVKS  183



>ref|XP_007158478.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
 gb|ESW30472.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
Length=972

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  250  NSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            NS   KTA   ++ PEWLP GW VE KTR SG + G  Y CYIDP G +FYSKPEV R+L
Sbjct  18   NSTKCKTAEKSNEHPEWLPDGWIVESKTRKSGANMGCGYKCYIDPTGCKFYSKPEVLRYL  77

Query  430  KTMNCN  447
            +T+N N
Sbjct  78   ETVNSN  83


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 53/179 (30%), Positives = 84/179 (47%), Gaps = 19/179 (11%)
 Frame = +1

Query  43   KSP-EPLPAGWSEHVKVKNG----RKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  207
            KSP E LP GW+   KV+ G    RK  +Y +  +G  F SKKD + Y+K    S     
Sbjct  133  KSPVEDLPPGWTIEAKVRKGGTGNRKDLFYIDPVSGYVFRSKKDALRYVKSGDISAC---  189

Query  208  AIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF  387
            AI   + ++ + +  S S K +   D     LPPGW  E K R  G    +  + Y+DP 
Sbjct  190  AIKPFKRQNQDEDKVSDSDKKSQVED-----LPPGWITEAKVRKGGTGKKKDLL-YLDPV  243

Query  388  -GRRFYSKPEVSRHLKTMNCNG----PIGVGEEKKSNIEEPSCNKVSQNEKATGGQSHT  549
             G  F SK +  R++ + + +     P   G + + NI + S  K  + +++   + H+
Sbjct  244  SGYVFRSKKDALRYVNSGDIDTCVLKPYKRGIQHEDNITQSSTGKKQKLKQSATNRRHS  302


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 57/184 (31%), Positives = 87/184 (47%), Gaps = 31/184 (17%)
 Frame = +1

Query  49   PEPLPAGWSEHVKVKN-----GRKVKYYTNAPNGKKFYSKKDVICYMK-IKGNSRGQNRA  210
            PE LP GW    K +      G   K Y + P G KFYSK +V+ Y++ +  NS    + 
Sbjct  32   PEWLPDGWIVESKTRKSGANMGCGYKCYID-PTGCKFYSKPEVLRYLETVNSNSHSSKKE  90

Query  211  IAQRETRHSERNTNSQ--------------SSKTAANPD---KSP-EWLPPGWTVEEKTR  336
              ++     E++T                 S+    +PD   KSP E LPPGWT+E K R
Sbjct  91   KMRKSNDAVEKSTAEDLPPDQIADVKMKKSSNGYRIDPDTVEKSPVEDLPPGWTIEAKVR  150

Query  337  MSGVSHGQTYMCYIDPF-GRRFYSKPEVSRHLKTMNCNGPIGVGEEKKSNIEEPSCNKVS  513
              G  + +  + YIDP  G  F SK +  R++K+ + +    +   K+ N +E   +KVS
Sbjct  151  KGGTGNRKD-LFYIDPVSGYVFRSKKDALRYVKSGDISA-CAIKPFKRQNQDE---DKVS  205

Query  514  QNEK  525
             ++K
Sbjct  206  DSDK  209



>ref|XP_008796735.1| PREDICTED: uncharacterized protein LOC103712110 isoform X1 [Phoenix 
dactylifera]
Length=695

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 57/165 (35%), Positives = 82/165 (50%), Gaps = 12/165 (7%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKVK-NGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  207
            M+A + PE LP GW   VK    G K   YT   + + F+SK++++ Y+  +     +  
Sbjct  1    MLAAERPEWLPEGWKMVVKTSMTGDKDVCYTCPTSSRTFHSKEEIMHYLNYE-----RVD  55

Query  208  AIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF  387
                + T     N +  + +    PD    WLP GW +E KTR SG   G+ Y CYIDP 
Sbjct  56   GYISKPTSCFGDNVHPLAEQIKDFPD----WLPAGWVLEFKTRKSGTHAGRQYKCYIDPV  111

Query  388  -GRRFYSKPEVSRHLKT-MNCNGPIGVGEEKKSNIEEPSCNKVSQ  516
             G RFYSK EV R++K  M+CN          + + E +C+  SQ
Sbjct  112  TGFRFYSKNEVLRYIKDGMSCNPRAKRKRSVVTKVTENACSSTSQ  156



>ref|XP_008796742.1| PREDICTED: uncharacterized protein LOC103712110 isoform X7 [Phoenix 
dactylifera]
Length=644

 Score = 83.2 bits (204),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 57/165 (35%), Positives = 82/165 (50%), Gaps = 12/165 (7%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKVK-NGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  207
            M+A + PE LP GW   VK    G K   YT   + + F+SK++++ Y+  +     +  
Sbjct  1    MLAAERPEWLPEGWKMVVKTSMTGDKDVCYTCPTSSRTFHSKEEIMHYLNYE-----RVD  55

Query  208  AIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF  387
                + T     N +  + +    PD    WLP GW +E KTR SG   G+ Y CYIDP 
Sbjct  56   GYISKPTSCFGDNVHPLAEQIKDFPD----WLPAGWVLEFKTRKSGTHAGRQYKCYIDPV  111

Query  388  -GRRFYSKPEVSRHLKT-MNCNGPIGVGEEKKSNIEEPSCNKVSQ  516
             G RFYSK EV R++K  M+CN          + + E +C+  SQ
Sbjct  112  TGFRFYSKNEVLRYIKDGMSCNPRAKRKRSVVTKVTENACSSTSQ  156



>ref|XP_008796737.1| PREDICTED: uncharacterized protein LOC103712110 isoform X3 [Phoenix 
dactylifera]
Length=693

 Score = 83.2 bits (204),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 57/165 (35%), Positives = 82/165 (50%), Gaps = 12/165 (7%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKVK-NGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  207
            M+A + PE LP GW   VK    G K   YT   + + F+SK++++ Y+  +     +  
Sbjct  1    MLAAERPEWLPEGWKMVVKTSMTGDKDVCYTCPTSSRTFHSKEEIMHYLNYE-----RVD  55

Query  208  AIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF  387
                + T     N +  + +    PD    WLP GW +E KTR SG   G+ Y CYIDP 
Sbjct  56   GYISKPTSCFGDNVHPLAEQIKDFPD----WLPAGWVLEFKTRKSGTHAGRQYKCYIDPV  111

Query  388  -GRRFYSKPEVSRHLKT-MNCNGPIGVGEEKKSNIEEPSCNKVSQ  516
             G RFYSK EV R++K  M+CN          + + E +C+  SQ
Sbjct  112  TGFRFYSKNEVLRYIKDGMSCNPRAKRKRSVVTKVTENACSSTSQ  156



>ref|XP_010918513.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X1 [Elaeis guineensis]
Length=514

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 90/192 (47%), Gaps = 13/192 (7%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKVK-NGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  207
            M+A + PE LP GW   VK    G K   YT   +   F SK++++ Y+  K     +  
Sbjct  1    MLAAERPEWLPEGWKMVVKTSMTGEKDVCYTCPTSSCTFNSKEEMMRYLNCK-----RAD  55

Query  208  AIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF  387
                + T H   N +  + +    PD    WLP GW +E KTR SG + G+ Y CYIDP 
Sbjct  56   GYISKPTSHFGDNVHPLAEQIKDFPD----WLPAGWGLEFKTRKSGTNAGRQYKCYIDPV  111

Query  388  -GRRFYSKPEVSRHLKTMNCNGPIGVGEEKKSNIEEPSCNKVSQNEKATGGQSHTSRKLR  564
             G +FYSK EV R++K      P    + K+S +   + +  S   +  G +  T   LR
Sbjct  112  TGYKFYSKNEVLRYIKDGIPRNP--RAKRKRSVVTRITEHTRSSTNQRKGIKRSTRENLR  169

Query  565  SGMGKQPSDIGS  600
            S +   P  + S
Sbjct  170  SQIEYTPDGLPS  181



>ref|XP_006827729.1| hypothetical protein AMTR_s00009p00261370 [Amborella trichopoda]
 gb|ERM95145.1| hypothetical protein AMTR_s00009p00261370 [Amborella trichopoda]
Length=1239

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 72/144 (50%), Gaps = 16/144 (11%)
 Frame = +1

Query  49   PEPLPAGWSEHVKVKN-----GRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRAI  213
            PE LP GW+  +KV+      G + KYY +   G  F S+  ++ Y+K K  S       
Sbjct  572  PEWLPPGWTMQIKVRKSGKTAGMREKYYIDPATGCSFRSRVAILRYVKTKKPS-------  624

Query  214  AQRETRHSERNTNSQSSKTAANPD---KSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDP  384
            A ++ +    +  S  +  A  PD   + PEWLPPGWT+E K R SG S G     YIDP
Sbjct  625  ATKQKKPKTLSPKSSGNVMATTPDAKEQPPEWLPPGWTMEIKERKSGKSAGLREKYYIDP  684

Query  385  F-GRRFYSKPEVSRHLKTMNCNGP  453
              GR F S+  + R+++    + P
Sbjct  685  ATGRSFRSRIAIVRYIEAGKLDDP  708


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 49/169 (29%), Positives = 73/169 (43%), Gaps = 39/169 (23%)
 Frame = +1

Query  46   SPEPLPAGWSEHVKVKN-----GRKVKYYTNAPNGKKFYSKKDVICYM--------KIKG  186
            +PE LP GW+  V V+      GR+ K+Y     G++F S+  V+ Y+        ++K 
Sbjct  452  TPEWLPPGWTMVVTVRKAGKTAGRREKFYIELATGQRFASRLAVVRYLENGNASLERLKS  511

Query  187  NSRGQNRA--IAQRETRHSERNTNSQSSKTAANPDK-----------------------S  291
               G ++   IA+      ++   S   KT    D                         
Sbjct  512  QEHGASKIDFIAEESNSPFQKRKESTVIKTKEKKDPLPEICPTNSSGNATVVTSGAEELR  571

Query  292  PEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF-GRRFYSKPEVSRHLKT  435
            PEWLPPGWT++ K R SG + G     YIDP  G  F S+  + R++KT
Sbjct  572  PEWLPPGWTMQIKVRKSGKTAGMREKYYIDPATGCSFRSRVAILRYVKT  620


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/150 (31%), Positives = 68/150 (45%), Gaps = 20/150 (13%)
 Frame = +1

Query  58   LPAGWSEHVK-----VKNGRKVKYYTNAPNGKKFYSKKDVICYMK-------------IK  183
            LP GW    K        G   KY+  A  G+ F SK  V+ Y+K             + 
Sbjct  10   LPDGWIMEQKRRKSGATKGLADKYFIEAATGRFFRSKLQVLRYLKTEKYTGKLWPVKLVS  69

Query  184  GNSRGQNRAIAQRETRHSE-RNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQ  360
             N    N    ++ET  ++      Q + + +   +S +WLPPGWT+E KTR +GVS G 
Sbjct  70   NNKELTNGESMEKETSSAKILQEKVQRTLSPSESGQSSDWLPPGWTIEIKTRKNGVSAGM  129

Query  361  TYMCYID-PFGRRFYSKPEVSRHLKTMNCN  447
                YI+   G++F S+  V R+L   N +
Sbjct  130  REKFYIELATGKKFASRLAVLRYLTDGNAS  159


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 72/176 (41%), Gaps = 39/176 (22%)
 Frame = +1

Query  49   PEPLPAGWSEHVKVK-----NGRKVKYYTNAPNGKKFYSKKDVICYMK------------  177
            P+ LP GW    KV+     +G + K+Y     G++F S+  V+ Y++            
Sbjct  216  PDWLPTGWMMETKVRKRGKSSGAQSKFYIELATGQRFTSRLAVLRYLENGNASLSRLKRK  275

Query  178  ------IKGNSRGQNRAIAQRETRHSERNTNSQSSKTAANPDKS--------------PE  297
                  I  N  G +  I  +   +    T  +      +P KS              PE
Sbjct  276  KHDATNIDLNMEGSDAPIENQNVSNVMMLTERKGPLPEISPCKSSGNVMVSTCTKELIPE  335

Query  298  WLPPGWTVEEKTRMSGVSHGQTYMCYID-PFGRRFYSKPEVSRHLKTMNCNGPIGV  462
            WLPPGW  E   R SG + G+    YI+   G+RF S+  V R+L   N + P G+
Sbjct  336  WLPPGWATEISVRKSGKTAGRREKFYIELATGQRFGSRLAVLRYLTNGNAS-PSGL  390



>ref|XP_006440581.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
 gb|ESR53821.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
Length=1065

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 73/149 (49%), Gaps = 43/149 (29%)
 Frame = +1

Query  121  NAPNGKKFYSKKDVICYMKIK---------GNSRG--------------QNRAIAQRETR  231
            N   G+KF+SK+D++ Y+K+K          +S G              +N+    R  R
Sbjct  2    NVRTGQKFFSKEDLLRYVKMKRTQLDEPSPTSSHGKRHLENSSSKLVAKENKQENSRSKR  61

Query  232  HSE-------------------RNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSH  354
            HSE                   R++ + S+K   + +  P+WLP GW VE KTR SG + 
Sbjct  62   HSENRSMKPVAEENSHDNGHGKRHSENSSTKPVVDENNRPDWLPDGWVVELKTRKSGSAV  121

Query  355  GQTYMCYIDPF-GRRFYSKPEVSRHLKTM  438
            G+ Y  YI+P  G +F+S PEV RHL+++
Sbjct  122  GRQYKVYIEPITGCKFFSMPEVLRHLESV  150



>gb|KDO55595.1| hypothetical protein CISIN_1g0013392mg, partial [Citrus sinensis]
Length=267

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/149 (32%), Positives = 73/149 (49%), Gaps = 43/149 (29%)
 Frame = +1

Query  121  NAPNGKKFYSKKDVICYMKIK---------GNSRG--------------QNRAIAQRETR  231
            N   G+KF+SK+D++ Y+K+K          +S G              +N+    R  R
Sbjct  2    NVRTGQKFFSKEDLLRYVKMKRTQLDEPSPTSSHGKRHLENSSSKLVAKENKQENSRSKR  61

Query  232  HSE-------------------RNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSH  354
            HSE                   R++ + S+K   + +  P+WLP GW V+ KTR SG + 
Sbjct  62   HSENRSMKPVAEENSHDNGHGKRHSENSSTKPVVDENNRPDWLPDGWVVDLKTRKSGSAV  121

Query  355  GQTYMCYIDPF-GRRFYSKPEVSRHLKTM  438
            G+ Y  YI+P  G +F+S PEV RHL+++
Sbjct  122  GRQYKVYIEPITGCKFFSMPEVLRHLESV  150



>gb|KEH21030.1| methyl-CpG-binding domain protein [Medicago truncatula]
Length=1325

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 47/69 (68%), Gaps = 4/69 (6%)
 Frame = +1

Query  235  SERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPFGR-RFYSKP  411
            ++RN+  Q+ + A   D+ PEWLP GW +E +TR SG + G  Y CYIDP    +FYSKP
Sbjct  20   TKRNSKQQTPEKA---DEHPEWLPNGWDIEVRTRQSGPAMGSAYKCYIDPSNTYKFYSKP  76

Query  412  EVSRHLKTM  438
            EV RHL+T+
Sbjct  77   EVLRHLETI  85



>ref|XP_006580605.1| PREDICTED: uncharacterized protein LOC100782433 [Glycine max]
Length=1209

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 57/99 (58%), Gaps = 2/99 (2%)
 Frame = +1

Query  223  ETRHSERNTNSQSSKTAAN-PDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPFGR-R  396
            ET     NT S S + + +  ++ P+WLP GW VE +TR SGV  G  Y CYI+P  R +
Sbjct  11   ETNRQIDNTKSNSKQQSVDKANEHPDWLPDGWNVEVRTRKSGVHMGSGYKCYIEPLKRYK  70

Query  397  FYSKPEVSRHLKTMNCNGPIGVGEEKKSNIEEPSCNKVS  513
            F+SKPEV R+L+T+  N       +K SN+  P  N  S
Sbjct  71   FFSKPEVLRYLETVKDNSCTSKKGKKCSNMHSPKHNSCS  109



>gb|KHN23667.1| Methyl-CpG-binding domain-containing protein 13 [Glycine soja]
Length=1188

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 57/99 (58%), Gaps = 2/99 (2%)
 Frame = +1

Query  223  ETRHSERNTNSQSSKTAAN-PDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPFGR-R  396
            ET     NT S S + + +  ++ P+WLP GW VE +TR SGV  G  Y CYI+P  R +
Sbjct  11   ETNRQIDNTKSNSKQQSVDKANEHPDWLPDGWNVEVRTRKSGVHMGSGYKCYIEPLKRYK  70

Query  397  FYSKPEVSRHLKTMNCNGPIGVGEEKKSNIEEPSCNKVS  513
            F+SKPEV R+L+T+  N       +K SN+  P  N  S
Sbjct  71   FFSKPEVLRYLETVKDNSCTSKKGKKCSNMHSPKHNSCS  109



>ref|XP_003532403.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X1 [Glycine max]
 ref|XP_006584707.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Glycine max]
Length=1122

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 58/102 (57%), Gaps = 2/102 (2%)
 Frame = +1

Query  214  AQRETRHSERNTNSQS-SKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF-  387
            ++   R  + NT S S  ++    ++ P+WLP GW VE +TR SGV  G  Y CYI+P  
Sbjct  9    SEETNRQIDSNTKSNSKQQSVEKANEHPDWLPDGWNVEVRTRKSGVHMGSGYKCYIEPLK  68

Query  388  GRRFYSKPEVSRHLKTMNCNGPIGVGEEKKSNIEEPSCNKVS  513
            G +F+SKPEV R+L+T+  N       +K SN+  P  N  +
Sbjct  69   GYKFFSKPEVLRYLETVKDNSCTSKKGKKCSNMHSPKHNSCT  110



>gb|KHN16846.1| Methyl-CpG-binding domain-containing protein 13 [Glycine soja]
Length=1122

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 58/102 (57%), Gaps = 2/102 (2%)
 Frame = +1

Query  214  AQRETRHSERNTNSQS-SKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF-  387
            ++   R  + NT S S  ++    ++ P+WLP GW VE +TR SGV  G  Y CYI+P  
Sbjct  9    SEETNRQIDSNTKSNSKQQSVEKANEHPDWLPDGWNVEVRTRKSGVHMGSGYKCYIEPLK  68

Query  388  GRRFYSKPEVSRHLKTMNCNGPIGVGEEKKSNIEEPSCNKVS  513
            G +F+SKPEV R+L+T+  N       +K SN+  P  N  +
Sbjct  69   GYKFFSKPEVLRYLETVKDNSCTSKKGKKCSNMHSPKHNSCT  110



>ref|XP_008796741.1| PREDICTED: uncharacterized protein LOC103712110 isoform X6 [Phoenix 
dactylifera]
Length=651

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 57/105 (54%), Gaps = 5/105 (5%)
 Frame = +1

Query  292  PEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF-GRRFYSKPEVSRHLKT-MNCNGPIGVG  465
            P+WLP GW +E KTR SG   G+ Y CYIDP  G RFYSK EV R++K  M+CN      
Sbjct  37   PDWLPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDGMSCNPRAKRK  96

Query  466  EEKKSNIEEPSCNKVSQNEKATGGQSHTSRKLRSGMGKQPSDIGS  600
                + + E +C+  SQ +   G +  T   +RS +   P  + S
Sbjct  97   RSVVTKVTENACSSTSQRK---GIKRSTMENVRSQIEYTPDGLPS  138



>ref|XP_008796743.1| PREDICTED: uncharacterized protein LOC103712110 isoform X8 [Phoenix 
dactylifera]
Length=600

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 57/105 (54%), Gaps = 5/105 (5%)
 Frame = +1

Query  292  PEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF-GRRFYSKPEVSRHLKT-MNCNGPIGVG  465
            P+WLP GW +E KTR SG   G+ Y CYIDP  G RFYSK EV R++K  M+CN      
Sbjct  37   PDWLPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDGMSCNPRAKRK  96

Query  466  EEKKSNIEEPSCNKVSQNEKATGGQSHTSRKLRSGMGKQPSDIGS  600
                + + E +C+  SQ +   G +  T   +RS +   P  + S
Sbjct  97   RSVVTKVTENACSSTSQRK---GIKRSTMENVRSQIEYTPDGLPS  138



>ref|XP_008796740.1| PREDICTED: uncharacterized protein LOC103712110 isoform X5 [Phoenix 
dactylifera]
Length=652

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 46/77 (60%), Gaps = 2/77 (3%)
 Frame = +1

Query  292  PEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF-GRRFYSKPEVSRHLKT-MNCNGPIGVG  465
            P+WLP GW +E KTR SG   G+ Y CYIDP  G RFYSK EV R++K  M+CN      
Sbjct  37   PDWLPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDGMSCNPRAKRK  96

Query  466  EEKKSNIEEPSCNKVSQ  516
                + + E +C+  SQ
Sbjct  97   RSVVTKVTENACSSTSQ  113



>ref|XP_010685755.1| PREDICTED: uncharacterized protein LOC104900109 [Beta vulgaris 
subsp. vulgaris]
Length=167

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/146 (32%), Positives = 69/146 (47%), Gaps = 21/146 (14%)
 Frame = +1

Query  28   KMVAGKSPEPLPAGWSEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  207
            K +    P+ LP  W  H  V +     YY+N P GKKF S+K+VI Y+      + Q R
Sbjct  17   KQITQIWPDWLPYDWCIHRNVHSSETQLYYSN-PRGKKFQSQKEVIQYLA----KQAQKR  71

Query  208  AIAQRETRHSERNTNSQSSK----------TAANPDKSPEWLPPGWTVEEKTRMSGVSHG  357
             I +R  R  +++ +   +K           A  P + PEWLP  W +E  ++       
Sbjct  72   VIIRRTKRKIKKSNDMVENKELLAEIAPQYVAYPPQEWPEWLPQDWIIERSSK------N  125

Query  358  QTYMCYIDPFGRRFYSKPEVSRHLKT  435
             T + Y +P  ++F SK EV  HL+T
Sbjct  126  PTKVYYCNPKWKKFRSKDEVLHHLET  151



>ref|XP_007160033.1| hypothetical protein PHAVU_002G287000g [Phaseolus vulgaris]
 gb|ESW32027.1| hypothetical protein PHAVU_002G287000g [Phaseolus vulgaris]
Length=1225

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 46/69 (67%), Gaps = 2/69 (3%)
 Frame = +1

Query  238  ERNTNSQS-SKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF-GRRFYSKP  411
            + NTNS S  ++    D+ PEWLP GW +E + R SG+  G  Y CYI+P  G +F+SKP
Sbjct  17   DSNTNSNSKQQSVEKADEHPEWLPDGWNMEVRIRKSGLHMGSGYKCYIEPLKGYKFFSKP  76

Query  412  EVSRHLKTM  438
            EV R+L+T+
Sbjct  77   EVLRYLETV  85



>gb|EYU25079.1| hypothetical protein MIMGU_mgv11b021680mg [Erythranthe guttata]
Length=330

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 70/141 (50%), Gaps = 25/141 (18%)
 Frame = +1

Query  34   VAGKSPEPLPAGWSEHVKVKN-GRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRA  210
            + G+S + LP GW   VKV+N G+K KYY N  NG++F SK +V+ Y+K           
Sbjct  62   MGGESLDWLPVGWRVSVKVRNSGKKDKYYVNPSNGRRFNSKPEVLRYVK-----------  110

Query  211  IAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYM--CYIDP  384
                    S +N N +            E LPPGW  E +T+  G   G+T    CYIDP
Sbjct  111  -------SSVKNPNPKEPSKIKIEKTVTENLPPGWIKEIRTKKKG---GRTRRDPCYIDP  160

Query  385  F-GRRFYSKPEVSRHLKTMNC  444
              GR F S  EV R+L++ + 
Sbjct  161  VSGRHFRSMQEVFRYLESKDV  181



>ref|XP_008791903.1| PREDICTED: uncharacterized protein LOC103708650 [Phoenix dactylifera]
Length=569

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 58/193 (30%), Positives = 88/193 (46%), Gaps = 19/193 (10%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  207
            M   + PE LP GW+  V+  KNG   +YYT+  +   F SK+ V+ Y+ +     G   
Sbjct  1    MSVEEPPEWLPDGWTMEVRRGKNGNIYRYYTSPVSSYTFCSKEAVMRYLNVV-KVDGHES  59

Query  208  AIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDP-  384
             I+          +  +S +       S +WLPPGW +E +T+  G    Q YM Y +P 
Sbjct  60   EISA--------CSGDESPRPVRQVKNSFKWLPPGWLLEIRTQRRGSKAQQIYMSYFEPS  111

Query  385  FGRRFYSKPEVSRHLKTMNCNGPIGVGEEKKSNIEEPSCNKVSQNEKATGGQSH------  546
             G RFYSK +V + +K+    GP    ++ +    E   N ++Q E    G  H      
Sbjct  112  TGSRFYSKGDVLQFVKSGKIYGP--TSDQTRHCEAESLENVIAQIEFYPDGLPHGWYKEI  169

Query  547  TSRKLRSGMGKQP  585
              +K RSG  + P
Sbjct  170  RIKKNRSGFRRDP  182



>emb|CBI34715.3| unnamed protein product [Vitis vinifera]
Length=1076

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 50/88 (57%), Gaps = 3/88 (3%)
 Frame = +1

Query  250  NSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDP-FGRRFYSKPEVSRH  426
            N ++ K      K P+WLP GW +E KT+ SG   G+ Y CY+DP  G RFYSKP+V R+
Sbjct  22   NGRNVKLGIKTKKFPDWLPNGWILELKTQRSGSCVGKQYKCYLDPSTGYRFYSKPDVFRY  81

Query  427  LKTMNCNGPIGVGEEKKSNIEEPSCNKV  510
            LKT+  N       +KK     PS  KV
Sbjct  82   LKTIKHNS--CTSRQKKVGPGMPSLGKV  107



>ref|XP_010661055.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X2 [Vitis vinifera]
Length=496

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 50/88 (57%), Gaps = 3/88 (3%)
 Frame = +1

Query  250  NSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDP-FGRRFYSKPEVSRH  426
            N ++ K      K P+WLP GW +E KT+ SG   G+ Y CY+DP  G RFYSKP+V R+
Sbjct  22   NGRNVKLGIKTKKFPDWLPNGWILELKTQRSGSCVGKQYKCYLDPSTGYRFYSKPDVFRY  81

Query  427  LKTMNCNGPIGVGEEKKSNIEEPSCNKV  510
            LKT+  N       +KK     PS  KV
Sbjct  82   LKTIKHNS--CTSRQKKVGPGMPSLGKV  107



>ref|XP_010661063.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X3 [Vitis vinifera]
Length=482

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 46/76 (61%), Gaps = 3/76 (4%)
 Frame = +1

Query  286  KSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDP-FGRRFYSKPEVSRHLKTMNCNGPIGV  462
            K P+WLP GW +E KT+ SG   G+ Y CY+DP  G RFYSKP+V R+LKT+  N     
Sbjct  20   KFPDWLPNGWILELKTQRSGSCVGKQYKCYLDPSTGYRFYSKPDVFRYLKTIKHNS--CT  77

Query  463  GEEKKSNIEEPSCNKV  510
              +KK     PS  KV
Sbjct  78   SRQKKVGPGMPSLGKV  93



>ref|XP_010273135.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 [Nelumbo 
nucifera]
 ref|XP_010273136.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 [Nelumbo 
nucifera]
Length=553

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 44/72 (61%), Gaps = 4/72 (6%)
 Frame = +1

Query  217  QRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDP-FGR  393
            +R+T+   R+ + +      +P   PEWLP GW VE KTRMSG S GQ Y CYI P  G 
Sbjct  6    ERQTKMCSRDKDMELVVQMEDP---PEWLPAGWVVEIKTRMSGSSAGQKYKCYIAPSTGC  62

Query  394  RFYSKPEVSRHL  429
            + YSK EV R+L
Sbjct  63   KLYSKKEVQRYL  74


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 50/152 (33%), Positives = 69/152 (45%), Gaps = 29/152 (19%)
 Frame = +1

Query  10   NLESLVKMVAGKSPEPLPAGWSEHVKVK-----NGRKVKYYTNAPNGKKFYSKKDV----  162
            ++E +V+M     PE LPAGW   +K +      G+K K Y     G K YSKK+V    
Sbjct  17   DMELVVQM--EDPPEWLPAGWVVEIKTRMSGSSAGQKYKCYIAPSTGCKLYSKKEVQRYL  74

Query  163  ICYMKIKGNSRGQNRAIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMS  342
             CYM            + ++E +      N QS+      D + E LPPGW  E + R  
Sbjct  75   SCYMP----------EVKRKECK------NMQSACNVVLKDVTEE-LPPGWIKEIRVRRK  117

Query  343  GVSHGQTYMCYIDPF-GRRFYSKPEVSRHLKT  435
                 ++   YIDP  G  F SK +V R+L T
Sbjct  118  TCKTKKSDTYYIDPVNGYEFRSKKDVFRYLGT  149



>ref|XP_002509754.1| hypothetical protein RCOM_1685990 [Ricinus communis]
 gb|EEF51141.1| hypothetical protein RCOM_1685990 [Ricinus communis]
Length=978

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = +1

Query  292  PEWLPPGWTVEEKTRMSGVSHGQTYMCYIDP-FGRRFYSKPEVSRHLKT  435
            PEWLP GW VE K + SG + G+ Y CY++P  G +FYSKPEV RHL+T
Sbjct  11   PEWLPHGWIVELKIKNSGSARGRKYKCYVEPSTGYKFYSKPEVFRHLET  59


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 66/143 (46%), Gaps = 22/143 (15%)
 Frame = +1

Query  49   PEPLPAGWSEHVKVKN-----GRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRAI  213
            PE LP GW   +K+KN     GRK K Y     G KFYSK +V  +++  G     ++  
Sbjct  11   PEWLPHGWIVELKIKNSGSARGRKYKCYVEPSTGYKFYSKPEVFRHLETTGLKSCTSK--  68

Query  214  AQRETRHSERNTNSQSSKTAANPD-------KSPEWLPPGWTVEEKT-RMSGVSHGQTYM  369
             Q+E   S   TN  S +    PD        + E LP GW  E K  R +       Y 
Sbjct  69   -QKEAVVSMLPTNKVSLRY---PDAKVKIEKSTVEDLPTGWIKEIKIQRKTNGIRKDPY-  123

Query  370  CYIDPF-GRRFYSKPEVSRHLKT  435
             YIDP  G  F SK +V R+L+T
Sbjct  124  -YIDPVSGYVFRSKRDVQRYLET  145



>ref|XP_009760427.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
[Nicotiana sylvestris]
Length=522

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 64/207 (31%), Positives = 98/207 (47%), Gaps = 34/207 (16%)
 Frame = +1

Query  49   PEPLPAGWSEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRAIAQRET  228
            P+ LPAGW   V+ + G+K K+Y++     KF SK DV+ Y+    +S G N + +    
Sbjct  8    PDWLPAGW--KVEFRKGKKEKWYSDPSKELKFNSKTDVLRYL----SSVGSNCSKSSNTK  61

Query  229  RHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF-GRRFYS  405
               +++T   S+  AA+     E LPPGW  E + R  G    +    YIDP  G+ F S
Sbjct  62   EMEKKDTGKFSTGKAAS-----EGLPPGWIKEMRVRRKGHKIRKDPY-YIDPVSGQTFRS  115

Query  406  KPEVSRHLKTM-----------NCNGPIGVGEEKKSNIEEPSCNKVSQNEKATGGQSHTS  552
              EVSR L+T             C G   +G E  S +   +  ++S +  A+G +   S
Sbjct  116  MKEVSRLLETRESGRIESKPGDQCPGTSELG-EPFSTLTAEADKQISLDSDASGKEVDLS  174

Query  553  RKLRSGMGKQPSDIGSSVVVQSDLVDG  633
            RKL+         +G+  +V S  V+G
Sbjct  175  RKLK---------LGAEHMVHSGCVEG  192



>ref|XP_011076193.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X1 [Sesamum indicum]
 ref|XP_011076194.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Sesamum indicum]
Length=654

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 68/134 (51%), Gaps = 22/134 (16%)
 Frame = +1

Query  49   PEPLPAGWSEHVKVKN-GRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRAIAQRE  225
            P+ LP GW   VKV++ GRK KYY N  NG KF SK +V+ Y+K     R + RA+    
Sbjct  6    PDWLPVGWRVSVKVRSCGRKDKYYVNPSNGLKFNSKPEVLRYLKYSAKGR-KPRAL----  60

Query  226  TRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSG-VSHGQTYMCYIDPF-GRRF  399
                  N   +  KT A+       LPPGW  E +T   G  +    Y  YIDP  GR F
Sbjct  61   ------NNKVEIRKTVADK------LPPGWIKEIRTTKKGRKTRRDPY--YIDPVTGRYF  106

Query  400  YSKPEVSRHLKTMN  441
             S  EV R+L++ +
Sbjct  107  RSMQEVFRYLESKD  120



>ref|XP_009364396.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like 
[Pyrus x bretschneideri]
Length=236

 Score = 62.8 bits (151),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 42/73 (58%), Gaps = 10/73 (14%)
 Frame = +1

Query  298  WLPPGWTVEEKTRMSGVSHGQTYMCYIDPF-GRRFYSKPEVSRHLKTMNCNGPIGVGEEK  474
            WLPPGW+V+EK R SG++ G T   Y DP  GRRF SK EV R L+T         G  K
Sbjct  101  WLPPGWSVQEKVRSSGLTAGSTDRYYFDPVSGRRFRSKIEVLRFLET---------GTAK  151

Query  475  KSNIEEPSCNKVS  513
            K+  E  S +K S
Sbjct  152  KAKTENASADKTS  164



>ref|XP_010934848.1| PREDICTED: uncharacterized protein LOC105054908 isoform X3 [Elaeis 
guineensis]
Length=638

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 70/143 (49%), Gaps = 11/143 (8%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  207
            M   + PE LP GW+  V+  K G   +YYT+  +   F SK+ V+ Y+ +         
Sbjct  1    MSIEEPPEWLPDGWTMEVRRGKTGNIYRYYTSPLSSYTFCSKEAVMRYLNVV--------  52

Query  208  AIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF  387
             +   E+  S R+ + +S +       S +WLPPGW +E +T+  G    Q Y  Y DP 
Sbjct  53   KVDGHESELSARSGD-ESPRPVQQVKNSFKWLPPGWLLEIRTQRCGSKARQIYKSYFDPS  111

Query  388  GR-RFYSKPEVSRHLKTMNCNGP  453
             R RFYSK +V + +K+     P
Sbjct  112  TRSRFYSKGDVLQFVKSGKIYSP  134



>ref|XP_010934849.1| PREDICTED: uncharacterized protein LOC105054908 isoform X4 [Elaeis 
guineensis]
Length=605

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 70/143 (49%), Gaps = 11/143 (8%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  207
            M   + PE LP GW+  V+  K G   +YYT+  +   F SK+ V+ Y+ +         
Sbjct  1    MSIEEPPEWLPDGWTMEVRRGKTGNIYRYYTSPLSSYTFCSKEAVMRYLNVV--------  52

Query  208  AIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF  387
             +   E+  S R+ + +S +       S +WLPPGW +E +T+  G    Q Y  Y DP 
Sbjct  53   KVDGHESELSARSGD-ESPRPVQQVKNSFKWLPPGWLLEIRTQRCGSKARQIYKSYFDPS  111

Query  388  GR-RFYSKPEVSRHLKTMNCNGP  453
             R RFYSK +V + +K+     P
Sbjct  112  TRSRFYSKGDVLQFVKSGKIYSP  134



>ref|XP_010934847.1| PREDICTED: uncharacterized protein LOC105054908 isoform X2 [Elaeis 
guineensis]
Length=654

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 70/143 (49%), Gaps = 11/143 (8%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  207
            M   + PE LP GW+  V+  K G   +YYT+  +   F SK+ V+ Y+ +         
Sbjct  1    MSIEEPPEWLPDGWTMEVRRGKTGNIYRYYTSPLSSYTFCSKEAVMRYLNVV--------  52

Query  208  AIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF  387
             +   E+  S R+ + +S +       S +WLPPGW +E +T+  G    Q Y  Y DP 
Sbjct  53   KVDGHESELSARSGD-ESPRPVQQVKNSFKWLPPGWLLEIRTQRCGSKARQIYKSYFDPS  111

Query  388  GR-RFYSKPEVSRHLKTMNCNGP  453
             R RFYSK +V + +K+     P
Sbjct  112  TRSRFYSKGDVLQFVKSGKIYSP  134



>emb|CDP05220.1| unnamed protein product [Coffea canephora]
Length=480

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 73/150 (49%), Gaps = 17/150 (11%)
 Frame = +1

Query  58   LPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRAIAQRETRH  234
            LPAGW   V+V K G+K K Y +  N +KFYSK +V+ Y+K  G S          +  H
Sbjct  11   LPAGWKVEVRVRKTGKKDKCYVDPSNERKFYSKPEVLRYLKDVGVS----------QPVH  60

Query  235  SERNTNSQSSKTAAN---PDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDP-FGRRFY  402
             E    S SS+ A      +++ E LP GW  E +    G +  +    YIDP  G  F 
Sbjct  61   EETQNKSISSRLAIKFVVKEEAAEGLPAGWIKETRVTQKG-NKIRRDPYYIDPESGHLFR  119

Query  403  SKPEVSRHLKTMNCNGPIGVGEEKKS-NIE  489
            S  EV R+L T    G   +G E+ S N+E
Sbjct  120  SMKEVFRYLDTGKMGGLASMGNEQSSINLE  149


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 45/83 (54%), Gaps = 5/83 (6%)
 Frame = +1

Query  289  SPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPFG-RRFYSKPEVSRHLKTMNCNGPIGVG  465
            S +WLP GW VE + R +G    +   CY+DP   R+FYSKPEV R+LK +  + P+   
Sbjct  7    SDDWLPAGWKVEVRVRKTG----KKDKCYVDPSNERKFYSKPEVLRYLKDVGVSQPVHEE  62

Query  466  EEKKSNIEEPSCNKVSQNEKATG  534
             + KS     +   V + E A G
Sbjct  63   TQNKSISSRLAIKFVVKEEAAEG  85



>ref|XP_010934846.1| PREDICTED: uncharacterized protein LOC105054908 isoform X1 [Elaeis 
guineensis]
Length=687

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 70/143 (49%), Gaps = 11/143 (8%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  207
            M   + PE LP GW+  V+  K G   +YYT+  +   F SK+ V+ Y+ +         
Sbjct  1    MSIEEPPEWLPDGWTMEVRRGKTGNIYRYYTSPLSSYTFCSKEAVMRYLNVV--------  52

Query  208  AIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF  387
             +   E+  S R+ + +S +       S +WLPPGW +E +T+  G    Q Y  Y DP 
Sbjct  53   KVDGHESELSARSGD-ESPRPVQQVKNSFKWLPPGWLLEIRTQRCGSKARQIYKSYFDPS  111

Query  388  GR-RFYSKPEVSRHLKTMNCNGP  453
             R RFYSK +V + +K+     P
Sbjct  112  TRSRFYSKGDVLQFVKSGKIYSP  134



>ref|XP_008357235.1| PREDICTED: methyl-CpG-binding domain-containing protein 5 [Malus 
domestica]
Length=236

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 42/73 (58%), Gaps = 10/73 (14%)
 Frame = +1

Query  298  WLPPGWTVEEKTRMSGVSHGQTYMCYIDPF-GRRFYSKPEVSRHLKTMNCNGPIGVGEEK  474
            WLPPGW+V+EK R SG++ G T   Y DP  GRRF SK EV R L+T         G  K
Sbjct  101  WLPPGWSVQEKVRSSGLTAGSTDRYYFDPVSGRRFRSKIEVLRFLET---------GTTK  151

Query  475  KSNIEEPSCNKVS  513
            K+  E  S +K S
Sbjct  152  KAKTENASADKTS  164



>ref|XP_004503754.1| PREDICTED: uncharacterized protein LOC101511357 [Cicer arietinum]
Length=1262

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = +1

Query  253  SQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF-GRRFYSKPEVSRHL  429
            S   +TA   ++ P+WLP GW +E +TR SG   G  Y CYID   G +FYSKPEV R+L
Sbjct  23   SSKQQTAEKGNEWPDWLPDGWDMEVRTRKSGPLMGSGYKCYIDSLNGNKFYSKPEVLRYL  82

Query  430  KTMNCN  447
            +T   N
Sbjct  83   ETTKGN  88



>ref|XP_010918514.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X2 [Elaeis guineensis]
Length=488

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 55/104 (53%), Gaps = 3/104 (3%)
 Frame = +1

Query  292  PEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF-GRRFYSKPEVSRHLKTMNCNGPIGVGE  468
            P+WLP GW +E KTR SG + G+ Y CYIDP  G +FYSK EV R++K      P    +
Sbjct  54   PDWLPAGWGLEFKTRKSGTNAGRQYKCYIDPVTGYKFYSKNEVLRYIKDGIPRNP--RAK  111

Query  469  EKKSNIEEPSCNKVSQNEKATGGQSHTSRKLRSGMGKQPSDIGS  600
             K+S +   + +  S   +  G +  T   LRS +   P  + S
Sbjct  112  RKRSVVTRITEHTRSSTNQRKGIKRSTRENLRSQIEYTPDGLPS  155


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 71/146 (49%), Gaps = 17/146 (12%)
 Frame = +1

Query  49   PEPLPAGWSEHVKVKN-----GRKVKYYTNAPNGKKFYSKKDVICYMK--IKGNSRGQN-  204
            P+ LPAGW    K +      GR+ K Y +   G KFYSK +V+ Y+K  I  N R +  
Sbjct  54   PDWLPAGWGLEFKTRKSGTNAGRQYKCYIDPVTGYKFYSKNEVLRYIKDGIPRNPRAKRK  113

Query  205  RAIAQRETRHSERNTN-------SQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHG-Q  360
            R++  R T H+  +TN       S      +  + +P+ LP GW  E + R S  S G +
Sbjct  114  RSVVTRITEHTRSSTNQRKGIKRSTRENLRSQIEYTPDGLPSGWIKEIRYRKSTSSCGAK  173

Query  361  TYMCYIDPF-GRRFYSKPEVSRHLKT  435
                Y DP  G  F S+ +  ++++T
Sbjct  174  RDQYYTDPVNGYVFRSRKDAIQYIET  199



>ref|XP_010533702.1| PREDICTED: uncharacterized protein LOC104809412 isoform X3 [Tarenaya 
hassleriana]
Length=325

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 67/135 (50%), Gaps = 20/135 (15%)
 Frame = +1

Query  31   MVAGKSPEPLPAGW-SEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  207
            + A KSP+ LPAGW ++   +K+GR+V+ YT+    ++F SK DV+ Y++++        
Sbjct  9    ITADKSPDWLPAGWIAQSTVLKSGREVRSYTHLNTCQRFSSKDDVLQYIEME--------  60

Query  208  AIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYID-P  384
                RE R+SE         T  NP     WLP  W +EE+      S G  Y  Y +  
Sbjct  61   --KIREIRYSETEREKNCGMTIQNPG----WLPDHWVMEERKG----SSGNVYKVYTNLS  110

Query  385  FGRRFYSKPEVSRHL  429
             G + Y+K  V R L
Sbjct  111  TGYKCYTKRAVQRCL  125



>ref|XP_010533701.1| PREDICTED: uncharacterized protein LOC104809412 isoform X2 [Tarenaya 
hassleriana]
Length=601

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 67/135 (50%), Gaps = 20/135 (15%)
 Frame = +1

Query  31   MVAGKSPEPLPAGW-SEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  207
            + A KSP+ LPAGW ++   +K+GR+V+ YT+    ++F SK DV+ Y++++        
Sbjct  9    ITADKSPDWLPAGWIAQSTVLKSGREVRSYTHLNTCQRFSSKDDVLQYIEME--------  60

Query  208  AIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYID-P  384
                RE R+SE         T  NP     WLP  W +EE+      S G  Y  Y +  
Sbjct  61   --KIREIRYSETEREKNCGMTIQNPG----WLPDHWVMEERKG----SSGNVYKVYTNLS  110

Query  385  FGRRFYSKPEVSRHL  429
             G + Y+K  V R L
Sbjct  111  TGYKCYTKRAVQRCL  125



>ref|XP_010533700.1| PREDICTED: uncharacterized protein LOC104809412 isoform X1 [Tarenaya 
hassleriana]
Length=630

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 67/135 (50%), Gaps = 20/135 (15%)
 Frame = +1

Query  31   MVAGKSPEPLPAGW-SEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  207
            + A KSP+ LPAGW ++   +K+GR+V+ YT+    ++F SK DV+ Y++++        
Sbjct  9    ITADKSPDWLPAGWIAQSTVLKSGREVRSYTHLNTCQRFSSKDDVLQYIEME--------  60

Query  208  AIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYID-P  384
                RE R+SE         T  NP     WLP  W +EE+      S G  Y  Y +  
Sbjct  61   --KIREIRYSETEREKNCGMTIQNPG----WLPDHWVMEERKG----SSGNVYKVYTNLS  110

Query  385  FGRRFYSKPEVSRHL  429
             G + Y+K  V R L
Sbjct  111  TGYKCYTKRAVQRCL  125



>ref|XP_009418270.1| PREDICTED: uncharacterized protein LOC103998509 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=268

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/146 (31%), Positives = 65/146 (45%), Gaps = 17/146 (12%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  207
            M   K P+ LP GW   V+  K G   +YYT   +   F SK++VI Y+ I   +     
Sbjct  1    MSEEKPPDWLPDGWIMEVRRGKKGFTYRYYTCPISEYTFCSKEEVIHYLNIVAAAS----  56

Query  208  AIAQRETRHSERNTN---SQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYI  378
                    H+  +T     +  +       S +WLP GW +E +TR  G    + Y CY+
Sbjct  57   --------HASEDTECFGDEDQQLVHKVKDSLKWLPRGWIMEIRTRKIGAEAEERYKCYL  108

Query  379  -DPFGRRFYSKPEVSRHLKTMNCNGP  453
                G  FYSK EV + ++  N  GP
Sbjct  109  HQSTGTVFYSKEEVLQFIEAGNACGP  134



>gb|KFK40518.1| hypothetical protein AALP_AA2G006300 [Arabis alpina]
Length=737

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 49/165 (30%), Positives = 81/165 (49%), Gaps = 16/165 (10%)
 Frame = +1

Query  31   MVAGKSPEPLPAGW-SEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  207
            + A  +P+ LP+GW S+   +K GR+ K YTN    KK Y+K  V+ Y+K++   R +  
Sbjct  9    ITADTTPDWLPSGWISQSTSLKRGRQTKTYTNVITKKKLYTKDQVLEYIKME-KIREKRL  67

Query  208  AIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYID-P  384
            +  +R   + +   +S  S TA    + P WLP GW +E  TR+ G   G  Y  Y++  
Sbjct  68   SAIERTKANVQAVEDSVDSSTAR---ERPSWLPDGWKME--TRI-GRYGGNQYTIYVNMS  121

Query  385  FGRRFYSKPEVSRHLKTMNCNGPIGVGEEKKSNIEEPSCNKVSQN  519
             G +   K +V  +  TM     +        N+EE   + +S++
Sbjct  122  SGFKTSLKHKVLEYEDTMESEASL-------ENVEETGIDYISED  159



>gb|KFK40519.1| hypothetical protein AALP_AA2G006300 [Arabis alpina]
Length=720

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 49/165 (30%), Positives = 81/165 (49%), Gaps = 16/165 (10%)
 Frame = +1

Query  31   MVAGKSPEPLPAGW-SEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  207
            + A  +P+ LP+GW S+   +K GR+ K YTN    KK Y+K  V+ Y+K++   R +  
Sbjct  9    ITADTTPDWLPSGWISQSTSLKRGRQTKTYTNVITKKKLYTKDQVLEYIKME-KIREKRL  67

Query  208  AIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYID-P  384
            +  +R   + +   +S  S TA    + P WLP GW +E  TR+ G   G  Y  Y++  
Sbjct  68   SAIERTKANVQAVEDSVDSSTAR---ERPSWLPDGWKME--TRI-GRYGGNQYTIYVNMS  121

Query  385  FGRRFYSKPEVSRHLKTMNCNGPIGVGEEKKSNIEEPSCNKVSQN  519
             G +   K +V  +  TM     +        N+EE   + +S++
Sbjct  122  SGFKTSLKHKVLEYEDTMESEASL-------ENVEETGIDYISED  159



>ref|XP_009345985.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like 
[Pyrus x bretschneideri]
Length=234

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 44/84 (52%), Gaps = 10/84 (12%)
 Frame = +1

Query  265  KTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF-GRRFYSKPEVSRHLKTMN  441
            K  A  D    WLP GW+V+EK R SG + G T   YIDP  GRRF SK EV R L+T  
Sbjct  89   KRKAFTDSMESWLPQGWSVQEKVRSSGATAGSTDRYYIDPVSGRRFRSKIEVLRFLET--  146

Query  442  CNGPIGVGEEKKSNIEEPSCNKVS  513
                   G  KK+  E  S +K S
Sbjct  147  -------GTTKKAKTENASLDKTS  163



>ref|XP_009345984.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like 
[Pyrus x bretschneideri]
Length=234

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 44/84 (52%), Gaps = 10/84 (12%)
 Frame = +1

Query  265  KTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF-GRRFYSKPEVSRHLKTMN  441
            K  A  D    WLP GW+V+EK R SG + G T   YIDP  GRRF SK EV R L+T  
Sbjct  89   KRKAFTDSMESWLPQGWSVQEKVRSSGATAGSTDRYYIDPVSGRRFRSKIEVLRFLET--  146

Query  442  CNGPIGVGEEKKSNIEEPSCNKVS  513
                   G  KK+  E  S +K S
Sbjct  147  -------GTTKKAKTENASLDKTS  163



>ref|XP_009595657.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 [Nicotiana 
tomentosiformis]
Length=541

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 57/199 (29%), Positives = 93/199 (47%), Gaps = 28/199 (14%)
 Frame = +1

Query  49   PEPLPAGWSEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRAIAQRET  228
            P+ LPAGW   V+ + G+K K+Y++   G KF SK DV+ Y+   G++  ++ +  + E 
Sbjct  8    PDWLPAGW--KVEFRKGKKEKWYSDPSKGLKFCSKADVLHYLSSVGSNCFKSSSTKEIEK  65

Query  229  RHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF-GRRFYS  405
            + + +    +++          E LPPGW  E + R  G    +    Y DP  G  F S
Sbjct  66   KDTGKVVTEKATS---------EGLPPGWIKEVRVRRKGHKIKKDPY-YTDPVSGHTFRS  115

Query  406  KPEVSRHLKTM-----------NCNGPIGVGEEKKSNIEEPSCNKVSQNEKATGGQSHTS  552
              EVSR L+T             C G   +G E  S +   +    S +  A+G + +++
Sbjct  116  MKEVSRFLETRESGRFESKSRDQCPGTSELG-EPFSTLTAEADKHTSLDSDASGKEVNSN  174

Query  553  RKLRSG---MGKQPSDIGS  600
            +KL+ G   MG     +GS
Sbjct  175  QKLKLGAEHMGHSSCVVGS  193



>ref|XP_009353664.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like 
[Pyrus x bretschneideri]
Length=231

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 44/84 (52%), Gaps = 10/84 (12%)
 Frame = +1

Query  265  KTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF-GRRFYSKPEVSRHLKTMN  441
            K  A  D    WLP GW+V+EK R SG + G T   YIDP  GRRF SK EV R L+T  
Sbjct  86   KRKAFTDSMESWLPQGWSVQEKVRSSGATAGSTDRYYIDPVSGRRFRSKIEVLRFLET--  143

Query  442  CNGPIGVGEEKKSNIEEPSCNKVS  513
                   G  KK+  E  S +K S
Sbjct  144  -------GTIKKAKTENASVDKTS  160



>ref|XP_011084407.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
[Sesamum indicum]
Length=523

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 68/139 (49%), Gaps = 23/139 (17%)
 Frame = +1

Query  34   VAGKSPEPLPAGWSEHVKVKN-GRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRA  210
            + G+ P  LP  W   VK ++ GRK KYY N  NG KF SK +V+ Y+K    + G+++ 
Sbjct  1    MGGEHPAWLPVDWKVCVKNRSFGRKDKYYINPLNGLKFNSKLEVLRYLK----NAGKDQK  56

Query  211  IAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKT-RMSGVSHGQTYMCYIDPF  387
            + Q               KT A      E LPPGW  E +T R  G +    Y  YIDP 
Sbjct  57   LKQL--------NEIGIKKTVA------EKLPPGWIKEIRTKRKGGKTRRDPY--YIDPV  100

Query  388  -GRRFYSKPEVSRHLKTMN  441
             GR F S  EV R L++ +
Sbjct  101  SGRHFRSMQEVFRFLESTD  119



>ref|XP_002276814.3| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X4 [Vitis vinifera]
Length=462

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 65/135 (48%), Gaps = 17/135 (13%)
 Frame = +1

Query  46   SPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMK-IKGNSRGQNRAIAQ  219
            SP+ +P GW+  VK+ KNGR VK Y +   G +FYSK DV  Y+K IK NS         
Sbjct  5    SPDWIPEGWTVQVKLAKNGRNVKCYLDPSTGYRFYSKPDVFRYLKTIKHNSCT-------  57

Query  220  RETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRM--SGVSHGQTYMCYIDPF-G  390
              +R  +      S         + + LP GW  E K RM  +G+        Y DP  G
Sbjct  58   --SRQKKVGPGMPSLGKVVIERSTADGLPAGWIKEIKIRMNENGIRRDPY---YTDPVSG  112

Query  391  RRFYSKPEVSRHLKT  435
              F S+ +V R+LKT
Sbjct  113  YVFRSRKDVFRYLKT  127


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 5/56 (9%)
 Frame = +1

Query  283  DKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDP-FGRRFYSKPEVSRHLKTMNCN  447
            + SP+W+P GWTV+ K       +G+   CY+DP  G RFYSKP+V R+LKT+  N
Sbjct  3    ENSPDWIPEGWTVQVKL----AKNGRNVKCYLDPSTGYRFYSKPDVFRYLKTIKHN  54



>gb|KHN35006.1| hypothetical protein glysoja_004772 [Glycine soja]
Length=188

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 40/80 (50%), Gaps = 28/80 (35%)
 Frame = +1

Query  292  PEWLPPGWTVEEKTRMSG--VSHGQT------------YM--------------CYIDPF  387
            PEWLP  W V+ +TR SG  + HGQ+            +M              CYI P 
Sbjct  32   PEWLPDDWNVDFRTRKSGANMGHGQSKGPLAKCSILRLFMAGTSQGHPQICIEYCYIAPS  91

Query  388  GRRFYSKPEVSRHLKTMNCN  447
            G +FYSKPEV R+L T+N N
Sbjct  92   GHKFYSKPEVLRYLDTVNIN  111



>ref|XP_006353332.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006353333.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Solanum tuberosum]
Length=594

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 90/187 (48%), Gaps = 24/187 (13%)
 Frame = +1

Query  49   PEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRAIAQRE  225
            P  +P GW   V+  K G+K K+Y +   G KF SK DV+ Y+    ++  ++    + E
Sbjct  8    PNWVPNGWKVEVRTRKKGKKEKWYIDPSKGLKFCSKADVLHYLSSVDSNCSKSSNTKEME  67

Query  226  TRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF-GRRFY  402
             + +E+     + KTA+      E LPPGW  E K R  G    +    YIDP  G+ F 
Sbjct  68   KKGTEK---CFTEKTAS------EGLPPGWIKELKVRRKGRKIRKDPY-YIDPVSGQTFR  117

Query  403  SKPEVSRHLKTMN-----------CNGPIGVGEEKKSNIEEPSCNKVSQNEKATGGQSHT  549
            S  +VSR L+T             C   + + EE  S+    +  ++S +  A+G + ++
Sbjct  118  SMKQVSRFLETREPGRFESTPDNRCPDTVKL-EEPSSSFPAEADKQMSLDSDASGKEVNS  176

Query  550  SRKLRSG  570
            ++KL+ G
Sbjct  177  NQKLKLG  183



>ref|XP_004234378.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X1 [Solanum lycopersicum]
Length=587

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 62/130 (48%), Gaps = 11/130 (8%)
 Frame = +1

Query  49   PEPLPAGWSEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRAIAQRET  228
            P  +P GW   V+ + G+K K+Y +   G KF SK DV+ Y+    +S   N + +    
Sbjct  8    PNWVPDGWKVEVRTRKGKKEKWYIDPSKGLKFCSKADVLHYL----SSVDSNCSKSSNTK  63

Query  229  RHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF-GRRFYS  405
                + TN    +  A+     E LPPGW  E K R  G    +    YIDP  G+ F S
Sbjct  64   EMENKGTNKCFIEKTAS-----EGLPPGWIKELKVRKKGRKIRKDPY-YIDPVSGQTFRS  117

Query  406  KPEVSRHLKT  435
              +VSR L+T
Sbjct  118  LKQVSRFLET  127



>gb|KJB39638.1| hypothetical protein B456_007G022700 [Gossypium raimondii]
Length=880

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 63/139 (45%), Gaps = 42/139 (30%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQ--  201
            M    SP+ LPAGW++  +  K GR++ +Y N   G+KF++K D+I Y K +  +  +  
Sbjct  1    MTEETSPDWLPAGWTQEFRFQKTGRRITHYVNLATGQKFFTKDDLIRYTKTETKTESKQY  60

Query  202  -NRAIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYI  378
             +R +  ++   ++ +TNSQ +                                    Y+
Sbjct  61   DDRLLTLKQI--TKPSTNSQVN-----------------------------------IYV  83

Query  379  DP-FGRRFYSKPEVSRHLK  432
            DP  G RFYSKP V R LK
Sbjct  84   DPSTGLRFYSKPAVFRFLK  102



>emb|CBI31785.3| unnamed protein product [Vitis vinifera]
Length=560

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 33/54 (61%), Gaps = 5/54 (9%)
 Frame = +1

Query  289  SPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF-GRRFYSKPEVSRHLKTMNCN  447
            S +WLPPGW VE    M   S G+ Y CYI P  G +FYSKPEVSR+L     N
Sbjct  6    SDDWLPPGWKVE----MKLTSTGRKYKCYIHPSRGLKFYSKPEVSRYLNKAPLN  55



>ref|XP_009390529.1| PREDICTED: uncharacterized protein LOC103976890 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=569

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 45/80 (56%), Gaps = 6/80 (8%)
 Frame = +1

Query  289  SPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDP-FGRRFYSKPEVSRHLKTMNCNGPIGVG  465
            SP+WLP GW +E +T+ +G   G+   CY +P  G RFYSK +V RHL       P  + 
Sbjct  32   SPDWLPSGWVLETRTQKNGAYAGREIKCYYNPSTGSRFYSKKQVFRHLNARKDFSPT-IR  90

Query  466  EEK---KSNIEEPSCNKVSQ  516
            E +    SN+++P C   SQ
Sbjct  91   ETRSITSSNMKKP-CTSTSQ  109



>ref|XP_010662494.1| PREDICTED: uncharacterized protein LOC100263513 isoform X1 [Vitis 
vinifera]
Length=637

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 33/54 (61%), Gaps = 5/54 (9%)
 Frame = +1

Query  289  SPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF-GRRFYSKPEVSRHLKTMNCN  447
            S +WLPPGW VE    M   S G+ Y CYI P  G +FYSKPEVSR+L     N
Sbjct  6    SDDWLPPGWKVE----MKLTSTGRKYKCYIHPSRGLKFYSKPEVSRYLNKAPLN  55



>ref|XP_009390518.1| PREDICTED: uncharacterized protein LOC103976890 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=589

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 45/80 (56%), Gaps = 6/80 (8%)
 Frame = +1

Query  289  SPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDP-FGRRFYSKPEVSRHLKTMNCNGPIGVG  465
            SP+WLP GW +E +T+ +G   G+   CY +P  G RFYSK +V RHL       P  + 
Sbjct  32   SPDWLPSGWVLETRTQKNGAYAGREIKCYYNPSTGSRFYSKKQVFRHLNARKDFSPT-IR  90

Query  466  EEK---KSNIEEPSCNKVSQ  516
            E +    SN+++P C   SQ
Sbjct  91   ETRSITSSNMKKP-CTSTSQ  109



>ref|XP_009390512.1| PREDICTED: uncharacterized protein LOC103976890 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=593

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 45/80 (56%), Gaps = 6/80 (8%)
 Frame = +1

Query  289  SPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDP-FGRRFYSKPEVSRHLKTMNCNGPIGVG  465
            SP+WLP GW +E +T+ +G   G+   CY +P  G RFYSK +V RHL       P  + 
Sbjct  32   SPDWLPSGWVLETRTQKNGAYAGREIKCYYNPSTGSRFYSKKQVFRHLNARKDFSPT-IR  90

Query  466  EEK---KSNIEEPSCNKVSQ  516
            E +    SN+++P C   SQ
Sbjct  91   ETRSITSSNMKKP-CTSTSQ  109



>ref|XP_010255469.1| PREDICTED: uncharacterized protein LOC104596134 isoform X3 [Nelumbo 
nucifera]
Length=543

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 74/167 (44%), Gaps = 26/167 (16%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  207
            M A KSP+ LP GW   VKV K G+K KYY +   G+KF SK  V+ Y++   +      
Sbjct  1    MAAEKSPDWLPDGWVMDVKVRKTGQKDKYYIHLKTGRKFRSKDGVLRYIETGESHNCMPL  60

Query  208  AIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF  387
             I        ER  N+ SS      DK      P     +K   +  S  +   CYI P 
Sbjct  61   QI--------ERQANTCSS------DKD----VPNTCSSDKDMPNTCSRDKDMPCYIAPI  102

Query  388  -GRRFYSKPEVSRHLKTMNCNGPIGVGEEKKSNIEEPSCNKVSQNEK  525
             G R YSK +V R+L+    N       EK     + +C+ V ++ K
Sbjct  103  TGCRLYSKRDVYRYLRYYASN------LEKDGTEMQSACDAVVKDAK  143



>ref|XP_008378256.1| PREDICTED: uncharacterized protein LOC103441353 [Malus domestica]
Length=863

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 68/137 (50%), Gaps = 14/137 (10%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  207
            M    S E LPAGW+  VKV KNGR+ KYY  + +G +F S+ +V  Y+     SR   +
Sbjct  169  MADQNSEEWLPAGWTVEVKVRKNGRRDKYYYESSSGHRFSSRAEVSRYLSTSKTSREDKQ  228

Query  208  AIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEK-TRMSGVSHGQTYMCYIDP  384
             I +   R S+   +    KT A      E LPPGW  E + T+ +      T+  YI P
Sbjct  229  KIEETLKRPSD---DVVVEKTVA------ERLPPGWIKEIRMTKKARKIRRDTH--YIAP  277

Query  385  FGRR-FYSKPEVSRHLK  432
               + F S  +V R+L+
Sbjct  278  VSEKVFRSLRDVHRYLE  294



>ref|XP_006369523.1| hypothetical protein POPTR_0001s24690g [Populus trichocarpa]
 gb|ERP66092.1| hypothetical protein POPTR_0001s24690g [Populus trichocarpa]
Length=162

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 40/71 (56%), Gaps = 3/71 (4%)
 Frame = +1

Query  298  WLPPGWTVEEKTRMSGVSHGQTYMCYIDPF-GRRFYSKPEVSRHLK--TMNCNGPIGVGE  468
            WLPPGW VE++ R SG + G     YI+P  GRRF SK +V  +L+  T+   G +    
Sbjct  73   WLPPGWVVEDRVRTSGATAGTRDKYYIEPVSGRRFRSKKDVQYYLETGTLKKRGKVAENV  132

Query  469  EKKSNIEEPSC  501
            +  +N+ + S 
Sbjct  133  DADTNVRKKSL  143



>ref|XP_006369524.1| hypothetical protein POPTR_0001s24690g [Populus trichocarpa]
 gb|ERP66093.1| hypothetical protein POPTR_0001s24690g [Populus trichocarpa]
Length=167

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 1/47 (2%)
 Frame = +1

Query  298  WLPPGWTVEEKTRMSGVSHGQTYMCYIDPF-GRRFYSKPEVSRHLKT  435
            WLPPGW VE++ R SG + G     YI+P  GRRF SK +V  +L+T
Sbjct  73   WLPPGWVVEDRVRTSGATAGTRDKYYIEPVSGRRFRSKKDVQYYLET  119



>ref|XP_002314180.1| methyl-CpG-binding domain-containing family protein [Populus 
trichocarpa]
 gb|EEE88135.1| methyl-CpG-binding domain-containing family protein [Populus 
trichocarpa]
Length=214

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 1/47 (2%)
 Frame = +1

Query  298  WLPPGWTVEEKTRMSGVSHGQTYMCYIDPF-GRRFYSKPEVSRHLKT  435
            WLPPGW VE++ R SG + G     YIDP  GR+F SK +V  +L+T
Sbjct  73   WLPPGWVVEDRIRTSGATAGTVDKYYIDPASGRKFRSKKDVQYYLET  119



>emb|CAN74037.1| hypothetical protein VITISV_023406 [Vitis vinifera]
Length=730

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 33/54 (61%), Gaps = 5/54 (9%)
 Frame = +1

Query  289  SPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF-GRRFYSKPEVSRHLKTMNCN  447
            S +WLPPGW VE    M   S G+ Y CYI P  G +FYSKPEVSR+L     N
Sbjct  6    SDDWLPPGWKVE----MKLTSTGRKYKCYIHPSRGLKFYSKPEVSRYLNKAPLN  55



>ref|XP_005196854.1| PREDICTED: methyl-CpG-binding domain protein 2-like [Bos taurus]
Length=149

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW +EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  6    LPPGWKIEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  48



>ref|XP_008223622.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like 
[Prunus mume]
Length=244

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 50/99 (51%), Gaps = 17/99 (17%)
 Frame = +1

Query  190  SRGQNRAIAQRETRHSERNTNSQSSKTAA---NPDKSP-------------EWLPPGWTV  321
            S GQN   AQ+  R  E++  ++ + + +   NPD                 WLP GW+V
Sbjct  55   SNGQNVKEAQKPRRAPEQSKCAEPATSGSGMENPDGGAGRVKRKGFVEPLENWLPQGWSV  114

Query  322  EEKTRMSGVSHGQTYMCYIDPF-GRRFYSKPEVSRHLKT  435
            EE+ R SG + G T   Y+DP  GRRF SK EV   L+T
Sbjct  115  EERVRASGATAGSTDRYYVDPVSGRRFRSKVEVLYFLET  153



>ref|XP_011042705.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like 
[Populus euphratica]
Length=214

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 1/47 (2%)
 Frame = +1

Query  298  WLPPGWTVEEKTRMSGVSHGQTYMCYIDPF-GRRFYSKPEVSRHLKT  435
            WLPPGW VE++ R SG + G     YIDP  GR+F SK +V  +L+T
Sbjct  73   WLPPGWVVEDRIRTSGATAGTVDKYYIDPASGRKFRSKKDVQYYLET  119



>emb|CBI16126.3| unnamed protein product [Vitis vinifera]
Length=177

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = +1

Query  283  DKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHLKT  435
            D+ P WLPP W VE++TR+ G   G     ++DP G RF SK +V   L+T
Sbjct  65   DERPSWLPPDWHVEKETRLQGKKAGYLDSFFVDPMGNRFRSKKKVLSFLQT  115



>ref|XP_008234128.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X1 [Prunus mume]
Length=547

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 85/186 (46%), Gaps = 30/186 (16%)
 Frame = +1

Query  31   MVAGKSPEPLPAGWSEHVKVKN-GRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  207
            M   KS + LP GW+  VKV+N G++ KYY ++ +G KF SK +V  Y+    N+   + 
Sbjct  1    MTDQKSEDWLPTGWTVEVKVRNNGKRDKYYYDSASGHKFNSKAEVSRYL----NTSQISD  56

Query  208  AIAQRETRHSERNTNS-QSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHG---QTYMCY  375
             + Q+     +R+ N     KT A        LP GW  E   RM+   H     +Y  Y
Sbjct  57   EVKQKVEETLKRSANDVVVEKTIAG------GLPQGWIKE--IRMTKKDHKIRRDSY--Y  106

Query  376  IDPFGRR-FYSKPEVSRHLKTMNCNGPIGVGEEKKSNIEEPSCNKVSQNEKATGGQSHTS  552
            IDP   + F S  +V+R+L+           E+ +  I EPS     + E      SH +
Sbjct  107  IDPVSEKLFRSMKDVNRYLEN----------EKPRRLILEPSHGSHKELEDEKASSSHLN  156

Query  553  RKLRSG  570
              ++ G
Sbjct  157  EIMKDG  162



>ref|XP_002299872.1| methyl-CpG-binding domain-containing family protein [Populus 
trichocarpa]
 gb|ABK93437.1| unknown [Populus trichocarpa]
 gb|EEE84677.1| methyl-CpG-binding domain-containing family protein [Populus 
trichocarpa]
Length=214

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 41/76 (54%), Gaps = 1/76 (1%)
 Frame = +1

Query  298  WLPPGWTVEEKTRMSGVSHGQTYMCYIDPF-GRRFYSKPEVSRHLKTMNCNGPIGVGEEK  474
            WLPPGW VE++ R SG + G     YI+P  GRRF SK +V  +L+T        V E  
Sbjct  73   WLPPGWVVEDRVRTSGATAGTRDKYYIEPVSGRRFRSKKDVQYYLETGTLKKRGKVAENV  132

Query  475  KSNIEEPSCNKVSQNE  522
             ++      +K S+N+
Sbjct  133  DADTNSAENSKSSKNK  148



>ref|XP_002532846.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF29524.1| DNA binding protein, putative [Ricinus communis]
Length=234

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 31/50 (62%), Gaps = 1/50 (2%)
 Frame = +1

Query  289  SPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF-GRRFYSKPEVSRHLKT  435
            S  WLPPGW VE++ R SG + G     YI+P  GRRF SK EV   L+T
Sbjct  96   SANWLPPGWLVEDRVRASGATAGTVDKYYIEPVTGRRFRSKKEVQYFLET  145



>emb|CDX80274.1| BnaC09g34680D [Brassica napus]
Length=549

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 43/86 (50%), Gaps = 3/86 (3%)
 Frame = +1

Query  178  IKGNSRGQNRAIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHG  357
            I+G  R  N        R    N   Q+ K AA  D +  WLPPGW VE+K R SG + G
Sbjct  358  IQGRKRRSNWLRGSESVRIGMSNGTEQTRKRAAPGDSN--WLPPGWRVEDKVRTSGATAG  415

Query  358  QTYMCYIDPF-GRRFYSKPEVSRHLK  432
                 Y +P  GR+F S+ EV  +L+
Sbjct  416  SVDKYYYEPITGRKFRSRTEVLYYLE  441



>ref|XP_002283682.1| PREDICTED: uncharacterized protein LOC100243225 [Vitis vinifera]
Length=207

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = +1

Query  283  DKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHLKT  435
            D+ P WLPP W VE++TR+ G   G     ++DP G RF SK +V   L+T
Sbjct  95   DERPSWLPPDWHVEKETRLQGKKAGYLDSFFVDPMGNRFRSKKKVLSFLQT  145



>gb|EEE60561.1| hypothetical protein OsJ_13923 [Oryza sativa Japonica Group]
Length=325

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 61/136 (45%), Gaps = 20/136 (15%)
 Frame = +1

Query  49   PEPLPAGWSEHV-KVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRAIAQRE  225
            P  LP GW   V +  NG   +YY    +G  F  K +V+ Y+             ++ +
Sbjct  39   PGWLPDGWIMEVYRGDNGTIYQYYICPVSGSTFTMKSEVLHYL------------FSEMD  86

Query  226  TRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPFGR-RFY  402
             R  E    S++     N  ++ EWLP GW VE   R  G +  + Y  Y+ P  R R Y
Sbjct  87   QRFME----SKNCAVGCNLMRTHEWLPKGWLVE--IRAGGDNMDKMYKFYVYPPHRVRLY  140

Query  403  SKPEVSRHLKTMNCNG  450
            SK +V  ++K M  +G
Sbjct  141  SKDDVLLYIKEMKISG  156



>gb|EAZ29862.1| hypothetical protein OsJ_13921 [Oryza sativa Japonica Group]
Length=411

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 38/136 (28%), Positives = 61/136 (45%), Gaps = 20/136 (15%)
 Frame = +1

Query  49   PEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRAIAQRE  225
            P  LP GW   V +  +G   +YY    +G+ F  K +V+ Y+                 
Sbjct  39   PGWLPDGWIMEVYLGDDGTIYRYYICPVSGRTFTMKSEVLHYLF----------------  82

Query  226  TRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPFGR-RFY  402
            +   +  T S++    +N  ++ EWLP GW VE   R  G +  + Y  Y+ P  R R +
Sbjct  83   SEMDQCFTESKNRAVGSNLTRTHEWLPKGWLVE--IRAGGDNMDKMYKFYVYPPNRVRLF  140

Query  403  SKPEVSRHLKTMNCNG  450
            SK +V  ++K M  +G
Sbjct  141  SKDDVLLYIKEMKISG  156



>emb|CDY59223.1| BnaCnng34510D [Brassica napus]
Length=229

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 47/82 (57%), Gaps = 4/82 (5%)
 Frame = +1

Query  193  RGQNRAIAQRE-TRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYM  369
            +G + AI   +    S  N+ S+S K +A  D S  WLPPGW VE+K R SG + G    
Sbjct  53   QGGSEAIGMSDQVNPSPANSESKSRKRSAPLDNS--WLPPGWRVEDKVRASGATAGSVDK  110

Query  370  CYIDPF-GRRFYSKPEVSRHLK  432
             Y++P  GR+F S+ EV  +L+
Sbjct  111  YYLEPITGRKFRSRTEVLYYLE  132



>emb|CDY48687.1| BnaC02g09990D [Brassica napus]
Length=229

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 47/82 (57%), Gaps = 4/82 (5%)
 Frame = +1

Query  193  RGQNRAIAQRE-TRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYM  369
            +G + AI   +    S  N+ S+S K +A  D S  WLPPGW VE+K R SG + G    
Sbjct  53   QGGSEAIGMSDQVNPSPANSESKSRKRSAPLDNS--WLPPGWRVEDKVRASGATAGSVDK  110

Query  370  CYIDPF-GRRFYSKPEVSRHLK  432
             Y++P  GR+F S+ EV  +L+
Sbjct  111  YYLEPITGRKFRSRTEVLYYLE  132



>ref|XP_009371320.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X2 [Pyrus x bretschneideri]
Length=572

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 79/159 (50%), Gaps = 23/159 (14%)
 Frame = +1

Query  58   LPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRAIAQRETRH  234
            LP GW+  VK  KNGR+ KYY  + +G +F S+ +V  Y+    +S    + I +   R 
Sbjct  10   LPTGWTVEVKFRKNGRRDKYYYESSSGHRFSSRAEVSRYLST--SSHEDEQKIKETLKRP  67

Query  235  SERNTNSQSSKTAANPDKSPEWLPPGWTVEEK-TRMSGVSHGQTYMCYIDPFGRR-FYSK  408
            S+   +    KT A      E LPPGWT E + T+ +  +   T+  YI P   + F S 
Sbjct  68   SD---DIVVEKTVA------EGLPPGWTKEIRITKKARKTRRDTH--YIAPVSEKVFCSI  116

Query  409  PEVSRHLK-------TMNCNGPIGVGEEKKSNIEEPSCN  504
             +V R+L+        +  +G   + +EK S +++PS N
Sbjct  117  RDVHRYLENEEPGRLILELSGDKELEDEKASELDKPSLN  155



>ref|XP_009371318.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X1 [Pyrus x bretschneideri]
Length=697

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 79/159 (50%), Gaps = 23/159 (14%)
 Frame = +1

Query  58   LPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRAIAQRETRH  234
            LP GW+  VK  KNGR+ KYY  + +G +F S+ +V  Y+    +S    + I +   R 
Sbjct  10   LPTGWTVEVKFRKNGRRDKYYYESSSGHRFSSRAEVSRYLST--SSHEDEQKIKETLKRP  67

Query  235  SERNTNSQSSKTAANPDKSPEWLPPGWTVEEK-TRMSGVSHGQTYMCYIDPFGRR-FYSK  408
            S+   +    KT A      E LPPGWT E + T+ +  +   T+  YI P   + F S 
Sbjct  68   SD---DIVVEKTVA------EGLPPGWTKEIRITKKARKTRRDTH--YIAPVSEKVFCSI  116

Query  409  PEVSRHLK-------TMNCNGPIGVGEEKKSNIEEPSCN  504
             +V R+L+        +  +G   + +EK S +++PS N
Sbjct  117  RDVHRYLENEEPGRLILELSGDKELEDEKASELDKPSLN  155



>gb|KCW52682.1| hypothetical protein EUGRSUZ_J02050 [Eucalyptus grandis]
Length=237

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 50/102 (49%), Gaps = 9/102 (9%)
 Frame = +1

Query  286  KSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRR-FYSKPEVSRHLKTMNCNGPIGV  462
            ++P+WLP GW VE++ R SGV+ G     Y DP   R F SK EV   L+T       G 
Sbjct  131  ETPDWLPAGWYVEDRVRTSGVTAGTRDKYYCDPVSHRVFRSKKEVLYFLET-------GF  183

Query  463  GEEKKSNIEEPSCNKVSQNEKATGGQSHTSRKLRSGMGKQPS  588
              +KK  +E    N  + N  AT  ++  ++  R    + PS
Sbjct  184  SRKKK-KMENADANNDAGNSNATKARALEAKNRRKQAERHPS  224



>pdb|2KY8|A Chain A, Solution Structure And Dynamic Analysis Of Chicken Mbd2 
Methyl Binding Domain Bound To A Target Methylated Dna Sequence
Length=72

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  13   LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  55



>emb|CDY53445.1| BnaA02g07070D [Brassica napus]
Length=229

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 43/81 (53%), Gaps = 3/81 (4%)
 Frame = +1

Query  193  RGQNRAIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMC  372
            RG        +   S  N+ S+S K +A  D S  WLPPGW VE+K R SG   G     
Sbjct  54   RGSEAIGMSDQVNPSPDNSGSKSRKRSAPLDNS--WLPPGWRVEDKVRASGAKAGSVDKY  111

Query  373  YIDPF-GRRFYSKPEVSRHLK  432
            Y++P  GR+F S+ EV  +L+
Sbjct  112  YLEPITGRKFRSRTEVLYYLE  132



>emb|CAE04540.2| OSJNBa0040D17.8 [Oryza sativa Japonica Group]
Length=377

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 37/133 (28%), Positives = 60/133 (45%), Gaps = 20/133 (15%)
 Frame = +1

Query  58   LPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRAIAQRETRH  234
            LP GW   V +  +G   +YY    +G+ F  K +V+ Y+                 +  
Sbjct  8    LPDGWIMEVYLGDDGTIYRYYICPVSGRTFTMKSEVLHYLF----------------SEM  51

Query  235  SERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPFGR-RFYSKP  411
             +  T S++    +N  ++ EWLP GW VE   R  G +  + Y  Y+ P  R R +SK 
Sbjct  52   DQCFTESKNRAVGSNLTRTHEWLPKGWLVE--IRAGGDNMDKMYKFYVYPPNRVRLFSKD  109

Query  412  EVSRHLKTMNCNG  450
            +V  ++K M  +G
Sbjct  110  DVLLYIKEMKISG  122



>ref|XP_010866106.1| PREDICTED: methyl-CpG-binding domain protein 2-like isoform X1 
[Esox lucius]
Length=269

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +1

Query  298  WLPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            +LPPGW  EE  R SG+S G++ + Y  P G++F SKP++SR+L
Sbjct  12   FLPPGWKKEEVIRKSGLSAGKSDVYYYSPTGKKFRSKPQLSRYL  55



>ref|XP_010866107.1| PREDICTED: methyl-CpG-binding domain protein 2-like isoform X2 
[Esox lucius]
Length=265

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +1

Query  298  WLPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            +LPPGW  EE  R SG+S G++ + Y  P G++F SKP++SR+L
Sbjct  12   FLPPGWKKEEVIRKSGLSAGKSDVYYYSPTGKKFRSKPQLSRYL  55



>gb|KGN65724.1| hypothetical protein Csa_1G522010 [Cucumis sativus]
Length=278

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 44/87 (51%), Gaps = 9/87 (10%)
 Frame = +1

Query  292  PEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPFG-RRFYSKPEVSRHLKTMNCNGPIGVGE  468
            P WLPPGW VE++ R SG + G     Y DP   RRF SK EV   L+T       G   
Sbjct  141  PNWLPPGWVVEDRVRSSGATAGTVDKYYFDPVSNRRFRSKIEVLYFLET-------GTLR  193

Query  469  EKKSNIE-EPSCNKVSQNEKATGGQSH  546
            ++K +++  PS   VS+  K     S+
Sbjct  194  KRKKSLDGNPSSTDVSEEPKGKKSSSN  220



>emb|CBI16127.3| unnamed protein product [Vitis vinifera]
Length=135

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = +1

Query  295  EWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF-GRRFYSKPEVSRHLKT  435
            +WLPPGW VE + R SG S G     +I+P  GRRF SK EV  +L+T
Sbjct  8    DWLPPGWIVEGRVRSSGASAGSRDKYFIEPITGRRFRSKKEVRYYLET  55



>emb|CAN80675.1| hypothetical protein VITISV_003810 [Vitis vinifera]
Length=319

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = +1

Query  283  DKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHLKT  435
            D+ P WLPP W VE++TR+ G   G     ++DP G RF SK +V   L+T
Sbjct  207  DERPSWLPPDWHVEKETRLQGKKAGYLDSFFVDPMGNRFRSKKKVLSFLQT  257



>ref|XP_010033125.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like 
[Eucalyptus grandis]
 gb|KCW52681.1| hypothetical protein EUGRSUZ_J02050 [Eucalyptus grandis]
Length=282

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 46/90 (51%), Gaps = 9/90 (10%)
 Frame = +1

Query  286  KSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRR-FYSKPEVSRHLKTMNCNGPIGV  462
            ++P+WLP GW VE++ R SGV+ G     Y DP   R F SK EV   L+T       G 
Sbjct  131  ETPDWLPAGWYVEDRVRTSGVTAGTRDKYYCDPVSHRVFRSKKEVLYFLET-------GF  183

Query  463  GEEKKSNIEEPSCNKVSQNEKATGGQSHTS  552
              +KK  +E    N  + N  AT  Q+ +S
Sbjct  184  SRKKK-KMENADANNDAGNSNATKAQAESS  212



>gb|KDP34493.1| hypothetical protein JCGZ_11043 [Jatropha curcas]
Length=237

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 33/51 (65%), Gaps = 1/51 (2%)
 Frame = +1

Query  286  KSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDP-FGRRFYSKPEVSRHLKT  435
            +S  WLPPGW VE++ R SG + G     YI+P  GR+F SK EV  +L+T
Sbjct  98   ESASWLPPGWLVEDRVRTSGATAGTVDKYYIEPTTGRKFRSKREVQYYLET  148



>ref|XP_007038658.1| Methyl-CPG-binding domain protein 13, putative isoform 1 [Theobroma 
cacao]
 gb|EOY23159.1| Methyl-CPG-binding domain protein 13, putative isoform 1 [Theobroma 
cacao]
Length=625

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 29/51 (57%), Gaps = 1/51 (2%)
 Frame = +1

Query  295  EWLPPGWTVEEKTRMSGVSHGQTYMCYIDPFGR-RFYSKPEVSRHLKTMNC  444
            +WLPPGW VE + R +G       MCY  P G  RF S+ EVSR+L    C
Sbjct  8    DWLPPGWKVEVRQRRNGKKDKLRVMCYYAPCGELRFISRAEVSRYLDKCGC  58



>gb|AFW57954.1| methyl-binding domain MBD113 protein [Zea mays]
Length=485

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 57/132 (43%), Gaps = 23/132 (17%)
 Frame = +1

Query  37   AGKSPEP---LPAGWSEHV-KVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQN  204
            +G   EP   LP GW+  V +  NG   KYYT+  +G  F SK + + Y+          
Sbjct  73   SGSLDEPPGWLPDGWTMEVCQEDNGSIYKYYTSPMSGYMFTSKMETLHYLF---------  123

Query  205  RAIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYID-  381
                   +   ER    Q+S       +S  WLP GW +E   R  G    + Y  Y+  
Sbjct  124  -------SGVEERMLELQASAEDNELHESHTWLPRGWVIE--VRAGGKKMDKMYKFYVHL  174

Query  382  PFGRRFYSKPEV  417
            P G+RF SK EV
Sbjct  175  PTGQRFLSKAEV  186



>ref|XP_003632148.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like 
[Vitis vinifera]
Length=297

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = +1

Query  295  EWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF-GRRFYSKPEVSRHLKT  435
            +WLPPGW VE + R SG S G     +I+P  GRRF SK EV  +L+T
Sbjct  170  DWLPPGWIVEGRVRSSGASAGSRDKYFIEPITGRRFRSKKEVRYYLET  217



>ref|XP_009126698.1| PREDICTED: methyl-CpG-binding domain-containing protein 6-like 
[Brassica rapa]
Length=229

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 40/67 (60%), Gaps = 3/67 (4%)
 Frame = +1

Query  235  SERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF-GRRFYSKP  411
            S  N+ S+S K +A  D S  WLPPGW VE+K R SG   G     Y++P  GR+F S+ 
Sbjct  68   SPDNSGSKSRKRSAPLDNS--WLPPGWRVEDKVRASGAKAGSVDKYYLEPITGRKFRSRT  125

Query  412  EVSRHLK  432
            EV  +L+
Sbjct  126  EVLYYLE  132



>ref|XP_008113313.1| PREDICTED: LOW QUALITY PROTEIN: methyl-CpG-binding domain protein 
2 [Anolis carolinensis]
Length=270

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  13   LPPGWKKEEVIRKSGLSAGKSDVYYFSPTGKKFRSKPQLARYL  55



>emb|CDQ84332.1| unnamed protein product [Oncorhynchus mykiss]
Length=271

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LP GW +EE TR SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  11   LPKGWQIEEVTRKSGLSAGKSDVYYYSPTGKKFRSKPQLARYL  53



>ref|XP_011015295.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like, 
partial [Populus euphratica]
Length=182

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 30/47 (64%), Gaps = 1/47 (2%)
 Frame = +1

Query  298  WLPPGWTVEEKTRMSGVSHGQTYMCYIDPF-GRRFYSKPEVSRHLKT  435
            WLPPGW VE++ R SG + G     Y +P  GRRF SK +V  +L+T
Sbjct  61   WLPPGWIVEDRVRSSGATAGTRDKYYFEPVSGRRFRSKKDVQYYLET  107



>ref|XP_008690446.1| PREDICTED: methyl-CpG-binding domain protein 2 [Ursus maritimus]
Length=263

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  6    LPPGWNKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  48



>gb|ERE82588.1| methyl-CpG-binding domain protein 2 [Cricetulus griseus]
Length=262

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  6    LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  48



>ref|XP_010581337.1| PREDICTED: methyl-CpG-binding domain protein 2 [Haliaeetus leucocephalus]
Length=269

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  12   LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  54



>gb|AGJ83088.1| methyl-CpG-binding domain protein 2/3 [Apostichopus japonicus]
Length=159

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LP GW  EE  R SG+S G+T + Y  P GR+F SKP+++R L
Sbjct  15   LPTGWKREEVIRKSGLSAGKTDIYYFSPCGRKFRSKPQLARFL  57



>ref|XP_007626931.1| PREDICTED: methyl-CpG-binding domain protein 2 isoform X2, partial 
[Cricetulus griseus]
Length=265

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  9    LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  51



>ref|XP_010869972.1| PREDICTED: methyl-CpG-binding domain protein 3-like isoform X3 
[Esox lucius]
Length=274

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LP GW +EE TR SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  11   LPKGWQMEEVTRKSGLSAGKSDVYYFSPTGKKFRSKPQLARYL  53



>ref|XP_006269717.1| PREDICTED: methyl-CpG-binding domain protein 2 [Alligator mississippiensis]
Length=269

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  12   LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  54



>ref|XP_008662320.1| PREDICTED: LOC542207 isoform X3 [Zea mays]
 gb|AFW57952.1| methyl-binding domain MBD113 protein isoform 1 [Zea mays]
 gb|AFW57953.1| methyl-binding domain MBD113 protein isoform 2 [Zea mays]
Length=491

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 57/132 (43%), Gaps = 23/132 (17%)
 Frame = +1

Query  37   AGKSPEP---LPAGWSEHV-KVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQN  204
            +G   EP   LP GW+  V +  NG   KYYT+  +G  F SK + + Y+   G      
Sbjct  79   SGSLDEPPGWLPDGWTMEVCQEDNGSIYKYYTSPMSGYMFTSKMETLHYL-FSGVE----  133

Query  205  RAIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYID-  381
                       ER    Q+S       +S  WLP GW +E   R  G    + Y  Y+  
Sbjct  134  -----------ERMLELQASAEDNELHESHTWLPRGWVIE--VRAGGKKMDKMYKFYVHL  180

Query  382  PFGRRFYSKPEV  417
            P G+RF SK EV
Sbjct  181  PTGQRFLSKAEV  192



>ref|XP_004422606.1| PREDICTED: methyl-CpG-binding domain protein 2 [Ceratotherium 
simum simum]
Length=262

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  6    LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  48



>ref|XP_011217316.1| PREDICTED: methyl-CpG-binding domain protein 2 [Ailuropoda melanoleuca]
Length=263

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  6    LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  48



>ref|XP_007434720.1| PREDICTED: methyl-CpG-binding domain protein 2, partial [Python 
bivittatus]
Length=226

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  12   LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  54



>emb|CDQ72293.1| unnamed protein product [Oncorhynchus mykiss]
Length=271

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LP GW +EE TR SG+S G+  + Y  P G++F SKP+++R+L
Sbjct  11   LPKGWQIEEVTRKSGLSAGKRDVYYFSPTGKKFRSKPQLARYL  53



>ref|XP_010959650.1| PREDICTED: methyl-CpG-binding domain protein 2 [Camelus bactrianus]
Length=262

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  6    LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  48



>ref|XP_008164256.1| PREDICTED: methyl-CpG-binding domain protein 2 [Chrysemys picta 
bellii]
Length=269

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  12   LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  54



>ref|XP_005323113.1| PREDICTED: methyl-CpG-binding domain protein 2 [Ictidomys tridecemlineatus]
Length=262

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  6    LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  48



>ref|XP_004616197.1| PREDICTED: methyl-CpG-binding domain protein 2 [Sorex araneus]
Length=262

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  6    LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  48



>ref|XP_005586721.1| PREDICTED: methyl-CpG-binding domain protein 2-like [Macaca fascicularis]
 ref|XP_003926168.2| PREDICTED: methyl-CpG-binding domain protein 2 [Saimiri boliviensis 
boliviensis]
Length=262

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  6    LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  48



>emb|CDY33033.1| BnaA10g12390D [Brassica napus]
Length=541

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 37/64 (58%), Gaps = 3/64 (5%)
 Frame = +1

Query  244  NTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPF-GRRFYSKPEVS  420
            N   Q+ K AA  D +  WLPPGW VE+K R SG + G     Y +P  GR+F SK EV 
Sbjct  373  NGTEQTRKRAAPGDSN--WLPPGWRVEDKVRTSGATAGSVDKYYYEPITGRKFRSKTEVL  430

Query  421  RHLK  432
             +L+
Sbjct  431  YYLE  434



>gb|ELK05599.1| Methyl-CpG-binding domain protein 2 [Pteropus alecto]
Length=262

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  6    LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  48



>ref|XP_006060281.1| PREDICTED: methyl-CpG-binding domain protein 2 [Bubalus bubalis]
Length=328

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  72   LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  114



>ref|XP_008275709.1| PREDICTED: methyl-CpG-binding domain protein 3-like isoform X1 
[Stegastes partitus]
Length=274

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LP GW +EE TR SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  11   LPKGWKMEEVTRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  53



>ref|XP_004552809.1| PREDICTED: methyl-CpG-binding domain protein 3-like isoform X2 
[Maylandia zebra]
 ref|XP_005478750.1| PREDICTED: methyl-CpG-binding domain protein 3-like isoform X2 
[Oreochromis niloticus]
 ref|XP_005727163.1| PREDICTED: methyl-CpG-binding domain protein 3-like isoform X2 
[Pundamilia nyererei]
 ref|XP_005932481.1| PREDICTED: methyl-CpG-binding domain protein 3-like isoform X2 
[Haplochromis burtoni]
 ref|XP_006790425.1| PREDICTED: methyl-CpG-binding domain protein 3-like isoform X1 
[Neolamprologus brichardi]
Length=274

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LP GW +EE TR SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  11   LPKGWKMEEVTRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  53



>ref|XP_010751459.1| PREDICTED: methyl-CpG-binding domain protein 2 isoform X7 [Larimichthys 
crocea]
Length=220

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP++SR+L
Sbjct  12   LPPGWKKEEVIRKSGLSAGKSDVYYYSPSGKKFRSKPQLSRYL  54



>ref|XP_010373660.1| PREDICTED: methyl-CpG-binding domain protein 2, partial [Rhinopithecus 
roxellana]
Length=277

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  21   LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  63



>ref|XP_010731400.1| PREDICTED: methyl-CpG-binding domain protein 3-like isoform X2 
[Larimichthys crocea]
Length=274

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LP GW +EE TR SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  11   LPKGWKMEEVTRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  53



>ref|XP_004826347.1| PREDICTED: methyl-CpG-binding domain protein 2-like, partial 
[Mustela putorius furo]
Length=284

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  27   LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  69



>ref|XP_008662316.1| PREDICTED: LOC542207 isoform X1 [Zea mays]
 ref|XP_008662317.1| PREDICTED: LOC542207 isoform X1 [Zea mays]
 ref|XP_008662318.1| PREDICTED: LOC542207 isoform X1 [Zea mays]
Length=506

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 57/132 (43%), Gaps = 23/132 (17%)
 Frame = +1

Query  37   AGKSPEP---LPAGWSEHV-KVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQN  204
            +G   EP   LP GW+  V +  NG   KYYT+  +G  F SK + + Y+   G      
Sbjct  94   SGSLDEPPGWLPDGWTMEVCQEDNGSIYKYYTSPMSGYMFTSKMETLHYL-FSGVE----  148

Query  205  RAIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTYMCYID-  381
                       ER    Q+S       +S  WLP GW +E   R  G    + Y  Y+  
Sbjct  149  -----------ERMLELQASAEDNELHESHTWLPRGWVIE--VRAGGKKMDKMYKFYVHL  195

Query  382  PFGRRFYSKPEV  417
            P G+RF SK EV
Sbjct  196  PTGQRFLSKAEV  207



>ref|XP_007121352.1| PREDICTED: methyl-CpG-binding domain protein 2, partial [Physeter 
catodon]
Length=283

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  27   LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  69



>ref|XP_007252124.1| PREDICTED: methyl-CpG-binding domain protein 2-like [Astyanax 
mexicanus]
Length=258

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP++SR+L
Sbjct  13   LPPGWKKEEVIRKSGLSAGKSDVYYYSPTGKKFRSKPQLSRYL  55



>ref|XP_010731391.1| PREDICTED: methyl-CpG-binding domain protein 3-like isoform X1 
[Larimichthys crocea]
Length=285

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LP GW +EE TR SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  22   LPKGWKMEEVTRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  64



>ref|XP_004067747.1| PREDICTED: methyl-CpG-binding domain protein 3-like isoform X1 
[Oryzias latipes]
Length=274

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LP GW +EE TR SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  11   LPKGWKMEEVTRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  53



>ref|XP_008512879.1| PREDICTED: methyl-CpG-binding domain protein 2, partial [Equus 
przewalskii]
Length=283

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  27   LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  69



>ref|XP_005994716.1| PREDICTED: methyl-CpG-binding domain protein 2 isoform X1 [Latimeria 
chalumnae]
 ref|XP_005994717.1| PREDICTED: methyl-CpG-binding domain protein 2 isoform X2 [Latimeria 
chalumnae]
Length=272

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  11   LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  53



>emb|CAG01351.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=261

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LP GW +EE TR SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  11   LPKGWKMEEVTRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  53



>gb|EFB26811.1| hypothetical protein PANDA_002637 [Ailuropoda melanoleuca]
Length=287

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  30   LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  72



>ref|XP_008336893.1| PREDICTED: methyl-CpG-binding domain protein 3-like isoform X2 
[Cynoglossus semilaevis]
Length=274

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LP GW +EE TR SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  11   LPKGWKMEEVTRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  53



>ref|XP_004703164.1| PREDICTED: methyl-CpG-binding domain protein 2, partial [Echinops 
telfairi]
Length=291

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  34   LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  76



>ref|XP_008405369.1| PREDICTED: methyl-CpG-binding domain protein 3-like isoform X4 
[Poecilia reticulata]
Length=274

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LP GW +EE TR SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  11   LPKGWKMEEVTRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  53



>ref|XP_005795658.1| PREDICTED: methyl-CpG-binding domain protein 3-like isoform X1 
[Xiphophorus maculatus]
Length=274

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LP GW +EE TR SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  11   LPKGWKMEEVTRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  53



>ref|XP_007569227.1| PREDICTED: methyl-CpG-binding domain protein 3-like isoform X1 
[Poecilia formosa]
 ref|XP_007569229.1| PREDICTED: methyl-CpG-binding domain protein 3-like isoform X1 
[Poecilia formosa]
Length=274

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LP GW +EE TR SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  11   LPKGWKMEEVTRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  53



>ref|XP_006205872.1| PREDICTED: methyl-CpG-binding domain protein 2, partial [Vicugna 
pacos]
Length=292

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  36   LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  78



>gb|EEE60563.1| hypothetical protein OsJ_13925 [Oryza sativa Japonica Group]
Length=337

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/149 (29%), Positives = 69/149 (46%), Gaps = 21/149 (14%)
 Frame = +1

Query  10   NLESLVKMVAGKSPEPLPAGWSEHVKVKN-GRKVKYYTNAPNGKKFYSKKDVICYMKIKG  186
            NL+S  + V G+ P  LP GW   V   + G   +YY    +G  F +K +V+ Y+    
Sbjct  27   NLQSDDENVDGR-PGWLPDGWIMEVYCDDDGTIYRYYICPLSGTTFTTKSEVLDYL----  81

Query  187  NSRGQNRAIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHGQTY  366
                     ++ +    E    S++    +N  ++ EWLP GW VE   R  G +  + Y
Sbjct  82   --------FSEMDQCFLE----SKNHAVGSNLTRTHEWLPKGWLVE--IRAGGDNMDKMY  127

Query  367  MCYIDPFGR-RFYSKPEVSRHLKTMNCNG  450
              Y+ P  R R +SK +V  ++K M  +G
Sbjct  128  KFYVYPPNRVRLFSKDDVLIYIKEMKISG  156



>ref|XP_009635713.1| PREDICTED: methyl-CpG-binding domain protein 2 [Egretta garzetta]
Length=283

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  12   LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  54



>ref|XP_007933750.1| PREDICTED: methyl-CpG-binding domain protein 2 [Orycteropus afer 
afer]
Length=328

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  72   LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  114



>ref|XP_005008631.1| PREDICTED: LOW QUALITY PROTEIN: methyl-CpG binding domain protein 
2 [Cavia porcellus]
Length=312

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  56   LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  98



>ref|XP_004561977.1| PREDICTED: methyl-CpG-binding domain protein 2-like isoform X1 
[Maylandia zebra]
Length=266

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP++SR+L
Sbjct  12   LPPGWKKEEVIRKSGLSAGKSDVYYYSPSGKKFRSKPQLSRYL  54



>ref|XP_011453190.1| PREDICTED: methyl-CpG-binding domain protein 2-like isoform X2 
[Crassostrea gigas]
Length=236

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G+T + YI P G++  SKP+++R L
Sbjct  11   LPPGWKREEVVRKSGLSAGKTDVYYISPDGKKIRSKPQLARQL  53



>ref|XP_005917072.1| PREDICTED: methyl-CpG-binding domain protein 2-like isoform X1 
[Haplochromis burtoni]
 ref|XP_006782171.1| PREDICTED: methyl-CpG-binding domain protein 2-like [Neolamprologus 
brichardi]
Length=266

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP++SR+L
Sbjct  12   LPPGWKKEEVIRKSGLSAGKSDVYYYSPSGKKFRSKPQLSRYL  54



>ref|XP_006891817.1| PREDICTED: methyl-CpG-binding domain protein 2 [Elephantulus 
edwardii]
Length=330

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  74   LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  116



>ref|XP_004654676.1| PREDICTED: methyl-CpG-binding domain protein 2 [Jaculus jaculus]
Length=324

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  68   LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  110



>ref|XP_005373227.1| PREDICTED: methyl-CpG-binding domain protein 2 [Chinchilla lanigera]
Length=340

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  84   LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  126



>ref|NP_001012403.1| methyl-CpG-binding domain protein 2 [Gallus gallus]
 gb|AAW78400.1| methyl-CpG-binding domain protein 2 [Gallus gallus]
Length=257

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  12   LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  54



>ref|XP_003440292.2| PREDICTED: methyl-CpG-binding domain protein 2-like [Oreochromis 
niloticus]
Length=266

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP++SR+L
Sbjct  12   LPPGWKKEEVIRKSGLSAGKSDVYYYSPSGKKFRSKPQLSRYL  54



>ref|NP_997933.1| methyl-CpG-binding domain protein 2 [Danio rerio]
 gb|AAO91661.1| methyl-CpG binding protein 2 [Danio rerio]
 gb|AAH93117.1| Mbd2 protein [Danio rerio]
 gb|AAI53556.1| Methyl-CpG binding domain protein 2 [Danio rerio]
 gb|AAI64452.1| Mbd2 protein [Danio rerio]
Length=256

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP++SR+L
Sbjct  11   LPPGWKKEEVIRKSGLSAGKSDVYYYSPKGKKFRSKPQLSRYL  53



>ref|XP_004379351.1| PREDICTED: methyl-CpG-binding domain protein 2 [Trichechus manatus 
latirostris]
Length=318

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  62   LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  104



>ref|XP_007080650.1| PREDICTED: methyl-CpG-binding domain protein 2 [Panthera tigris 
altaica]
Length=318

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  62   LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  104



>ref|XP_006837625.1| PREDICTED: methyl-CpG-binding domain protein 2 [Chrysochloris 
asiatica]
Length=377

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  121  LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  163



>ref|XP_008146572.1| PREDICTED: methyl-CpG-binding domain protein 2, partial [Eptesicus 
fuscus]
Length=300

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  44   LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  86



>ref|XP_004294545.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like 
[Fragaria vesca subsp. vesca]
Length=209

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 48/87 (55%), Gaps = 2/87 (2%)
 Frame = +1

Query  178  IKGNSRGQNRAIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHG  357
            I G++  +++ + + ++  +   +  ++    ++P  S +WLP GW VE K R SG + G
Sbjct  35   IDGSTMEESQEVGKAQSNGTADGSAGRAKAKGSDP-MSMDWLPAGWRVEYKVRSSGATAG  93

Query  358  QTYMCYIDPF-GRRFYSKPEVSRHLKT  435
             T   Y DP  GRRF SK EV   L+T
Sbjct  94   STDRYYHDPVSGRRFRSKKEVLHFLET  120



>ref|XP_004623785.1| PREDICTED: methyl-CpG-binding domain protein 2 [Octodon degus]
Length=342

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  86   LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  128



>ref|XP_008950946.1| PREDICTED: methyl-CpG-binding domain protein 2 [Pan paniscus]
Length=372

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  116  LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  158



>ref|XP_004579733.1| PREDICTED: methyl-CpG-binding domain protein 2 [Ochotona princeps]
Length=350

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  94   LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  136



>ref|XP_008322590.1| PREDICTED: methyl-CpG-binding domain protein 2 [Cynoglossus semilaevis]
 ref|XP_008322592.1| PREDICTED: methyl-CpG-binding domain protein 2 [Cynoglossus semilaevis]
Length=267

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP++SR+L
Sbjct  13   LPPGWKKEEVIRKSGLSAGKSDVYYYSPSGKKFRSKPQLSRYL  55



>ref|XP_005356460.1| PREDICTED: methyl-CpG-binding domain protein 2 [Microtus ochrogaster]
Length=348

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  92   LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  134



>ref|XP_010751457.1| PREDICTED: methyl-CpG-binding domain protein 2 isoform X5 [Larimichthys 
crocea]
Length=266

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP++SR+L
Sbjct  12   LPPGWKKEEVIRKSGLSAGKSDVYYYSPSGKKFRSKPQLSRYL  54



>ref|XP_004168988.1| PREDICTED: methyl-CpG-binding domain-containing protein 6-like 
[Cucumis sativus]
Length=206

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 29/49 (59%), Gaps = 1/49 (2%)
 Frame = +1

Query  292  PEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPFG-RRFYSKPEVSRHLKT  435
            P WLPPGW VE++ R SG + G     Y DP   RRF SK EV   L+T
Sbjct  141  PNWLPPGWVVEDRVRSSGATAGTVDKYYFDPVSNRRFRSKIEVLYFLET  189



>ref|XP_006970190.1| PREDICTED: methyl-CpG-binding domain protein 2 [Peromyscus maniculatus 
bairdii]
Length=327

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  71   LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  113



>ref|XP_007519298.1| PREDICTED: LOW QUALITY PROTEIN: methyl-CpG-binding domain protein 
2 [Erinaceus europaeus]
Length=318

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  62   LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  104



>ref|XP_006143513.1| PREDICTED: methyl-CpG-binding domain protein 2 [Tupaia chinensis]
Length=365

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  109  LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  151



>ref|XP_011453189.1| PREDICTED: methyl-CpG-binding domain protein 2-like isoform X1 
[Crassostrea gigas]
 gb|EKC32831.1| Methyl-CpG-binding domain protein 2 [Crassostrea gigas]
Length=248

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G+T + YI P G++  SKP+++R L
Sbjct  11   LPPGWKREEVVRKSGLSAGKTDVYYISPDGKKIRSKPQLARQL  53



>ref|XP_004684067.1| PREDICTED: methyl-CpG-binding domain protein 2 [Condylura cristata]
Length=364

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  108  LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  150



>ref|XP_006920149.1| PREDICTED: methyl-CpG-binding domain protein 2 [Pteropus alecto]
Length=357

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  101  LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  143



>ref|XP_007972158.1| PREDICTED: methyl-CpG-binding domain protein 2 [Chlorocebus sabaeus]
Length=412

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  156  LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  198



>ref|XP_003914441.1| PREDICTED: methyl-CpG-binding domain protein 2 isoform X1 [Papio 
anubis]
 ref|XP_009191022.1| PREDICTED: methyl-CpG-binding domain protein 2 isoform X1 [Papio 
anubis]
Length=412

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  156  LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  198



>ref|XP_001082249.1| PREDICTED: methyl-CpG-binding domain protein 2 [Macaca mulatta]
Length=412

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  156  LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  198



>ref|XP_005074763.1| PREDICTED: methyl-CpG-binding domain protein 2 [Mesocricetus 
auratus]
Length=374

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  118  LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  160



>ref|NP_003918.1| methyl-CpG-binding domain protein 2 isoform 1 [Homo sapiens]
 sp|Q9UBB5.1|MBD2_HUMAN RecName: Full=Methyl-CpG-binding domain protein 2; AltName: Full=Demethylase; 
Short=DMTase; AltName: Full=Methyl-CpG-binding 
protein MBD2 [Homo sapiens]
 gb|AAC68871.1| methyl-CpG binding protein MBD2 [Homo sapiens]
 gb|AAD56597.1| methyl-CpG binding protein 2 [Homo sapiens]
 gb|AAH32638.1| Methyl-CpG binding domain protein 2 [Homo sapiens]
 gb|EAW62997.1| methyl-CpG binding domain protein 2, isoform CRA_a [Homo sapiens]
Length=411

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  155  LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  197



>ref|XP_004059488.1| PREDICTED: methyl-CpG-binding domain protein 2 [Gorilla gorilla 
gorilla]
Length=411

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  155  LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  197



>ref|XP_010585404.1| PREDICTED: methyl-CpG-binding domain protein 2 [Loxodonta africana]
Length=345

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  89   LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  131



>ref|XP_010751454.1| PREDICTED: methyl-CpG-binding domain protein 2 isoform X2 [Larimichthys 
crocea]
Length=300

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP++SR+L
Sbjct  12   LPPGWKKEEVIRKSGLSAGKSDVYYYSPSGKKFRSKPQLSRYL  54



>ref|XP_001362190.1| PREDICTED: methyl-CpG-binding domain protein 2 [Monodelphis domestica]
Length=416

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  160  LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  202



>ref|XP_004405899.1| PREDICTED: LOW QUALITY PROTEIN: methyl-CpG-binding domain protein 
2 [Odobenus rosmarus divergens]
Length=408

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  151  LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  193



>ref|XP_004855231.1| PREDICTED: methyl-CpG-binding domain protein 2 [Heterocephalus 
glaber]
Length=400

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  144  LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  186



>ref|NP_001108497.1| methyl-CpG-binding domain protein 2 [Rattus norvegicus]
 gb|AAI58878.1| Mbd2 protein [Rattus norvegicus]
Length=412

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  156  LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  198



>ref|XP_001499825.2| PREDICTED: methyl-CpG-binding domain protein 2 [Equus caballus]
Length=337

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  81   LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  123



>ref|XP_007471726.1| PREDICTED: methyl-CpG-binding domain protein 2 [Lipotes vexillifer]
Length=354

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  96   LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  138



>ref|XP_005809830.1| PREDICTED: methyl-CpG-binding domain protein 2-like [Xiphophorus 
maculatus]
Length=265

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  11   LPPGWKKEEVIRKSGLSAGKSDVYYYSPTGKKFRSKPQLARYL  53



>ref|XP_008457481.1| PREDICTED: methyl-CpG-binding domain-containing protein 5 [Cucumis 
melo]
Length=280

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 29/49 (59%), Gaps = 1/49 (2%)
 Frame = +1

Query  292  PEWLPPGWTVEEKTRMSGVSHGQTYMCYIDPFG-RRFYSKPEVSRHLKT  435
            P WLPPGW VE++ R SG + G     Y DP   RRF SK EV   L+T
Sbjct  143  PNWLPPGWVVEDRVRSSGATAGTVDKYYFDPVSNRRFRSKIEVLYFLET  191



>ref|NP_034903.2| methyl-CpG-binding domain protein 2 [Mus musculus]
 sp|Q9Z2E1.2|MBD2_MOUSE RecName: Full=Methyl-CpG-binding domain protein 2; AltName: Full=Methyl-CpG-binding 
protein MBD2 [Mus musculus]
Length=414

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  158  LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  200



>gb|AAC68872.1| methyl-CpG binding protein MBD2 [Mus musculus]
 gb|AAD50372.1| methyl-CpG binding protein 2 [Mus musculus]
 gb|AAH46607.2| Methyl-CpG binding domain protein 2 [Mus musculus]
 gb|EDL09566.1| methyl-CpG binding domain protein 2, isoform CRA_b [Mus musculus]
Length=414

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  158  LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  200



>gb|EDM14791.1| rCG46680, isoform CRA_b [Rattus norvegicus]
Length=447

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  191  LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  233



>ref|XP_004459900.1| PREDICTED: methyl-CpG-binding domain protein 2 isoform 1 [Dasypus 
novemcinctus]
 ref|XP_004459901.1| PREDICTED: methyl-CpG-binding domain protein 2 isoform 2 [Dasypus 
novemcinctus]
Length=411

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  155  LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  197



>emb|CAF91173.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=290

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP++SR+L
Sbjct  11   LPPGWKKEEVIRKSGLSAGKSDVYYYSPSGKKFRSKPQLSRYL  53



>ref|XP_008400582.1| PREDICTED: methyl-CpG-binding domain protein 2-like [Poecilia 
reticulata]
Length=265

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  11   LPPGWKKEEVIRKSGLSAGKSDVYYYSPTGKKFRSKPQLARYL  53



>ref|XP_004266158.1| PREDICTED: methyl-CpG-binding domain protein 2 [Orcinus orca]
Length=409

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  153  LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  195



>gb|AAH71531.1| Methyl-CpG binding domain protein 3a [Danio rerio]
Length=273

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL-KTMNCN  447
            LP GW +EE TR SG+S G++ + Y  P G++F SKP++ R+L K+M+ +
Sbjct  11   LPNGWKMEEVTRKSGLSAGKSDVYYFSPTGKKFRSKPQLVRYLGKSMDLS  60



>ref|XP_005674618.1| PREDICTED: LOW QUALITY PROTEIN: methyl-CpG binding domain protein 
2, partial [Sus scrofa]
Length=219

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  76   LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  118



>ref|XP_003965116.1| PREDICTED: methyl-CpG-binding domain protein 2-like [Takifugu 
rubripes]
Length=265

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP++SR+L
Sbjct  11   LPPGWKKEEVIRKSGLSAGKSDVYYYSPSGKKFRSKPQLSRYL  53



>ref|NP_997934.1| methyl-CpG-binding domain protein 3 [Danio rerio]
 gb|AAQ97812.1| methyl-CpG binding domain protein 3 [Danio rerio]
Length=273

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL-KTMNCN  447
            LP GW +EE TR SG+S G++ + Y  P G++F SKP++ R+L K+M+ +
Sbjct  11   LPNGWKMEEVTRKSGLSAGKSDVYYFSPTGKKFRSKPQLVRYLGKSMDLS  60



>ref|XP_007575083.1| PREDICTED: methyl-CpG-binding domain protein 2 [Poecilia formosa]
Length=265

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  11   LPPGWKKEEVIRKSGLSAGKSDVYYYSPTGKKFRSKPQLARYL  53



>ref|XP_010751455.1| PREDICTED: methyl-CpG-binding domain protein 2 isoform X3 [Larimichthys 
crocea]
Length=290

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP++SR+L
Sbjct  12   LPPGWKKEEVIRKSGLSAGKSDVYYYSPSGKKFRSKPQLSRYL  54



>ref|XP_007192116.1| PREDICTED: methyl-CpG-binding domain protein 2 [Balaenoptera 
acutorostrata scammoni]
Length=389

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  133  LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  175



>ref|XP_004084660.1| PREDICTED: methyl-CpG-binding domain protein 2-like [Oryzias 
latipes]
Length=261

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  12   LPPGWKKEEVIRKSGLSAGKSDVYYYSPTGKKFRSKPQLARYL  54



>ref|XP_009432315.1| PREDICTED: methyl-CpG-binding domain protein 2 isoform X2 [Pan 
troglodytes]
Length=411

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  155  LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL  197



>ref|XP_008301772.1| PREDICTED: methyl-CpG-binding domain protein 2-like [Stegastes 
partitus]
Length=265

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP+++R+L
Sbjct  11   LPPGWKKEEVIRKSGLSAGKSDVYYYSPSGKKFRSKPQLARYL  53



>ref|XP_010751451.1| PREDICTED: methyl-CpG-binding domain protein 2 isoform X1 [Larimichthys 
crocea]
Length=306

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP++SR+L
Sbjct  12   LPPGWKKEEVIRKSGLSAGKSDVYYYSPSGKKFRSKPQLSRYL  54



>ref|XP_004561978.1| PREDICTED: methyl-CpG-binding domain protein 2-like isoform X2 
[Maylandia zebra]
 ref|XP_005748235.1| PREDICTED: methyl-CpG-binding domain protein 2-like [Pundamilia 
nyererei]
 ref|XP_005917073.1| PREDICTED: methyl-CpG-binding domain protein 2-like isoform X2 
[Haplochromis burtoni]
Length=261

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  301  LPPGWTVEEKTRMSGVSHGQTYMCYIDPFGRRFYSKPEVSRHL  429
            LPPGW  EE  R SG+S G++ + Y  P G++F SKP++SR+L
Sbjct  12   LPPGWKKEEVIRKSGLSAGKSDVYYYSPSGKKFRSKPQLSRYL  54



Lambda      K        H        a         alpha
   0.310    0.128    0.378    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 933768211125